5LJNA

Structure of the hoip pub domain bound to spata2 pim peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
173
structure length
173
Chain Sequence
GEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 56
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljnA00
4OYKA 4OYJA 2HPJA 2CM0A 2HPLA 4P0AA 5LJMA 2D5UA 4P09A 5LJNA 4JUYA 4P0BA 2CCQA
chains in the Genus database with same CATH superfamily
2LLYA 4TWHA 4YSXA 1BR1A 3GWHA 2JRKA 2VB6A 2XQ7A 3L8RA 3RQWA 4X62T 3JADA 5FY1A 3I9WA 2WZIA 3K3QC 3ZN0B 4DV1T 3UFEA 4HWFA 5LP6E 1Y01A 3RIUC 4PJJA 2EHOB 2C0SA 3EI0A 1D1CA 2DNXA 4P0BA 4H9SE 5AQVB 3I1AA 3ZC1A 3CQXC 2LRLA 3AVRA 1WR6A 3N9OA 4HFEA 4YY3T 4DBQA 4YSYA 1UUSA 1U5PA 2XM2A 2LHNA 3C51A 1LRZA 4EGWA 5L4HA 4TV8E 2LOPA 4JYAT 5EZYE 4EZ4A 2XSAA 5FP3A 4JEHB 1J1JA 4MBQA 2WWVA 4UV8B 2YDSA 3AAAB 3A7MA 1LVKA 3F2EA 1VCSA 3GA8A 4IDQA 2K48A 4ISSA 3CX7B 3QUJA 4WZXA 4DNDA 2SPCA 3ZSTA 2D9DA 2QVAA 2IC6A 2DHRA 3AA1B 3ZYLA 5F8PA 3RHWA 5LG3A 2XQ8A 4PNIA 2KLQA 2VASA 1MNEA 1XZYA 2XAJB 2YDQA 3M65A 3BQLA 2W67A 3RX6A 3KFWX 3ZSSA 3ZMVB 3EHZA 4ISTA 2XHEB 4Z91A 3C64A 5HXCA 1ZKEA 3KINB 2WM9A 2OV9A 4DVDA 1EZ3A 1XMQT 4X1KE 2X66A 2Q9QA 1HNZT 2JJ9A 2WWUA 2ZM8A 2RPAA 2CPTA 3RIFA 2LJLA 2FUPA 1HCIA 3PUQA 4EB6E 2IC9A 3LDQB 4G2AA 4TV9E 2XQ5A 5LMUT 1YQ4A 2NP9A 4UXNB 3PUWF 5H6QB 2X9XA 3AE8A 4Q25A 4DR6T 4CI2B 1T98A 3OBVE 2CHOA 5FXXA 3PU8A 3ETVA 3ZYKA 2WDVA 3PTRB 2CRBA 1QLBA 4FI5A 1WYBA 4ZS2A 2ES0A 3NVOA 4EEBA 3AA6B 4DV6T 2NWBA 5ABFB 5FL0A 5L2LA 3O9XA 4U2YA 3AE9A 2FJAA 5KXJA 4HTEA 3UU6A 5L3DB 3VR9A 2IUBA 4X1YE 4YHHT 2NW8A 2BBJA 3DP7A 4ILAA 2N2NA 3EDUA 2LHRA 4ADZA 2LM9A 4ZEYA 5CA1E 5KX5E 2Y48B 3GMIA 3UU5A 3NKZA 3P7IA 1S94A 5IHYA 2YK0A 5LXTE 4CI1B 3I0OA 3A5XA 1Y64B 2XY8B 1B7TA 5J2UE 3KV4A 2DLRA 5JDNA 4OYKA 5FXVA 1O3XA 3ZEFB 5ETWA 2Q9QB 1HX8A 4X5TA 5FMNA 4DMVA 2V1DB 5HEHA 3UFGA 3AVSA 3Q2MA 4QKNA 2KWIB 2HHHT 5AQHB 2L8KA 3W15B 4JLEA 3AE3A 1OEDC 1FIOA 1UX4A 2RA1A 2NR4A 2PBIA 4GK5E 3TLTA 3ANWA 1HNWT 3Q5EA 4MLKA 3QB5K 5LGNB 1IZNB 3AE6A 1KF6A 2DCFA 3E22E 4TUYE 3H3AA 4DR1T 4MHCA 3RYFE 1W0AA 2RP4A 5AQNB 2X9WA 4EAHA 3CMLA 3PUVF 2XAFB 4O4JE 2ACXA 4XZCA 5FNVE 2X67A 2V6YA 1G73A 4JEUB 5HEGA 2XUEA 4CXXA 4YXDA 4UV9B 1XMOT 3DTOA 1XDOA 3TLUA 5AQUB 2NTYA 4ANJA 5CFBA 2KWHA 2V5DA 1KFYA 4LFBT 4LF6T 4ILCA 4B3MT 4CXYA 1Z8UA 4UVAB 2OLTA 2KNDA 2V5CA 4DV3T 5LB7B 4AKGA 5HXSA 3CQCB 5JR9C 4HWHA 3RF1A 4U3CA 2X0YA 1HX1B 3CQGB 2CEAA 3MACA 2UXDT 3JC6C 4JI0T 2DI4A 2W0GA 3RRWA 5JDMA 3N5LA 1IJ5A 3RI5A 2VURA 2WU2A 3IBPA 2MBGA 4DUZT 4WNKA 4LFAT 1AJ3A 2E9XB 2BKOA 2LSYA 2BKNA 2E2AA 5HWXA 3ZJ2A 5A1LA 2BVMA 4IIJE 3RGLA 2LT3A 2VK9A 3NWIA 3HKEE 4XAXB 4ILBA 3PJAJ 2WB5A 4YTNA 4HFVA 2KSRA 2JIWA 4IE6A 2WAUA 1US7B 4L0RA 4IL9A 1HR0T 2E9XD 1ZP0A 3K3OA 3C4WA 2JMKA 1BR2A 3H37A 2BG9C 2FJDA 5L3FB 4IDPA 3A8YC 3U78A 3JC6D 3UUNA 5L3CB 3ETUA 4E7ZA 5AQLB 1D1BA 3TLWA 4LF9T 2IW5B 3P50A 4BAYB 3QK6A 1HFAA 3UUBA 4AKIA 1HF8A 3HKBE 5JDQA 4EYYR 3VU7H 2M6IA 3P4PA 4WYVA 1X9BA 2GK9A 1N34T 5M4YA 4JV5T 3ONLC 2YDRA 3S4UA 3EAMA 5LGUB 1JNRA 4UIGA 5EK4A 4P1NA 2UUAT 3CK6A 2Y8DA 3T1YT 5AQKB 3T8OA 1KNZA 4JI2T 5FKYA 4A97A 4L9IA 3Q5DA 4E7SA 2EHOC 1MIVA 4ZI3C 3L09A 3VKHA 5JRCB 3OYXA 4CN6A 1VOMA 3FZMB 2X0HA 1UGOA 2B76A 2LSIA 3AEBA 2KINB 1DU2A 2CHNA 3R84B 3K8PC 3O1IA 3TLVA 2Z6EA 4B3TT 2WQYA 1XDPA 3BQKA 2XPKA 2NOXA 4ERRA 3ZC0A 2HPJA 1KNPA 3ESLA 4F8HA 2QGSA 4H9OC 4UF0A 4NXMT 1FEWA 4H9PC 4NIQA 5C8YE 4DV4T 2JQ9A 3SWHA 3RKGA 1R8IA 4DUYT 1E7PA 4COFA 2CA5A 2EHOD 4HWIB 4ZI3D 1FJGT 3WAKA 1KK7A 2V7JA 4X1IE 2VL0A 3I9YA 1YW0A 4UVCB 4CN1A 2DWKA 2CE7A 2D0UA 1FMWA 3RRCA 1N33T 3DJBA 3NBXX 5FXZA 2LSKA 2LKGA 2N9DA 1T7SA 1WCRA 1YD8G 3CKDA 3FBZA 4YJ2E 4HEAA 4NPPA 5IWAT 3ZT7A 4NUVA 4HFHA 4OFZA 3VKGA 5ADXL 3CX8B 3AXJA 4JI1T 3P4SA 2H3RA 2VVNA 4I4TE 2P9BA 5GONE 2LSJA 5AFUL 2YN6A 1D0XA 3JAEA 5HXEA 2D2SA 1S35A 2V8SV 2JQHA 3T1HT 4JBWF 5E0OA 2MTQA 1FMVA 4U33A 3VRAA 4NXNT 3SRZA 5FVLA 4WBNE 3L3PA 5AQJB 5HAXA 2ACZA 3Q9DA 4EXTA 2WDRA 4I0UA 3BQIA 3IA3A 4PFPA 2W2UA 3SS1A 4QXCB 3FZFB 3O1JA 4AQFC 4L5GA 3MJXA 2BZBA 4WBOA 4FJOA 2BVLA 5FVKA 3I0QA 5FL1A 2HN2A 4O4HE 2IHR1 4ZI2C 3HKCE 3IF8B 4LF4T 3Q5XA 2E5VA 2XTLA 4F6RC 4UF0B 3RLFF 4KX6A 1NEKA 3FZHB 3UU8A 2NW9A 2Y6XA 1HNXT 5AQTB 4EV6A 2C5JA 3ZPOA 2VL8A 3MA9A 4MFRA 1OXZA 3HA4A 