5LJKA

Crystal structure of human apo crbp1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
b'PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 1
publication title Structural and molecular determinants affecting the interaction of retinol with human CRBP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Retinol-binding protein
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5ljkA00
3RSWA 3ZQ3A 1LKEA 4TKJA 5HZQA 4ORRA 3VG2A 3UEUA 3ZUIA 1BJ7A 4MVKA 2GJ5A 4BVMA 1A2DA 4TLJA 3NX2A 3WVMA 3ZUOA 4M7MA 3TGCA 2E4JA 1E00A 4NLJA 5LJKA 1ACDA 2WQ9A 3HWFA 1AB0A 2AT5X 1GKAB 3CBCA 1FELA 5D4AA 1OEEA 3C76X 3UEVA 2RA6A 1KT7A 3APWA 3BX7A 1FE3A 3KFFA 1SY2A 4HPBA 4XMCA 1BRPA 1DF3A 2ACOA 1OEKA 3D95A 3FLLA 3B2IA 1QG5A 5LJGA 2WSJA 3AKMA 1YP7A 1PBOA 1ML7A 2RQ0A 3BLGA 4DQ3A 2G78A 2ACPX 2CZUA 3DSZA 1GT3A 5HCEC 4I9RA 1PEEA 1S44A 1SXYA 3NQ3A 1IIUA 1EUOA 1LICA 4ZHCA 2HMBA 3AKNA 1ERBA 2JU3A 1JZUA 5H9LA 4ALBA 4A8ZA 2MO5A 1KQWA 4QGXA 2NNDA 1CRBA 1LIBA 4RUUA 3STMX 3Q6LA 1U0XA 3NADA 4I3CA 2XKLA 4YGGA 5FENA 1GM6A 4XMGA 5F7GA 5HTEA 1UZ2X 2AL0X 1MX7A 4CK4A 3P6HA 5DPQA 3MVFA 1A18A 1T8VA 1HN2A 3FA6A 1YUPA 4IBAA 4O9SA 1SA8A 3RZYA 1RBPA 1N0SA 2L5PA 2LFOA 2JN3A 3PP6A 1X8UA 2QO6A 1JYDA 1FEMA 2CBSA 3G7XA 1A3YA 3FA7A 2AT8X 4ZJ0A 4Y0SA 4YDBA 1YWCA 2LBAA 2A2UA 2G79A 2PY1A 5KHPA 3APVA 3PEDA 4GNYA 4M6SA 5F6ZA 3EBWA 1X71A 3VG3A 3JS1A 1I05A 3GAQA 1AQBA 1HBQA 3P6EA 4Y0QA 4BOEA 1IKJA 4YFQA 5D45A 1GXAA 1ICMA 3PECA 4YKMA 1LFOA 3QKGA 4GETA 5FFHA 3OJYC 2DM5A 2AH7X 1BSOA 2KT4B 1CBRA 1GX8A 1BRQA 2AT3X 3BS2A 1FENA 1SXUA 3B2JA 4D6AA 1ZNHA 2JOZA 4EXZA 4ZHHA 5KIDA 4GNWA 1QY0A 2OZQA 3PH5A 4OMWA 1LIDA 1TOUA 3CMPA 1DZMA 2OFRX 1TXLA 3WJCA 5LJBA 1YWDA 3EMMA 1LPJA 4YDAA 5LJDA 2X45A 1CJ5A 1GT5A 3O22A 1MUPA 4TKHA 5CE4A 4IMNA 2N93A 3FMZA 4NLIA 4YFPA 1IKEA 1BEBA 2WEXA 4ES7A 5HZ8A 1O8VA 3VG6A 4YBPA 2LKKA 4OS0A 4QYNA 2F73A 4HFOA 1OBPA 5HWZA 3K3LA 3I0AA 4GE1A 1A57A 3BRNA 3FR2A 3NX1A 1RLBE 4ZHFA 1ALBA 2CM9A 4NP1A 1L6MA 1KT3A 2CBRA 4IB8A 1B56A 2FTBA 3EM0A 3PPTA 4ORUA 2QM9A 3I17A 1PM1X 2IFBA 4QGWA 1AELA 1D3SA 3CQNA 4DQ4A 3NPOA 3ELXA 1DV9A 3F8AA 1EIOA 1DC9A 1E5PA 3P6CA 3U03A 4GH7A 1T68X 5HBSA 1X8PA 2R73A 5D8JA 2NNEA 4AZQA 4QGVA 2FS6A 3CBSA 4YFRA 4ZGUA 1SXXA 3S26A 1X89A 1AVGI 2HLVA 3IA8A 1KQXA 2AT6X 1YP6A 1LNMA 2NP1A 5EDCA 1TW4A 4QZUA 5H9NA 1JYJA 4A1YA 1X8NA 2K23A 3BX8A 1HMSA 2WEWA 3C78X 1KT6A 4ZFXA 5FAZA 3FR5A 4ORWA 4I3BA 2W2AA 1ZNGA 2AKQA 2MM3A 1KT5A 1NGLA 4IB7A 2NNQA 4IAWA 1U18A 2OFMX 1VYFA 4QAEA 5EPQA 4A1HA 2K62A 3MBTA 4XMEA 1IW2A 4WFUA 2WWPA 1S7DA 2POAA 3NR3A 2A2GA 3HK1A 4ORYA 5EDBA 1G74A 1KZXA 1X8OA 4IB6A 1OEJA 5L8NA 4HPAA 1BLRA 2FT9A 2GTFX 1DZKA 1UREA 3DTQA 5H8TA 2FWVA 3STKA 2RD7C 4YCHA 4IB9A 4IMOA 2FS7A 1BM5A 2W2BA 3BY0A 5EEDA 1TOWA 3BDRA 3BSZE 4AZMA 4PSQA 2MJIA 1SY0A 4NYRA 5HZ6A 4ALOA 1B4MA 5D47A 4YGZA 2OVDA 4YH0A 4GRJA 4KIIA 2AMMX 1OPBA 1GX9A 2OVAA 2JU7A 4ODDA 2FR2A 2Q2MA 2ASNX 4GKCA 3SAOA 4LZVA 4UU3A 3TGBA 1X8QA 3L4RA 5HZ9A 3CR6A 3JSQA 2GC9A 1NP1A 4I9SA 5HZ5A 4D6BA 5K06A 5IO5A 5LKEA 2P8GA 1DZPA 1VPRA 1G7NA 1ZNEA 1YWAA 1OPAA 4ZHDA 5B27A 4MVLA 1ZRYA 3O2YA 3KFHA 1JBHA 4YGHA 1EXSA 3APUA 2OVEA 2LBVA 1OBUA 2XSTA 3UEXA 4N7DA 3KZAA 1LF7A 3APXA 5JR8A 1GKAA 4YKOA 1IFBA 1QFTA 2Q2PA 1P6PA 2QO4A 2FRSA 3KFIA 4IAXA 4MVIA 1BSYA 4OS3A 2LB6A 4ORXA 3TGAA 1VYGA 5BVSA 3WXQA 2HZRA 1CBSA 4XMHA 4YBUA 1QABE 3FELA 2L9CA 3EYCA 3BU1A 1G85A 1QFVA 3FR4A 4Y0RA 3P6GA 5HTDA 2CZTA 3CWKA 1JJJA 3F9DA 1EQDA 3FIQA 5F6BA 4HPCA 2JU8A 4EDEA 1KGLA 4Y0PA 1XCAA 3VG4A 4ZH6A 1T0VA 3B2LA 5LJEA 1ZNLA 3STNA 1FDQA 1D2UA 1XKIA 4ZH9A 4YCEA 1LIEA 2Q4NA 1BBPA 4ARHA 4NNTA 1KZWA 4TNNA 2BLGA 3IFBA 1EPBA 2R56A 3B2KA 1HQPA 1ADLA 1MX8A 4XMFA 3WJDA 1G5WA 2W2FA 1LIFA 4ZCBA 1H91A 3NQ9A 5HCDC 3WJFA 1B0OA 3HWGA 1I04A 2FR3A 1HBPA 1QY2A 5H9KA 4ORSA 5EZ2A 4RUNA 5LKFA 4HPDA 2A3FX 1KXOA 3VG7A 4AZRA 4LKPA 1QQSA 4ZHGA 1FTPA 4YMYA 4AZOA 4NYQA 1GGLA 3C77X 1R0UA 1ZNDA 2L67A 3P6DA 5LJHA 5F1EA 5LJCA 4I3DA 4LKTA 1QWDA 4AYHA 4WBKA 1I4UA 1SXWA 2HYSA 4A60A 1EW3A 2G7BA 3FEKA 1EIIA 1DFVA 1DZJA 4TJZA 1HMRA 1OBQA 4BQUA 1Z24A 4AZPA 5HAEA 3KFGA 5HA1A 3UEWA 3NP1A 3T1DA 5DG4A 2CM4A 3FW4A 1IFCA 2ALLX 1NP4A 3BU9A 3FA9A 3TF6A 1QY1A 3O19A 1S2PA 5C0NA 5L8OA 1BWYA 2WQAE 2L68A 3FA8A 3KQ0A 1B8EA 3ELZA 2Q39A 1GT1A 4EFGA 4WFVA 2QOSC 1O1UA 4UU2A 3WJEA 4QYPA 1CBIA 3D97A 1ERXA 1JV4A 3PH6A 3FEPA 3CQRA 2A0AA 1O1VA 1JJXA 3TZSA 2R74A 4AW8A 4AZNA 1EALA 2O62A 2WUTA 1CBQA 2HNXA 5EEEA 5BVQA 4R0BA 3VG5A 3U0DA 3HWDA 4OMXA 4N7CA 1PMPA 2KTDA 1E06A 3WJBA 3FENA 2AT0X 3D96A 5H9AA 2RCQA 1SY1A 1E02A 4QZTA 5BVTA 1EPAA 1KOIA 1MDCA 5IO7A 3EBKA 1SY3A 1ICNA 5D48A 4EEJA 2RCTA 2WR6A 1ZNKA 2QO5A 3U9PC 1KT4A 2YG2A 1BSQA 3WJGA 1GT4A 3P6FA 4K19A 1TVQA 4ZR2A 4TQ2A 1YIVA 4LZUA 2A13A 2Q9SA 4TKBA 1MVGA 5HCCC 2HZQA 4XMDA 1U17A 2X46A 5KICA 2EU7X 4OS8A 1I06A 5AQ6A 5IO6A 4NNSA 5F58A 5HA0A 1HMTA 3B2HA 3WBGA 5B29A 3HWEA 2FLJA 5L8IA 3FW5A 2ANSA 1YWBA
chains in the Genus database with same CATH superfamily
