5LJLA

Streptococcus pneumonia tigr4 flavodoxin: structural and biophysical characterization of a novel drug target
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
GMALAKIVFASMTGNTEEIADIVADKLRDLGLDVDVDECTTVDASDFLEADIAIVATYTYGDGELPDEMMDFYEDLADLNLNGKIYGVVGSGDTFYDEFCKAVDDFDRVFVSTGAEKGSECVKVDLSAEEEDIERLEQFAEELAAKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavodoxin
publication title Streptococcus pneumoniae TIGR4 Flavodoxin: Structural and Biophysical Characterization of a Novel Drug Target.
pubmed doi rcsb
source organism Streptococcus pneumoniae serotype 4 (strain atcc baa-334 / tigr4)
molecule tags Oxidoreductase
total genus 53
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ljlA00
3QFCA 4D02A 2W5UA 2MWMA 3GAMA 4N65A 3FW1A 3NHJA 3B6JA 2FAXA 1E5DA 4ZVKA 4S24A 3UXEA 4FX2A 2M6RA 4CETA 3NLLA 4BMPB 4U7GA 1YCGA 5B3LA 1JA1A 1FUEA 4XDHA 4Y9UA 3F2VA 3U7IA 1D04A 1RLIA 3F6RA 3NHYA 3NHKA 1TLLA 3O73A 2XOEA 4DY4A 1J9ZA 1DXOA 4F8YA 6NULA 3GFSA 1AMOA 3LT5A 4YAOA 3KLBA 3KAQA 1FVXA 2BPOA 4N9QA 1SG0A 2BF4A 2BMVA 3G5MA 3L9WA 3GFRA 3NHRA 2Z98A 4LTMA 2KQUA 4ICIA 1AG9A 2FZVA 2MTBA 3OX2A 5LBTA 4DILA 1WSBA 1RLJA 5NULA 4YALA 5NLLA 1ZWKA 5A4KA 3ESXA 2FOXA 4XDGA 4FGJA 1C7FA 2QWXA 3W78A 1AHNA 3OJXA 4C76A 1J9GA 1SQSA 1I1OA 1C7EA 3FVWA 1VMEA 3NHSA 1CZUA 4LA4A 4YAWA 3OX1A 2OHJA 2ARKA 1FLDA 2Q62A 1TIKA 1B1CA 3SVLA 2R97A 2MOKA 3S2YA 3FNIA 5EMNA 4GQIA 1AKQA 3N39C 4YAFA 1FLVA 2V5UA 2F1OA 2FVXA 3TE7A 1KBQA 4CF6A 3HA2A 4BMOB 4GI5A 1CZLA 1AKTA 1RTTA 5FA6A 2KLBA 3ZHOA 5BUCA 1XI2A 2MT9A 1ZX1A 2OHHA 2QX8A 3B6IA 3K1YA 2GSWA 1GG5A 3W7AA 2QX4A 1YKGA 2QR2A 2Z9BA 3TEMA 2OHIA 1RCFA 1V4BA 4ZVLA 3QE2A 4N82A 2FCRA 1DXQA 3FJOA 4PTZA 4HEQA 4QOFA 5LBUA 1AKVA 5LJIA 4LTNA 1XYYA 3OX3A 1YCFA 3NFRA 3ESYA 2FLVA 4QOGA 3W79A 3L9XA 4QODA 2Z9DA 1YDGA 5LLDA 1AKRA 4ZVNA 3U7RA 3W77A 5EAIA 4H6PA 5FUQA 5FX2A 1XT6A 2X2OA 2N1MA 2BZSA 4QOHA 2AMJA 2BN4A 5F12A 4YQEA 4LTDA 1YCHA 2XODA 1XYVA 5LMCA 4ESEA 3RPEA 1H69A 4R81A 1AKWA 4PTYA 1F4PA 3N3BC 2B3DA 4U7FA 3NHLA 2R96A 3K20A 3KAPA 2HPVA 2X2PA 5LJLA 2QX6A 2Q9UA 2WC1A 3ES9A 2OYSA 2QMYA 3EDOA 4M0CA 2V5VA 1J9EA 3NHPA 1ZWLA 2Z9CA 3O2NA 1OBVA 4FGKA 4GR9A 5ULLA 4FGLA 3OJWA 3UXHA 1FLNA 1FTGA 1T0IA 3D7NA 3P0RA 2D5IA 4OXXA 1BVYF 1CZHA 1T5BA 2FX2A 3JSXA 3FX2A 4C14A 3OVMA 4C0XA 2RG1A 1KBOA 1H66A 4NULA 2A5LA 5EA2A 1CZKA 5F51A 1AKUA 3OWHA 3F90A 2HNAA 1CZOA 4C0WA 1X77A 3N3AC 3LCMA 3F6SA 5TGZA 3NHFA 2V9CA 4Y9RA 1WSWA 2M6SA 2FZ5A 4NLLA 1OBOA 4U7HA 4YAUA 3ESZA 1CZRA 1DX9A 2FDXA 3QFRA 3B6KA 3NHUA 1NNI1 3HLYA 1YOBA 1J8QA 5JROA 2QMZA 1QR2A 1D03A 3TZBA 1OFVA 3R6WA 4J8PA 5F4BA 2HNBA 4DIKA 5B3KA 1AZLA 3NHWA 3KEGA 3EYWA 3GFQA 1QBGA 5LVAA 3OWXA 3HR4A 1BU5A 4H2DA 4PU0A 1YRHA 1CZNA 2QX9A 3B6MA 4ZVMA 1D4AA 1QHEA 1QRDA 1JA0A 4QOEA 4HS4A 1FLAA 4Y7CA 1FX1A 4LAFA 4QOIA 4QOJA 2ZKIA
chains in the Genus database with same CATH superfamily
4QGHA 4LBZA 4JD5A 1P7ZA 4QYIB 4P4LA 5ECYA 5EEHA 3UWDA 1QYIA 3IJ5A 1YBMA 1GYRA 3I9OA 2K5UA 2EFYA 5BYAA 1B41A 1GZ3A 1NXOA 2LBPA 2YXEA 4FXOA 3T5GA 4AYTA 2JBAA 4LXUA 1U7HA 4G9BA 4B35A 1RI3A 1HKUA 3LUFA 1Z6AA 3H2IA 3I0ZA 1RTKA 1E6MA 1E18A 1ZCFA 2O1WA 4FU0A 3AVWA 1EWVA 4L2IB 2CV2A 1T0UA 2PS1A 3T7IA 4WADA 2GVDC 2REOA 4ID9A 2AGVA 4H7IA 4P80A 4CNQA 4DCTA 1VPTA 1W2GA 3ZOKA 5K3AA 2QLNA 4CQMA 2OO5A 4HC4A 5A3JA 2Q3BA 1ULUA 2VNJA 1J00A 3TIVA 3W05A 4EB6B 1MOPA 2TRSB 3G8AA 1Z7BA 3L0SA 1P1HA 4KN8A 1E6CA 4WA7A 5SZHB 3U44B 3QSYA 3U60B 1TMYA 4PRLA 1MXHA 2BUAA 1Y37A 4EMTA 1FYVA 2FW9A 5KDOA 1K7SN 2ZBVA 3AVOA 2PU7A 4KXLA 4RIFA 4UU8A 4BBJA 1VYHA 3RT1A 4CN8A 3GQBB 2PS0A 4N03A 2FN9A 3S55A 2ZSDA 3EPHA 4UTNA 1X3LA 3P9SA 1FQKA 1ZZEA 3FLAA 3AFNA 4EZBA 3EN0A 4R31A 2QTLA 3KD3A 1DG9A 2CFCA 1JA9A 1XD9A 4PC1A 1Q15A 1TPYA 1L4LA 2WU4A 3PDIB 2I2AA 1RYFA 1MOZA 1SGWA 1MIHA 4EO9A 4G8CA 2GN8A 2XSZA 3U39A 3ZDXB 3RREA 5HR5A 4HRAA 5IANA 3KQHA 4MUHA 5DWQA 3TXAA 5JAOA 5JWOA 4NC9A 2FE1A 3UV3A 3ZH2A 3MLEA 1Y3HA 1RHMA 5LMZA 4QG7A 4YTEA 3D2AA 3DQQA 1D2HA 1E2IA 3RIXA 5B2FA 5EHZA 1Q3HA 3HU5A 2RAPA 1H5NA 3IIEA 2J0EA 3L6DA 1LDBA 1MJGA 3CT4A 3TB6A 1V3UA 3KWMA 2Z95A 3MSCA 2GR9A 1W0JA 3O83A 1YIDA 1ZNWA 2I3BA 4X8HA 2VH1A 1FNMA 3MFQA 2WA1A 1K0FA 3JQ8B 1AXEA 1Y5IA 1CDDA 1QQ5A 2DXIA 2I8AA 2ZYTX 4MLCA 3RC3A 2WMOB 3EFOA 4QM6A 1J06A 5KJ6A 4Z4GA 2PQ6A 1TW3A 2H2IA 1VBMA 2XYHA 3P32A 4BMYA 1YASA 3VO9A 4AW9A 3OCYA 4LF4B 2CXOA 5SICE 3TTTA 2FR1A 2GJ8A 1U4NA 4PLWA 3UAYA 3EZ7A 3QUCA 1CG6A 1G7RA 3AGQA 4JIMA 4BTLA 2B1IA 2HWUA 4V3CA 4HP8A 1A9TA 1YC5A 3M6UA 3PYXA 4K9OA 4OJMX 1RRFA 2ONZA 5BV0A 5JEDA 1H5QA 2OZVA 4DLRA 4IH4A 4AY3A 4E7PA 5JEEA 2EOAA 4M8IA 4IS3A 1OVMA 1JBKA 3UAXA 3HMKA 2QAJA 4Q3KA 1UBLS 1XZHA 2HRDA 3ESXA 3I73A 3OOEA 1PN3A 2H57A 5CW2A 3GVXA 1QP8A 1N3YA 3PUKA 2I8CA 2IU3A 1KYQA 4EUEA 1QYVA 2EVWX 4JNKA 3IEKA 3L84A 1E9VA 1NFFA 1TM4E 5DHPA 4JUCA 4BNIA 5J40A 5IKOA 4KYVA 5B2ZA 4MV1A 3BULA 1JKJB 4RNDB 1KY4A 1GT91 4C76A 4PCUA 4NBRA 1AU9A 5EE9A 4EPRA 5ADWA 1DV1A 2O59A 3TW8A 5I8PA 3R7WB 2ZM5A 2WSMA 1N2CE 5HM6A 1J9GA 3AF3A 1EDEA 3EVZA 1CJUC 4XX1A 1MAUA 1F51E 4BATA 2G5PA 3VNVA 2O3SA 3N53A 5FI3A 4MW0A 3G0HA 5GZ3A 1D09A 2IGTA 2QTRA 1M2FA 