4U31A 5C2TA 2YOEA 3LFMA 1HG2A 3HR0A 3AE4A 1I6ZA 1GQEA 2JPFA 2LE8A 3RYHE 3AE1A 3ZJ1A 5F3JA 4ZXLA 4PW8A 2Q9QC 2H7VC 3U3IA 1MMGA 1L0VA 3RIAA 1LKXA 3AXJB 4ZI2D 3EVYA 3AE5A 3OPCA 2X68A 4CN4A 3IEEA 2W00A 2FJBA 3VHLA 1D0YA 2I59A 4C91A 2V7LA 3P4RA 2IAKA 4YTMA 4HWDA 2WY2A 4QHOA 2J47A 3ZMTB 4DV2T 5JQGE 3FZLB 1I94T 3D0TA 2PG8A 2QYWA 1G8XA 3RYCE 5EK2A 5LNKA 2OA5A 3NZQA 2CLYB 2W63A 3NZPA 1QSDA 1MNDA 5F5WA 3MKDA 2XQ9A 1XNQT 3TKLB 4LF7T 4O4IE 3ZMUB 5LYJE 2VVSA 2YINA 2VKDA 5JTGA 2LKHA 5LJNA 2Q9QD 2I0MA 5BMVE 4IDZA 3X1DA 3LBXA 4I50E 4HN9A 2CCQA 2C5IT 3ONXA 4B3RT 5L3GB 4JI5T 1OWAA 1IBMT 5LGTB 4LF8T 4O2AE 2CBJA 2E8IA 3OJAA 5FY0A 4X64T 5JVDE 4U2ZA 4KHPT 2LSGA 2PJQA 4DMWA 5FY7A 4IE7A 4EEDA 1W09A 5JDFA 5AQSB 2YU1A 3RYIE 4BA9A 1ZHCA 3RPUA 3JCFA 3FBLA 4UVBB 2CXDA 1VCTA 4JI4T 1IJ6A 2J62A 2E9XC 3UUXB 3UT5E 3MZKB 5AQRB 4O8SA 4DR7T 3TLSA 2XQ6A 4CXWA 1NAFA 3NRYA 5HYAA 4LMLA 5J1GA 4JUYA 3H3MA 3C4ZA 4ILUA 4KBMB 3FB2A 2WZHA 4TX5A 1E1HB 3AEGA 3ZKRA 2VKHA 3RC8A 4QH1A 2BS4A 3WI3A 5HCMA 3O1HA 2JQQA 2BS2A 1YQ3A 2V26A 3PV0F 3OTOT 2HH7A 4IDOA 3RQUA 2HPLA 3ZCJA 3ANWB 4G63A 3PUGA 5H6RB 3LBXB 2XJ7A 1N32T 4ZZBA 4AKRB 5DABA 4V1Av 4HKAA 3CWZB 1QUUA 3FXDB 2KMFA 1XNRT 2WU5A 2V7IA 3UU3A 5FXWA 1UK5A 4PK5A 1NENA 2XSBA 3HI2A 2MYSA 4IE0A 4LF5T 4IDNA 3KV5A 1IBKT 3C4XA 1SUMB 2BBHA 4LMJA 2V6YB 3ZCIA 3RIUA 2IDOB 3AE7A 2J1DG 2A9UA 5HEUA 4O2BE 1HTJF 4AISA 2WDQA 2AXDS 4TWFA 2FJEA 3AEFA 4HE8A 2YU2A 3VRBA 3LK42 2XQ4A 1NWMX 4HFIA 3Q5WA 3IHRA 1BR0A 4H63H 1VRBA 2XQAA 4LFCT 3N9MA 3EUHA 2KT9A 5AQFB 3O4XE 5HEOA 4DIDB 2WS3A 3NRXA 2X0LB 3PUXF 4QX7B 3EABA 3ZYMA 3N2GE 5BR8T 2R6GF 1YKEB 2QA7A 2MOZA 4P09A 4IGUA 1HG5A 3N9PA 5AQGB 4OX9T 3KDSE 3CX6B 1WYCA 2FBWA 2J4GA 2E5LT 4J2CA 2YEVC 3B57A 5AQPB 4TNWA 4QX8B 2DL1A 3L39A 2A3DA 2W4XA 4AXPA 2IIUA 2H89A 3MXZA 3KBUA 4TNVA 4IE5A 1CUNA 3N2KE 4M1PA 2K3WA 5HCJA 4A56A 4H9QC 5LBMA 4IL4A 5J2TE 4QH4A 2F4VT 1KEYA 2L3LA 3PUSA 3UUMA 4JI8T 2CM0A 2VKJA 4AQFA 4EIWA 5LBQB 5L3EB 4N78D 2WMOA 3KVAA 5CJ5A 4C90A 5AQMB 5ABFA 4KMCA 1D0ZA 4EYUA 4EZHA 2PTFA 2LOSA 5DJQC 2A72A 3E08A 4DO0A 5LHGB 4HGAA 4AKHA 1W9RA 4UEMA 5JREA 4H9RC 5AQOB 3P4QA 2ZM0A 2MAWA 2AE9A 1HS7A 1M62A 4BJMA 1Z0PA 4YLHA 3QOFA 3LSVA 3UQ4A 4IE4A 1E2AA 1WFDA 4CQIA 5LOVE 3R6NA 5JDLA 3MK7C 3GN5A 3HKDE 3RKOA 3AAIA 4Z90A 3EDVA 3PUAA 2UUCT 5HXHA 4O4LE 4YFSA 4AQGA 2CWYA 4A98A 5LJMA 3ZT5A 4GOUA 5LCYA 1MMDA 2QRXA 2A2FX 2WBLA 4X20E 4K0KT 3J7Yq 5J0ZA 5LHHB 3QB5A 4Z8XA 4X66T 4KHZF 3AEAA 1N36T 3P4WA 4JI7T 1UCUA 3LK3B 2X51A 4DBRA 3WAJA 4GKKT 2DWGA 5HEJA 5JH7E 2XM1A 4WW0A 4PJMA 2CWOA 4DR2T 4DV0T 2XQ3A 5L4EA 4IREA 3ZMZB 2CXLA 2V7KA 1SHZC 3N9NA 4DR4T 3JAFA 3QNUA 1JNZA 5CA0E 2K5BB 3FZKB 2PFVA 4IT4A 4PK4A 5CGMA 3CVRA 4TN7B 4MALA 3LK2B 3PUZF 1OEDA 3RC3A 5LMNT 1MMNA 3BK9A 1J5WA 3N9QA 4KI0F 3AE2A 1LVFA 4DR5T 5AQIB 4PK6A 1MMAA 3ZMSB 4NUUA 2ODUA 2UXBT 4YSZA 2ZM6T 4XBFB 3RH3A 3PU3A 1SA0E 2CLYC 4DR3T 4GK0E 3ZLIA 2ZMAA 3PUYF 2C5KT 1XWMA 2B1EA 4JI6T 3KV6A 4TWDA 5HWYA 2BKPA 3AAEB 2W61A 2BDEA 4UR9A 3PJAA 2IMLA 2CBIA 2VWAA 4U7YA 4CZZB 1U4QA 3GN5B 1OEDE 2UU9T 2K24A 2W66A 5LHIB 5FYMA 2WCAA 3OYZA 4ASKA 4QXHB 2I6HA 3KVBA 5LG4A 3N2OA 4LMKA 3PE0A 1YXRA 2E9XA 3ABVA 3UU4A 4YJ3E 4AI6A 4UELA 3OVUA 5JR9A 1KNRA 5DQVA 4GYSA 5JDGA 5KMGP 4CI3B 4X65T 1ZOYA 4YT0A 4DV7T 4GIWA 3KBTA 5TAOA 2UXXB 2VQFT 2ODVA 4AKLA 5ABGA 4H9NC 3AA7B 1V9DA 4JI3T 2XASB 2MPKA 4QXBB 3PDYA 5EK3A 2K9AA 4HFBA 4U74A 1IBLT 2G0UA 3B13A 1M7KA 4OK0A 1OEDB 5C3JA 4DV5T 3AEEA 1ZEEA 4OHFA 1H7CA 1UURA 4ZZCA 4HWCA 3J9X1 4EOZB 1WRDA 2WP9A 3AEDA 5KDMC 2V7MA 3N9LA 4QH5A 2M67A 3LJCA 1YKHB 4OYJA 2L9QA 1ZV4X 2KZ7B 2BS3A 2XAQB 2BG9A 2JMHA 3UULA 3SFEA 3B5MA 2M6BA 5ABHA 4B3ST 5IUXA 3QC9A 4TZ4C 4PAGA 3LG7A 5DQWA 2KXPB 2V6XA 3ONJA 3OKQA 3FHNA 5JDHA 3K3NA 2X9HA 5JRCA 1CHUA 2XAHB 4PJNA 2YKSA 4U72A 2WMNA 1UX5A 4A5XA 3UQ7A 2UXNB 4GKJT 3V5SA 1WR0A 1BR4A 3FXEB 4HFCA 1SE7A 3SFDA 2JQKA 2NTXA 3AECA 4H63V 3E0ZA 1MIYA 5L3BB 4I43B 2XZEA 3F31A 2ZLYA 1D1AA 1J5ET 4I55E 3K1SA 2W62A 1T8BA 2LEHA 2EHOA 5JR9B 3HL6A 2BG9E 3V5UA 4PFOA 2CMRA 2NW7A 5HXRA 4AIUA 3KV9A 3M3ZB 2UXCT 4KUMB 4ZI7E 3AA0B 3G06A 4YHJA 5AQQB 3ZT6A 2D5UA 1T72A 2CXFA 3ZN1B 3F57A 2XQYA 2XAGB 2WSSV 4ZHQE 4PJLA 4BJNA 2UUBT 4P0AA 2LRKA 2D0TA 3AB3B 2HN1A 4IHJE 2LM2A 4ZOLE 5CB4E 3SOLA 3C98B 3CIRA 4U7IA 5LA6E 4ZS3A 3CPZA 4HFDA 2H7OA 4KP3C 4GYRA 1MIWA 3PURA 2BG9B 2VQET 1W0BA 3UTKA 1IAPA 5IYZE 4YTPA 1X79A 2X9YA 2ZM2A 1WLXA 2H88A 2VKOA 4QWNB 3P8CD 3VR8A 5ABEA 2N1GA 4K0UA 5L47A 3C50A 4B6XA 4AQYT