4BX6B 3RSWA 3ZQ3A 1LKEA 1SWSA 4Z6JA 4TKJA 5HZQA 2PI3O 1SWLA 4O3WA 4ORRA 3VG2A 3UEUA 3ZUIA 5HZ8A 1BJ7A 1SWQA 2BS6A 4MVKA 2GJ5A 4BVMA 1A2DA 4TLJA 3NX2A 3WVMA 3ZUOA 4GDZA 1AVEA 2RTAA 4M7MA 3TGCA 1MM9A 1E00A 2E4JA 3PQUA 4NLJA 4Z2VA 1WUBA 1ACDA 5LJKA 2WQ9A 3HWFA 1AB0A 2AT5X 1GKAB 2FGSA 3Q34A 4FQBB 3CBCA 1FELA 5D4AA 1OEEA 3C76X 3UEVA 2RA6A 4DCBA 1KT7A 3APWA 3BX7A 1FE3A 3KFFA 4U46A 3S5XA 2CAMA 1HXZA 1SWKA 2RTFB 5CHKA 1SY2A 4HPBA 4XMCA 1BRPA 1DF3A 2ACOA 1OEKA 2RTQB 2X8FA 2MF6A 3B2IA 1QG5A 3D95A 3FLLA 2VFCA 5LJGA 2WSJA 3AKMA 1YP7A 1PBOA 1RAVA 1ML7A 3P24A 2RQ0A 3T2WA 3BLGA 3LTWA 5FQ7E 4DQ3A 1NQMA 2G78A 2ACPX 2CZUA 3DSZA 1GT3A 2OVSA 1I9HA 4I9RA 5HCEC 1PEEA 1S44A 1SXYA 1VWPB 1SWCA 3NQ3A 1IIUA 1EUOA 1LICA 2X56A 4ZHCA 2HMBA 4FBRA 3AKNA 1ERBA 2Z4IA 3UAQA 4KCAA 4C5PA 2JU3A 1JZUA 4BX7B 2BC3A 2RTPB 4BX5A 2OY1O 5H9LA 3VPJE 4ALBA 4A8ZA 3ZW0A 2MO5A 1KQWA 3OE3A 2NNDA 4QGXA 1CRBA 1LIBA 4RUUA 3STMX 3Q6LA 1U0XA 1N4JA 2QMIA 3NADA 4I3CA 2XKLA 3T6LA 4YGGA 4GUZA 5FENA 1GM6A 2X34A 4XMGA 5F7GA 2LA7A 5HTEA 1UZ2X 2AL0X 1MX7A 4CK4A 3P6HA 2RTMA 5DPQA 4CDCA 3MVFA 1A18A 1T8VA 1HN2A 3FA6A 1YUPA 2RTOB 3HOLA 4IBAA 1SA8A 4O9SA 3RZYA 1RBPA 5FQ8E 1N0SA 2L5PA 2LFOA 2JN3A 1VWBB 3PP6A 4Y5DA 5B10O 1SWBA 1LCWA 1X8UA 1FJ1E 2QO6A 2RTKA 1JYDA 1FEMA 2CBSA 1VWOB 3G7XA 1JIWI 1A3YA 1SWFA 2AT8X 3FA7A 4ZJ0A 2BT9A 1K3BA 4Y0SA 4YDBA 1YWCA 1KGLA 2LBAA 2A2UA 2F09A 1SRHA 2G79A 1SRIA 2PY1A 5KHPA 3APVA 3PEDA 4GNYA 4M6SA 1VWDB 5F6ZA 3EBWA 1N7YA 3SLJA 1X71A 2KTSA 3VG3A 3JS1A 4GJVA 1I05A 3GAQA 1SWNA 1AQBA 1HBQA 2ZAIA 3MX7A 3P6EA 4Y0QA 5B5FA 4BOEA 1IKJA 4YFQA 1SLFB 5D45A 1GXAA 1ICMA 3PECA 1Y52X 4YKMA 1LFOA 3QKGA 4GETA 5FFHA 1K24A 3OJYC 2DM5A 2AH7X 1BSOA 1AVDA 2KT4B 2C1SA 2KW1A 2WPUA 1CBRA 1GX8A 1BRQA 3KVNA 2AT3X 3BS2A 1FENA 1SXUA 3B2JA 4D6AA 1ZNHA 2JOZA 4EXZA 4ZHHA 5KIDA 4GNWA 1QY0A 2OZQA 4ID2A 3PH5A 2DJGA 4OMWA 2MWHA 1LIDA 1TOUA 2RTCB 1DZMA 2OFRX 3CMPA 1TXLA 1N9MA 4GGZA 4CDFA 1IJ8A 3WJCA 2RTEB 4O49A 5LJBA 1YWDA 3EMMA 4GGTA 1LPJA 4YDAA 1VWQB 2BS5A 5LJDA 2X45A 1CJ5A 1GT5A 3O22A 5B2AO 2OY5O 1MUPA 4TKHA 5CE4A 3F6ZB 4NW4A 2Z4HA 5CSEA 4IMNA 2AF5A 2N93A 3FMZA 4NLIA 2FKGA 1IKEA 1BEBA 2WEXA 3CKGA 4IABA 1O8VA 4YFPA 3S60A 3VG6A 1LCVA 2LKKA 4YBPA 4OS0A 3T6FA 4QYNA 2F73A 4HFOA 1OBPA 5HWZA 4O4UA 3K3LA 3I0AA 4GE1A 1A57A 3BRNA 3FR2A 3NX1A 3RE5A 1RLBE 4CPHB 4ZHFA 3RDUA 3MM0A 1N9YA 1ALBA 1RXKA 2IZJA 1RSUB 3SZHA 2CM9A 3ZW1B 4NP1A 1L6MA 2FKJA 2X32A 1KT3A 4WHIA 2CBRA 4IB8A 5AEOA 1B56A 2FTBA 3EM0A 3PPTA 4ORUA 2QM9A 3I17A 1PM1X 4CPIA 2IFBA 2IZFB 3QQ2A 4QGWA 4EKVA 4KH8A 1AELA 1D3SA 3CQNA 2OYBO 4JGLA 1STRB 1OSPO 4DQ4A 3NPOA 2OL6O 2I5ZO 3ELXA 3F8AA 4OEMA 1DV9A 1Y0GA 4OKAA 1EIOA 1DC9A 1DF8A 1E5PA 1LCZA 3P6CA 3U03A 4GH7A 1T68X 1VWCB 1Y9LA 3RBYA 2G5LA 5HBSA 1X8PA 2R73A 1NDJA 2NNEA 4GDAA 2IZBA 2FS6A 3CBSA 5D8JA 4AZQA 4BBOA 1SXXA 4QGVA 3S26A 4YFRA 1SWGA 1AVGI 1X89A 2HLVA 2ZAGA 5F2BA 3PDFA 3IA8A 1KQXA 2AT6X 1YP6A 1LNMA 1HQQA 1MEPA 4U8UN 2NP1A 1SWEA 4O4SA 2IZAA 1TW4A 4QZUA 5EDCA 5H9NA 4ES7A 1JYJA 1SWUA 4A1YA 1X8NA 2K23A 2Y3FA 3BX8A 4KC8A 5IRUA 1HMSA 2WEWA 3C78X 1KT6A 4ZFXA 1MOYA 3NQKA 5FAZA 4GD9A 2RTLA 2F01A 2Y32A 3FR5A 4GJSA 4ORWA 1LDQA 1W6FA 1SMPI 2W2AA 1ZNGA 4I3BA 5CYBA 3WZPA 2AKQA 4BCSA 2MM3A 1KT5A 1NGLA 4IB7A 2NNQA 4IAWA 1U18A 2RTBB 4FBOA 5FQ6E 2OFMX 4ZGUA 3RDMA 2GTLM 4MEEA 1VYFA 4QAEA 1E2TA 5EPQA 4A1HA 2K62A 3MBTA 2GTLN 4XMEA 1IW2A 4MVEA 4WFUA 3GE2A 2RTDB 2WWPA 3NBXX 1S7DA 2POAA 3NR3A 2A2GA 3HK1A 4ORYA 5EDBA 1G74A 1KZXA 1X8OA 4IB6A 3JQOA 1OEJA 5L8NA 4HPAA 1BLRA 2FT9A 1SRFA 2OFBA 2GTFX 1DZKA 1UREA 4EQAC 3DTQA 5H8TA 2FWVA 1SWJA 3RWXA 3STKA 4BJ8A 2RD7C 4YCHA 3OBLA 4IB9A 2FHNX 4IMOA 2FS7A 1BM5A 2M4LA 1LUQA 2W2BA 3BY0A 5EEDA 1TOWA 1SLDB 3WYQA 3BDRA 3BSZE 4AZMA 4ON1A 4PSQA 2MJIA 1SY0A 4NYRA 3EC5A 4ALOA 5HZ6A 5IRWA 1SWDA 1B4MA 2ZSCA 1VWHB 4GK9A 5D47A 3WZQA 5IXGA 1SWRA 4YGZA 1VWEB 2IZHB 3VHHA 2OVDA 4YH0A 2X55A 4GRJA 4KIIA 2AMMX 4GU8A 4FGIB 1OPBA 1GX9A 3MG5A 1Y9TA 2OVAA 2JU7A 2X8SA 1SWOA 4ODDA 2FR2A 2Q2MA 1VWKB 2A5CA 3WYPA 2ASNX 4GKCA 3SAOA 4LZVA 4UU3A 3TGBA 1X8QA 3L4RA 5HZ9A 3CR6A 3HTYA 3JSQA 3CKFA 4BX5B 2RTNB 2GC9A 1NP1A 4I9SA 3SOTA 4BX6A 4D6BA 5HZ5A 5IO5A 3ZW0B 5K06A 5LKEA 2BHVA 3FDCA 2P8GA 2KD2A 1DZPA 2RTIB 1VWIB 1VPRA 1G7NA 1ZNEA 1YWAA 1OPAA 3AUMO 3ZWEA 5B27A 4MVLA 4ZHDA 1ZRYA 3O2YA 3KFHA 1JBHA 2MHDA 4YGHA 1EXSA 1JMXA 3APUA 2OVEA 2LBVA 1OBUA 2XSTA 3UEXA 4N7DA 3KZAA 1LF7A 1MK5A 2A8GA 3APXA 1PTSA 5JR8A 1GKAA 4YKOA 1IFBA 1QFTA 2RTHB 2Q2PA 4CV7A 1KFFA 1P6PA 1VWLB 1EI5A 2QO4A 4LQZA 4IRWA 3RY1A 2FRSA 3LV4A 3HOEA 3KFIA 2DJFA 4HWMA 4IAXA 4MVIA 1BSYA 4OS3A 2LB6A 4L1NA 4ORXA 3TGAA 1VYGA 2JGSA 4GGRA 5BVSA 3AEHA 3WXQA 2OL8O 2HZRA 1CBSA 2Y3EA 4XMHA 1QABE 4YBUA 4PJ2A 3FELA 2IZKA 2L9CA 3EYCA 4OELA 3BU1A 1G85A 1QFVA 1JMZA 3FR4A 4Y0RA 3D9WA 3P6GA 5HTDA 2CZTA 3CWKA 1VWGB 5AJBA 3F9DA 1EQDA 3FIQA 5F6BA 1JJJA 1UYOX 4HPCA 1STSB 2JU8A 1GX3A 4EDEA 4JNJA 2RTGB 4Y0PA 2OY7A 1XCAA 2RTRB 2UZ2A 3VG4A 4ZH6A 1Y53X 1T0VA 2OFAA 1VYOA 3B2LA 5B11O 5LJEA 4BX7A 1ZNLA 3STNA 1FDQA 3RE6A 1SWPA 2UYWA 3SZIA 1XKIA 1D2UA 2JW1A 4ZH9A 3SLOA 4YCEA 1Y55X 1LIEA 2Q4NA 1BBPA 4ARHA 4NNTA 4FBVA 1KZWA 4TNNA 2BLGA 1VWFB 4GZVA 3RY2A 3IFBA 1EPBA 2R56A 3WOVA 3WZNA 3B2KA 1HQPA 1ADLA 1SWAA 3FYFA 2FHLA 1MX8A 4KT5A 4XMFA 3WJDA 4U9CA 1SLEB 2W2FA 1LIFA 1G5WA 4ZCBA 3VE2A 4U8UM 4JHQA 1H91A 2BSZA 2I5VO 3NQ9A 5HCDC 4CDEA 3E3CA 3FIDA 3WJFA 5K67A 1B0OA 3HWGA 1LDOA 1I04A 2IZIA 2FR3A 4U8UO 1VWRB 1HBPA 1QY2A 4DNEA 5H9KA 2HKDA 4ORSA 5EZ2A 1I78A 1NQNA 4RUNA 4HPDA 5LKFA 3PK2A 1UYNX 2A3FX 4NV8A 1KXOA 3VG7A 4AZRA 4LKPA 3ZI8A 1QQSA 4ZHGA 1FTPA 4YMYA 4AZOA 2VDFA 4NYQA 2C1QA 1GGLA 3C77X 1R0UA 1ZNDA 2L67A 3P6DA 4COTA 5LJHA 5F1EA 3VGWA 4YVBA 4I3DA 4LKTA 1W5RA 2GH7A 4ML7B 5LJCA 1QWDA 1KL4A 5K68A 1VWMB 1I4UA 4WBKA 4AYHA 1SXWA 4I60A 2HYSA 4A60A 1EW3A 4CSBA 2G7BA 3FEKA 1EIIA 4O4XA 4CDDA 1DFVA 1DZJA 2GTLO 4TJZA 4ZGFA 1HMRA 1OBQA 4BQUA 1JQPA 1Z24A 3ZZVA 4AZPA 5HAEA 2YMSA 3KFGA 4I6SA 1SRGA 5HA1A 5BYPA 2IZGB 3UEWA 3NP1A 3T1DA 4Z28A 5DG4A 2CM4A 3FW4A 2IZDB 1IFCA 2ALLX 