2WHXA 2GH1A 5TQ2B 3U7JA 2JIZD 2VEOA 1MX1A 5C31A 3I4LA 1NVDA 3IFSA 1EFUA 1GA6A 1JPNA 3E8XA 2G83A 2HI0A 3IDOA 3MLAA 4M8KA 4R0NA 3SZGA 4DS3A 1OT5A 2ID9A 2BTQB 4YC7A 2B0CA 2Y1XA 4F4IA 5LWQA 1G63A 3UJ9A 1QVWA 3BYZA 3B53X 1OX5A 2ZROA 3OPMA 1K8ZB 3ZWBA 5I7UA 4AMGA 2WYWA 3N0TA 4E0BA 2B94A 2QSZA 3R6LA 4L57A 3T12A 2IOFK 1PJLA 5KU7A 1N8TA 5H9VA 2W48A 3Q7PA 4RGYA 1FRNA 5K8LA 4QRHA 1ISPA 3HHPA 4N3CA 2WIKA 4OP2A 2PMCA 2VDJA 1L4FA 3B2QA 1BXGA 3B12A 4CF3A 4RULA 2Q3JA 3WGMA 3THWA 3WGOA 4M87A 5GV7A 2G07A 3QU2A 1K3UB 3NWBA 4R6WA 4AJEA 2J45A 1Y42X 4BRUA 1WVIA 4FYIA 3S2YA 1G38A 4RJLA 3INNA 3O3NB 5HDBB 3WNVA 2X2EA 4WLVA 5EMNA 2X7XA 5PGMA 1V48A 4UNNA 5C3MA 1B3RA 1J99A 5SY9A 4OJKA 4R9SA 4NYJR 1GTJ1 2DFTA 4Z9BA 4C3OB 4Z4CA 5JSZB 2GWRA 1Z47A 4ZREA 5A9SB 1F2VA 1HEYA 1NHWA 4UARA 4C1NA 4C0JA 2Z3WA 4DDWA 2W6QA 3IGFA 3IYLW 1XTZA 2O7RA 2XDWA 4E88A 2YWHA 5C4IA 1F3LA 3PICA 2HPAA 2PFGA 1FP7A 1UIRA 3MJRA 4IDGA 4CI0B 4FSDA 3Q41A 1TVCA 3IURA 1MRZA 1J20A 1SD1A 1T6BY 2HLDD 3D6FA 3QNMA 1DEOA 4I7EA 1IYZA 4TTVA 4UHJA 4ARCA 2O2YA 4FR5A 1JFLA 1QE3A 4D9IA 5ENZA 1LRKA 1EMDA 1UEXC 2XGOA 3SJZA 4X54A 1R5BA 3LLSA 1MO6A 1FFCA 2IHYA 3M5CA 4PYIA 1O9HA 1KDTA 2KLBA 3H1TA 3QELA 3SNHA 2H1WA 1ZX1A 4O1IA 1AQLA 4TLEA 5JSYA 1RIIA 4BP3A 5KYTA 3C45A 5CA1F 1IZ0A 2GETA 3VJLA 2NPFA 2YY5A 3AFIA 4F12A 1HDGO 4PX3A 2YXPX 5D6OA 4S3MA 2J3DA 3LC0A 5D87A 3RBAA 3LW7A 3RVRA 4QHTA 3LCUA 2QE7A 3CUYA 3LKBA 3UJPA 2C77A 1VJ0A 4RACA 1OIXA 4ZK6A 5BN3B 3L1HA 1WXGA 1K7EB 1ZUWA 1CHNA 1LX6A 3ANTA 3WGNA 3EXFB 4KXFB 3TBHA 3V9AA 3B5IA 4YRZA 4D9BA 1XRSB 1GGNA 5FFMA 1FTYA 3GNTA 4NFHA 4CT0A 3JSAA 2AI1A 4OB6A 2GDZA 2I3ZA 3RHFA 3EDRA 3VBEA 2ID4A 3EG9A 4YUAA 3ZBQA 3NVAA 4Q1BA 2VHYA 5JZSA 1JIVA 2NO4A 3AKEA 4R1QA 4DXDA 2DMRA 3FSRA 2M6LA 5EIWA 1KP2A 3SBOA 4A6PA 3ISVA 1RP7A 3DOIA 3U6KA 4XQCA 4DA8A 3CLTC 4MRVA 4KVFA 2QP4A 4URUR 1GDTA 4C08A 2VUHB 4QOGA 4L8LA 4JB0A 2C98A 2E4YA 1AGRA 1S6YA 1OPRA 3KUDA 5DRYA 5BSMA 4EFDA 2WU3A 3FWNA 3DVRX 3DV2A 1UKYA 4GD3Q 3MRVA 4I9NA 1Z39A 2NWQA 3FHJA 3DWIA 3IAS6 2E18A 3OD5A 1NJ5A 5ALZA 5KI6A 4RTJA 1WXEA 3DW3X 5LLDA 5BN1A 1DFGA 1U65A 4ENQA 4BQOA 4AD8A 1BQ3A 3QEAZ 3L8DA 3NJ8A 1SBIA 2HSZA 4ZGWA 1NSYA 1M5TA 3DDHA 4ZICA 1U2RA 1G5RA 3QIAA 2N1MA 3REQB 1NE2A 5F5XA 2C9BA 2D6FA 4LE2A 5CM2Z 4JLWA 4Q7LA 1X74A 3WL8A 4NL4H 5KSWB 5IT4A 1EUDB 4L15A 4G1EB 1KOGA 3OZAA 3K8ZA 3SU8A 4MS1A 1Z0IA 4FDLA 4JJKA 4JLSA 1V1RB 3RVKA 1YCDA 1PNQA 2Y4OA 1CR0A 1PJ8A 4OLBA 1YONA 3KSMA 5A3QA 5C18A 4EBFA 1MNAA 1SC4A 1VG1A 3HB0A 4Y3UA 4LZPA 1BS1A 1PNTA 4L08A 1U0FA 1Z16A 1C9JA 1U8YA 1UXIA 3IDSA 4PNHA 3HWX1 1HQCA 3DZDA 3YASA 4P0QB 1WMFA 1KAQA 2BELA 4F6RB 2QVYX 4M9UA 3MB8A 4HQ0A 2W43A 1GCIA 3HDTA 3ELDA 4TL8A 3A9TA 3W3AH 2XMGA 2ZREA 3PEUA 1IN6A 1A1SA 2OHVA 2WF5A 2ZU0C 5EZ6B 3H99A 1SM4A 2XBUA 5AW5A 3VX4A 4NG4A 1DJLA 3NC1C 5IXSA 1U3UA 2VPWA 1NF3A 4HEHA 3UT5B 3F3YA 1EFKA 5FUVA 4R71A 3LHFA 3ANXA 1XCOA 2BKUA 5C34B 1P9NA 3KUCA 3ZW7A 1OYOA 2DHEA 2G70A 2COUA 3WYGA 3EY9A 2O3JA 2OYSA 5FPYA 3OQIA 5GAJA 4DA6A 4WE3A 2J5QA 5BVHB 2WDZA 3MUNA 2OE2A 4KTTE 2XXAA 3MMZA 3CNOA 1UJNA 3HL4A 2FYTA 2PZLA 4RZQA 5EKTA 4C87A 5F23A 2XCRB 1C80A 3E2MA 4GOKA 2D3WA 2F43B 4HQ6A 5BQ5A 4ZAFA 3AUTA 1FFSA 2YHUA 3K2EA 5EN4A 3HP4A 5IPFA 4MRAA 4H15A 5DSZA 4DV2B 1J22A 4Y0VA 2AC2A 5TVKA 5JYEA 3HUUA 3EXEA 1UT8A 3FZGA 3TQHA 2C3PA 5JSKA 4OA5A 4TLBA 4IIUA 1DU4A 3K0HA 1UKZA 1SR8A 1MDFA 1U3CA 2DFDA 2AJTA 3HDQA 5FQOA 3D4PA 5FOTA 1JGTA 2QN2A 3W6NA 1Y1PA 2H7YA 4XYGA 3PNOA 1LQTA 1E2HA 5B1DA 2AE2A 2BHSA 3NGMA 4BKQA 4DNQA 2PH7A 4OU4A 4YRKA 1BDIA 4DM4A 1SOWA 4AO6A 3ZYZA 1TUBA 4EAAA 4MV0A 1QZXA 2FWAA 3RW9A 3F47A 4K9DA 1XZLA 4JODA 3ENZA 5HF9A 4O8ZA 4U5XA 2K7FA 4P22A 4R2KA 1ABEA 1G8MA 1NE7A 2HJGA 1JPJA 3KYCB 3PEEA 1R0ZA 4LBVA 1ZO8A 4E2XA 4POOA 3GJ0A 1A8PA 1TK3A 4UTZA 4ZODA 3ZWCA 3O74A 3T5TA 5FL7A 5JLAA 3T34A 4YUYA 2ECPA 3NDIA 1OYWA 3FVVA 4LRSB 2ICAA 4OXNA 1NV9A 1XTVA 2DKOA 2R79A 4EHAA 2YN4A 1BDMA 4YV7A 2AIRA 3PHLA 5JANA 1EK0A 5IJ0A 2IPNA 1UK8A 3ADKA 3ICOA 4L0MA 4PQRA 1U3WA 2YNMC 1YJAA 1FX0B 3LXUX 1J25A 4M6WB 4XSHA 5CTJA 1QP0A 5EXDA 4DMHA 2ECKA 2GDJA 1YB4A 4LRYA 4N0PA 4AT1A 4EO7A 4FFOA 2H1RA 3IP8A 5B4UA 4K0KB 2W2LD 3LHKA 3EMKA 3IR5A 4UUPA 1Q7CA 3HI4A 3Q5GA 2C5GA 4FD2A 1AKEA 4JENA 5LA6F 4UPEA 4EYEA 3PNQA 3E9NA 2FSPA 2WIBA 3HY3A 2JH9A 2D1TA 1KGDA 3F3SA 1T3TA 2WU8A 3HYNA 3DF9A 5CYGA 4BWGA 5HTOA 3AW8A 3OKAA 3BGOS 4Q1FA 3T1QA 4V1CA 1OI4A 2WPDD 1YK1A 4A0GA 2W2KB 4EYGA 2Z2JA 3HP1A 1HLDA 4LRWA 1P4HA 4KODA 1O0BA 2H2WA 3CLSD 1K4MA 5IAAA 3RSLA 1KAGA 4ZI7B 1DXHA 3L01A 4NFYA 1LRLA 5DI3A 3WYNA 1IEWA 5CGZA 1A4UA 3UJHA 5JBNA 2GN6A 4R98A 2AD5A 3JYOA 2DBVO 3UAVA 4DN6A 3RWBA 2HMTA 2PBLA 1HDRA 4E14A 1DCKA 1VM6A 1CUBA 1E4EB 1H9AA 2ZWVA 1N25A 3AOEA 4FDVA 2DHDA 1T2VA 4ZDKA 5CDHA 3AV0B 1M0SA 4IKPA 4GM1A 3RWOA 1DIHA 3MTDA 1J8MF 3E81A 1LSUA 2VP2A 3EGCA 2JK0A 3TZBA 2F48A 3D81A 3EVEA 2OBYA 1BS2A 3QW4B 5CYOA 4EGCB 2JDIA 2R7NA 2P27A 2OXFA 3VSEA 3JWGA 4JMPA 4L9RA 3KHKA 1JEOA 3GMSA 2FZGA 5ICGA 3GW8A 3IE1A 1K8RA 2PVSA 2Z0MA 3FJ1A 2I65A 3LX4A 4R05A 4RUKA 2CXTA 1FDTA 3MPOA 5EHNA 4PZEA 3ZZ1A 3NH6A 1X86B 1IRIA 1ZGJA 4Q3BA 1RQ7A 3GA0A 3LBFA 1WB6A 2NZVG 1AXRA 