chains in the Genus database with same CATH topology
2PG8A 4O4LE 1G8XA 3RYCE 2DI4A 4YFSA 5EK2A 4AQGA 2CWYA 5LNKA 1BR1A 2OA5A 3NZQA 2W0GA 3RRWA 2CLYB 2W63A 5JDMA 3N5LA 3NZPA 5LJMA 1IJ5A 1QSDA 3GWHA 1MNDA 2JRKA 2VB6A 3IBPA 4GOUA 5LCYA 1MMDA 3MKDA 2MBGA 3TKLB 4WNKA 1AJ3A 2E9XB 5FY1A 3I9WA 2A2FX 2WBLA 2LSYA 4X20E 3K3QC 3ZN0B 3J7Yq 4O4IE 5LHHB 3ZMUB 4Z8XA 3UFEA 5HWXA 5LYJE 3ZJ2A 5LP6E 2YINA 2VKDA 5A1LA 2BVMA 4IIJE 2LT3A 5LJNA 2Q9QD 4PJJA 2VK9A 5BMVE 2EHOB 4IDZA 2C0SA 3LBXA 1D1CA 3HKEE 4XAXB 2DNXA 4I50E 4H9SE 2CCQA 4HN9A 4P0BA 2C5IT 3I1AA 1UCUA 3ZC1A 3CQXC 3AVRA 3ONXA 4HFVA 3LK3B 2X51A 1WR6A 3N9OA 4DBRA 3WAJA 4DBQA 5L3GB 4IE6A 1OWAA 2DWGA 5JH7E 2WAUA 1US7B 4L0RA 5LGTB 4WW0A 2E9XD 4PJMA 2CWOA 4O2AE 3K3OA 3C4WA 1U5PA 3ZMZB 2LHNA 2CXLA 2E8IA 2V7KA 3C51A 2JMKA 3OJAA 1BR2A 5FY0A 1LRZA 1SHZC 5JVDE 3N9NA 4TV8E 2LOPA 3H37A 5CA0E 5EZYE 5L3FB 2K5BB 4EZ4A 2PFVA 4PK4A 5FP3A 3CVRA 4JEHB 2LSGA 4TN7B 2PJQA 4MALA 4MBQA 3LK2B 3U78A 3JC6D 3UUNA 5L3CB 3ETUA 4E7ZA 4DMWA 3RC3A 4UV8B 5FY7A 1D1BA 1MMNA 3BK9A 3AAAB 3N9QA 4IE7A 1LVFA 1LVKA 2IW5B 3F2EA 5JDFA 4PK6A 3GA8A 1MMAA 2YU1A 3RYIE 4BAYB 2K48A 4ISSA 3ZMSB 3QK6A 4NUUA 4BA9A 1HFAA 2ODUA 3CX7B 1HF8A 4AKIA 1ZHCA 3HKBE 5JDQA 3QUJA 3RPUA 4DNDA 4EYYR 2SPCA 3FBLA 4UVBB 3RH3A 3PU3A 3VU7H 4XBFB 1SA0E 2CXDA 2IC6A 2DHRA 2GK9A 5M4YA 2CLYC 3AA1B 3ZYLA 4GK0E 5F8PA 3ZLIA 3S4UA 2ZMAA 1IJ6A 2C5KT 5LGUB 4PNIA 2KLQA 2VASA 1MNEA 4UIGA 2XAJB 5EK4A 2B1EA 2E9XC 3M65A 3UUXB 3UT5E 3BQLA 3KV6A 5HWYA 3RX6A 2Y8DA 3KFWX 3MZKB 3T8OA 1KNZA 3ZMVB 4O8SA 4L9IA 4ISTA 4E7SA 2XHEB 2EHOC 3AAEB 1MIVA 2W61A 3L09A 1NAFA 2BDEA 3NRYA 3C64A 4ZI3C 5HXCA 4CXWA 5HYAA 1ZKEA 3VKHA 3KINB 2WM9A 5J1GA 4DVDA 5JRCB 3OYXA 2VWAA 4JUYA 4CZZB 1VOMA 1U4QA 3GN5B 1EZ3A 3C4ZA 4X1KE 4ILUA 2X66A 2LSIA 2Q9QA 2K24A 5LHIB 5FYMA 2KINB 4KBMB 3FB2A 4TX5A 3OYZA 1E1HB 3R84B 3K8PC 4QXHB 4ASKA 2JJ9A 2VKHA 2WWUA 3KVBA 3RC8A 2ZM8A 3O1IA 5LG4A 2Z6EA 3N2OA 3WI3A 3PE0A 2LJLA 3O1HA 2JQQA 3BQKA 2E9XA 1HCIA 2NOXA 2V26A 3PUQA 4ERRA 4YJ3E 4AI6A 4UELA 3ZC0A 4EB6E 2HPJA 2IC9A 5JR9A 3ESLA 5DQVA 4GYSA 2HH7A 5JDGA 5KMGP 2QGSA 4CI3B 2HPLA 3ZCJA 3ANWB 4G2AA 4G63A 4H9OC 4GIWA 4TV9E 3PUGA 5H6RB 3LBXB 3KBTA 4UF0A 1FEWA 4H9PC 2NP9A 5C8YE 5TAOA 4UXNB 3SWHA 4AKRB 5H6QB 2UXXB 5DABA 2X9XA 4V1Av 4HKAA 3CWZB 1QUUA 3FXDB 2KMFA 2ODVA 4AKLA 4CI2B 2V7IA 1T98A 3OBVE 4H9NC 5FXWA 4PK5A 3AA7B 1V9DA 5FXXA 2XASB 3HI2A 2CA5A 2EHOD 4QXBB 3PDYA 2MYSA 3ETVA 3PU8A 4IE0A 5EK3A 3ZYKA 4ZI3D 3WAKA 2K9AA 3PTRB 1KK7A 2V7JA 3KV5A 4X1IE 3C4XA 4FI5A 3I9YA 1YW0A 4U74A 1WYBA 4UVCB 4ZS2A 2G0UA 2DWKA 2ES0A 2CE7A 3B13A 3ZCIA 3AA6B 4OK0A 2D0UA 1FMWA 2NWBA 3RRCA 5L2LA 2J1DG 3O9XA 1ZEEA 3DJBA 3NBXX 4OHFA 5FXZA 1H7CA 2LSKA 1HTJF 4O2BE 2N9DA 1YD8G 3CKDA 4HTEA 3J9X1 3FBZA 4EOZB 4YJ2E 4HEAA 1WRDA 4HE8A 5KDMC 2YU2A 4NUVA 4OFZA 2V7MA 3N9LA 3LK42 2M67A 5L3DB 3VKGA 3LJCA 5ADXL 1YKHB 3CX8B 4X1YE 1NWMX 2NW8A 4OYJA 2H3RA 2L9QA 1ZV4X 2KZ7B 3DP7A 2XAQB 2JMHA 3UULA 3Q5WA 2N2NA 3EDUA 2LHRA 3IHRA 2LM9A 4ADZA 4I4TE 2P9BA 5CA1E 5KX5E 3QC9A 2Y48B 3GMIA 5GONE 2LSJA 4TZ4C 5AFUL 3P7IA 1BR0A 4PAGA 1S94A 4H63H 1VRBA 5IHYA 3N9MA 3EUHA 3LG7A 2KT9A 1D0XA 5DQWA 5HXEA 3O4XE 2YK0A 2D2SA 5LXTE 1S35A 3NRXA 2X0LB 2KXPB 4QX7B 3ZYMA 4CI1B 3N2GE 1YKEB 3OKQA 5E0OA 3FHNA 2MTQA 5JDHA 1FMVA 3SRZA 3I0OA 3A5XA 3K3NA 2X9HA 5JRCA 4WBNE 2QA7A 3L3PA 1Y64B 2MOZA 4P09A 2XAHB 1B7TA 5J2UE 3KV4A 4IGUA 1HG5A 2DLRA 4PJNA 4U72A 5JDNA 4OYKA 2WMNA 5FXVA 1O3XA 3N9PA 1UX5A 3ZEFB 5ETWA 2Q9QB 5HAXA 1HX8A 3Q9DA 4EXTA 3KDSE 3CX6B 5FMNA 3BQIA 2UXNB 4DMVA 1WYCA 4PFPA 2V1DB 3V5SA 4J2CA 1BR4A 3FXEB 3O1JA 4QXCB 3SS1A 4AQFC 2YEVC 3B57A 4H63V 2NTXA 3AVSA 3Q2MA 3E0ZA 4QKNA 4L5GA 3MJXA 1MIYA 2BZBA 2KWIB 3F31A 4QX8B 4I43B 5L3BB 2A3DA 2ZLYA 1D1AA 2L8KA 4WBOA 4AXPA 4I55E 4FJOA 2BVLA 4JLEA 3W15B 2W62A 3I0QA 2LEHA 1FIOA 2EHOA 5JR9B 3MXZA 1UX4A 4O4HE 2RA1A 3HL6A 3KBUA 4ZI2C 3HKCE 3IF8B 2PBIA 4GK5E 3V5UA 3Q5XA 3ANWA 4PFOA 2CMRA 4IE5A 2NW7A 5HXRA 1CUNA 3N2KE 4MLKA 2XTLA 4F6RC 3KV9A 4M1PA 4UF0B 5LGNB 1IZNB 2DCFA 4A56A 4H9QC 5LBMA 3E22E 4TUYE 4KUMB 5J2TE 4ZI7E 