1NP4A 3BU9A 3FA9A 3TF6A 1QY1A 3O19A 1S2PA 1SWHA 5C0NA 5L8OA 3VHMA 1BWYA 3D4RA 2G8CO 2WQAE 3EW2A 3V8UA 2L68A 3FA8A 4Z27A 3KQ0A 2VFBA 1B8EA 3ELZA 4INNA 4CPEA 2Q39A 2X4MA 4QRLA 3SLTA 1GT1A 2JMBA 4EFGA 2A5BA 2QOSC 4WFVA 4Z2OA 1O1UA 2QCBA 4O3XB 4UU2A 3WJEA 3S5VA 4QYPA 1CBIA 3VU1A 3D97A 1ERXA 1JV4A 3PH6A 2IZEB 3FEPA 1HXLA 3CQRA 4QQ1A 1NBXA 2A0AA 3RDXA 4Z2PA 1O1VA 1SLGB 1JJXA 3TZSA 1STPA 5IRAA 2R74A 4AW8A 4AZNA 1LELA 1EALA 2O62A 2WUTA 3ZW2A 1CBQA 3RKGA 2HNXA 1KL3A 5EEEA 5BVQA 4R0BA 3VG5A 5B5GA 5JD2A 3SZJA 4BGFA 2AVIA 3U0DA 4CPHA 1SREA 3HWDA 4OMXA 1RXHA 4MISA 4N7CA 3H3IA 4JO6A 3T2XA 1PMPA 2KTDA 3N91A 1E06A 3ZW1A 1HY2A 2X8TA 4I95A 3WJBA 3FENA 3RDOA 2AT0X 5B3MO 3D96A 5H9AA 2RCQA 1SY1A 1E02A 1VWNB 4QZTA 5BVTA 1WBIA 4O3ZA 1NC9A 1EPAA 2C4IA 2RN4A 1KOIA 4O3YA 1RSTB 3VHIA 4CPFA 1MDCA 5IO7A 3EBKA 3LHNA 1SY3A 1ICNA 5D48A 2OF8A 1PBYA 2RCTA 1ZNKA 2WR6A 3OD9A 4EEJA 2QO5A 1JJUA 2OL7A 3U9PC 1KT4A 2YG2A 3X00A 1BSQA 3WJGA 1GT4A 3P6FA 4K19A 5L3YA 4KC7A 1TVQA 1SRJA 1VWAB 4ZR2A 4TQ2A 1YIVA 1N43A 4LZUA 1RXJA 1SWTA 2A13A 1MVGA 2Q9SA 3EW1A 4TKBA 2OF9A 5HCCC 2HZQA 4MIRA 4XMDA 5AJCA 4U3QA 1U17A 2X46A 3PQSA 5KICA 2EU7X 2IZCB 1KL5A 2OY8A 1I06A 2QOMA 4NV7A 4OS8A 5AQ6A 3RDSA 3VE1A 3P02A 4B55A 3WZOA 4QNIA 4NNSA 4Y59A 2IZLB 5F58A 5HA0A 1HMTA 3B2HA 5IO6A 1VWJB 3HPEA 3WBGA 4L3RA 3HWEA 2FLJA 5B29A 3RDQA 4O4OA 5L8IA 3FW5A 2ANSA 2RTJA 1YWBA 1W4TA
chains in the Genus database with same CATH topology
3RSWA 3ZQ3A 1LKEA 4TKJA 5HZQA 4ORRA 4O3WA 3VG2A 3UEUA 3ZUIA 1BJ7A 4MVKA 2BS6A 2GJ5A 4BVMA 1A2DA 4TLJA 3NX2A 3WVMA 3ZUOA 4GDZA 4M7MA 3TGCA 2E4JA 1E00A 4NLJA 3PQUA 5LJKA 1ACDA 2WQ9A 3HWFA 1AB0A 2AT5X 1GKAB 4FQBB 3CBCA 1FELA 5D4AA 1OEEA 3C76X 3UEVA 2RA6A 1KT7A 3APWA 3BX7A 1FE3A 3KFFA 3S5XA 1SY2A 4HPBA 4XMCA 1BRPA 1DF3A 2ACOA 1OEKA 2X8FA 3D95A 3FLLA 3B2IA 1QG5A 5LJGA 2WSJA 3AKMA 1YP7A 1PBOA 3P24A 1ML7A 2RQ0A 3BLGA 4DQ3A 5FQ7E 2G78A 2ACPX 2CZUA 3DSZA 1GT3A 2OVSA 5HCEC 4I9RA 1PEEA 1S44A 1SXYA 3NQ3A 1IIUA 1EUOA 1LICA 4ZHCA 2HMBA 4FBRA 3AKNA 1ERBA 2Z4IA 3UAQA 4KCAA 2JU3A 1JZUA 5H9LA 3VPJE 4ALBA 4A8ZA 3ZW0A 2MO5A 1KQWA 3OE3A 2NNDA 4QGXA 1CRBA 1LIBA 4RUUA 3STMX 3Q6LA 1U0XA 2QMIA 3NADA 4I3CA 2XKLA 4YGGA 5FENA 1GM6A 4XMGA 5F7GA 2LA7A 5HTEA 1UZ2X 2AL0X 1MX7A 4CK4A 3P6HA 5DPQA 3MVFA 1A18A 1T8VA 1HN2A 3FA6A 1YUPA 3HOLA 4IBAA 4O9SA 1SA8A 3RZYA 1RBPA 5FQ8E 1N0SA 2L5PA 2LFOA 2JN3A 3PP6A 1X8UA 2QO6A 1JYDA 1FEMA 2CBSA 3G7XA 1JIWI 1A3YA 3FA7A 2AT8X 4ZJ0A 2BT9A 4Y0SA 4YDBA 1YWCA 2LBAA 2A2UA 2F09A 2G79A 2PY1A 5KHPA 3APVA 3PEDA 4GNYA 4M6SA 5F6ZA 3EBWA 1X71A 2KTSA 3VG3A 3JS1A 1I05A 3GAQA 2ZAIA 1AQBA 1HBQA 3MX7A 3P6EA 4Y0QA 4BOEA 1IKJA 4YFQA 5D45A 1GXAA 1ICMA 3PECA 4YKMA 1LFOA 3QKGA 4GETA 5FFHA 3OJYC 2DM5A 2AH7X 1BSOA 2KT4B 2KW1A 1CBRA 1GX8A 1BRQA 2AT3X 3BS2A 1FENA 1SXUA 3B2JA 4D6AA 1ZNHA 2JOZA 4EXZA 4ZHHA 5KIDA 4GNWA 1QY0A 2OZQA 4ID2A 3PH5A 4OMWA 2MWHA 1LIDA 1TOUA 3CMPA 1DZMA 2OFRX 1TXLA 3WJCA 4O49A 5LJBA 1YWDA 3EMMA 1LPJA 4YDAA 2BS5A 5LJDA 2X45A 1CJ5A 1GT5A 3O22A 1MUPA 4TKHA 5CE4A 3F6ZB 4NW4A 2Z4HA 4IMNA 2N93A 3FMZA 4NLIA 4YFPA 1IKEA 1BEBA 2WEXA 4IABA 3S60A 1O8VA 3VG6A 4ES7A 4YBPA 5HZ8A 2LKKA 4OS0A 4QYNA 2F73A 4HFOA 1OBPA 5HWZA 4O4UA 3K3LA 3I0AA 4GE1A 1A57A 3BRNA 3FR2A 3NX1A 1RLBE 4ZHFA 1ALBA 2CM9A 3ZW1B 4NP1A 1L6MA 1KT3A 4WHIA 2CBRA 4IB8A 5AEOA 1B56A 2FTBA 3EM0A 3PPTA 4ORUA 2QM9A 3I17A 1PM1X 2IFBA 4QGWA 4KH8A 1AELA 1D3SA 3CQNA 4JGLA 4DQ4A 3NPOA 3ELXA 1DV9A 3F8AA 1EIOA 1DC9A 1E5PA 3P6CA 3U03A 4GH7A 1T68X 1Y9LA 3RBYA 5HBSA 1X8PA 2R73A 5D8JA 2NNEA 4AZQA 4QGVA 2FS6A 3CBSA 4YFRA 4ZGUA 1SXXA 3S26A 1X89A 1AVGI 2HLVA 2ZAGA 3IA8A 1KQXA 2AT6X 1YP6A 1LNMA 4U8UN 2NP1A 4O4SA 5EDCA 1TW4A 4QZUA 5H9NA 1JYJA 4A1YA 1X8NA 2K23A 3BX8A 4KC8A 1HMSA 2WEWA 3C78X 1KT6A 4ZFXA 3NQKA 5FAZA 3FR5A 4ORWA 1SMPI 2W2AA 1ZNGA 4I3BA 5CYBA 2AKQA 2MM3A 1KT5A 1NGLA 4IB7A 2NNQA 4IAWA 1U18A 4FBOA 5FQ6E 2OFMX 2GTLM 1VYFA 4QAEA 5EPQA 4A1HA 2K62A 3MBTA 2GTLN 4XMEA 1IW2A 4MVEA 4WFUA 3GE2A 2WWPA 3NBXX 1S7DA 2POAA 3NR3A 2A2GA 3HK1A 4ORYA 5EDBA 1G74A 1KZXA 1X8OA 4IB6A 3JQOA 1OEJA 5L8NA 4HPAA 1BLRA 2FT9A 2GTFX 1DZKA 1UREA 4EQAC 3DTQA 5H8TA 2FWVA 3RWXA 3STKA 2RD7C 4YCHA 3OBLA 4IB9A 4IMOA 2FS7A 1BM5A 2M4LA 2W2BA 3BY0A 5EEDA 1TOWA 3BDRA 3BSZE 4AZMA 4ON1A 4PSQA 2MJIA 1SY0A 4NYRA 5HZ6A 4ALOA 1B4MA 4GK9A 5D47A 4YGZA 2OVDA 4YH0A 4GRJA 4KIIA 2AMMX 4GU8A 4FGIB 1OPBA 1GX9A 1Y9TA 2OVAA 2JU7A 2X8SA 4ODDA 2FR2A 2Q2MA 2ASNX 4GKCA 3SAOA 4LZVA 4UU3A 3TGBA 1X8QA 3L4RA 5HZ9A 3CR6A 3HTYA 3JSQA 2GC9A 1NP1A 4I9SA 3SOTA 4D6BA 5HZ5A 5IO5A 5K06A 3ZW0B 5LKEA 2BHVA 2P8GA 2KD2A 1DZPA 1VPRA 1G7NA 1ZNEA 1YWAA 1OPAA 3ZWEA 4ZHDA 5B27A 4MVLA 1ZRYA 3O2YA 3KFHA 1JBHA 2MHDA 4YGHA 1EXSA 3APUA 2OVEA 2LBVA 1OBUA 2XSTA 3UEXA 4N7DA 3KZAA 1LF7A 3APXA 5JR8A 1GKAA 4YKOA 1IFBA 1QFTA 2Q2PA 4CV7A 1P6PA 2QO4A 1EI5A 4LQZA 2FRSA 3LV4A 3HOEA 3KFIA 4HWMA 4IAXA 4MVIA 1BSYA 4OS3A 2LB6A 4L1NA 4ORXA 3TGAA 1VYGA 5BVSA 3WXQA 2HZRA 1CBSA 4XMHA 4YBUA 1QABE 4PJ2A 3FELA 2L9CA 3EYCA 3BU1A 1G85A 1QFVA 3FR4A 4Y0RA 3P6GA 5HTDA 2CZTA 3CWKA 5AJBA 3F9DA 1EQDA 3FIQA 5F6BA 1JJJA 4HPCA 2JU8A 4EDEA 1KGLA 4Y0PA 1XCAA 3VG4A 4ZH6A 1T0VA 3B2LA 5LJEA 1ZNLA 3STNA 1FDQA 1D2UA 1XKIA 2JW1A 4ZH9A 4YCEA 1LIEA 2Q4NA 1BBPA 4ARHA 4NNTA 4FBVA 1KZWA 4TNNA 2BLGA 4GZVA 3IFBA 1EPBA 2R56A 3WOVA 3B2KA 1HQPA 1ADLA 3FYFA 1MX8A 4KT5A 4XMFA 3WJDA 4U9CA 1G5WA 2W2FA 1LIFA 4ZCBA 3VE2A 4U8UM 1H91A 3NQ9A 5HCDC 3E3CA 3WJFA 1B0OA 3HWGA 1I04A 4U8UO 2FR3A 1HBPA 1QY2A 5H9KA 4ORSA 5EZ2A 4RUNA 5LKFA 4HPDA 2A3FX 1KXOA 3VG7A 4AZRA 