3ADPA 4XJXA 5CHYA 5HG0A 3MG9A 3TVDA 3OM9A 4DWWA 2QT0A 3CUWA 1QBGA 4KDRA 4MSUA 1PJTA 1EJ6A 5TARA 2GN0A 3WDKA 1P4AA 3W6PA 3HGQA 4AMYA 4YRMA 4ZO4A 1OJLA 4PU0A 5ARBA 1QFMA 3TL6A 1Y82A 1NT4A 1YD7A 1YNSA 2FMXA 4I9UA 3UHJA 3W5HA 5I4IA 3GLGB 3FCOA 1JHZA 4LOAA 1EI9A 4XJTA 4OXIA 1P1IA 2EFJA 3X43A 2DETA 3D4OA 4I8DA 4BFVA 4M53A 4PO1A 4UCQA 4JBLA 4KQ2A 4TUYF 5C9ZA 1OPXA 2WT8A 3L6CA 3MJEA 3BREA 3REOA 2ATCA 3E3LA 4Q3LA 1UBSB 4UAGA 3E7PA 4O4LB 1U3VA 1W52X 2R8EA 4EFKA 2DHRA 3EA0A 3KEFA 4ITVA 4A6XA 3WIBA 4NICA 3GJZA 2HFJA 1L9KA 3B1JA 4RPIA 3D4IA 3FSEA 4ZXPA 4A8TA 4AFNA 3WICA 3NT4A 1CIJA 1EK5A 1PJAA 3KVVA 3KXLA 3ORQA 4RLSA 1O5OA 1XQ9A 2VRBA 2ZI5A 4K9LA 6PFKA 3CS3A 4JP8A 1RW4A 4ALJA 1DKNA 2QTWB 4BJ3A 4EJMA 4OP3A 3PXGA 5AP9A 2IUEA 5LQDA 2A3RA 1LBQA 1GRVA 2NU9A 3KVRA 4WZAA 1E2KA 4PLGA 1RBYA 4ODIA 1C8LA 4B5LA 5K8CA 1EM8B 2NVWA 2H1CA 2HL6A 1ZIPA 2VLBA 3B6JA 3OZSA 1L7OA 1YVRA 4RMIA 1DARA 1HFWA 2P2ZA 3HYTA 2QRVB 5FBQB 1GUZA 1BVHA 1E4VA 2AYZA 3OESA 4LQLA 1SVOA 3KU1A 4AN4A 1M34E 2YL2A 4PSKA 2BJWA 4OHOA 1H65A 3Q3IA 4FZJA 3MWGA 2XUPA 4UAVA 4F3TA 4IGFA 4YREA 4UPVA 4BMPB 5J2TB 3ER9A 1TF2A 1IC6A 1I2AA 3USES 4GYKA 4JDPA 5KTTA 4XDHA 1EJBA 1O1YA 1FSFA 4CMJA 5KWIA 4HXGA 4LOJA 3ZHQA 2HJVA 3F5MA 4U7WA 4ZCMA 3GDHA 5CVEA 2I4MA 2FSIA 3HKBB 4MJLA 3VR6H 3D7LA 4B5KA 4TN5A 3I2JA 3AG5A 3KBOA 1VHJA 3N74A 4K86A 3T06B 4A2CA 1U5AA 3PC4A 3ZJ4A 2OCXA 3ORSA 2PFKA 3TTXA 2IOQA 3C7KA 3QVGB 4BIIA 3JZDA 5IBRA 1F1BA 1X7GA 1PG0A 1PW5A 4EG0A 5KX5A 1L4YA 1JV2B 4C7KA 4MI1A 3UB2A 1WCWA 2PX0A 5IEBA 4CQNA 3V2IA 5K6AA 3HJFA 1YVUA 4DCNA 4XWKA 5MF6A 1JXAA 3JYQA 1NY6A 3LG2A 2VNAA 3B7WA 1OLSB 3QF4B 2C1EA 3LKDA 4MQ5A 4YFYA 1SHUX 2HB6A 3KB6A 2ZBGA 2NVUA 1CKEA 4NBTA 4RADA 5IVPA 5EWMB 1OAOA 3KT0A 2IXBA 1ELOA 4DBLE 1KVSA 1E5XA 4KNVA 1U9IC 1E32A 2BR3A 1TYDE 3BRWD 2MR6A 3SFTA 3E8MA 3QUAA 4KGXA 4TWJA 5H81A 2J33A 1G8PA 3EDYA 4YONB 2XQIA 2RHGB 3L1KA 3NATA 3D2BA 1II9A 1U0GA 3H6HA 2L82A 2C07A 3LP8A 4RJKA 3BGSA 4PBSA 4DGSA 3CSDA 3OKFA 1RPJA 2ZRNA 3CPJB 1YS1X 1CSEE 2BTOA 2F9LA 2YVQA 3A6KA 2D0PB 3ZK9A 3WIUA 4CHGA 4EL0A 1P7CA 3HBNA 4MMYB 3RD5A 1PJQA 4FN4A 1C8VB 3V1UA 1W36C 1Q1NA 3P4XA 2GZ3A 1X1TA 2A94A 2JLWA 2KQUA 5H59A 3WGZA 4E94A 2IOHA 2NU6B 3TO5A 3GN1A 1QJCA 2VUUA 3S6JA 2B4YA 5SV2A 3H5LA 4UBKA 1YZNA 1LU9A 4MWTA 3GOHA 1L7XA 2HWWA 3CLKA 4Q3EA 1L7QA 1KEEA 2P90A 2P9YA 5I9SA 4ARUA 3HN7A 1LPMA 2CEKA 3BOSA 1UH5A 3MINA 4ZZ3A 5JISA 2QWXA 2OGUA 1PFYA 4O29A 2FR8C 3LT1A 3NIGB 2IPLA 4TV8A 1BDHA 3NHZA 1NJ1A 2WIJA 1T4CA 5AVOA 3AX6A 5A71A 1WABA 4EG3A 4BX9A 4LPSA 1J56A 2O52A 2YV5A 3AW9A 3AERA 2IUUA 1ENZA 3T7AA 3T3NA 2PQ0A 2VLIA 3G5AA 1QFSA 2GAFA 1SQSA 1ULHA 4LDAA 4PZUA 3INYA 2NT3A 4ECEA 1JVSA 2P3SA 2DWCA 3A6PC 1K8XB 3KOOA 3TTWA 3L0YA 1CZUA 3HZHA 5AJYA 1P1RA 3JASB 3G3EA 1NWHA 2OBFA 1NVTA 4M1QA 4D6YA 2QUZA 1NYLA 1M6VB 2JD2A 1EFAA 2WD7B 3WKCA 4M55A 1FQJA 3FMOB 2JVJA 3X3HA 2X5NA 1AY0A 1C14A 2P11A 2FPLA 3AINA 4X94A 2HO5A 2DWPA 2V1XA 3V33A 1E3TA 4C6SA 1ZINA 5AUPB 4JLBA 3M4YA 4DRXB 1XLTA 4D79A 2XZOA 1QVAA 3KP1A 2C5LA 3MQ4A 4KPUA 1V4NA 5JPDA 5F3WB 4PCVA 1YA4A 1GNSA 5AVRA 2BFBB 5A4AA 1WV0A 1T9GR 3DH0A 4O2AA 3USZA 3FG9A 2FETA 1YIAA 2O3TA 1L5WA 5F2OA 2BH2A 5CBKA 3LUJA 4YP1A 2AFVA 1Y9DA 4OQEA 5K45A 1QCCA 2PGXA 1MKYA 1O95A 3UCEA 4BRZA 3QLUA 2NSDA 1AK9A 3OZBA 1FDRA 2FHSA 3IVXA 4GOMD 4IDQA 3UICA 3W8EA 4C4AA 5EGNA 4DBLC 4ZAGA 2GQ0A 5BR4A 1E2MA 1R9JA 1XALA 2YXLA 3I39X 2VZ9A 3UPUA 4G01B 4TQ9A 1B0ZA 4YQFA 1D2EA 3H65A 3DGFC 2IW3A 5J58A 4P84A 5AVJA 4EUFA 1UFVA 3K4QA 2YZGA 3ECAA 2IUYA 3U49A 5DT9A 4DJTA 3B2NA 2R7MA 5JVDF 5E6RA 3P2MA 4MB2A 5ERGB 5FD8A 1KEKA 3ZWXA 1MRNA 3MA0A 3ROMA 5DK4A 1UBKS 5ALGA 2NSLA 4MS3B 2XTJA 1UWCA 1FJGB 3L7AA 2C95A 2VP6A 4KGDA 4CM9A 1YSCA 1LLUA 2DLDA 4NJOA 4O4JF 1RAGA 1F60A 1EFDN 3FLBA 1EE9A 2OLEA 3HSYA 4HAUA 3AG6A 4U2CA 4Y2XA 3VU1A 3SQLA 3LCJA 4IR7A 4DCOA 3HBJA 5CH8A 3ZBPA 3W7AA 4JCOA 5K0CA 4MA0A 3LQ1A 3CCCA 3Q5EA 3NIBA 4IFBA 5DNEA 1SXJE 1TAGA 3K0EA 1KETA 4CKXA 1D2GA 4XPIB 2HHAA 2UYGA 4FOSA 2WSBA 4EF4A 2BFEB 4TN1A 2G4VA 3BAZA 1ECJA 2X7JA 3CLTD 5E9AA 3W6UA 3A1FA 1GZ4A 2W2PA 1KE2A 4DADA 3QX7A 1UQUA 4NU8X 5IJWA 5K0GA 2B1JA 3ZHUA 3C85A 3JVUA 1ULTA 1A96A 4B7CA 2HXYA 3FSGA 2I2BA 4XOIA 4UQPA 3VJKA 4DV1B 1USGA 4DA4A 1AKVA 3BXGA 5J5AA 3ZI0A 4EG5A 2AT1A 2IEDA 3CU5A 1ZD1A 4MPJA 4IOJA 5IK2A 5HW0A 2RGCA 1Q0ZA 2WMNB 3OX3A 2NO0A 2WM3A 3E2PA 3RRNA 4FFRA 4G07A 3TLZA 4WZBE 3KZMA 1VG9B 4PPYA 4Q02A 1F14A 4PSAA 5CAEB 3DE2X 2WD9A 1DDGA 4Y0NA 5CFLA 4HNAB 3SIRA 3W79A 4TT8A 4B8YA 2GN1A 4EW3A 3IOMA 3RK4A 1U2SA 3QX8A 1Y8CA 1W88A 4RYDA 3QBEA 1O89A 4AK9A 3OQVA 5KOJB 5CG1A 2FPUA 1FB5A 5FYDA 3D7KA 3GY0A 1NULA 1EVJA 3FBWA 3OWOA 2POCA 4M0FA 1ZCZA 4LK2A 2G0TA 2RIPA 4E6EA 5CYPA 3DPUA 1XB2A 3M5PA 4FBLA 4MAAA 4ZANA 3RS8A 3V80A 3EWSA 3E8SA 1VMKA 5B36A 2D0IA 2AR7A 1TD1A 2WAAA 1T6ZA 3D0OA 4DLZA 3EBOA 4BFZA 1T5DX 2JRLA 2OV4A 4IRUB 4JI6B 1NRJB 3GLHA 3KR2A 4ZQGA 2R3SA 3CX7A 2OWDA 2V6BA 3QEJA 4Q7KA 4RK4A 3A2NA 2R8PA 4QOHA 5FWXA 3WZ2A 2FMFA 2D5AA 3AKDA 2VRCD 3KWFA 4Z7NB 3WLOA 3H2ZA 1T9KA 5FBKA 5AXCA 3FGNA 1FY2A 4G0WA 3WAJA 3ZJVA 3L4EA 4WXEA 4F5DA 3WNCA 1RXIA 1F8XA 4XUEA 5LMCA 1UBCA 4I08A 3SGLA 