3H3AA 2NW9A 4MHCA 3RYFE 2Y6XA 3AA0B 2RP4A 2X9WA 4YHJA 2L3LA 4EAHA 3CMLA 2C5JA 3ZPOA 2D5UA 2XAFB 4O4JE 2CXFA 2VL8A 3PUSA 3UUMA 3ZN1B 3MA9A 2CM0A 2ACXA 3F57A 1OXZA 4MFRA 2VKJA 4XZCA 5FNVE 2XQYA 2XAGB 4AQFA 3HA4A 2X67A 4EIWA 5LBQB 3LFMA 2WSSV 4ZHQE 1G73A 5L3EB 4N78D 2WMOA 4JEUB 4PJLA 4BJNA 3KVAA 2XUEA 4P0AA 1HG2A 4CXXA 4UV9B 2D0TA 4C90A 3DTOA 3AB3B 2NTYA 4ANJA 4KMCA 1D0ZA 4EYUA 3HR0A 4EZHA 4IHJE 4ZOLE 5CB4E 2LOSA 2JPFA 5DJQC 3SOLA 2A72A 2KWHA 3C98B 3E08A 2LE8A 3RYHE 4DO0A 5LHGB 3ZJ1A 5F3JA 4PW8A 4HGAA 5LA6E 2Q9QC 4AKHA 4UEMA 3CPZA 2H7VC 4ZS3A 3U3IA 1MMGA 5JREA 2H7OA 4KP3C 4H9RC 1LKXA 4GYRA 4ZI2D 3EVYA 4CXYA 2ZM0A 1MIWA 2X68A 3PURA 4UVAB 3IEEA 2KNDA 2W00A 1HS7A 4AKGA 3UTKA 4BJMA 1IAPA 1Z0PA 4YLHA 5IYZE 3CQCB 5HXSA 1X79A 2X9YA 2ZM2A 3VHLA 4IE4A 5JR9C 1D0YA 2I59A 1WLXA 4C91A 2V7LA 3CQGB 4QWNB 2VKOA 2CEAA 3MACA 3P8CD 4CQIA 2IAKA 5LOVE 2N1GA 4QHOA 3R6NA 5JDLA 3MK7C 4K0UA 3ZMTB 5JQGE 3GN5A 3D0TA 3C50A 3HKDE 3RKOA 3AAIA 4B6XA 3EDVA 3PUAA 3JC6C 5HXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  4OYJ A;  2HPJ A;  2CM0 A;  2HPL A;  4P0A A;  5LJM A;  2D5U A;  4P09 A;  5LJN A;  4JUY A;  4P0B A;  2CCQ A; 
#chains in the Genus database with same CATH topology
 2LLY A;  4TWH A;  4YSX A;  1BR1 A;  3GWH A;  2JRK A;  2VB6 A;  2XQ7 A;  3L8R A;  3RQW A;  4X62 T;  3JAD A;  5FY1 A;  3I9W A;  2WZI A;  3K3Q C;  3ZN0 B;  4DV1 T;  3UFE A;  4HWF A;  5LP6 E;  1Y01 A;  3RIU C;  4PJJ A;  2EHO B;  2C0S A;  3EI0 A;  1D1C A;  2DNX A;  4P0B A;  4H9S E;  5AQV B;  3I1A A;  3ZC1 A;  3CQX C;  2LRL A;  3AVR A;  1WR6 A;  3N9O A;  4HFE A;  4YY3 T;  4DBQ A;  4YSY A;  1UUS A;  1U5P A;  2XM2 A;  2LHN A;  3C51 A;  1LRZ A;  4EGW A;  5L4H A;  4TV8 E;  2LOP A;  4JYA T;  5EZY E;  4EZ4 A;  2XSA A;  5FP3 A;  4JEH B;  1J1J A;  4MBQ A;  2WWV A;  4UV8 B;  2YDS A;  3AAA B;  3A7M A;  1LVK A;  3F2E A;  1VCS A;  3GA8 A;  4IDQ A;  2K48 A;  4ISS A;  3CX7 B;  3QUJ A;  4WZX A;  4DND A;  2SPC A;  3ZST A;  2D9D A;  2QVA A;  2IC6 A;  2DHR A;  3AA1 B;  3ZYL A;  5F8P A;  3RHW A;  5LG3 A;  2XQ8 A;  4PNI A;  2KLQ A;  2VAS A;  1MNE A;  1XZY A;  2XAJ B;  2YDQ A;  3M65 A;  3BQL A;  2W67 A;  3RX6 A;  3KFW X;  3ZSS A;  3ZMV B;  3EHZ A;  4IST A;  2XHE B;  4Z91 A;  3C64 A;  5HXC A;  1ZKE A;  3KIN B;  2WM9 A;  2OV9 A;  4DVD A;  1EZ3 A;  1XMQ T;  4X1K E;  2X66 A;  2Q9Q A;  1HNZ T;  2JJ9 A;  2WWU A;  2ZM8 A;  2RPA A;  2CPT A;  3RIF A;  2LJL A;  2FUP A;  1HCI A;  3PUQ A;  4EB6 E;  2IC9 A;  3LDQ B;  4G2A A;  4TV9 E;  2XQ5 A;  5LMU T;  1YQ4 A;  2NP9 A;  4UXN B;  3PUW F;  5H6Q B;  2X9X A;  3AE8 A;  4Q25 A;  4DR6 T;  4CI2 B;  1T98 A;  3OBV E;  2CHO A;  5FXX A;  3PU8 A;  3ETV A;  3ZYK A;  2WDV A;  3PTR B;  2CRB A;  1QLB A;  4FI5 A;  1WYB A;  4ZS2 A;  2ES0 A;  3NVO A;  4EEB A;  3AA6 B;  4DV6 T;  2NWB A;  5ABF B;  5FL0 A;  5L2L A;  3O9X A;  4U2Y A;  3AE9 A;  2FJA A;  5KXJ A;  4HTE A;  3UU6 A;  5L3D B;  3VR9 A;  2IUB A;  4X1Y E;  4YHH T;  2NW8 A;  2BBJ A;  3DP7 A;  4ILA A;  2N2N A;  3EDU A;  2LHR A;  4ADZ A;  2LM9 A;  4ZEY A;  5CA1 E;  5KX5 E;  2Y48 B;  3GMI A;  3UU5 A;  3NKZ A;  3P7I A;  1S94 A;  5IHY A;  2YK0 A;  5LXT E;  4CI1 B;  3I0O A;  3A5X A;  1Y64 B;  2XY8 B;  1B7T A;  5J2U E;  3KV4 A;  2DLR A;  5JDN A;  4OYK A;  5FXV A;  1O3X A;  3ZEF B;  5ETW A;  2Q9Q B;  1HX8 A;  4X5T A;  5FMN A;  4DMV A;  2V1D B;  5HEH A;  3UFG A;  3AVS A;  3Q2M A;  4QKN A;  2KWI B;  2HHH T;  5AQH B;  2L8K A;  3W15 B;  4JLE A;  3AE3 A;  1OED C;  1FIO A;  1UX4 A;  2RA1 A;  2NR4 A;  2PBI A;  4GK5 E;  3TLT A;  3ANW A;  1HNW T;  3Q5E A;  4MLK A;  3QB5 K;  5LGN B;  1IZN B;  3AE6 A;  1KF6 A;  2DCF A;  3E22 E;  4TUY E;  3H3A A;  4DR1 T;  4MHC A;  3RYF E;  1W0A A;  2RP4 A;  5AQN B;  2X9W A;  4EAH A;  3CML A;  3PUV F;  2XAF B;  4O4J E;  2ACX A;  4XZC A;  5FNV E;  2X67 A;  2V6Y A;  1G73 A;  4JEU B;  5HEG A;  2XUE A;  4CXX A;  4YXD A;  4UV9 B;  1XMO T;  3DTO A;  1XDO A;  3TLU A;  5AQU B;  2NTY A;  4ANJ A;  5CFB A;  2KWH A;  2V5D A;  1KFY A;  4LFB T;  4LF6 T;  4ILC A;  4B3M T;  4CXY A;  1Z8U A;  4UVA B;  2OLT A;  2KND A;  2V5C A;  4DV3 T;  5LB7 B;  4AKG A;  5HXS A;  3CQC B;  5JR9 C;  4HWH A;  3RF1 A;  4U3C A;  2X0Y A;  1HX1 B;  3CQG B;  2CEA A;  3MAC A;  2UXD T;  3JC6 C;  