4LKPA 3ZI8A 1QQSA 4ZHGA 1FTPA 4YMYA 4AZOA 4NYQA 1GGLA 3C77X 1R0UA 1ZNDA 2L67A 3P6DA 4COTA 5LJHA 5F1EA 5LJCA 4I3DA 4LKTA 4ML7B 1QWDA 4AYHA 4WBKA 1I4UA 1SXWA 2HYSA 4A60A 1EW3A 4CSBA 2G7BA 3FEKA 1EIIA 4O4XA 1DFVA 1DZJA 2GTLO 4TJZA 4ZGFA 1HMRA 1OBQA 4BQUA 1Z24A 3ZZVA 4AZPA 5HAEA 2YMSA 3KFGA 4I6SA 5HA1A 5BYPA 3UEWA 3NP1A 3T1DA 5DG4A 2CM4A 3FW4A 1IFCA 2ALLX 1NP4A 3BU9A 3FA9A 3TF6A 1QY1A 3O19A 1S2PA 5C0NA 5L8OA 1BWYA 3D4RA 2WQAE 3V8UA 2L68A 3FA8A 3KQ0A 1B8EA 3ELZA 4INNA 2Q39A 4QRLA 1GT1A 2JMBA 4EFGA 4WFVA 2QOSC 1O1UA 4O3XB 4UU2A 3WJEA 3S5VA 4QYPA 1CBIA 3VU1A 3D97A 1ERXA 1JV4A 3PH6A 3FEPA 3CQRA 4QQ1A 2A0AA 1O1VA 1JJXA 3TZSA 2R74A 4AW8A 4AZNA 1EALA 2O62A 2WUTA 3ZW2A 1CBQA 3RKGA 2HNXA 5EEEA 5BVQA 4R0BA 3VG5A 3U0DA 3HWDA 4OMXA 4MISA 4N7CA 3H3IA 1PMPA 2KTDA 3N91A 1E06A 3ZW1A 2X8TA 4I95A 3WJBA 3FENA 2AT0X 3D96A 5H9AA 2RCQA 1SY1A 1E02A 4QZTA 5BVTA 4O3ZA 4O3YA 1EPAA 2RN4A 1KOIA 1MDCA 5IO7A 3EBKA 3LHNA 1SY3A 1ICNA 5D48A 3OD9A 2RCTA 2WR6A 1ZNKA 4EEJA 2QO5A 3U9PC 1KT4A 2YG2A 1BSQA 3WJGA 1GT4A 3P6FA 4K19A 4KC7A 1TVQA 4ZR2A 4TQ2A 1YIVA 4LZUA 2A13A 2Q9SA 4TKBA 1MVGA 5HCCC 2HZQA 4MIRA 4XMDA 5AJCA 4U3QA 1U17A 2X46A 3PQSA 5KICA 2EU7X 4OS8A 1I06A 3VE1A 5AQ6A 3P02A 4QNIA 4NNSA 5F58A 5HA0A 5IO6A 1HMTA 3B2HA 3WBGA 5B29A 4L3RA 3HWEA 2FLJA 4O4OA 5L8IA 3FW5A 2ANSA 1YWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSW A;  3ZQ3 A;  1LKE A;  4TKJ A;  5HZQ A;  4ORR A;  3VG2 A;  3UEU A;  3ZUI A;  1BJ7 A;  4MVK A;  2GJ5 A;  4BVM A;  1A2D A;  4TLJ A;  3NX2 A;  3WVM A;  3ZUO A;  4M7M A;  3TGC A;  2E4J A;  1E00 A;  4NLJ A;  5LJK A;  1ACD A;  2WQ9 A;  3HWF A;  1AB0 A;  2AT5 X;  1GKA B;  3CBC A;  1FEL A;  5D4A A;  1OEE A;  3C76 X;  3UEV A;  2RA6 A;  1KT7 A;  3APW A;  3BX7 A;  1FE3 A;  3KFF A;  1SY2 A;  4HPB A;  4XMC A;  1BRP A;  1DF3 A;  2ACO A;  1OEK A;  3D95 A;  3FLL A;  3B2I A;  1QG5 A;  5LJG A;  2WSJ A;  3AKM A;  1YP7 A;  1PBO A;  1ML7 A;  2RQ0 A;  3BLG A;  4DQ3 A;  2G78 A;  2ACP X;  2CZU A;  3DSZ A;  1GT3 A;  5HCE C;  4I9R A;  1PEE A;  1S44 A;  1SXY A;  3NQ3 A;  1IIU A;  1EUO A;  1LIC A;  4ZHC A;  2HMB A;  3AKN A;  1ERB A;  2JU3 A;  1JZU A;  5H9L A;  4ALB A;  4A8Z A;  2MO5 A;  1KQW A;  4QGX A;  2NND A;  1CRB A;  1LIB A;  4RUU A;  3STM X;  3Q6L A;  1U0X A;  3NAD A;  4I3C A;  2XKL A;  4YGG A;  5FEN A;  1GM6 A;  4XMG A;  5F7G A;  5HTE A;  1UZ2 X;  2AL0 X;  1MX7 A;  4CK4 A;  3P6H A;  5DPQ A;  3MVF A;  1A18 A;  1T8V A;  1HN2 A;  3FA6 A;  1YUP A;  4IBA A;  4O9S A;  1SA8 A;  3RZY A;  1RBP A;  1N0S A;  2L5P A;  2LFO A;  2JN3 A;  3PP6 A;  1X8U A;  2QO6 A;  1JYD A;  1FEM A;  2CBS A;  3G7X A;  1A3Y A;  3FA7 A;  2AT8 X;  4ZJ0 A;  4Y0S A;  4YDB A;  1YWC A;  2LBA A;  2A2U A;  2G79 A;  2PY1 A;  5KHP A;  3APV A;  3PED A;  4GNY A;  4M6S A;  5F6Z A;  3EBW A;  1X71 A;  3VG3 A;  3JS1 A;  1I05 A;  3GAQ A;  1AQB A;  1HBQ A;  3P6E A;  4Y0Q A;  4BOE A;  1IKJ A;  4YFQ A;  5D45 A;  1GXA A;  1ICM A;  3PEC A;  4YKM A;  1LFO A;  3QKG A;  4GET A;  5FFH A;  3OJY C;  2DM5 A;  2AH7 X;  1BSO A;  2KT4 B;  1CBR A;  1GX8 A;  1BRQ A;  2AT3 X;  3BS2 A;  1FEN A;  1SXU A;  3B2J A;  4D6A A;  1ZNH A;  2JOZ A;  4EXZ A;  4ZHH A;  5KID A;  4GNW A;  1QY0 A;  2OZQ A;  3PH5 A;  4OMW A;  1LID A;  1TOU A;  3CMP A;  1DZM A;  2OFR X;  1TXL A;  3WJC A;  5LJB A;  1YWD A;  3EMM A;  1LPJ A;  4YDA A;  5LJD A;  2X45 A;  1CJ5 A;  1GT5 A;  3O22 A;  1MUP A;  4TKH A;  5CE4 A;  4IMN A;  2N93 A;  3FMZ A;  4NLI A;  4YFP A;  1IKE A;  1BEB A;  2WEX A;  4ES7 A;  5HZ8 A;  1O8V A;  3VG6 A;  4YBP A;  2LKK A;  4OS0 A;  4QYN A;  2F73 A;  4HFO A;  1OBP A;  5HWZ A;  3K3L A;  3I0A A;  4GE1 A;  1A57 A;  3BRN A;  3FR2 A;  3NX1 A;  1RLB E;  4ZHF A;  1ALB A;  2CM9 A;  4NP1 A;  1L6M A;  1KT3 A;  2CBR A;  4IB8 A;  1B56 A;  2FTB A;  3EM0 A;  3PPT A;  4ORU A;  2QM9 A;  3I17 A;  1PM1 X;  2IFB A;  4QGW A;  1AEL A;  1D3S A;  3CQN A;  4DQ4 A;  3NPO A;  3ELX A;  1DV9 A;  3F8A A;  1EIO A;  1DC9 A;  1E5P A;  3P6C A;  3U03 A;  4GH7 A;  1T68 X;  5HBS A;  1X8P A;  2R73 A;  5D8J A;  2NNE A;  4AZQ A;  4QGV A;  2FS6 A;  3CBS A;  4YFR A;  4ZGU A;  1SXX A;  3S26 A;  1X89 A;  1AVG I;  2HLV A;  3IA8 A;  1KQX A;  2AT6 X;  1YP6 A;  1LNM A;  2NP1 A;  5EDC A;  1TW4 A;  4QZU A;  5H9N A;  1JYJ A;  4A1Y A;  1X8N A;  2K23 A;  3BX8 A;  1HMS A;  2WEW A;  3C78 X;  1KT6 A;  4ZFX A;  5FAZ A;  3FR5 A;  4ORW A;  4I3B A;  2W2A A;  1ZNG A;  2AKQ A;  2MM3 A;  1KT5 A;  1NGL A;  4IB7 A;  2NNQ A;  4IAW A;  1U18 A;  2OFM X;  1VYF A;  4QAE A;  5EPQ A;  4A1H A;  2K62 A;  3MBT A;  4XME A;  1IW2 A;  4WFU A;  2WWP A;  1S7D A;  2POA A;  3NR3 A;  2A2G A;  3HK1 A;  4ORY A;  5EDB A;  1G74 A;  1KZX A;  1X8O A;  4IB6 A;  1OEJ A;  5L8N A;  4HPA A;  1BLR A;  2FT9 A;  2GTF X;  1DZK A;  1URE A;  3DTQ A;  5H8T A;  2FWV A;  3STK A;  2RD7 C;  4YCH A;  4IB9 A;  4IMO A;  2FS7 A;  1BM5 A;  2W2B A;  3BY0 A;  5EED A;  1TOW A;  3BDR A;  3BSZ E;  4AZM A;  4PSQ A;  2MJI A;  1SY0 A;  4NYR A;  5HZ6 A;  4ALO A;  1B4M A;  5D47 A;  4YGZ A;  2OVD A;  4YH0 A;  4GRJ A;  4KII A;  2AMM X;  1OPB A;  1GX9 A;  2OVA A;  2JU7 A;  4ODD A;  2FR2 A;  2Q2M A;  2ASN X;  4GKC A;  3SAO A;  4LZV A;  4UU3 A;  3TGB A;  1X8Q A;  3L4R A;  5HZ9 A;  3CR6 A;  3JSQ A;  2GC9 A;  1NP1 A;  4I9S A;  5HZ5 A;  4D6B A;  5K06 A;  5IO5 A;  5LKE A;  2P8G A;  1DZP A;  1VPR A;  1G7N A;  1ZNE A;  1YWA A;  1OPA A;  4ZHD A;  5B27 A;  4MVL A;  1ZRY A;  3O2Y A;  3KFH A;  1JBH A;  4YGH A;  1EXS A;  3APU A;  2OVE A;  2LBV