3BB3A 5FT9A 1OU4A 2B7LA 2QQFA 2AZ4A 2CB0A 4PTYA 3EASA 2JC3A 3N9IA 5AUNB 4YQYA 3GLIB 2FP4A 4RJJA 1A76A 1D4ZA 1K97A 5MHTA 2NVOA 1PJBA 4OH1A 3P9CA 3VPFA 3BMNB 1SA0A 5BMOA 4KUGA 4U02A 3LECA 5LJLA 5A6VA 2WUVA 4ND3A 4GVXA 3WFZA 4QPDA 1XJ0A 3Q9SA 2MINA 2XGGA 4X1KB 5D85A 2CFSA 3PUIA 1RQNA 1X7WA 1D2AA 2R9VA 3NBAA 3PNPA 2GAJA 4A8PA 1SXJC 1C1YA 4MGZR 1F0NA 3JD4A 3HYLA 1GLVA 1TQ2A 4EJFA 4ENUA 4LHXA 1OBVA 2JG3A 4JA2A 1N7GA 4MX8A 1Q1BA 4ZEWA 2G09A 2ZSUA 1ZVKA 2PRZA 3OJWA 1DV2A 3N5CA 4NENA 4AECA 4KGVA 1JLSA 5J4VA 4D96A 1XHLA 2ZUEA 3PI6A 3SHOA 2AK2A 4WTOA 1MTZA 3FYSA 2FWMX 1V5GA 4NMXB 4A8HA 3TMAA 4CL3A 1ID8A 1SEPA 3H1BA 2BBSA 4LRTB 4M3NA 4B6FA 5ADVA 3TCNA 4JR1A 1FTQA 2EW1A 2NTNA 3JD2A 1VE6A 3V42A 3NIFB 3PWZA 1KOFA 4ZYYA 3HB9A 1RBMA 2CUKA 3L7IA 3N86A 5C8YA 5AESA 3PVZA 4FDAA 1WY7A 3HWRA 2MMCA 4G23A 4RGVA 1VB3A 1R0KA 4ZI3A 1TI7A 1KBOA 1ZBDA 2EFGA 3PD0A 2YV3A 5I3ZA 4MB6A 5J63A 2AZXA 1CYEA 4YRAA 4NOMA 3ORFA 3G82C 5GMOA 3SZOA 3A1NA 1QIJA 3S44A 2HJRA 1Q3KA 5IDQA 4BCBA 2D0OB 4C0WA 2PUAA 1YT5A 2XB2A 3N8HA 3DE0X 1UMBB 1F5NA 2QYTA 1JJIA 2W4QA 3F6SA 1WZIA 2PJRA 2CCJA 1NF2A 3N2KB 1R0LA 4I6GA 2HK9A 1E63A 2WHPB 1PTJC 3MTJA 2X0KA 4D81A 1DSSG 4DC1A 5HGJA 2GZRA 4MQLA 1JG3A 3LOUA 1UC4B 2Z4SA 4EBBA 3O9VA 1JG1A 4INJA 4QT4A 1DDOA 4RZXA 4ZAZA 1LBHA 1E3DA 5FJJA 3VC3A 2H4WA 3C14C 4R01A 1CRWG 1ONSA 4QQNA 3MT8A 4ZT4A 5BOSB 3B1FA 4BX2A 1CB0A 1E60A 2A92A 1UWVA 3M49A 4HBGA 3LQRA 1ZD4A 4QUAA 1X7XA 4FN5A 1FOEB 1Y4UA 1A71A 1T9GS 4FIDA 4LEIA 3KQUA 2PWYA 1OZAA 3GELA 2MSKA 2O8VA 2NVBA 4CTJA 3PFGA 5I7HA 1EB8A 1DWOA 1VCOA 4X45A 1O94D 2D1QA 1PZMA 3HVIA 4YWJA 2Y2UA 1UOPA 4MW2A 3Q3VA 3IEUA 3ONEA 4QIHA 3QWFA 4CUJA 1KAOA 4EYOA 3PFBA 3FDZB 4HDKA 3VVBA 1JLHA 1JQKA 1P4RA 1TZMA 3DEFA 1APBA 2HJSA 1DBVO 3DMTA 2BSAA 1T1SA 3AIMA 4CTKA 2P9EA 8ATCA 1XNHA 1RE1A 4WY8A 1FZQA 5CDYA 3E5NA 5CPBA 2Y05A 2BRUC 2QM8A 4UULA 2CLMB 1Z63A 3K96A 4B3MB 1THZA 4HDAA 5KWEA 2EWWA 4K26A 1IXRC 2IYQA 4ILKA 5JQGA 3MBOA 1BFUA 4XFJA 2ZQYA 3CVOA 3ER8A 2Q6OA 2IOYA 3OCUA 4BCDA 1BXKA 2GA8A 4LQCA 2DKNA 3QEMA 3RUDA 2IBTA 5CT5A 1BYIA 1QYRA 3HFRA 4DR2B 5JJ5A 2ZTLA 3WB1A 2Q5EA 1DAKA 2CDAA 2Z83A 5CLHA 5EJGA 1K5PA 1CUIA 2QUBA 3FMGA 3QJ5A 3NFYA 4PRYA 2XE7A 4IBOA 2XZLA 1DQRA 3BK2A 4H2DA 4RY0A 3KQOA 2BM9A 3W5BA 3UJNA 1W6UA 2GXAA 2DSNA 4O0LA 3O4JA 3TW6A 3I9V1 2P4HX 2Q7OE 4KNYA 1I7LA 1P91A 2DULA 3BDAA 5A5FA 1PLKA 3P5BA 1KPGA 4ND8B 4YT2A 3D5TA 3G89A 1UPTA 1S2GA 3UWPA 3ONVA 1M1YA 4EX6A 1HE1C 5DXJA 2AQHA 3C4QA 3VU8A 2H0RA 2VJLA 1YZ3A 5AJUA 1TNDA 6REQB 1Y5MA 3UC5A 1NF8A 2JGFA 1FQWA 2IHKA 4B7UA 3SDBA 5BXYA 1ZISA 1PP4A 1N3IA 1KRHA 4S1TA 5CTAA 4PXYA 4LNUB 1VXRA 3U13A 3VPSA 1N1GA 4IEEA 5C51B 1KR5A 4AY2A 1V3TA 3ABZA 3C8ZA 4BZZA 5AKIA 1KYZA 1RHRA 3QFCA 1DXYA 3DMHA 3IBTA 3L7MA 3PNVA 4NJMB 2ODAA 1MV5A 2JI6A 3D0KA 2I6QA 3SF8A 4ARZA 3U7FB 3FKSA 2V0GA 1QIFA 1FFXB 3TI9A 1E62A 4NV3A 3V48A 1O5TA 4GR5A 2XNKA 2GN4A 1ZH6A 1GPDG 2VSFA 3A6JA 2R5WA 3KYDA 5DOVA 5AQEA 5I4CA 1HZJA 3NAZA 4XWWA 4PVCA 3ZWDA 1GTRA 4F5EA 1RXWA 3LT2A 5EC8A 4C7MA 4E13A 5TQ0A 2NACA 2QRGA 4TVBA 5CNJA 1UBOS 5DHAA 2C4TA 2JFHA 4FEYA 1D5CA 2QYHA 4MR9B 1ZCAA 2J3HA 4HNGA 3ZHTA 3BRQA 4KLNA 2IYOA 1LF0A 3JZMA 4R8RA 2ETXA 3E7WA 2B6HA 2RKOA 2E4UA 4I14A 4TRJA 3W3AD 1G9XA 1D3AA 2YY7A 3T61A 5F21A 2WWYA 4V0MA 3F1LA 3CX6A 3M1YA 3BMCB 3Q6IA 5DEOA 4NH4A 4B34A 2Y1LA 4M1SA 3V4PB 3MS7A 2V8BA 4IRMA 3I9NA 2D1FA 3G8CA 1ZJZA 3U7IA 3R20A 1N3LA 1UDXA 3LF2A 3RVNA 4D4LA 2IX3A 1P7VA 4DHWA 1KNXA 1L5KA 1VGQA 4DUGD 4TV9F 4F2PA 4DY4A 1PGNA 1CUYA 3DDWA 3KZNA 2G5TA 4UHBA 3BEOA 3CWCA 3R6DA 2PT7A 4J0IA 4W8HA 5BRAA 4YAOA 5DZSA 3OHMA 2E3JA 5BWLA 1UT6A 2W70A 3GFTA 4WESA 1MIOA 4HUQA 1ONPA 3M3HA 1BCSA 1O4VA 2PA3A 3DZKA 1QV6A 1RKBA 2WTMA 2X9GA 1UBFA 5IZCC 4ZDWA 5LPNA 1G7CA 4CG0A 5MGNA 2ZYSA 4JMLA 4WHMA 5CUQA 5HSGA 3TX6A 2OD7A 3PQEA 2GNPA 2E2WA 3E4CA 3LQQA 4OSEA 1JLKA 1JLLB 1RQXA 3AILA 3ZS9A 4MGIR 2F1HA 1JRLA 3GMDA 5LP6A 4CCYB 3DPSA 2P2LA 3NZEA 2G1UA 1NPTO 1CY7A 4L7VA 2I6GA 3ZJUA 1GILA 4YJHB 2A1UB 3G5MA 5EXPA 3Q1LA 4ZZIA 4MVXA 3VO1A 2JJ8A 1DJQA 2H3HA 3B82A 4CKBA 3ND8A 1JDTA 5FUXA 1EWRA 3G1UA 2GB4A 3B20A 3C0KA 2C42A 1EFTA 3ZNNA 5C1BA 3GLGE 3GGJA 1B0UA 2C4WA 2HWXA 3KS9A 4OXKA 3CN9A 1C0LA 2PMDA 4JLPA 4S1OA 4R69A 3SM9A 1QGOA 2IYWA 5J3JA 1VHLA 1TCAA 2VQSA 4UNSA 5EWJA 1JSZA 3GEBA 2EIXA 4EG8A 1JKXA 4ZCIA 1FFBA 2EYUA 2PMKA 2X76A 1EYZA 2QPTA 2ZIFA 4I4TB 3V46A 3WWOA 2PSJA 1ZIXA 3RUEA 1KQ3A 3IVGA 1MJGM 2WKRA 4E4RA 4Z4FA 2CY0A 1C1HA 1YMVA 1UPXA 3RGGA 2MTBA 4PSCA 4D4IA 1SIUA 3PXAA 1DUSA 1M1ZA 1PWZA 1QS0B 4YALA 2O2SA 3WDMA 2EKLA 2DLNA 3SR0A 1KMIY 1L8XA 4HDRA 4P93A 3ITEA 4RTPA 4XWOA 5BSHA 4OSPA 3BHIA 3DBHA 3W8NA 4B3BA 1E61A 3L8HA 1CUSA 4CNBA 1OA1A 3JZAA 2NUTB 2PJDA 3QFSA 3A1VA 1BHSA 3F4BA 3LY9A 2VT6A 3QFHA 4G24A 4L6CA 4Y1RB 5LQSA 1OZFA 3DLPX 3USCS 2ZR0A 3LWDA 4PXSA 2SKCA 5FR1A 2HA6A 2P2GA 4PYKA 5DM70 3FNRA 4F4CA 5HBGA 2BFAA 3AR3A 3A1EA 4FEAA 1P2GA 2IIVA 2QIPA 2IT1A 1PZEA 3C16C 1II8A 3ITDA 3LPAA 2EZ8A 3OCZA 5PNTA 4E5SA 4LQ4A 1Z9BA 4OQZA 4CODB 2J3KA 3TLKA 3KOWA 2WICA 1ISGA 1SXHA 2ORED 2VP3A 3MGKA 4TS3A 5DX0A 4W5TA 1PVOA 2RHWA 4FOLA 2ZAIA 4FFPA 4KMMA 1W19A 1S3SA 2WJZB 1Z73A 