4JI0 T;  2DI4 A;  2W0G A;  3RRW A;  5JDM A;  3N5L A;  1IJ5 A;  3RI5 A;  2VUR A;  2WU2 A;  3IBP A;  2MBG A;  4DUZ T;  4WNK A;  4LFA T;  1AJ3 A;  2E9X B;  2BKO A;  2LSY A;  2BKN A;  2E2A A;  5HWX A;  3ZJ2 A;  5A1L A;  2BVM A;  4IIJ E;  3RGL A;  2LT3 A;  2VK9 A;  3NWI A;  3HKE E;  4XAX B;  4ILB A;  3PJA J;  2WB5 A;  4YTN A;  4HFV A;  2KSR A;  2JIW A;  4IE6 A;  2WAU A;  1US7 B;  4L0R A;  4IL9 A;  1HR0 T;  2E9X D;  1ZP0 A;  3K3O A;  3C4W A;  2JMK A;  1BR2 A;  3H37 A;  2BG9 C;  2FJD A;  5L3F B;  4IDP A;  3A8Y C;  3U78 A;  3JC6 D;  3UUN A;  5L3C B;  3ETU A;  4E7Z A;  5AQL B;  1D1B A;  3TLW A;  4LF9 T;  2IW5 B;  3P50 A;  4BAY B;  3QK6 A;  1HFA A;  3UUB A;  4AKI A;  1HF8 A;  3HKB E;  5JDQ A;  4EYY R;  3VU7 H;  2M6I A;  3P4P A;  4WYV A;  1X9B A;  2GK9 A;  1N34 T;  5M4Y A;  4JV5 T;  3ONL C;  2YDR A;  3S4U A;  3EAM A;  5LGU B;  1JNR A;  4UIG A;  5EK4 A;  4P1N A;  2UUA T;  3CK6 A;  2Y8D A;  3T1Y T;  5AQK B;  3T8O A;  1KNZ A;  4JI2 T;  5FKY A;  4A97 A;  4L9I A;  3Q5D A;  4E7S A;  2EHO C;  1MIV A;  4ZI3 C;  3L09 A;  3VKH A;  5JRC B;  3OYX A;  4CN6 A;  1VOM A;  3FZM B;  2X0H A;  1UGO A;  2B76 A;  2LSI A;  3AEB A;  2KIN B;  1DU2 A;  2CHN A;  3R84 B;  3K8P C;  3O1I A;  3TLV A;  2Z6E A;  4B3T T;  2WQY A;  1XDP A;  3BQK A;  2XPK A;  2NOX A;  4ERR A;  3ZC0 A;  2HPJ A;  1KNP A;  3ESL A;  4F8H A;  2QGS A;  4H9O C;  4UF0 A;  4NXM T;  1FEW A;  4H9P C;  4NIQ A;  5C8Y E;  4DV4 T;  2JQ9 A;  3SWH A;  3RKG A;  1R8I A;  4DUY T;  1E7P A;  4COF A;  2CA5 A;  2EHO D;  4HWI B;  4ZI3 D;  1FJG T;  3WAK A;  1KK7 A;  2V7J A;  4X1I E;  2VL0 A;  3I9Y A;  1YW0 A;  4UVC B;  4CN1 A;  2DWK A;  2CE7 A;  2D0U A;  1FMW A;  3RRC A;  1N33 T;  3DJB A;  3NBX X;  5FXZ A;  2LSK A;  2LKG A;  2N9D A;  1T7S A;  1WCR A;  1YD8 G;  3CKD A;  3FBZ A;  4YJ2 E;  4HEA A;  4NPP A;  5IWA T;  3ZT7 A;  4NUV A;  4HFH A;  4OFZ A;  3VKG A;  5ADX L;  3CX8 B;  3AXJ A;  4JI1 T;  3P4S A;  2H3R A;  2VVN A;  4I4T E;  2P9B A;  5GON E;  2LSJ A;  5AFU L;  2YN6 A;  1D0X A;  3JAE A;  5HXE A;  2D2S A;  1S35 A;  2V8S V;  2JQH A;  3T1H T;  4JBW F;  5E0O A;  2MTQ A;  1FMV A;  4U33 A;  3VRA A;  4NXN T;  3SRZ A;  5FVL A;  4WBN E;  3L3P A;  5AQJ B;  5HAX A;  2ACZ A;  3Q9D A;  4EXT A;  2WDR A;  4I0U A;  3BQI A;  3IA3 A;  4PFP A;  2W2U A;  3SS1 A;  4QXC B;  3FZF B;  3O1J A;  4AQF C;  4L5G A;  3MJX A;  2BZB A;  4WBO A;  4FJO A;  2BVL A;  5FVK A;  3I0Q A;  5FL1 A;  2HN2 A;  4O4H E;  2IHR 1;  4ZI2 C;  3HKC E;  3IF8 B;  4LF4 T;  3Q5X A;  2E5V A;  2XTL A;  4F6R C;  4UF0 B;  3RLF F;  4KX6 A;  1NEK A;  3FZH B;  3UU8 A;  2NW9 A;  2Y6X A;  1HNX T;  5AQT B;  4EV6 A;  2C5J A;  3ZPO A;  2VL8 A;  3MA9 A;  4MFR A;  1OXZ A;  3HA4 A;  4U31 A;  5C2T A;  2YOE A;  3LFM A;  1HG2 A;  3HR0 A;  3AE4 A;  1I6Z A;  1GQE A;  2JPF A;  2LE8 A;  3RYH E;  3AE1 A;  3ZJ1 A;  5F3J A;  4ZXL A;  4PW8 A;  2Q9Q C;  2H7V C;  3U3I A;  1MMG A;  1L0V A;  3RIA A;  1LKX A;  3AXJ B;  4ZI2 D;  3EVY A;  3AE5 A;  3OPC A;  2X68 A;  4CN4 A;  3IEE A;  2W00 A;  2FJB A;  3VHL A;  1D0Y A;  2I59 A;  4C91 A;  2V7L A;  3P4R A;  2IAK A;  4YTM A;  4HWD A;  2WY2 A;  4QHO A;  2J47 A;  3ZMT B;  4DV2 T;  5JQG E;  3FZL B;  1I94 T;  3D0T A;  2PG8 A;  2QYW A;  1G8X A;  3RYC E;  5EK2 A;  5LNK A;  2OA5 A;  3NZQ A;  2CLY B;  2W63 A;  3NZP A;  1QSD A;  1MND A;  5F5W A;  3MKD A;  2XQ9 A;  1XNQ T;  3TKL B;  4LF7 T;  4O4I E;  3ZMU B;  5LYJ E;  2VVS A;  2YIN A;  2VKD A;  5JTG A;  2LKH A;  5LJN A;  2Q9Q D;  2I0M A;  5BMV E;  4IDZ A;  3X1D A;  3LBX A;  4I50 E;  4HN9 A;  2CCQ A;  2C5I T;  3ONX A;  4B3R T;  5L3G B;  4JI5 T;  1OWA A;  1IBM T;  5LGT B;  4LF8 T;  4O2A E;  2CBJ A;  2E8I A;  3OJA A;  5FY0 A;  4X64 T;  5JVD E;  4U2Z A;  4KHP T;  2LSG A;  2PJQ A;  4DMW A;  5FY7 A;  4IE7 A;  4EED A;  1W09 A;  5JDF A;  5AQS B;  2YU1 A;  3RYI E;  4BA9 A;  1ZHC A;  3RPU A;  3JCF A;  3FBL A;  4UVB B;  2CXD A;  1VCT A;  4JI4 T;  1IJ6 A;  2J62 A;  2E9X C;  3UUX B;  3UT5 E;  3MZK B;  5AQR B;  4O8S A;  4DR7 T;  3TLS A;  2XQ6 A;  4CXW A;  1NAF A;  3NRY A;  5HYA A;  4LML A;  5J1G A;  4JUY A;  3H3M A;  3C4Z A;  4ILU A;  4KBM B;  3FB2 A;  2WZH A;  4TX5 A;  1E1H B;  3AEG A;  3ZKR A;  2VKH A;  3RC8 A;  4QH1 A;  2BS4 A;  3WI3 A;  5HCM A;  3O1H A;  