A;  1OBU A;  2XST A;  3UEX A;  4N7D A;  3KZA A;  1LF7 A;  3APX A;  5JR8 A;  1GKA A;  4YKO A;  1IFB A;  1QFT A;  2Q2P A;  1P6P A;  2QO4 A;  2FRS A;  3KFI A;  4IAX A;  4MVI A;  1BSY A;  4OS3 A;  2LB6 A;  4ORX A;  3TGA A;  1VYG A;  5BVS A;  3WXQ A;  2HZR A;  1CBS A;  4XMH A;  4YBU A;  1QAB E;  3FEL A;  2L9C A;  3EYC A;  3BU1 A;  1G85 A;  1QFV A;  3FR4 A;  4Y0R A;  3P6G A;  5HTD A;  2CZT A;  3CWK A;  1JJJ A;  3F9D A;  1EQD A;  3FIQ A;  5F6B A;  4HPC A;  2JU8 A;  4EDE A;  1KGL A;  4Y0P A;  1XCA A;  3VG4 A;  4ZH6 A;  1T0V A;  3B2L A;  5LJE A;  1ZNL A;  3STN A;  1FDQ A;  1D2U A;  1XKI A;  4ZH9 A;  4YCE A;  1LIE A;  2Q4N A;  1BBP A;  4ARH A;  4NNT A;  1KZW A;  4TNN A;  2BLG A;  3IFB A;  1EPB A;  2R56 A;  3B2K A;  1HQP A;  1ADL A;  1MX8 A;  4XMF A;  3WJD A;  1G5W A;  2W2F A;  1LIF A;  4ZCB A;  1H91 A;  3NQ9 A;  5HCD C;  3WJF A;  1B0O A;  3HWG A;  1I04 A;  2FR3 A;  1HBP A;  1QY2 A;  5H9K A;  4ORS A;  5EZ2 A;  4RUN A;  5LKF A;  4HPD A;  2A3F X;  1KXO A;  3VG7 A;  4AZR A;  4LKP A;  1QQS A;  4ZHG A;  1FTP A;  4YMY A;  4AZO A;  4NYQ A;  1GGL A;  3C77 X;  1R0U A;  1ZND A;  2L67 A;  3P6D A;  5LJH A;  5F1E A;  5LJC A;  4I3D A;  4LKT A;  1QWD A;  4AYH A;  4WBK A;  1I4U A;  1SXW A;  2HYS A;  4A60 A;  1EW3 A;  2G7B A;  3FEK A;  1EII A;  1DFV A;  1DZJ A;  4TJZ A;  1HMR A;  1OBQ A;  4BQU A;  1Z24 A;  4AZP A;  5HAE A;  3KFG A;  5HA1 A;  3UEW A;  3NP1 A;  3T1D A;  5DG4 A;  2CM4 A;  3FW4 A;  1IFC A;  2ALL X;  1NP4 A;  3BU9 A;  3FA9 A;  3TF6 A;  1QY1 A;  3O19 A;  1S2P A;  5C0N A;  5L8O A;  1BWY A;  2WQA E;  2L68 A;  3FA8 A;  3KQ0 A;  1B8E A;  3ELZ A;  2Q39 A;  1GT1 A;  4EFG A;  4WFV A;  2QOS C;  1O1U A;  4UU2 A;  3WJE A;  4QYP A;  1CBI A;  3D97 A;  1ERX A;  1JV4 A;  3PH6 A;  3FEP A;  3CQR A;  2A0A A;  1O1V A;  1JJX A;  3TZS A;  2R74 A;  4AW8 A;  4AZN A;  1EAL A;  2O62 A;  2WUT A;  1CBQ A;  2HNX A;  5EEE A;  5BVQ A;  4R0B A;  3VG5 A;  3U0D A;  3HWD A;  4OMX A;  4N7C A;  1PMP A;  2KTD A;  1E06 A;  3WJB A;  3FEN A;  2AT0 X;  3D96 A;  5H9A A;  2RCQ A;  1SY1 A;  1E02 A;  4QZT A;  5BVT A;  1EPA A;  1KOI A;  1MDC A;  5IO7 A;  3EBK A;  1SY3 A;  1ICN A;  5D48 A;  4EEJ A;  2RCT A;  2WR6 A;  1ZNK A;  2QO5 A;  3U9P C;  1KT4 A;  2YG2 A;  1BSQ A;  3WJG A;  1GT4 A;  3P6F A;  4K19 A;  1TVQ A;  4ZR2 A;  4TQ2 A;  1YIV A;  4LZU A;  2A13 A;  2Q9S A;  4TKB A;  1MVG A;  5HCC C;  2HZQ A;  4XMD A;  1U17 A;  2X46 A;  5KIC A;  2EU7 X;  4OS8 A;  1I06 A;  5AQ6 A;  5IO6 A;  4NNS A;  5F58 A;  5HA0 A;  1HMT A;  3B2H A;  3WBG A;  5B29 A;  3HWE A;  2FLJ A;  5L8I A;  3FW5 A;  2ANS A;  1YWB A; 
#chains in the Genus database with same CATH topology
 4BX6 B;  3RSW A;  3ZQ3 A;  1LKE A;  1SWS A;  4Z6J A;  4TKJ A;  5HZQ A;  2PI3 O;  1SWL A;  4O3W A;  4ORR A;  3VG2 A;  3UEU A;  3ZUI A;  5HZ8 A;  1BJ7 A;  1SWQ A;  2BS6 A;  4MVK A;  2GJ5 A;  4BVM A;  1A2D A;  4TLJ A;  3NX2 A;  3WVM A;  3ZUO A;  4GDZ A;  1AVE A;  2RTA A;  4M7M A;  3TGC A;  1MM9 A;  1E00 A;  2E4J A;  3PQU A;  4NLJ A;  4Z2V A;  1WUB A;  1ACD A;  5LJK A;  2WQ9 A;  3HWF A;  1AB0 A;  2AT5 X;  1GKA B;  2FGS A;  3Q34 A;  4FQB B;  3CBC A;  1FEL A;  5D4A A;  1OEE A;  3C76 X;  3UEV A;  2RA6 A;  4DCB A;  1KT7 A;  3APW A;  3BX7 A;  1FE3 A;  3KFF A;  4U46 A;  3S5X A;  2CAM A;  1HXZ A;  1SWK A;  2RTF B;  5CHK A;  1SY2 A;  4HPB A;  4XMC A;  1BRP A;  1DF3 A;  2ACO A;  1OEK A;  2RTQ B;  2X8F A;  2MF6 A;  3B2I A;  1QG5 A;  3D95 A;  3FLL A;  2VFC A;  5LJG A;  2WSJ A;  3AKM A;  1YP7 A;  1PBO A;  1RAV A;  1ML7 A;  3P24 A;  2RQ0 A;  3T2W A;  3BLG A;  3LTW A;  5FQ7 E;  4DQ3 A;  1NQM A;  2G78 A;  2ACP X;  2CZU A;  3DSZ A;  1GT3 A;  2OVS A;  1I9H A;  4I9R A;  5HCE C;  1PEE A;  1S44 A;  1SXY A;  1VWP B;  1SWC A;  3NQ3 A;  1IIU A;  1EUO A;  1LIC A;  2X56 A;  4ZHC A;  2HMB A;  4FBR A;  3AKN A;  1ERB A;  2Z4I A;  3UAQ A;  4KCA A;  4C5P A;  2JU3 A;  1JZU A;  4BX7 B;  2BC3 A;  2RTP B;  4BX5 A;  2OY1 O;  5H9L A;  3VPJ E;  4ALB A;  4A8Z A;  3ZW0 A;  2MO5 A;  1KQW A;  3OE3 A;  2NND A;  4QGX A;  1CRB A;  1LIB A;  4RUU A;  3STM X;  3Q6L A;  1U0X A;  1N4J A;  2QMI A;  3NAD A;  4I3C A;  2XKL A;  3T6L A;  4YGG A;  4GUZ A;  5FEN A;  1GM6 A;  2X34 A;  4XMG A;  5F7G A;  2LA7 A;  5HTE A;  1UZ2 X;  2AL0 X;  1MX7 A;  4CK4 A;  3P6H A;  2RTM A;  5DPQ A;  4CDC A;  3MVF A;  1A18 A;  1T8V A;  1HN2 A;  3FA6 A;  1YUP A;  2RTO B;  3HOL A;  4IBA A;  1SA8 A;  4O9S A;  3RZY A;  1RBP A;  5FQ8 E;  1N0S A;  2L5P A;  2LFO A;  2JN3 A;  1VWB B;  3PP6 A;  4Y5D A;  5B10 O;  1SWB A;  1LCW A;  1X8U A;  1FJ1 E;  2QO6 A;  2RTK A;  1JYD A;  1FEM A;  2CBS A;  1VWO B;  3G7X A;  1JIW I;  1A3Y A;  1SWF A;  2AT8 X;  3FA7 A;  4ZJ0 A;  2BT9 A;  1K3B A;  4Y0S A;  4YDB A;  1YWC A;  1KGL A;  2LBA A;  2A2U A;  2F09 A;  1SRH A;  2G79 A;  1SRI A;  2PY1 A;  5KHP A;  3APV A;  3PED A;  4GNY A;  4M6S A;  1VWD B;  5F6Z A;  3EBW A;  1N7Y A;  3SLJ A;  1X71 A;  2KTS A;  3VG3 A;  3JS1 A;  4GJV A;  1I05 A;  3GAQ A;  1SWN A;  1AQB A;  1HBQ A;  2ZAI A;  3MX7 A;  3P6E A;  4Y0Q A;  5B5F A;  4BOE A;  1IKJ A;  4YFQ A;  1SLF B;  5D45 A;  1GXA A;  1ICM A;  3PEC A;  1Y52 X;  4YKM A;  1LFO A;  3QKG A;  4GET A;  5FFH A;  1K24 A;  3OJY C;  2DM5 A;  2AH7 X;  1BSO A;  1AVD A;  2KT4 B;  2C1S A;  2KW1 A;  2WPU A;  1CBR A;  1GX8 A;  1BRQ A;  3KVN A;  2AT3 X;  3BS2 A;  1FEN A;  1SXU A;  3B2J A;  4D6A A;  1ZNH A;  2JOZ A;  4EXZ A;  4ZHH A;  5KID A;  4GNW A;  1QY0 A;  2OZQ A;  4ID2 A;  3PH5 A;  2DJG A;  4OMW A;  