5L51A 1YZGA 2YZ2A 4FMCB 1XFAA 4I1PA 2IY9A 2H18A 2JS7A 3F6CA 2CL6X 5HXAA 1ORVA 2B98A 1WEHA 2WIAA 2GKGA 1QGED 4V3BA 3K1JA 1SN7A 1TVMA 3TL3A 2X8LA 1XVLA 3RUAA 1KDYA 4R1PA 4Q4JA 4YQZA 5LUBA 1ZGGA 5AM1A 4FJ1A 4NBKA 3TRKA 2ZJ1A 1CUWA 1JX6A 4ZYVA 3P0JA 5FFNA 4MKGA 5FTNA 3CNLA 1FU4A 3ABSB 4RIGA 4UOQA 4D3SA 1F0YA 1GZ6A 1IZZA 2Q2OA 1VGRA 2ZE6A 4ZOQI 1F0KA 1F12A 3AHDA 3BJEA 4O3FA 2PRYA 4LRQA 3KAKA 4UZEA 3SVLA 4E3ZA 4K6GA 1GPMA 4UOEA 5K4GA 4ADSG 4DSNA 3FNIA 4EUKA 1HUQA 4XD7A 1T5TA 5JNVA 3R7BA 1KVTA 3N39C 1TZJA 4H17A 4YAJA 3EH1A 4BQFA 3I9LA 4G85A 4WBXC 3U4QA 2B2CA 1KHHA 4MVJF 4K7JA 3RSQA 3SBEA 3G85A 1UZAA 3CR7A 1JT2A 4CTOA 1GN9A 4TTSA 1TQ8A 4Q1AA 5L3RA 3K8YA 3L7CA 3A70A 4L5AA 1HSOA 2EATA 2ZYAA 2ZS8A 4KEAA 1ZHFA 1WF3A 1WNTA 1M75A 1OI3A 4IX9A 4QTUB 5FDFA 4HAVA 1NNLA 3BWYA 3I01A 1G291 2JARA 1MC4A 4F56A 1CIVA 4BKPA 3RU7A 1K63A 4MVJE 4BBAA 1ND6A 1H42A 5G0WA 2RHHA 4QYIA 1H0HA 2QLFA 3PZRA 3IDAA 3QOWA 1P19A 3EZGA 4DIUA 2RDMA 5ICCA 1BC5A 1WAMA 2A0XA 1XNRB 1YK0A 3ZDCA 3NVKI 5LBIA 1YS9A 4QM7A 5B1YA 1KS2A 2QBYB 5EIBD 1RI5A 1XJQA 4UBOA 1FJ2A 1QFJA 4FS8A 5DI9A 1GGEA 1RCFA 1AH2A 3OZCA 4L2IA 2CXRA 4ZVLA 5GIPE 3IE2A 4BRSA 3QE2A 2FH5B 3W9UA 4Y6GB 1UL1X 4EJ0A 4J29A 2IQ5A 4NIMA 1YBHA 4YJ2F 4YLEA 1KI6A 4P8RA 2JIOA 2WOJA 1AF4A 4HEQA 2BM1A 2ORYA 4W4TA 3V4LA 1KFKB 4AZTA 3JVVA 3QXHA 4EB6A 1GSIA 1NMQA 4EW1A 4UU1A 4KVZA 3QV2A 1QF6A 1QYXA 2BONA 3B3JA 3E1KA 3BK1A 1U8TA 1CVRA 2WSSD 3HCFA 2E4WA 2I66A 4KH1A 1KVRA 4P5DA 1TGYA 3NHAA 4M22A 1SKAA 4DSAA 4IIDA 4H7PA 5TMPA 4CM3A 4MRMB 4KPEC 1OB5A 2ZDHA 1K2WA 2PUVA 3FN4A 1R9MA 2OHXA 2O1SA 3GQBA 4MI3A 4IOLA 2FN7A 4P3XA 4BKMA 3GYGA 1NJ6A 4OO3A 3K30A 3UHAA 4CM5A 2XVYA 5TC4A 5DTIA 2JGRA 2AFIB 4HYTA 4DRYA 1EIWA 4Z5XA 1RABA 4CLHA 2PTGA 3QPDA 1JNYA 3KRTA 2A67A 4S1VA 3VR6D 3L8GA 3NBQA 4DWJA 4EH1A 4DJEC 4GPD1 1J0AA 4OHFA 2JVIA 4PAOA 1BJTA 2JFVA 4IHJB 3GLTA 1RMYA 3V6LA 1E0DA 4JBGA 4C4SA 1NJSA 2QP9X 3W77A 4C4PA 1L5HA 4LHVA 3VHLB 4ALIA 1JJFA 1BFKA 5CW1A 1E4YA 3KHUA 2WFLA 3EVNA 3TLXA 3V8NA 3V1MA 1G20B 1BD3A 3FMFA 3QBTA 4WVLA 2D7CA 2RGYA 5ESXA 4RTOA 5JS8A 3IBFA 3WQQA 5IRCD 5JW6A 1DBQA 5EMHA 1G3IA 4BWFB 3KVYA 4XW2A 1NWCA 1RBZA 2H07A 4F9GA 1N32B 3P52A 4YRPA 3HY6A 2XYVA 4MKZA 2JA2A 5ILQA 1YZVA 3ZWVA 4N6NA 5L53A 1X87A 3FCSB 3AVXA 4B3TB 2HMSA 1QSGA 1F4LA 2FPGA 4QWWA 1G9SA 1L7MA 4RD2A 2WIDA 2WYUA 3CONA 3B8HA 4LWZA 2HADA 3OPVA 4AF6A 4CIYA 5ENVA 2PKEA 3RRJA 5JCZA 4G84A 5A4JA 3RJMA 1IQ0A 1C4KA 4LJSA 1YGPA 1LQ2A 1SXJD 1EWYA 1YUNA 1XL1A 2P0YA 4NR0A 5JFOA 3AHHA 3SJAA 4QARA 1XA3A 4YCMA 3K20A 3VR2D 3PWTA 2R6ZA 5FUYA 2P9FA 1L7AA 2JAHA 3DL7A 4D5EA 2FRDA 2QX6A 4CG1A 4IIVA 4R2LA 4DM3A 4CKWB 3T4EA 1UBJS 3OF5A 4OYYA 3VR5H 5EIEA 2ATIA 2OCKA 4XD2A 4ZYZA 1XQYA 3IUSA 2ZRLA 4YROA 1FJHA 5H8WA 3A1SA 3OIVA 4HZGA 2BEVB 2Z9CA 5CGQB 3TW8B 1XZBA 3KKNA 4G0YA 1TJ4A 3THXA 3K9HA 4M0UA 3N2GB 1GVNB 4N5MA 4PBTA 5FBRB 1N5DA 5ULLA 1NDUA 2V03A 1OLUA 3KTOA 3PQ5A 4MKRA 4EDHA 1EUZA 3HJCA 3SHVA 1JKJA 1RBQA 2XX3A 3BS4A 4ZCRA 5A2QA 5HK9A 5JY6A 5CH3A 1V9LA 5F1OA 2AOVA 3G7SA 1DS6A 1ZSVA 4NVRA 4MI9A 5AM4A 3S8EA 2H06A 3ZCUA 3HBFA 1IMJA 1T3LA 3R7WA 8MHTA 5BQ3A 2FSVA 1S4QA 2AN1A 3RJ9A 2WKWA 1N36B 4P7FA 3PCTA 3PNSA 3Q88A 4HF7A 4P4TA 4LSMA 4DCPA 1TJNA 3OC0A 3BF8A 2C04A 4M9RA 5CK4A 4B7ZA 4IIJB 3KCQA 1VA5A 3LMKA 3PRYA 3FX2A 3MWFA 4E03A 4DYDA 1ACMA 1PL0A 2WHRA 4ZOCA 5JWRA 1QRSA 4RA9B 1GNVA 1GZVA 2BTQA 2PRIA 2I7TA 1ZKDA 2XKBA 3OVMA 4OBWA 3ZV4A 3WHPA 3OJFA 3R74A 5B12A 2YOGA 1TYEB 5LQJA 4B6SA 4CQMD 4G4SP 1VSUA 2A5LA 2PWPA 1IOLA 5BSGA 5BUQA 1VL1A 1VE9A 5KPJA 2OUKA 5COQA 1SXPA 3PEVA 3S2GA 1U1GA 1GEGA 2FFQA 4QPNA 3B1YA 3KR1A 4EENA 3DEJA 3RRZA 4R8VA 1NOIA 1VKOA 1RMQA 3N3AC 5DFAA 3ER6A 3FKQA 4XPZA 5FPHA 1BWRA 3KZOA 2E6UX 4RHXA 3M6IA 4EI8A 5IABA 5AWFC 1MT3A 2BE7A 1C30B 1N6KA 2JCVA 3AJAA 3C8UA 3E9RA 3K09A 3LPLA 4OB7A 5ALKA 3UOWA 2HIAA 2WJAA 1KR2A 1IUOA 3EGEA 5CCXA 2VBIA 2C99A 3RS7A 3C4JA 4QEZA 3ASUA 1UDCA 1A97A 3M6XA 5HKOA 4JXJA 2CSXA 3HJRA 1A7KA 2C4HA 2XCUA 5ESWA 2FJPA 4OI2A 4PYLA 1DZ3A 3GLVA 5DNDA 2XSZD 3WFJA 5C0OE 4UREA 3ZI7A 4YAUA 4RSRA 1INLA 5BV2P 5JCXA 4U1RA 3KOZA 2BKLA 3AEKA 2YUTA 1OGJA 1SO8A 3AUAA 4C6TB 4D8TA 3CLUC 2YX1A 1E4OA 3WNBA 2LIVA 3PLAE 2FPIB 5DN6A 4UNRA 2XGMA 3QFRA 2YXBA 2HLPA 1BE1A 2PLRA 3BA6A 1GUAA 5C81A 1H0RA 1PJ2A 3QVMA 4IDDA 3INRA 5LIRA 1RCTE 4K6OA 1TF7A 2GXQA 1N4AA 4XFKA 3T4XA 1UDAA 1W0JD 5KQRA 4U7DA 4Z2YA 1EU1A 3NP9A 3E61A 1YZFA 2GKOA 3KKQA 4RBNA 2HUNA 4BX0A 1HH4A 1P2SA 2OGSA 4G0XA 2PD3A 1YFZA 2GBLA 3C70A 4UATA 3R6WA 5CM8B 1MT0A 4GQAA 5BN3A 3UXMA 3GVHA 1DRKA 4K8OA 1KGSA 3PTAA 1OXBB 5DM0A 1OAOC 3OT1B 1QIKA 2AXQA 2XIQA 1SBHA 4PHGA 2F59A 5T41A 3T7DA 3RASA 3TXYA 1QP4A 1I3KA 3FNFA 3QPWA 5HFAA 3IELA 3QG5A 4JYAB 1QIIA 2YR0A 2NXWA 2PCJA 2V7WA 2YDXA 3AIIA 3FB1A 1Y1SA 2JF0A 3I6QA 3QE3A 4HWSA 2IZZA 1Q14A 4WCFC 3D7RA 4QGFA 4R51A 2HU5A 4BOYA 2HMYB 1TKRA 4Q6BA 1GFSA 1N5MA 3V7FA 2VJMA 4GGOA 5FOUA 4L6AA 3A4YA 2A78A 1A9ZA 3A32A 2OXRA 1IK4A 4K2HA 3THRA 1JEDA 3VOBA 2O3RA 2CLSA 3LT0A 2W8BA 2G3YA 5FRDA 2P9GA 3ANLA 3RSCA 1LKZA 3C5CA 3JTMA 2FWJA 4U9UA 3TR6A 1XAGA 5B3AA 3OPXA 3J81k 1SWWA 3ETLA 3EAFA 4S05A 3C3EA 1T9ZA 2W6JA 3HLTA 