2JQQ A;  2BS2 A;  1YQ3 A;  2V26 A;  3PV0 F;  3OTO T;  2HH7 A;  4IDO A;  3RQU A;  2HPL A;  3ZCJ A;  3ANW B;  4G63 A;  3PUG A;  5H6R B;  3LBX B;  2XJ7 A;  1N32 T;  4ZZB A;  4AKR B;  5DAB A;  4V1A v;  4HKA A;  3CWZ B;  1QUU A;  3FXD B;  2KMF A;  1XNR T;  2WU5 A;  2V7I A;  3UU3 A;  5FXW A;  1UK5 A;  4PK5 A;  1NEN A;  2XSB A;  3HI2 A;  2MYS A;  4IE0 A;  4LF5 T;  4IDN A;  3KV5 A;  1IBK T;  3C4X A;  1SUM B;  2BBH A;  4LMJ A;  2V6Y B;  3ZCI A;  3RIU A;  2IDO B;  3AE7 A;  2J1D G;  2A9U A;  5HEU A;  4O2B E;  1HTJ F;  4AIS A;  2WDQ A;  2AXD S;  4TWF A;  2FJE A;  3AEF A;  4HE8 A;  2YU2 A;  3VRB A;  3LK4 2;  2XQ4 A;  1NWM X;  4HFI A;  3Q5W A;  3IHR A;  1BR0 A;  4H63 H;  1VRB A;  2XQA A;  4LFC T;  3N9M A;  3EUH A;  2KT9 A;  5AQF B;  3O4X E;  5HEO A;  4DID B;  2WS3 A;  3NRX A;  2X0L B;  3PUX F;  4QX7 B;  3EAB A;  3ZYM A;  3N2G E;  5BR8 T;  2R6G F;  1YKE B;  2QA7 A;  2MOZ A;  4P09 A;  4IGU A;  1HG5 A;  3N9P A;  5AQG B;  4OX9 T;  3KDS E;  3CX6 B;  1WYC A;  2FBW A;  2J4G A;  2E5L T;  4J2C A;  2YEV C;  3B57 A;  5AQP B;  4TNW A;  4QX8 B;  2DL1 A;  3L39 A;  2A3D A;  2W4X A;  4AXP A;  2IIU A;  2H89 A;  3MXZ A;  3KBU A;  4TNV A;  4IE5 A;  1CUN A;  3N2K E;  4M1P A;  2K3W A;  5HCJ A;  4A56 A;  4H9Q C;  5LBM A;  4IL4 A;  5J2T E;  4QH4 A;  2F4V T;  1KEY A;  2L3L A;  3PUS A;  3UUM A;  4JI8 T;  2CM0 A;  2VKJ A;  4AQF A;  4EIW A;  5LBQ B;  5L3E B;  4N78 D;  2WMO A;  3KVA A;  5CJ5 A;  4C90 A;  5AQM B;  5ABF A;  4KMC A;  1D0Z A;  4EYU A;  4EZH A;  2PTF A;  2LOS A;  5DJQ C;  2A72 A;  3E08 A;  4DO0 A;  5LHG B;  4HGA A;  4AKH A;  1W9R A;  4UEM A;  5JRE A;  4H9R C;  5AQO B;  3P4Q A;  2ZM0 A;  2MAW A;  2AE9 A;  1HS7 A;  1M62 A;  4BJM A;  1Z0P A;  4YLH A;  3QOF A;  3LSV A;  3UQ4 A;  4IE4 A;  1E2A A;  1WFD A;  4CQI A;  5LOV E;  3R6N A;  5JDL A;  3MK7 C;  3GN5 A;  3HKD E;  3RKO A;  3AAI A;  4Z90 A;  3EDV A;  3PUA A;  2UUC T;  5HXH A;  4O4L E;  4YFS A;  4AQG A;  2CWY A;  4A98 A;  5LJM A;  3ZT5 A;  4GOU A;  5LCY A;  1MMD A;  2QRX A;  2A2F X;  2WBL A;  4X20 E;  4K0K T;  3J7Y q;  5J0Z A;  5LHH B;  3QB5 A;  4Z8X A;  4X66 T;  4KHZ F;  3AEA A;  1N36 T;  3P4W A;  4JI7 T;  1UCU A;  3LK3 B;  2X51 A;  4DBR A;  3WAJ A;  4GKK T;  2DWG A;  5HEJ A;  5JH7 E;  2XM1 A;  4WW0 A;  4PJM A;  2CWO A;  4DR2 T;  4DV0 T;  2XQ3 A;  5L4E A;  4IRE A;  3ZMZ B;  2CXL A;  2V7K A;  1SHZ C;  3N9N A;  4DR4 T;  3JAF A;  3QNU A;  1JNZ A;  5CA0 E;  2K5B B;  3FZK B;  2PFV A;  4IT4 A;  4PK4 A;  5CGM A;  3CVR A;  4TN7 B;  4MAL A;  3LK2 B;  3PUZ F;  1OED A;  3RC3 A;  5LMN T;  1MMN A;  3BK9 A;  1J5W A;  3N9Q A;  4KI0 F;  3AE2 A;  1LVF A;  4DR5 T;  5AQI B;  4PK6 A;  1MMA A;  3ZMS B;  4NUU A;  2ODU A;  2UXB T;  4YSZ A;  2ZM6 T;  4XBF B;  3RH3 A;  3PU3 A;  1SA0 E;  2CLY C;  4DR3 T;  4GK0 E;  3ZLI A;  2ZMA A;  3PUY F;  2C5K T;  1XWM A;  2B1E A;  4JI6 T;  3KV6 A;  4TWD A;  5HWY A;  2BKP A;  3AAE B;  2W61 A;  2BDE A;  4UR9 A;  3PJA A;  2IML A;  2CBI A;  2VWA A;  4U7Y A;  4CZZ B;  1U4Q A;  3GN5 B;  1OED E;  2UU9 T;  2K24 A;  2W66 A;  5LHI B;  5FYM A;  2WCA A;  3OYZ A;  4ASK A;  4QXH B;  2I6H A;  3KVB A;  5LG4 A;  3N2O A;  4LMK A;  3PE0 A;  1YXR A;  2E9X A;  3ABV A;  3UU4 A;  4YJ3 E;  4AI6 A;  4UEL A;  3OVU A;  5JR9 A;  1KNR A;  5DQV A;  4GYS A;  5JDG A;  5KMG P;  4CI3 B;  4X65 T;  1ZOY A;  4YT0 A;  4DV7 T;  4GIW A;  3KBT A;  5TAO A;  2UXX B;  2VQF T;  2ODV A;  4AKL A;  5ABG A;  4H9N C;  3AA7 B;  1V9D A;  4JI3 T;  2XAS B;  2MPK A;  4QXB B;  3PDY A;  5EK3 A;  2K9A A;  4HFB A;  4U74 A;  1IBL T;  2G0U A;  3B13 A;  1M7K A;  4OK0 A;  1OED B;  5C3J A;  4DV5 T;  3AEE A;  1ZEE A;  4OHF A;  1H7C A;  1UUR A;  4ZZC A;  4HWC A;  3J9X 1;  4EOZ B;  1WRD A;  2WP9 A;  3AED A;  5KDM C;  2V7M A;  3N9L A;  4QH5 A;  2M67 A;  3LJC A;  1YKH B;  4OYJ A;  2L9Q A;  1ZV4 X;  2KZ7 B;  2BS3 A;  2XAQ B;  2BG9 A;  2JMH A;  3UUL A;  3SFE A;  3B5M A;  2M6B A;  5ABH A;  4B3S T;  5IUX A;  3QC9 A;  4TZ4 C;  4PAG A;  3LG7 A;  5DQW A;  2KXP B;  2V6X A;  3ONJ A;  3OKQ A;  3FHN A;  5JDH A;  3K3N A;  2X9H A;  5JRC A;  1CHU A;  2XAH B;  4PJN A;  2YKS A;  4U72 A;  2WMN A;  1UX5 A;  4A5X A;  3UQ7 A;  2UXN B;  4GKJ T;  3V5S A;  1WR0 A;  1BR4 A;  3FXE B;  4HFC A;  1SE7 A;  3SFD A;  2JQK A;  2NTX