2MWH A;  1LID A;  1TOU A;  2RTC B;  1DZM A;  2OFR X;  3CMP A;  1TXL A;  1N9M A;  4GGZ A;  4CDF A;  1IJ8 A;  3WJC A;  2RTE B;  4O49 A;  5LJB A;  1YWD A;  3EMM A;  4GGT A;  1LPJ A;  4YDA A;  1VWQ B;  2BS5 A;  5LJD A;  2X45 A;  1CJ5 A;  1GT5 A;  3O22 A;  5B2A O;  2OY5 O;  1MUP A;  4TKH A;  5CE4 A;  3F6Z B;  4NW4 A;  2Z4H A;  5CSE A;  4IMN A;  2AF5 A;  2N93 A;  3FMZ A;  4NLI A;  2FKG A;  1IKE A;  1BEB A;  2WEX A;  3CKG A;  4IAB A;  1O8V A;  4YFP A;  3S60 A;  3VG6 A;  1LCV A;  2LKK A;  4YBP A;  4OS0 A;  3T6F A;  4QYN A;  2F73 A;  4HFO A;  1OBP A;  5HWZ A;  4O4U A;  3K3L A;  3I0A A;  4GE1 A;  1A57 A;  3BRN A;  3FR2 A;  3NX1 A;  3RE5 A;  1RLB E;  4CPH B;  4ZHF A;  3RDU A;  3MM0 A;  1N9Y A;  1ALB A;  1RXK A;  2IZJ A;  1RSU B;  3SZH A;  2CM9 A;  3ZW1 B;  4NP1 A;  1L6M A;  2FKJ A;  2X32 A;  1KT3 A;  4WHI A;  2CBR A;  4IB8 A;  5AEO A;  1B56 A;  2FTB A;  3EM0 A;  3PPT A;  4ORU A;  2QM9 A;  3I17 A;  1PM1 X;  4CPI A;  2IFB A;  2IZF B;  3QQ2 A;  4QGW A;  4EKV A;  4KH8 A;  1AEL A;  1D3S A;  3CQN A;  2OYB O;  4JGL A;  1STR B;  1OSP O;  4DQ4 A;  3NPO A;  2OL6 O;  2I5Z O;  3ELX A;  3F8A A;  4OEM A;  1DV9 A;  1Y0G A;  4OKA A;  1EIO A;  1DC9 A;  1DF8 A;  1E5P A;  1LCZ A;  3P6C A;  3U03 A;  4GH7 A;  1T68 X;  1VWC B;  1Y9L A;  3RBY A;  2G5L A;  5HBS A;  1X8P A;  2R73 A;  1NDJ A;  2NNE A;  4GDA A;  2IZB A;  2FS6 A;  3CBS A;  5D8J A;  4AZQ A;  4BBO A;  1SXX A;  4QGV A;  3S26 A;  4YFR A;  1SWG A;  1AVG I;  1X89 A;  2HLV A;  2ZAG A;  5F2B A;  3PDF A;  3IA8 A;  1KQX A;  2AT6 X;  1YP6 A;  1LNM A;  1HQQ A;  1MEP A;  4U8U N;  2NP1 A;  1SWE A;  4O4S A;  2IZA A;  1TW4 A;  4QZU A;  5EDC A;  5H9N A;  4ES7 A;  1JYJ A;  1SWU A;  4A1Y A;  1X8N A;  2K23 A;  2Y3F A;  3BX8 A;  4KC8 A;  5IRU A;  1HMS A;  2WEW A;  3C78 X;  1KT6 A;  4ZFX A;  1MOY A;  3NQK A;  5FAZ A;  4GD9 A;  2RTL A;  2F01 A;  2Y32 A;  3FR5 A;  4GJS A;  4ORW A;  1LDQ A;  1W6F A;  1SMP I;  2W2A A;  1ZNG A;  4I3B A;  5CYB A;  3WZP A;  2AKQ A;  4BCS A;  2MM3 A;  1KT5 A;  1NGL A;  4IB7 A;  2NNQ A;  4IAW A;  1U18 A;  2RTB B;  4FBO A;  5FQ6 E;  2OFM X;  4ZGU A;  3RDM A;  2GTL M;  4MEE A;  1VYF A;  4QAE A;  1E2T A;  5EPQ A;  4A1H A;  2K62 A;  3MBT A;  2GTL N;  4XME A;  1IW2 A;  4MVE A;  4WFU A;  3GE2 A;  2RTD B;  2WWP A;  3NBX X;  1S7D A;  2POA A;  3NR3 A;  2A2G A;  3HK1 A;  4ORY A;  5EDB A;  1G74 A;  1KZX A;  1X8O A;  4IB6 A;  3JQO A;  1OEJ A;  5L8N A;  4HPA A;  1BLR A;  2FT9 A;  1SRF A;  2OFB A;  2GTF X;  1DZK A;  1URE A;  4EQA C;  3DTQ A;  5H8T A;  2FWV A;  1SWJ A;  3RWX A;  3STK A;  4BJ8 A;  2RD7 C;  4YCH A;  3OBL A;  4IB9 A;  2FHN X;  4IMO A;  2FS7 A;  1BM5 A;  2M4L A;  1LUQ A;  2W2B A;  3BY0 A;  5EED A;  1TOW A;  1SLD B;  3WYQ A;  3BDR A;  3BSZ E;  4AZM A;  4ON1 A;  4PSQ A;  2MJI A;  1SY0 A;  4NYR A;  3EC5 A;  4ALO A;  5HZ6 A;  5IRW A;  1SWD A;  1B4M A;  2ZSC A;  1VWH B;  4GK9 A;  5D47 A;  3WZQ A;  5IXG A;  1SWR A;  4YGZ A;  1VWE B;  2IZH B;  3VHH A;  2OVD A;  4YH0 A;  2X55 A;  4GRJ A;  4KII A;  2AMM X;  4GU8 A;  4FGI B;  1OPB A;  1GX9 A;  3MG5 A;  1Y9T A;  2OVA A;  2JU7 A;  2X8S A;  1SWO A;  4ODD A;  2FR2 A;  2Q2M A;  1VWK B;  2A5C A;  3WYP A;  2ASN X;  4GKC A;  3SAO A;  4LZV A;  4UU3 A;  3TGB A;  1X8Q A;  3L4R A;  5HZ9 A;  3CR6 A;  3HTY A;  3JSQ A;  3CKF A;  4BX5 B;  2RTN B;  2GC9 A;  1NP1 A;  4I9S A;  3SOT A;  4BX6 A;  4D6B A;  5HZ5 A;  5IO5 A;  3ZW0 B;  5K06 A;  5LKE A;  2BHV A;  3FDC A;  2P8G A;  2KD2 A;  1DZP A;  2RTI B;  1VWI B;  1VPR A;  1G7N A;  1ZNE A;  1YWA A;  1OPA A;  3AUM O;  3ZWE A;  5B27 A;  4MVL A;  4ZHD A;  1ZRY A;  3O2Y A;  3KFH A;  1JBH A;  2MHD A;  4YGH A;  1EXS A;  1JMX A;  3APU A;  2OVE A;  2LBV A;  1OBU A;  2XST A;  3UEX A;  4N7D A;  3KZA A;  1LF7 A;  1MK5 A;  2A8G A;  3APX A;  1PTS A;  5JR8 A;  1GKA A;  4YKO A;  1IFB A;  1QFT A;  2RTH B;  2Q2P A;  4CV7 A;  1KFF A;  1P6P A;  1VWL B;  1EI5 A;  2QO4 A;  4LQZ A;  4IRW A;  3RY1 A;  2FRS A;  3LV4 A;  3HOE A;  3KFI A;  2DJF A;  4HWM A;  4IAX A;  4MVI A;  1BSY A;  4OS3 A;  2LB6 A;  4L1N A;  4ORX A;  3TGA A;  1VYG A;  2JGS A;  4GGR A;  5BVS A;  3AEH A;  3WXQ A;  2OL8 O;  2HZR A;  1CBS A;  2Y3E A;  4XMH A;  1QAB E;  4YBU A;  4PJ2 A;  3FEL A;  2IZK A;  2L9C A;  3EYC A;  4OEL A;  3BU1 A;  1G85 A;  1QFV A;  1JMZ A;  3FR4 A;  4Y0R A;  3D9W A;  3P6G A;  5HTD A;  2CZT A;  3CWK A;  1VWG B;  5AJB A;  3F9D A;  1EQD A;  3FIQ A;  5F6B A;  1JJJ A;  1UYO X;  4HPC A;  1STS B;  2JU8 A;  1GX3 A;  4EDE A;  4JNJ A;  2RTG B;  4Y0P A;  2OY7 A;  1XCA A;  2RTR B;  2UZ2 A;  3VG4 A;  4ZH6 A;  1Y53 X;  1T0V A;  2OFA A;  1VYO A;  3B2L A;  5B11 O;  5LJE A;  4BX7 A;  1ZNL A;  3STN A;  1FDQ A;  3RE6 A;  1SWP A;  2UYW A;  3SZI A;  1XKI A;  1D2U A;  2JW1 A;  4ZH9 A;  3SLO A;  4YCE A;  1Y55 X;  1LIE A;  2Q4N A;  1BBP A;  4ARH A;  4NNT A;  4FBV A;  1KZW A;  4TNN A;  2BLG A;  1VWF B;  4GZV A;  3RY2 A;  3IFB A;  1EPB A;  2R56 A;  3WOV A;  3WZN A;  3B2K A;  1HQP A;  1ADL A;  1SWA A;  3FYF A;  2FHL A;  1MX8 A;  4KT5 A;  4XMF A;  3WJD A;  4U9C A;  1SLE B;  2W2F A;  1LIF A;  1G5W A;  4ZCB A;  3VE2 A;  4U8U M;  4JHQ A;  1H91 A;  2BSZ A;  2I5V O;  3NQ9 A;  5HCD C;  4CDE A;  3E3C A;  3FID A;  3WJF A;  5K67 A;  1B0O A;  3HWG A;  1LDO A;  1I04 A;  2IZI A;  2FR3 A;  4U8U O;  1VWR B;  1HBP A;  1QY2 A;  4DNE A;  5H9K A;  2HKD A;  4ORS A;  5EZ2 A;  1I78 A;  1NQN A;  4RUN A;  4HPD A;  5LKF A;  3PK2 A;  1UYN X;  2A3F X;  4NV8 A;  1KXO A;  3VG7 A;  4AZR A;  