1MJNA 2I6FA 4G4SO 4LMAA 3G2NA 4PW0A 5AT1A 3RS9A 4F8EA 5FTKA 2PT9A 3MFYA 5EJMA 4XIYA 1JDVA 4MYHA 1NVBA 1ZOOA 3P27A 3DTNA 4G25A 5HKAA 2GPBA 1IWOA 4ZGBA 1TKBA 3REQA 2W98A 3GCXA 4DSOA 2BSXA 1FVOA 5KWVA 2QY9A 4WL0A 3VVMA 2FDCA 4UHKA 1CLUA 1PG2A 1G17A 2R25B 1QZUA 3H9CA 2BKEA 4WNAB 2M1XA 3U81A 2OFWA 4KUHA 4B7AA 4BWVA 1SIWA 5B7QA 3EZ6A 2FMKA 4NCAA 4P31A 3PB3A 5K20A 2I6TA 2IE8A 3KG2A 3BB1A 3COSA 1U2GA 2XWQA 1W9HA 2PO7A 4EFMA 2HX1A 3O82A 3C3DA 3EUAA 3K72B 3FDFA 4Q15A 1U4SA 1MJHA 1Y7TA 4D9CA 2XCOA 4YMTA 3CH6A 3FLMA 1Y1KE 4O63O 4YP9A 2Z56A 4LI3X 4R40A 4JI8B 4MWCA 5CB4A 3MK31 4FB5A 3M5DA 1IBKB 2E82A 3R09A 4GC9A 1VHWA 4IQFA 4E3WA 2NTYC 1G7TA 3K5WA 1A5SB 2ODWA 3HY4A 4MYUA 2BDTA 4A0SA 1R00A 1TYBE 5K05A 3LK6A 4ZCLA 1W85A 2IJGX 3E53A 1BE8A 5T6BA 4K6FA 3S29A 2W6PA 1XIVA 3UT5A 1WDLA 2X0JA 3IHLA 1RRGA 1BVRA 3JQQA 4PPGA 4LFCB 4E7OA 3D59A 1CT9A 3DBLB 3FA2A 4WXHA 3E23A 5HIIA 2GPJA 3B70A 3K9WA 3STXA 4F7DA 4H3VA 5BURA 1QDUA 1Y7LA 2BD0A 1QP7A 2VSXA 5BVHA 1R0WA 3Q9UA 4HUJA 1G0NA 1IB0A 3NHKA 4RQTA 3GLHE 3GZ4A 4LBWA 1O95C 3EXG1 1PL6A 2Y8EA 2WG0A 2IYVA 3JVDA 1FA9A 3BD8A 4EK9A 5LU9A 5EIAA 3DMNA 4D9NA 4BUCA 4FUQA 1KO7A 4L4SA 3WGYA 4DDTA 2Y3IA 1Z82A 3SD7A 3L0BA 4YHBA 3UVEA 3NIWA 3REFA 3R7NA 1IAVA 3PJRA 1DO0A 4FINA 1E99A 1U2DA 3P0EA 1AO0A 1BCRB 2FPMA 1V16A 2XEDA 3ZXYA 1TJPB 4ES6A 3L82B 3MERA 3CH7A 3OLZA 5CLGA 3PKZA 3Q0EA 3CZQA 2WR8A 4U39A 4U5QA 4J1QA 2XMDA 4HNHA 1YB5A 2WABA 1K6EA 4FFDA 1GYQA 1N0UA 1I3CA 1UZNA 2GEUA 4FNOA 3FPEA 3LBAA 2Q6LA 3P97A 1J24A 1F2TB 4KBGA 1CUUA 4D3DA 2QE7D 5E3HA 1SHKA 5AVZA 1KDRA 4TSKA 3COWA 5FTLA 1CXZA 4G5HA 4HAOA 1JFRA 4PR3A 2HK6A 1A4IA 1H1LB 4Q7JB 1P2UA 5EY5B 1UK6A 4GLJA 1TTHA 3A1WA 4C4XA 5G4KB 2YOHA 2JFYA 2PU5A 2O2EA 4L0CA 1JPVA 1G5HA 2CJYA 1X7DA 2YJ3A 1Z4NA 3HCCA 4M9XA 1O54A 1PWYE 4MDYA 5DM1A 1KZHA 3EFHA 4J4BA 1SXQA 3W1EA 3DOCA 1FX0A 4B84A 3BL5A 4QG3A 5L4SA 2V55B 2ZJ3A 4LTMA 4P4GA 1HI9A 2GJSA 4QNMA 4E09A 1RLMA 3OZXA 3WFIA 1NG9A 5J23A 5I4KA 1XX6A 2GPAA 1Z4IA 1PQYA 1AHHA 4KW7A 1T35A 5B30A 1RCUA 4AKHA 3Q9NA 3QU9A 2PRJA 5A4KA 1ITZA 1Q1AA 2C2HA 2LDBA 4ZAYA 2RH8A 3FPFA 2G82A 4GR4A 2JANA 3ETDA 3QI7A 3HXQA 5D01A 2R86A 3GCDA 1E2QA 2H52A 2PKQP 1EM6A 3FCUB 4J2OA 4TLMB 4XB2A 1LXCA 1NBOA 1YU6A 1P2FA 2D8AA 3W78A 3QEBZ 4MV8A 1WMBA 4WGFA 2QN6A 1I4LD 1P72A 1RYMA 4ND2A 4ZI7A 4BMNA 3MCZA 4FEEA 3AQIA 1M2OA 2ONJA 2HF8A 1Y9AA 1YHYA 1JAXA 2YVUA 3JPWA 4QDXA 1E92A 5K0BA 4O1MA 1EVYA 1NMEA 3HSSA 2XE4A 4G0ZA 3GI1A 1BVUA 2FZKA 3B7GA 1KRXA 1NUAA 2HA7A 3TINA 3U7HB 2TSYB 4KQWA 1GNRA 3ETCA 3QEOA 2ZIEA 3DM9B 2Y27A 3WZMA 2YINC 4MVYA 4G1VA 4BLWA 3E6AA 3PSHA 3N7AA 2LUOA 3JQ7B 5EQFA 3UCFA 2AYYA 4NH0A 4AJ9A 4GLBA 5A05A 1DEHA 1V5EA 3H87A 3E3OA 4I1RA 3P9ZA 4YAWA 3K9FC 1JQBA 1P0CA 1R3DA 1BHO1 1SUEA 1C4XA 3FGOA 3I2KA 3OIFA 3IAAA 1VPLA 3FB4A 2C83A 4TWZA 2Q0XA 3EIFA 1EIZA 3FFTA 4DMLA 3VKHA 4MUYA 2Q5OA 5CEEA 2ZE7A 2WP8J 5A1JA 2HBQA 3IVRA 1KWKA 3LTNC 1DDIA 1T10A 1XEFA 3W5SA 4F2WA 2HBRA 3IMEA 1ZGCA 3WWYA 2Y77A 4Y1FA 1ZH0A 5JV5A 1RWBA 2QTVB 1RXCA 2NLOA 3GDWA 1PT8A 2A88A 1E96A 1B1CA 4WLEA 1CJKC 2G5CA 4QNRA 3WMRA 2JPDA 4PEVA 1EGMB 2GLXA 1KPIA 1U99A 5A5DA 3L4SO 3O4RA 4YT5A 5H5JA 5TE9A 1A2OA 1CEXA 2C5AA 3LX6A 4ZQIA 2V7TA 3JWIA 3WK8A 2HO4A 4BS9A 2FSSA 2WZBA 4D9FA 2CGEA 3ND5A 3TOVA 2I2XB 3W7VA 2ZXUA 1TX4B 3HS3A 4AIIA 2R6R1 3DB1A 4LXTA 3ENNA 2YRFA 3TE7A 4KK3A 1EZ4A 4EHIA 3LXMA 4YRDA 3RHZA 4D0LB 1MW8X 4BMOB 3TPFA 4V03A 3GROA 1H2FA 4BGVA 5A2GA 2R5FA 3RO7A 2GXSA 4NAVA 5CBPB 4I0WB 1E1YA 1YI8A 2C4MA 3EGIA 3ZIAA 3VNRA 1A7UA 4JBYA 2B2XA 4TLDA 1D7AA 4QUHA 1RWPA 3MWEA 2V1UA 5BUCA 2EJTA 2GYYA 3QKSB 4U2KA 2C7GA 3K0AB 4ZOLF 3SAJA 4DJJA 3EGVA 5ADHA 1U7ZA 2QX8A 3HXTA 4Z86A 2NPOA 2Z3ZA 4D57A 4EPTA 3CQ9A 1F8UA 2HAEA 2P69A 3BDIA 4XQ0A 4U2GA 4UAJA 5FL7D 4JI3B 3KDAA 3O26A 3W0LB 1HM5A 2J3MA 3AK4A 4F96A 1C2YA 4EZIA 4PFSA 3UXYA 2PKQO 2FCRA 3KWJA 3A4NA 3KQWA 4J3FA 2VR1A 1W44A 4IIHA 3K6SB 2JAPA 3F4KA 4F84A 3OO1A 5C8XA 2VJNA 3NYWA 4HQNA 3WL4A 2GARA 3HO1A 4N0EA 1WCYA 2SNIE 1CERA 3R5SA 3QX3A 1B8UA 2FW8A 3ZGNA 3BTUA 1VIMA 2ZPAA 2FSFA 5J2TA 4LTNA 3SICE 4LIPD 2D4HA 3D4NA 4AG6A 2ZVPX 3HXOA 4RA6A 3GFOA 1NXQA 2UYQA 4HCJA 1HE5A 1K3FA 1TVKB 1O96B 5A62A 3AB3A 1AB6A 1UJ6A 3ESYA 1NUPA 3KTAB 1NVWQ 2OZLA 4RTLA 1B8PA 3ZZNA 3SJCA 4AJKA 3EW7A 4A8JC 3KOUA 2DBZA 1EP3B 3FYTA 4XIFA 2EYQA 4UVHA 1CTQA 1YB1A 2QYSA 1XTBA 1Z75A 3DZGA 3G9UA 2LCFA 3JWPA 1G3QA 1PEAA 5AW8A 1GP2A 1BW9B 3QVGA 5EZ5A 1JQEA 1AKRA 1YI1A 2G9QA 4OMFG 4IMIB 2IBSA 3KK0A 2R87A 3TJZA 1EWQA 4G0QA 2BFDA 2ZPUA 5AVUA 1U3FA 1UQTA 1WD7A 5DDIP 3SY8A 4M0EA 4BGIA 3H1PA 3ZDQA 4JJZA 2QQGA 1MQ9A 3TSWA 4ENPA 4ZPXA 2IDMA 2I62A 3HKDA 4I19A 1HA3A 5LQCA 3QF4A 1OLSA 4PX5A 4C30A 1N2JA 2W2QA 2YCBA 1V45E 3H5TA 3PVCA 4W5NA 4BV2A 3SEQA 3TQCA 3RTGA 3ZV6A 2I34A 3GCZA 1CEEA 5KHLB 4IUYA 4JLMA 4AU1A 4LTDA 3SQXA 1XOIA 2I7DA 4KMRA 4ISCA 1S96A 1OYVA 3D9QX 5P8WA 5C8ZA 3LGSA 1T5LA 2JW5A 1F4PA 4GECA 3DMGA 4D9HA 4WCVA 3D3EA 4CMGA 4A6DA 5FWAA 1OXKB 3CNNA 3QKRB 1FXSA 3FGPA 4YRBA 8GPBA 1L7DA 4OUDB 1A5BB 4J91A 2O8BB 1LSJA 1MGPA 1RKXA 2ZRHA 2EEZA 2VJQA 2X2PA 1EXVA 1ORRA 3DXFA 2FVYA 4RHTA 4QXMA 4B4OA 1V2GA 2EJVA 3FNGA 3W9BA 1KJIA 4AJPA 