A;  3AEC A;  4H63 V;  3E0Z A;  1MIY A;  5L3B B;  4I43 B;  2XZE A;  3F31 A;  2ZLY A;  1D1A A;  1J5E T;  4I55 E;  3K1S A;  2W62 A;  1T8B A;  2LEH A;  2EHO A;  5JR9 B;  3HL6 A;  2BG9 E;  3V5U A;  4PFO A;  2CMR A;  2NW7 A;  5HXR A;  4AIU A;  3KV9 A;  3M3Z B;  2UXC T;  4KUM B;  4ZI7 E;  3AA0 B;  3G06 A;  4YHJ A;  5AQQ B;  3ZT6 A;  2D5U A;  1T72 A;  2CXF A;  3ZN1 B;  3F57 A;  2XQY A;  2XAG B;  2WSS V;  4ZHQ E;  4PJL A;  4BJN A;  2UUB T;  4P0A A;  2LRK A;  2D0T A;  3AB3 B;  2HN1 A;  4IHJ E;  2LM2 A;  4ZOL E;  5CB4 E;  3SOL A;  3C98 B;  3CIR A;  4U7I A;  5LA6 E;  4ZS3 A;  3CPZ A;  4HFD A;  2H7O A;  4KP3 C;  4GYR A;  1MIW A;  3PUR A;  2BG9 B;  2VQE T;  1W0B A;  3UTK A;  1IAP A;  5IYZ E;  4YTP A;  1X79 A;  2X9Y A;  2ZM2 A;  1WLX A;  2H88 A;  2VKO A;  4QWN B;  3P8C D;  3VR8 A;  5ABE A;  2N1G A;  4K0U A;  5L47 A;  3C50 A;  4B6X A;  4AQY T; 
#chains in the Genus database with same CATH homology
 2PG8 A;  4O4L E;  1G8X A;  3RYC E;  2DI4 A;  4YFS A;  5EK2 A;  4AQG A;  2CWY A;  5LNK A;  1BR1 A;  2OA5 A;  3NZQ A;  2W0G A;  3RRW A;  2CLY B;  2W63 A;  5JDM A;  3N5L A;  3NZP A;  5LJM A;  1IJ5 A;  1QSD A;  3GWH A;  1MND A;  2JRK A;  2VB6 A;  3IBP A;  4GOU A;  5LCY A;  1MMD A;  3MKD A;  2MBG A;  3TKL B;  4WNK A;  1AJ3 A;  2E9X B;  5FY1 A;  3I9W A;  2A2F X;  2WBL A;  2LSY A;  4X20 E;  3K3Q C;  3ZN0 B;  3J7Y q;  4O4I E;  5LHH B;  3ZMU B;  4Z8X A;  3UFE A;  5HWX A;  5LYJ E;  3ZJ2 A;  5LP6 E;  2YIN A;  2VKD A;  5A1L A;  2BVM A;  4IIJ E;  2LT3 A;  5LJN A;  2Q9Q D;  4PJJ A;  2VK9 A;  5BMV E;  2EHO B;  4IDZ A;  2C0S A;  3LBX A;  1D1C A;  3HKE E;  4XAX B;  2DNX A;  4I50 E;  4H9S E;  2CCQ A;  4HN9 A;  4P0B A;  2C5I T;  3I1A A;  1UCU A;  3ZC1 A;  3CQX C;  3AVR A;  3ONX A;  4HFV A;  3LK3 B;  2X51 A;  1WR6 A;  3N9O A;  4DBR A;  3WAJ A;  4DBQ A;  5L3G B;  4IE6 A;  1OWA A;  2DWG A;  5JH7 E;  2WAU A;  1US7 B;  4L0R A;  5LGT B;  4WW0 A;  2E9X D;  4PJM A;  2CWO A;  4O2A E;  3K3O A;  3C4W A;  1U5P A;  3ZMZ B;  2LHN A;  2CXL A;  2E8I A;  2V7K A;  3C51 A;  2JMK A;  3OJA A;  1BR2 A;  5FY0 A;  1LRZ A;  1SHZ C;  5JVD E;  3N9N A;  4TV8 E;  2LOP A;  3H37 A;  5CA0 E;  5EZY E;  5L3F B;  2K5B B;  4EZ4 A;  2PFV A;  4PK4 A;  5FP3 A;  3CVR A;  4JEH B;  2LSG A;  4TN7 B;  2PJQ A;  4MAL A;  4MBQ A;  3LK2 B;  3U78 A;  3JC6 D;  3UUN A;  5L3C B;  3ETU A;  4E7Z A;  4DMW A;  3RC3 A;  4UV8 B;  5FY7 A;  1D1B A;  1MMN A;  3BK9 A;  3AAA B;  3N9Q A;  4IE7 A;  1LVF A;  1LVK A;  2IW5 B;  3F2E A;  5JDF A;  4PK6 A;  3GA8 A;  1MMA A;  2YU1 A;  3RYI E;  4BAY B;  2K48 A;  4ISS A;  3ZMS B;  3QK6 A;  4NUU A;  4BA9 A;  1HFA A;  2ODU A;  3CX7 B;  1HF8 A;  4AKI A;  1ZHC A;  3HKB E;  5JDQ A;  3QUJ A;  3RPU A;  4DND A;  4EYY R;  2SPC A;  3FBL A;  4UVB B;  3RH3 A;  3PU3 A;  3VU7 H;  4XBF B;  1SA0 E;  2CXD A;  2IC6 A;  2DHR A;  2GK9 A;  5M4Y A;  2CLY C;  3AA1 B;  3ZYL A;  4GK0 E;  5F8P A;  3ZLI A;  3S4U A;  2ZMA A;  1IJ6 A;  2C5K T;  5LGU B;  4PNI A;  2KLQ A;  2VAS A;  1MNE A;  4UIG A;  2XAJ B;  5EK4 A;  2B1E A;  2E9X C;  3M65 A;  3UUX B;  3UT5 E;  3BQL A;  3KV6 A;  5HWY A;  3RX6 A;  2Y8D A;  3KFW X;  3MZK B;  3T8O A;  1KNZ A;  3ZMV B;  4O8S A;  4L9I A;  4IST A;  4E7S A;  2XHE B;  2EHO C;  3AAE B;  1MIV A;  2W61 A;  3L09 A;  1NAF A;  2BDE A;  3NRY A;  3C64 A;  4ZI3 C;  5HXC A;  4CXW A;  5HYA A;  1ZKE A;  3VKH A;  3KIN B;  2WM9 A;  5J1G A;  4DVD A;  5JRC B;  3OYX A;  2VWA A;  4JUY A;  4CZZ B;  1VOM A;  1U4Q A;  3GN5 B;  1EZ3 A;  3C4Z A;  4X1K E;  4ILU A;  2X66 A;  2LSI A;  2Q9Q A;  2K24 A;  5LHI B;  5FYM A;  2KIN B;  4KBM B;  3FB2 A;  4TX5 A;  3OYZ A;  1E1H B;  3R84 B;  3K8P C;  4QXH B;  4ASK A;  2JJ9 A;  2VKH A;  2WWU A;  3KVB A;  3RC8 A;  2ZM8 A;  3O1I A;  5LG4 A;  2Z6E A;  3N2O A;  3WI3 A;  3PE0 A;  2LJL A;  3O1H A;  2JQQ A;  3BQK A;  2E9X A;  1HCI A;  2NOX A;  2V26 A;  3PUQ A;  4ERR A;  4YJ3 E;  4AI6 A;  4UEL A;  3ZC0 A;  4EB6 E;  2HPJ A;  2IC9 A;  5JR9 A;  3ESL A;  5DQV A;  4GYS A;  2HH7 A;  5JDG A;  5KMG P;  2QGS A;  4CI3 B;  2HPL A;  3ZCJ A;  3ANW B;  4G2A A;  4G63 A;  4H9O C;  4GIW A;  4TV9 E;  3PUG A;  5H6R B;  3LBX B;  3KBT A;  4UF0 A;  1FEW A;  4H9P C;  2NP9 A;  5C8Y E;  5TAO A;  4UXN B;  3SWH A;  4AKR B;  5H6Q B;  2UXX B;  5DAB