4LKP A;  3ZI8 A;  1QQS A;  4ZHG A;  1FTP A;  4YMY A;  4AZO A;  2VDF A;  4NYQ A;  2C1Q A;  1GGL A;  3C77 X;  1R0U A;  1ZND A;  2L67 A;  3P6D A;  4COT A;  5LJH A;  5F1E A;  3VGW A;  4YVB A;  4I3D A;  4LKT A;  1W5R A;  2GH7 A;  4ML7 B;  5LJC A;  1QWD A;  1KL4 A;  5K68 A;  1VWM B;  1I4U A;  4WBK A;  4AYH A;  1SXW A;  4I60 A;  2HYS A;  4A60 A;  1EW3 A;  4CSB A;  2G7B A;  3FEK A;  1EII A;  4O4X A;  4CDD A;  1DFV A;  1DZJ A;  2GTL O;  4TJZ A;  4ZGF A;  1HMR A;  1OBQ A;  4BQU A;  1JQP A;  1Z24 A;  3ZZV A;  4AZP A;  5HAE A;  2YMS A;  3KFG A;  4I6S A;  1SRG A;  5HA1 A;  5BYP A;  2IZG B;  3UEW A;  3NP1 A;  3T1D A;  4Z28 A;  5DG4 A;  2CM4 A;  3FW4 A;  2IZD B;  1IFC A;  2ALL X;  1NP4 A;  3BU9 A;  3FA9 A;  3TF6 A;  1QY1 A;  3O19 A;  1S2P A;  1SWH A;  5C0N A;  5L8O A;  3VHM A;  1BWY A;  3D4R A;  2G8C O;  2WQA E;  3EW2 A;  3V8U A;  2L68 A;  3FA8 A;  4Z27 A;  3KQ0 A;  2VFB A;  1B8E A;  3ELZ A;  4INN A;  4CPE A;  2Q39 A;  2X4M A;  4QRL A;  3SLT A;  1GT1 A;  2JMB A;  4EFG A;  2A5B A;  2QOS C;  4WFV A;  4Z2O A;  1O1U A;  2QCB A;  4O3X B;  4UU2 A;  3WJE A;  3S5V A;  4QYP A;  1CBI A;  3VU1 A;  3D97 A;  1ERX A;  1JV4 A;  3PH6 A;  2IZE B;  3FEP A;  1HXL A;  3CQR A;  4QQ1 A;  1NBX A;  2A0A A;  3RDX A;  4Z2P A;  1O1V A;  1SLG B;  1JJX A;  3TZS A;  1STP A;  5IRA A;  2R74 A;  4AW8 A;  4AZN A;  1LEL A;  1EAL A;  2O62 A;  2WUT A;  3ZW2 A;  1CBQ A;  3RKG A;  2HNX A;  1KL3 A;  5EEE A;  5BVQ A;  4R0B A;  3VG5 A;  5B5G A;  5JD2 A;  3SZJ A;  4BGF A;  2AVI A;  3U0D A;  4CPH A;  1SRE A;  3HWD A;  4OMX A;  1RXH A;  4MIS A;  4N7C A;  3H3I A;  4JO6 A;  3T2X A;  1PMP A;  2KTD A;  3N91 A;  1E06 A;  3ZW1 A;  1HY2 A;  2X8T A;  4I95 A;  3WJB A;  3FEN A;  3RDO A;  2AT0 X;  5B3M O;  3D96 A;  5H9A A;  2RCQ A;  1SY1 A;  1E02 A;  1VWN B;  4QZT A;  5BVT A;  1WBI A;  4O3Z A;  1NC9 A;  1EPA A;  2C4I A;  2RN4 A;  1KOI A;  4O3Y A;  1RST B;  3VHI A;  4CPF A;  1MDC A;  5IO7 A;  3EBK A;  3LHN A;  1SY3 A;  1ICN A;  5D48 A;  2OF8 A;  1PBY A;  2RCT A;  1ZNK A;  2WR6 A;  3OD9 A;  4EEJ A;  2QO5 A;  1JJU A;  2OL7 A;  3U9P C;  1KT4 A;  2YG2 A;  3X00 A;  1BSQ A;  3WJG A;  1GT4 A;  3P6F A;  4K19 A;  5L3Y A;  4KC7 A;  1TVQ A;  1SRJ A;  1VWA B;  4ZR2 A;  4TQ2 A;  1YIV A;  1N43 A;  4LZU A;  1RXJ A;  1SWT A;  2A13 A;  1MVG A;  2Q9S A;  3EW1 A;  4TKB A;  2OF9 A;  5HCC C;  2HZQ A;  4MIR A;  4XMD A;  5AJC A;  4U3Q A;  1U17 A;  2X46 A;  3PQS A;  5KIC A;  2EU7 X;  2IZC B;  1KL5 A;  2OY8 A;  1I06 A;  2QOM A;  4NV7 A;  4OS8 A;  5AQ6 A;  3RDS A;  3VE1 A;  3P02 A;  4B55 A;  3WZO A;  4QNI A;  4NNS A;  4Y59 A;  2IZL B;  5F58 A;  5HA0 A;  1HMT A;  3B2H A;  5IO6 A;  1VWJ B;  3HPE A;  3WBG A;  4L3R A;  3HWE A;  2FLJ A;  5B29 A;  3RDQ A;  4O4O A;  5L8I A;  3FW5 A;  2ANS A;  2RTJ A;  1YWB A;  1W4T A; 
#chains in the Genus database with same CATH homology
 3RSW A;  3ZQ3 A;  1LKE A;  4TKJ A;  5HZQ A;  4ORR A;  4O3W A;  3VG2 A;  3UEU A;  3ZUI A;  1BJ7 A;  4MVK A;  2BS6 A;  2GJ5 A;  4BVM A;  1A2D A;  4TLJ A;  3NX2 A;  3WVM A;  3ZUO A;  4GDZ A;  4M7M A;  3TGC A;  2E4J A;  1E00 A;  4NLJ A;  3PQU A;  5LJK A;  1ACD A;  2WQ9 A;  3HWF A;  1AB0 A;  2AT5 X;  1GKA B;  4FQB B;  3CBC A;  1FEL A;  5D4A A;  1OEE A;  3C76 X;  3UEV A;  2RA6 A;  1KT7 A;  3APW A;  3BX7 A;  1FE3 A;  3KFF A;  3S5X A;  1SY2 A;  4HPB A;  4XMC A;  1BRP A;  1DF3 A;  2ACO A;  1OEK A;  2X8F A;  3D95 A;  3FLL A;  3B2I A;  1QG5 A;  5LJG A;  2WSJ A;  3AKM A;  1YP7 A;  1PBO A;  3P24 A;  1ML7 A;  2RQ0 A;  3BLG A;  4DQ3 A;  5FQ7 E;  2G78 A;  2ACP X;  2CZU A;  3DSZ A;  1GT3 A;  2OVS A;  5HCE C;  4I9R A;  1PEE A;  1S44 A;  1SXY A;  3NQ3 A;  1IIU A;  1EUO A;  1LIC A;  4ZHC A;  2HMB A;  4FBR A;  3AKN A;  1ERB A;  2Z4I A;  3UAQ A;  4KCA A;  2JU3 A;  1JZU A;  5H9L A;  3VPJ E;  4ALB A;  4A8Z A;  3ZW0 A;  2MO5 A;  1KQW A;  3OE3 A;  2NND A;  4QGX A;  1CRB A;  1LIB A;  4RUU A;  3STM X;  3Q6L A;  1U0X A;  2QMI A;  3NAD A;  4I3C A;  2XKL A;  4YGG A;  5FEN A;  1GM6 A;  4XMG A;  5F7G A;  2LA7 A;  5HTE A;  1UZ2 X;  2AL0 X;  1MX7 A;  4CK4 A;  3P6H A;  5DPQ A;  3MVF A;  1A18 A;  1T8V A;  1HN2 A;  3FA6 A;  1YUP A;  3HOL A;  4IBA A;  4O9S A;  1SA8 A;  3RZY A;  1RBP A;  5FQ8 E;  1N0S A;  2L5P A;  2LFO A;  2JN3 A;  3PP6 A;  1X8U A;  2QO6 A;  1JYD A;  1FEM A;  2CBS A;  3G7X A;  1JIW I;  1A3Y A;  3FA7 A;  2AT8 X;  4ZJ0 A;  2BT9 A;  4Y0S A;  4YDB A;  1YWC A;  2LBA A;  2A2U A;  2F09 A;  2G79 A;  2PY1 A;  5KHP A;  3APV A;  3PED A;  4GNY A;  4M6S A;  5F6Z A;  3EBW A;  1X71 A;  2KTS A;  3VG3 A;  3JS1 A;  1I05 A;  3GAQ A;  2ZAI A;  1AQB A;  1HBQ A;  3MX7 A;  3P6E A;  4Y0Q A;  4BOE A;  1IKJ A;  4YFQ A;  5D45 A;  1GXA A;  1ICM A;  3PEC A;  4YKM A;  1LFO A;  3QKG A;  4GET A;  5FFH A;  3OJY C;  2DM5 A;  2AH7 X;  1BSO A;  2KT4 B;  2KW1 A;  1CBR A;  1GX8 A;  1BRQ A;  2AT3 X;  3BS2 A;  1FEN A;  1SXU A;  3B2J A;  4D6A A;  1ZNH A;  2JOZ A;  4EXZ A;  4ZHH A;  5KID A;  4GNW A;  1QY0 A;  2OZQ A;  4ID2 A;  3PH5 A;  4OMW A;  2MWH A;  1LID A;  1TOU A;  3CMP A;  1DZM A;  2OFR X;  1TXL A;  3WJC A;  4O49 A;  5LJB A;  1YWD A;  3EMM A;  1LPJ A;  4YDA A;  2BS5 A;  5LJD A;  2X45 A;  1CJ5 A;  1GT5 A;  3O22 A;  1MUP A;  4TKH A;  5CE4 A;  3F6Z B;  4NW4 A;  2Z4H A;  4IMN A;  2N93 A;  3FMZ A;  4NLI A;  4YFP A;  1IKE A;  1BEB A;  2WEX A;  4IAB A;  3S60 A;  1O8V A;  3VG6 A;  4ES7 A;  4YBP A;  5HZ8 A;  2LKK A;  4OS0 A;  4QYN A;  2F73 A;  4HFO A;  1OBP A;  5HWZ A;  4O4U A;  3K3L A;  3I0A A;  