1JKMA 4PC3A 4S0ZA 5H3LA 1EUCA 1I1NA 1PUXA 1XTIA 4G67A 1ZSNA 5FOSA 2D2IA 2G71A 3ASVA 5ALTA 3CN7A 1XE3A 4ENWA 4RD0A 5EIOA 4G0OA 5JDCC 2IEYA 4INAA 4D1YA 5L7TA 1OC2A 3A3PA 3P9NA 3V97A 4EOGA 4MULA 3ILYA 1KIFA 1ZWLA 1A8HA 3BVPA 5A4DA 4MQEB 3G6WA 1UBUS 1C2TA 1GTMA 1X9HA 2FQYA 5LU8A 4OBXA 4DWVA 3ZZ0A 3ETGA 3LC2O 4C7OB 1ISFA 1GNTA 5DLYA 2ZRQA 3F78A 4NABA 1M2EA 2OCAA 2DY0A 4KO4S 4JQSA 4Q21A 4L5YA 1ZM4A 2PMFA 4UMVA 5HZGA 4R2MA 3NM4A 5KYNA 3WA7A 4EF6A 3IP7A 4D0SA 1QK5A 5JH7B 2CBGA 2EBHX 8LDHA 5E1DA 1J2EA 1IAQA 4X6XA 3RQSA 3ZUGA 5AJXA 4BB5A 1PNRA 3AKYA 1Q5PA 1IPEA 1LJUA 2Y1GA 4GU5A 4NCHA 4TUYB 4XDYA 4U8GA 1H5UA 1LUAA 4BDTA 2YTZA 3T9DA 2A9OA 3AC0A 4LKOA 3JASA 2H1FA 1ZVJA 1QOQB 3ROKA 4B6EA 2IH4A 1M6VA 3L0OA 1EVEA 1J8FA 1HRDA 1MF7A 3WR5A 3VJMA 1VIVA 5JMPA 2HSEA 1WMDA 3JYNA 4QBIA 3VHRA 1KEPA 1UFOA 1SUAA 2D5LA 2OZKA 2ZYIA 3N6XA 3R0JA 2O3UA 3IA7A 4OQQA 4YPOA 3BHNA 2C8VA 4HXYA 5BSRA 4MWEA 1X77A 2BFBA 3OZUA 3W6OA 1U5BB 3HXPA 3QVLA 4AZ3B 3WIEA 1IVNA 5FH9A 4XGRA 3ZWNA 1R5OA 2ZQZA 3CLUD 4FSXA 5JNUA 4KV9A 4EG7A 4UJ5A 4AP6A 1ESNA 3KL2A 1KI3A 3I5UA 3QPCA 3W5JA 4P0PB 2F1JA 1TECE 3HPRA 1NU6A 5JD3A 5KJEA 1VE7A 2DFVA 2IDKA 3AJRA 4QQ8A 2AFHB 4EY3A 1ZR2A 4A36A 2E0IA 5HPYB 2PVPA 5ALIA 1QBKC 5AKZA 4MQ6A 3U7QB 4GYYA 4HI0E 4DOMA 2HUPA 4NU0A 2GCEA 4L27A 5HZMA 2ZFUA 5DCWA 2YJGA 1QTNA 2FDXA 1I3OA 1DAGA 2BI7A 1LK0A 1W73A 1B6SA 1SKUA 2BGUA 4LV5B 4HH4A 1T13A 1UC5B 1XXHE 4ND1A 1HNWB 1JE0A 1SCAA 4Y0AA 5AKJA 4ZEOA 2IYXA 4C6HA 2J5KA 4ZTZB 1AA6A 1SZPA 4NOJA 4X24A 5KYGA 2VJDA 4OJQA 4DV6B 1JXQA 2O0HA 3CNQS 3VKVA 4LGVA 2GBGA 2VPYA 4BLTA 4EG6A 1EUQA 3LGXA 4R84A 1A04A 3IHWA 5I47A 1OFVA 5F4ZA 2CV1A 3U4GA 4XPIA 5J1SB 3I23A 4JSTA 4MZXA 1IY9A 1N2GA 4RIHA 2BFEA 1WCXA 3KZ1E 1OASA 2XZTA 3K1TA 2OFXA 5CB0A 3W1VA 1MXFA 2LW7A 4B82A 1SC3A 5C7LO 3LD9A 4C4ZA 2AI2A 4O0MA 3NM5A 5ITSA 1NVXQ 4KSBA 3T9EA 3EF0A 2IF0A 1DOAA 2ZIVB 4BRWA 1W4LA 5DPMA 1YR9A 1IHOA 3NH9A 3WMWA 1YQUA 4JJEA 2XWBF 3RIYA 1JU4A 1Z18A 2AUMA 2AX3A 2HQRA 3LBNA 1D2RA 1L9XA 4OTZA 4XWAA 1YVPA 4BZWA 1MEJA 1K6IA 1JEQB 4B80A 3PUHA 2W6NA 2HOQA 2V8OA 5CAEA 5B2EA 4XWYA 2A14A 1QF9A 2QX9A 3ILHA 1F20A 5H80A 1P77A 4R9UC 4AQDA 1OH6A 2Q4TA 4HVAA 2AKEA 1HBJA 3MZ0A 1IJKA 1QO0A 4EA8A 2GZSA 3LIPA 1K92A 2YRWA 1Z56C 1KEWA 4ZHQA 2G25A 4RWEA 4IVNA 3LKZA 3MN1A 4BVFA 5JMWA 2IYPA 1UODA 4H08A 3RVPA 3UK7A 3UW1A 2VEDA 4LDJA 5FXMA 1Z8DA 4HS4A 4F71A 3BL6A 3FBTA 4E6PA 1EBUA 1XVAA 4LXHA 3VYUB 5WRFA 2MR5A 2SICE 3FAKA 4Y9DA 1DTSA 5K6RA 2R8XA 3EBLA 3H2HA 1EDZA 5LYYA 4UTVA 1Z6GA 4MYSA 3O2SB 4WN9B 5DYYA 4H4DA 3WRWA 4KWTA 3ZNPA 1JMYA 3F8WA 3GRUA 5CFOA 3WGUA 1Q2UA 1NXTA 1V6CA 4YJ3F 3NBMA 4JHLA 1FP6A 3EQ2A 4F5WA 2Q5QA 1Z4JA 4Z8XA 1SUBA 4XCXA 2C0CA 2O07A 3A6LA 1LCIA 1GZSA 2QN9A 4Z9FA 2E4AA 3F5SA 3VI3B 3C1TA 1BYUA 1E5DA 1U8ZA 4F3YA 4C2TA 1NJ2A 4C7BA 1V8BA 4CV3A 1S2DA 5JR3A 2JCYA 4TMZA 5HKKA 2QY6A 4GOOD 4CIDA 3T0IA 3PHCA 2IIPA 2YW9A 1N34B 1S2OA 3K9CA 4UAUA 4WLNA 2G9UA 3UGKA 4NBVA 3CEPB 1T3GA 2ZB7A 5EE1A 3DCYA 1O95D 3G5TA 3PC7A 5L3ZA 1LS6A 2AL7A 2NZJA 2OP1A 1C3JA 2RHCA 4AJ1A 4H1UA 4I3GA 4X1KA 1EBBA 2X9QA 2GPSA 5D86A 2XT9A 4C2AA 3NCHA 4E5MA 5JRJA 1RXEA 1BHJA 2R5NA 2B30A 1R5NA 4ZEMA 5KSPA 4LJ9A 2VHZA 4PF1A 1DJNA 1I7DA 1Z4PX 5CX1B 1QFXA 1VCHA 2BGMA 4HH3C 1RWVA 3C1UA 3VR5D 1V7ZA 3ZCRA 5JAZA 2H2HA 1YQEA 3V4OA 1W2WB 4W7HA 4L4ZA 4C6RA 5JNSA 1J9ZA 3PDJA 3LWBA 4ZAWA 1IY0A 3AO0B 1B7GO 1MEEA 4HAZA 2WPNA 4N54A 5J2UB 3VZQA 1QHXA 2GN9A 1Q21A 5FL3A 4FYKA 5DHUA 4CM9D 2R1UA 3KT6A 5ALEA 3BK7A 4CMEA 2Z2ZA 4JJFA 4PINA 2XE8A 1N2XA 3ZD6A 4N49A 4JZYA 1B2LA 2GXUA 3SHFA 1CW2B 2PKCA 2J7PD 2BPOA 2V98A 2PR2A 1GNQA 3U1TA 5KYXB 4E5VA 4MZDA 3AI3A 1DRVA 2F17A 3H42B 1K3TA 2QUJA 4WKPA 2Q2NA 4C03A 1AOXA 3GT0A 3PK0A 4MEAA 1FMJA 1UDWA 2XMRA 5JVDB 4F4DA 2BH9A 2HSWA 5LYJA 2VUIB 1E3JA 2A1IA 1J07A 1VGVA 4MWGA 2A6PA 3FCYA 2NTEA 2OESA 1QIGA 2IITA 3GFRA 1N6PA 2D2VA 1ZZGA 3FSGD 4D6XA 1H05A 4JJ8A 3D3JA 1GPWB 1KAEA 4DW8A 3AEXA 4B71A 3R3YA 1XN4A 5ENDA 1V8PA 3F3KA 4HGYA 4BFYA 2VS1A 3EVDA 5IK2D 5AW3A 4BQSA 2B2NA 2O57A 1UMBA 1TC2A 1Z2CA 3A28A 1KY5A 3S2SA 2Q9CA 1FP2A 2OLJA 3WB0A 1GTVA 1X1BA 2W6IA 3OPYI 1EESA 3FI9A 2WHPA 3DKVA 1FP4B 2HSDA 2XCLA 4JBXA 3W6ZA 1ZRHA 4RJ2A 5K3CA 2PMBA 3L4KA 3CVWA 1CQWA 5KJCA 3K92A 2R8ZA 3CVVA 4CEIB 4JASB 3E3NA 3W5VA 5LDHA 3V1KA 2GI4A 1SFRA 3JX9A 2VOEA 3OZTA 1BWSA 5BOSA 1CY2A 3TUJC 4BCCA 3WSVA 2W2NA 2ZRAA 4FGJA 3B5JA 3CG4A 4PBRA 4RF3A 1R8JA 2WMDA 2VPZA 5EI5A 2FZLA 5FLKA 4X6YA 3G0DA 5IAJA 3FTDA 3W9SA 1I6MA 4QJ5A 4R7ZA 4X60A 4MARA 3OEEA 1GT6A 2JK1A 4RELA 5DV9A 4A7PA 1U0JA 3RM3A 4PLHA 2WU0A 1OD6A 3U3DA 4JFAA 3UYLA 4PIVA 2DZDA 4BPRA 3KUXA 4BV8A 3ZQ4A 5KPDA 2MYNA 5J5CA 2OXIA 2WOOA 2PL1A 4R83A 1JJAA 1VDZA 3BRCA 4S0XA 5IFLA 3DLTA 2CMDA 1QH8B 1NBIA 2EERA 2EFCB 3WHIA 1OJ7A 1T5HX 5ECGC 1SPXA 4IUDS 4BNNA 1E1KA 1GRRA 1D07A 1NW7A 3EVAA 3UMGA 9ABPA 1J42A 5E8JA 3STTA 3AEUB 1QQTA 1DHRA 3NT2A 4JVSB 4FYMA 1NVVQ 3BQMB 4PGMA 4PQFA 2X19A 1Z0KA 4NBWA 4YV1A 5AVVA 2HC9A 4UCXA 4DBVO 4QBFA 4LZWA 1V6AA 3IVAA 2RJNA 4N12A 3DZ8A 1ATIA 3DGEC 3FFXA 3UZUA 1JHQA 4WH0A 4X62B 3E9YA 2J59A 1FDVA 4FE4A 4GZ3A 1SUWA 2HQSA 2KI5A 4OL0A 5BSUA 4YDQA 1HNZB 1EJ2A 2LGJA 