A;  2X9X A;  4V1A v;  4HKA A;  3CWZ B;  1QUU A;  3FXD B;  2KMF A;  2ODV A;  4AKL A;  4CI2 B;  2V7I A;  1T98 A;  3OBV E;  4H9N C;  5FXW A;  4PK5 A;  3AA7 B;  1V9D A;  5FXX A;  2XAS B;  3HI2 A;  2CA5 A;  2EHO D;  4QXB B;  3PDY A;  2MYS A;  3ETV A;  3PU8 A;  4IE0 A;  5EK3 A;  3ZYK A;  4ZI3 D;  3WAK A;  2K9A A;  3PTR B;  1KK7 A;  2V7J A;  3KV5 A;  4X1I E;  3C4X A;  4FI5 A;  3I9Y A;  1YW0 A;  4U74 A;  1WYB A;  4UVC B;  4ZS2 A;  2G0U A;  2DWK A;  2ES0 A;  2CE7 A;  3B13 A;  3ZCI A;  3AA6 B;  4OK0 A;  2D0U A;  1FMW A;  2NWB A;  3RRC A;  5L2L A;  2J1D G;  3O9X A;  1ZEE A;  3DJB A;  3NBX X;  4OHF A;  5FXZ A;  1H7C A;  2LSK A;  1HTJ F;  4O2B E;  2N9D A;  1YD8 G;  3CKD A;  4HTE A;  3J9X 1;  3FBZ A;  4EOZ B;  4YJ2 E;  4HEA A;  1WRD A;  4HE8 A;  5KDM C;  2YU2 A;  4NUV A;  4OFZ A;  2V7M A;  3N9L A;  3LK4 2;  2M67 A;  5L3D B;  3VKG A;  3LJC A;  5ADX L;  1YKH B;  3CX8 B;  4X1Y E;  1NWM X;  2NW8 A;  4OYJ A;  2H3R A;  2L9Q A;  1ZV4 X;  2KZ7 B;  3DP7 A;  2XAQ B;  2JMH A;  3UUL A;  3Q5W A;  2N2N A;  3EDU A;  2LHR A;  3IHR A;  2LM9 A;  4ADZ A;  4I4T E;  2P9B A;  5CA1 E;  5KX5 E;  3QC9 A;  2Y48 B;  3GMI A;  5GON E;  2LSJ A;  4TZ4 C;  5AFU L;  3P7I A;  1BR0 A;  4PAG A;  1S94 A;  4H63 H;  1VRB A;  5IHY A;  3N9M A;  3EUH A;  3LG7 A;  2KT9 A;  1D0X A;  5DQW A;  5HXE A;  3O4X E;  2YK0 A;  2D2S A;  5LXT E;  1S35 A;  3NRX A;  2X0L B;  2KXP B;  4QX7 B;  3ZYM A;  4CI1 B;  3N2G E;  1YKE B;  3OKQ A;  5E0O A;  3FHN A;  2MTQ A;  5JDH A;  1FMV A;  3SRZ A;  3I0O A;  3A5X A;  3K3N A;  2X9H A;  5JRC A;  4WBN E;  2QA7 A;  3L3P A;  1Y64 B;  2MOZ A;  4P09 A;  2XAH B;  1B7T A;  5J2U E;  3KV4 A;  4IGU A;  1HG5 A;  2DLR A;  4PJN A;  4U72 A;  5JDN A;  4OYK A;  2WMN A;  5FXV A;  1O3X A;  3N9P A;  1UX5 A;  3ZEF B;  5ETW A;  2Q9Q B;  5HAX A;  1HX8 A;  3Q9D A;  4EXT A;  3KDS E;  3CX6 B;  5FMN A;  3BQI A;  2UXN B;  4DMV A;  1WYC A;  4PFP A;  2V1D B;  3V5S A;  4J2C A;  1BR4 A;  3FXE B;  3O1J A;  4QXC B;  3SS1 A;  4AQF C;  2YEV C;  3B57 A;  4H63 V;  2NTX A;  3AVS A;  3Q2M A;  3E0Z A;  4QKN A;  4L5G A;  3MJX A;  1MIY A;  2BZB A;  2KWI B;  3F31 A;  4QX8 B;  4I43 B;  5L3B B;  2A3D A;  2ZLY A;  1D1A A;  2L8K A;  4WBO A;  4AXP A;  4I55 E;  4FJO A;  2BVL A;  4JLE A;  3W15 B;  2W62 A;  3I0Q A;  2LEH A;  1FIO A;  2EHO A;  5JR9 B;  3MXZ A;  1UX4 A;  4O4H E;  2RA1 A;  3HL6 A;  3KBU A;  4ZI2 C;  3HKC E;  3IF8 B;  2PBI A;  4GK5 E;  3V5U A;  3Q5X A;  3ANW A;  4PFO A;  2CMR A;  4IE5 A;  2NW7 A;  5HXR A;  1CUN A;  3N2K E;  4MLK A;  2XTL A;  4F6R C;  3KV9 A;  4M1P A;  4UF0 B;  5LGN B;  1IZN B;  2DCF A;  4A56 A;  4H9Q C;  5LBM A;  3E22 E;  4TUY E;  4KUM B;  5J2T E;  4ZI7 E;  3H3A A;  2NW9 A;  4MHC A;  3RYF E;  2Y6X A;  3AA0 B;  2RP4 A;  2X9W A;  4YHJ A;  2L3L A;  4EAH A;  3CML A;  2C5J A;  3ZPO A;  2D5U A;  2XAF B;  4O4J E;  2CXF A;  2VL8 A;  3PUS A;  3UUM A;  3ZN1 B;  3MA9 A;  2CM0 A;  2ACX A;  3F57 A;  1OXZ A;  4MFR A;  2VKJ A;  4XZC A;  5FNV E;  2XQY A;  2XAG B;  4AQF A;  3HA4 A;  2X67 A;  4EIW A;  5LBQ B;  3LFM A;  2WSS V;  4ZHQ E;  1G73 A;  5L3E B;  4N78 D;  2WMO A;  4JEU B;  4PJL A;  4BJN A;  3KVA A;  2XUE A;  4P0A A;  1HG2 A;  4CXX A;  4UV9 B;  2D0T A;  4C90 A;  3DTO A;  3AB3 B;  2NTY A;  4ANJ A;  4KMC A;  1D0Z A;  4EYU A;  3HR0 A;  4EZH A;  4IHJ E;  4ZOL E;  5CB4 E;  2LOS A;  2JPF A;  5DJQ C;  3SOL A;  2A72 A;  2KWH A;  3C98 B;  3E08 A;  2LE8 A;  3RYH E;  4DO0 A;  5LHG B;  3ZJ1 A;  5F3J A;  4PW8 A;  4HGA A;  5LA6 E;  2Q9Q C;  4AKH A;  4UEM A;  3CPZ A;  2H7V C;  4ZS3 A;  3U3I A;  1MMG A;  5JRE A;  2H7O A;  4KP3 C;  4H9R C;  1LKX A;  4GYR A;  4ZI2 D;  3EVY A;  4CXY A;  2ZM0 A;  1MIW A;  2X68 A;  3PUR A;  4UVA B;  3IEE A;  2KND A;  2W00 A;  1HS7 A;  4AKG A;  3UTK A;  4BJM A;  1IAP A;  1Z0P A;  4YLH A;  5IYZ E;  3CQC B;  5HXS A;  1X79 A;  2X9Y A;  2ZM2 A;  3VHL A;  4IE4 A;  5JR9 C;  1D0Y A;  2I59 A;  1WLX A;  4C91 A;  2V7L A;  3CQG B;  4QWN B;  2VKO A;  2CEA A;  3MAC A;  3P8C D;  4CQI A;  2IAK A;  5LOV E;  2N1G A;  4QHO A;  3R6N A;  5JDL A;  3MK7 C;  4K0U A;  3ZMT B;  5JQG E;  3GN5 A;  3D0T A;  3C50 A;  3HKD E;  3RKO A;  3AAI A;  4B6X A;  3EDV A;  3PUA A;  3JC6 C;  5HXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...