4GE1 A;  1A57 A;  3BRN A;  3FR2 A;  3NX1 A;  1RLB E;  4ZHF A;  1ALB A;  2CM9 A;  3ZW1 B;  4NP1 A;  1L6M A;  1KT3 A;  4WHI A;  2CBR A;  4IB8 A;  5AEO A;  1B56 A;  2FTB A;  3EM0 A;  3PPT A;  4ORU A;  2QM9 A;  3I17 A;  1PM1 X;  2IFB A;  4QGW A;  4KH8 A;  1AEL A;  1D3S A;  3CQN A;  4JGL A;  4DQ4 A;  3NPO A;  3ELX A;  1DV9 A;  3F8A A;  1EIO A;  1DC9 A;  1E5P A;  3P6C A;  3U03 A;  4GH7 A;  1T68 X;  1Y9L A;  3RBY A;  5HBS A;  1X8P A;  2R73 A;  5D8J A;  2NNE A;  4AZQ A;  4QGV A;  2FS6 A;  3CBS A;  4YFR A;  4ZGU A;  1SXX A;  3S26 A;  1X89 A;  1AVG I;  2HLV A;  2ZAG A;  3IA8 A;  1KQX A;  2AT6 X;  1YP6 A;  1LNM A;  4U8U N;  2NP1 A;  4O4S A;  5EDC A;  1TW4 A;  4QZU A;  5H9N A;  1JYJ A;  4A1Y A;  1X8N A;  2K23 A;  3BX8 A;  4KC8 A;  1HMS A;  2WEW A;  3C78 X;  1KT6 A;  4ZFX A;  3NQK A;  5FAZ A;  3FR5 A;  4ORW A;  1SMP I;  2W2A A;  1ZNG A;  4I3B A;  5CYB A;  2AKQ A;  2MM3 A;  1KT5 A;  1NGL A;  4IB7 A;  2NNQ A;  4IAW A;  1U18 A;  4FBO A;  5FQ6 E;  2OFM X;  2GTL M;  1VYF A;  4QAE A;  5EPQ A;  4A1H A;  2K62 A;  3MBT A;  2GTL N;  4XME A;  1IW2 A;  4MVE A;  4WFU A;  3GE2 A;  2WWP A;  3NBX X;  1S7D A;  2POA A;  3NR3 A;  2A2G A;  3HK1 A;  4ORY A;  5EDB A;  1G74 A;  1KZX A;  1X8O A;  4IB6 A;  3JQO A;  1OEJ A;  5L8N A;  4HPA A;  1BLR A;  2FT9 A;  2GTF X;  1DZK A;  1URE A;  4EQA C;  3DTQ A;  5H8T A;  2FWV A;  3RWX A;  3STK A;  2RD7 C;  4YCH A;  3OBL A;  4IB9 A;  4IMO A;  2FS7 A;  1BM5 A;  2M4L A;  2W2B A;  3BY0 A;  5EED A;  1TOW A;  3BDR A;  3BSZ E;  4AZM A;  4ON1 A;  4PSQ A;  2MJI A;  1SY0 A;  4NYR A;  5HZ6 A;  4ALO A;  1B4M A;  4GK9 A;  5D47 A;  4YGZ A;  2OVD A;  4YH0 A;  4GRJ A;  4KII A;  2AMM X;  4GU8 A;  4FGI B;  1OPB A;  1GX9 A;  1Y9T A;  2OVA A;  2JU7 A;  2X8S A;  4ODD A;  2FR2 A;  2Q2M A;  2ASN X;  4GKC A;  3SAO A;  4LZV A;  4UU3 A;  3TGB A;  1X8Q A;  3L4R A;  5HZ9 A;  3CR6 A;  3HTY A;  3JSQ A;  2GC9 A;  1NP1 A;  4I9S A;  3SOT A;  4D6B A;  5HZ5 A;  5IO5 A;  5K06 A;  3ZW0 B;  5LKE A;  2BHV A;  2P8G A;  2KD2 A;  1DZP A;  1VPR A;  1G7N A;  1ZNE A;  1YWA A;  1OPA A;  3ZWE A;  4ZHD A;  5B27 A;  4MVL A;  1ZRY A;  3O2Y A;  3KFH A;  1JBH A;  2MHD A;  4YGH A;  1EXS A;  3APU A;  2OVE A;  2LBV A;  1OBU A;  2XST A;  3UEX A;  4N7D A;  3KZA A;  1LF7 A;  3APX A;  5JR8 A;  1GKA A;  4YKO A;  1IFB A;  1QFT A;  2Q2P A;  4CV7 A;  1P6P A;  2QO4 A;  1EI5 A;  4LQZ A;  2FRS A;  3LV4 A;  3HOE A;  3KFI A;  4HWM A;  4IAX A;  4MVI A;  1BSY A;  4OS3 A;  2LB6 A;  4L1N A;  4ORX A;  3TGA A;  1VYG A;  5BVS A;  3WXQ A;  2HZR A;  1CBS A;  4XMH A;  4YBU A;  1QAB E;  4PJ2 A;  3FEL A;  2L9C A;  3EYC A;  3BU1 A;  1G85 A;  1QFV A;  3FR4 A;  4Y0R A;  3P6G A;  5HTD A;  2CZT A;  3CWK A;  5AJB A;  3F9D A;  1EQD A;  3FIQ A;  5F6B A;  1JJJ A;  4HPC A;  2JU8 A;  4EDE A;  1KGL A;  4Y0P A;  1XCA A;  3VG4 A;  4ZH6 A;  1T0V A;  3B2L A;  5LJE A;  1ZNL A;  3STN A;  1FDQ A;  1D2U A;  1XKI A;  2JW1 A;  4ZH9 A;  4YCE A;  1LIE A;  2Q4N A;  1BBP A;  4ARH A;  4NNT A;  4FBV A;  1KZW A;  4TNN A;  2BLG A;  4GZV A;  3IFB A;  1EPB A;  2R56 A;  3WOV A;  3B2K A;  1HQP A;  1ADL A;  3FYF A;  1MX8 A;  4KT5 A;  4XMF A;  3WJD A;  4U9C A;  1G5W A;  2W2F A;  1LIF A;  4ZCB A;  3VE2 A;  4U8U M;  1H91 A;  3NQ9 A;  5HCD C;  3E3C A;  3WJF A;  1B0O A;  3HWG A;  1I04 A;  4U8U O;  2FR3 A;  1HBP A;  1QY2 A;  5H9K A;  4ORS A;  5EZ2 A;  4RUN A;  5LKF A;  4HPD A;  2A3F X;  1KXO A;  3VG7 A;  4AZR A;  4LKP A;  3ZI8 A;  1QQS A;  4ZHG A;  1FTP A;  4YMY A;  4AZO A;  4NYQ A;  1GGL A;  3C77 X;  1R0U A;  1ZND A;  2L67 A;  3P6D A;  4COT A;  5LJH A;  5F1E A;  5LJC A;  4I3D A;  4LKT A;  4ML7 B;  1QWD A;  4AYH A;  4WBK A;  1I4U A;  1SXW A;  2HYS A;  4A60 A;  1EW3 A;  4CSB A;  2G7B A;  3FEK A;  1EII A;  4O4X A;  1DFV A;  1DZJ A;  2GTL O;  4TJZ A;  4ZGF A;  1HMR A;  1OBQ A;  4BQU A;  1Z24 A;  3ZZV A;  4AZP A;  5HAE A;  2YMS A;  3KFG A;  4I6S A;  5HA1 A;  5BYP A;  3UEW A;  3NP1 A;  3T1D A;  5DG4 A;  2CM4 A;  3FW4 A;  1IFC A;  2ALL X;  1NP4 A;  3BU9 A;  3FA9 A;  3TF6 A;  1QY1 A;  3O19 A;  1S2P A;  5C0N A;  5L8O A;  1BWY A;  3D4R A;  2WQA E;  3V8U A;  2L68 A;  3FA8 A;  3KQ0 A;  1B8E A;  3ELZ A;  4INN A;  2Q39 A;  4QRL A;  1GT1 A;  2JMB A;  4EFG A;  4WFV A;  2QOS C;  1O1U A;  4O3X B;  4UU2 A;  3WJE A;  3S5V A;  4QYP A;  1CBI A;  3VU1 A;  3D97 A;  1ERX A;  1JV4 A;  3PH6 A;  3FEP A;  3CQR A;  4QQ1 A;  2A0A A;  1O1V A;  1JJX A;  3TZS A;  2R74 A;  4AW8 A;  4AZN A;  1EAL A;  2O62 A;  2WUT A;  3ZW2 A;  1CBQ A;  3RKG A;  2HNX A;  5EEE A;  5BVQ A;  4R0B A;  3VG5 A;  3U0D A;  3HWD A;  4OMX A;  4MIS A;  4N7C A;  3H3I A;  1PMP A;  2KTD A;  3N91 A;  1E06 A;  3ZW1 A;  2X8T A;  4I95 A;  3WJB A;  3FEN A;  2AT0 X;  3D96 A;  5H9A A;  2RCQ A;  1SY1 A;  1E02 A;  4QZT A;  5BVT A;  4O3Z A;  4O3Y A;  1EPA A;  2RN4 A;  1KOI A;  1MDC A;  5IO7 A;  3EBK A;  3LHN A;  1SY3 A;  1ICN A;  5D48 A;  3OD9 A;  2RCT A;  2WR6 A;  1ZNK A;  4EEJ A;  2QO5 A;  3U9P C;  1KT4 A;  2YG2 A;  1BSQ A;  3WJG A;  1GT4 A;  3P6F A;  4K19 A;  4KC7 A;  1TVQ A;  4ZR2 A;  4TQ2 A;  1YIV A;  4LZU A;  2A13 A;  2Q9S A;  4TKB A;  1MVG A;  5HCC C;  2HZQ A;  4MIR A;  4XMD A;  5AJC A;  4U3Q A;  1U17 A;  2X46 A;  3PQS A;  5KIC A;  2EU7 X;  4OS8 A;  1I06 A;  3VE1 A;  5AQ6 A;  3P02 A;  4QNI A;  4NNS A;  5F58 A;  5HA0 A;  5IO6 A;  1HMT A;  3B2H A;  3WBG A;  5B29 A;  4L3R A;  3HWE A;  2FLJ A;  4O4O A;  5L8I A;  3FW5 A;  2ANS A;  1YWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...