2R85A 2ZVDA 1P81A 1Y8RA 3CBQA 4LCEA 4EA6A 1ILEA 2O4UX 2TMYA 3HABA 1S7GA 1DNPA 2EQAA 2PYDA 1PGQA 3OBBA 3VVLA 1A1VA 2GAAA 4OF4A 1BH6A 2E37A 2PRKA 2XKJE 3DEKA 4PQEA 1MFZA 1FLVA 2DWOA 2EX0A 3G9ZA 3IJPA 4J7AA 2BGTA 4X6LA 1R66A 2F1OA 4A0QA 1Y34E 3MJSA 4WBSA 4YXWA 4DDUA 1MZPA 1QH9A 4MLDA 1DTWA 3HA3A 3BXXA 3P4YA 1NN0A 4S1NA 5H82A 3UW3A 3OCXA 2H1SA 3I4FA 4TVOA 4DJ5X 4UFPA 4M8NE 5F7JA 3C15C 1IUKA 1H2YA 4KQHA 4G97A 3PQ7A 1BMTA 1GN8A 4IY1A 4LXIA 5EGSA 3Q8MA 4G4JA 4V0QA 1ETUA 1Q50A 2B4RO 4KHZA 1XSEA 2OK8A 3ZQKA 3PUZA 1Y5LA 4G2NA 3SYRA 1LDMA 4EJ2A 1M0EA 5ELMA 1XTPA 6ABPA 1SXGA 1XTJA 3DYBA 4PSVA 2ALJA 1ZD8A 4J0QA 4ZP1A 4GE0A 4RD3A 5HF6A 3WZLA 1DO8A 3M34A 1YS4A 1FFXA 5DXFA 3JRXA 4DIFA 2NAPA 3NBUA 4MKHA 3M70A 4MV7A 3PTLA 3BCHA 1NW5A 2FW6A 4YYEA 1TA9A 3MWDB 1O8CA 3HNOA 3EIEA 4JZKA 1P7WA 4KDEA 2VJAA 1BA2A 5TS2A 4XYMA 2PEZA 2LKDA 2REXB 3QJYA 3KETA 1D4OA 2WBLC 3FJOA 5EPEA 3FDIA 5ALLA 4DV4B 3I01M 2V7GA 4EL5A 1NMSA 4Z1MD 4UCWA 4X1YB 1N2EA 3NKFA 4RKYA 3BJMA 4QU0A 3RGWS 5LP1A 4FYVA 3VTFA 2CVFA 3II6X 4HWGA 4OGFA 3Q8WA 4PRKA 3W5AA 2FJ0A 4MUXA 3D6HA 2ZWIA 3QYFA 4F92B 2I7VA 3K3PA 4NKRA 5JJIA 3D0RA 1I33A 4R1MA 2YYYA 1K6MA 1GCOA 1VJ5A 4PFKA 4URZR 1ID1A 2D62A 2P1ZA 2E7ZA 2ZETA 3UUGA 4HQOA 2B8NA 4YRSA 3RFXA 9MHTA 2P3QA 1GJRA 2OQRA 4F21A 1MGOA 4HNUA 3C6BA 3FMPB 4BNXA 1DG1G 1PYGA 4P2BA 4CM1A 1QH1B 1U1CA 4XYBA 4IQ0A 3L18A 2OCPA 4G5XA 4JELA 5IJAA 1MA0A 4HYEA 3H8VA 3KAJA 3PJGA 1FDIA 1SPBS 2R8BA 2ZSKA 2GBPA 3BB4A 5GQSA 1DP4A 4D9MA 5TRTA 3R9XA 4JOCA 4Z7QB 1PQWA 2NW6A 1DBSA 3HCOA 3I2GA 3QHAA 1VG0B 3PEFA 1UM8A 5BUSA 1WY5A 3Q7IA 1E8MA 4DCGA 5I4BA 4DPMA 3MF4A 4PX2A 4G1MB 1AQUA 1T34A 5BT9A 4E12A 3KJHA 4TYNA 1OKKA 2QEQA 4I55A 3QE0A 5BV1A 4W8GA 4CCYA 3MCVA 4FMDF 4HZUA 4RWZA 1V9SA 4LF5B 4XGKA 5EE0A 2G04A 3SMVA 3MHTA 1HT2E 4X7PA 1Z0AA 3T3EA 1QHIA 3OAAA 1Y1LA 3IODA 2QPAA 3M0EA 4YJHA 2AOUB 3HA7A 4U9HS 2UUPA 3UJCA 3MYRA 1GDHA 2HTFA 3I04A 3E5RA 4Q47A 4ESVA 2H1OA 2Q4DA 1EAYA 1RM0A 4XYEA 1M7HA 2H2AA 4KIWA 4OX9Y 4QLAA 1YJQA 3B2EA 3DA8A 2GTHA 2OQVA 1XU7A 4W6QA 5HQ3B 1QRAA 5DBIA 2V7XA 2AEJA 5EZYA 4MO9A 4CDMA 3GRCA 4Z4IA 2C96A 3EVFA 3GEPA 3RIMA 4G0VA 3ERCA 4IHKA 1NUSA 3AFOA 1WG8A 4I4TA 3T38A 2OBNA 5K4HA 4KRFA 4GP9A 5FNVB 4YWHA 4L16A 1SCQA 3G5LA 3Q10A 4YRQA 1J6UA 5E7MA 1N1DA 4UZFA 3HUFA 3M4NA 1Y7IA 2O8DB 4EW2A 3M83A 3PC2A 2VDLB 4GXRA 3IDQA 5KZMB 4MP3A 3T3GA 3QYJA 1J9EA 4EARA 1QG6A 2WG1A 4ZV4A 1ULZA 2X3UA 3IB6A 3B9PA 5TQVA 3AR2A 4Y67A 4R1UA 4EO4A 3VTZA 1IM2A 2FMTA 2CN1A 1NI4A 4HDMB 4QD3A 1VE1A 4Y1RA 3DT8A 1CY8A 3KQYA 1T29A 3HYSA 1AQ6A 4EATA 4FYJA 1V41E 4NZPA 5JXJA 3WI7A 5I7EA 5JJBA 3TXXA 1U0TA 4N5LA 3M6VA 3E1GA 2GUGA 1YACA 1GUDA 2A59A 3GHYA 3IXMA 1M74A 5LNK1 1YQXA 3FKSD 4HGQA 2RHOA 3H2KA 3MMSA 3NDJA 5IWAB 2UYHA 4XKJA 2B9VA 3OZFA 3O03A 1T26A 3HYCA 3MRTA 3PF9A 3X2FA 3AGPA 2RKBA 1KKLA 5C35A 3HVRA 1M2VA 1E9CA 2OEPA 3IQGX 5HBRA 1RWMA 1S2MA 3CRZA 3I6MA 9LDTA 1U8FO 1K5HA 1GCGA 4D8YA 2R60A 4W5HA 4Q1VA 1A5ZA 1U31A 2CDBA 5FWDA 2X8AA 1ORIA 1UMDB 4C0XA 4F6LA 4NULA 3SDSA 3VR3A 4CMIB 2VHXA 3B13B 3C6QA 3GUVA 4I50F 4BO8A 1D4FA 4NCBA 4AKIA 3V8RA 5M04A 4BNKA 3NOXA 5AKYA 5EUQB 4L8YA 2W2LA 4AJ4A 4HK4A 3PI7A 2V9PA 3BH0A 3TDKA 3TQIA 5BSTA 2OCDA 3AEQB 4L73A 1U0EA 1FYXA 3R41A 1N0WA 3OLXA 4M89A 1GQRA 4I1IA 4AYWA 4TL9A 5ETJA 4Q4AA 5J4KA 1FU7A 1XZGA 1DIOB 1QUFA 5AIAA 5E6UA 4ZC8A 3DMRA 3X1DA 4EHBA 3NNSA 2C1XA 1TAQA 3BZUA 2ATXA 5J43A 2AVDA 3QUQA 5ARDA 3TPZA 1UP7A 4ZI2A 3ESRA 2NMVA 5DASA 4MW7A 4Z1OA 4JP5A 4OOFA 4RH3A 1JSRA 1U2QA 4ZMRA 4HPWA 3V4VB 2WE8A 4ATNA 3OJCA 3F6PA 4JBIA 5JASA 2O7NA 3ZX5A 2XY4A 3S7ZA 2HA5A 4FS3A 4RX1A 3JQGB 4IF6A 1ENPA 2X9LA 4OCZA 4RCYA 1D8TA 2Q99A 3WK9A 5JFTA 1UZUA 3TLEA 2CJWB 3PTZA 4J0FA 2XCQA 1IEQA 2QD4A 4DREA 4YUZA 3QKTA 1CUEA 1XAIA 1N0HA 2J30A 2YWCA 2HK8A 3L92A 4GNRA 5E7IA 4EQ6A 3CW2A 1K5GA 3C1OA 3GHHA 2ADFA 3RCBA 3RU9A 1XEXB 4TV9B 3P96A 4RLFA 4ZU1X 2A4KA 1CY1A 2IUTA 3BWDD 4OB8A 1I6KA 4TTQA 1X94A 5TF0A 1X1EA 1FDUA 1R6TA 3HUDA 1VRWA 4FFBB 4MA5A 3PT9A 4TKVB 4V24A 5CNKA 2X77A 4R1NA 4PAQA 1KAHA 1SVWA 1GLGA 1A9OA 1N1EA 3HKCB 4LYGA 3DYIA 1M0WA 3A4VA 3NEYA 4L9SA 4O4LF 4U4AA 3VHQA 1R6AA 4NK4A 4AZWA 4HNTA 1RWXA 2O6HA 2GWHA 2Y67A 3D6VA 4DLAA 2B3TA 1D2MA 1ULAA 3BQNB 1XZIA 3G6KA 1H1DA 2QV7A 3MC1A 4FKMA 5GPBA 1T1GA 3RLIA 3S5JA 1CS0A 1AZLA 1C1XB 1FMLA 2CVQA 2YJZA 4KIFA 4J76A 1ETHA 3AM4A 2XYGA 3KEGA 2ZJ0A 4KN5A 1FC0A 3GF4A 4A3SA 5MN5A 1JQJC 1OUMA 1WR8A 1SKMA 1QR6A 2ACWA 5CDUA 2EDCA 4NQRA 5FWYB 4B3RB 2H63A 3ID6C 3JZFA 2ZSAA 3KE8A 4LXGA 4MRMA 4L4YA 4UBJA 2GASA 5HZHA 1NVVR 2C2XA 5LQAA 2AJBA 1JH8A 1ZSYA 1EFPB 2DSTA 2OK7A 3I5AA 4GX1A 5F64A 3OPYA 1X7YB 7REQA 2YZNA 3O4IA 4PYMA 3QQPA 1J2YA 3KCNA 4G8BA 3KVOA 3OJ0A 4L8WB 4NPAA 3D8NA 2D7DA 4O4HB 1D6SA 1F06A 3UFXA 1C1DB 2QPLA 4H7DA 2IL1A 5SYNA 3VNSA 1PHPA 3F9RA 3DJFA 5HIJA 3OFJA 4JLKA 1XQXA 1C3OA 1A4XA 1VLMA 3PVSA 1U1FA 4J2HA 1TPZA 1WDWB 3F9CA 4QSMA 3T8YA 4QOJA 3WSTA 2H9IA 4KI0A 1G20A 1IN8A 1DT5A 1PFUA 3L4BC 2E48A 1JHVA 3ZBUA 3WRYC 4AQYB 1HK7A 3SKXA 4IRXA 5I5GA 3ZY5A 5K3BA 2NTJA 2V3CC 2X9VA 2MSCB 2Y9MB 1B1AA 3QVXA 1E7QA 1OLXB 2HRBA 2GBCA 4INOA 4AULA 4CQLB 1FPMA 4IO0A 1XDBA 4URFA 2BZ1A 4WBNF