5LJNA

Structure of the hoip pub domain bound to spata2 pim peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
173
structure length
173
Chain Sequence
b'GEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
molecule keywords E3 ubiquitin-protein ligase RNF31
source organism Homo sapiens
molecule tags Ligase
total genus 56
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljnA00
2CM0A 4P09A 2CCQA 4OYJA 5LJNA 2HPLA 4P0AA 4JUYA 2HPJA 4P0BA 5LJMA 4OYKA 2D5UA
chains in the Genus database with same CATH superfamily
4PJMA 2M6BA 2A9UA 3ZKRA 4DV1T 3V5UA 4UVAB 4O2BE 4LF9T 1GQEA 3AEGA 4WW0A 2WSSV 1MNDA 2V7LA 4A98A 4GK0E 5CA1E 3A7MA 4U74A 1Z0PA 3K3QC 2XQ5A 2WS3A 1HX8A 3N9MA 4P1NA 4YTNA 5HXHA 3C50A 2E9XA 3CIRA 4JEHB 4NPPA 2UXDT 2VURA 1S35A 3N5LA 3VR8A 1E7PA 4EB6E 2WP9A 5JDMA 3VRAA 2UXNB 1FJGT 3OYXA 3I0OA 2XASB 3UU4A 2A72A 5ADXL 3RRWA 5FXWA 2UUAT 3UUMA 3A5XA 4A97A 4HFIA 2AXDS 2NW7A 3CX8B 4TWFA 1XMOT 2CRBA 4YJ3E 3I0QA 2CHNA 1AJ3A 1KNRA 2Z6EA 4N78D 2H7VC 1NWMX 2K5BB 3ABVA 2E5VA 1W9RA 2JQQA 2P9BA 1HTJF 4DV5T 2CLYC 4K0UA 2IUBA 1OXZA 3EI0A 1WR0A 3FBZA 5HEUA 3ZT7A 3MJXA 5DQWA 1MIYA 1IBLT 1KF6A 4MHCA 4ZZCA 5AQOB 3LK3B 4LF8T 4PJLA 3VKHA 5ABHA 4U7IA 2LHNA 3RYIE 2X0HA 2BBHA 4ILUA 5LBQB 2KLQA 5CFBA 3JCFA 4U33A 2DWGA 1HF8A 4PFPA 1YKEB 1WFDA 3CPZA 3QB5K 1XNRT 3FB2A 4HWCA 5L4HA 1T98A 4H9QC 2IMLA 3Q5WA 3K3OA 4DV2T 3UQ4A 5H6QB 4O8SA 4PNIA 2E8IA 4HFDA 3GWHA 3IEEA 2I59A 2X67A 1SHZC 3PU8A 3T8OA 4ZI7E 4P0AA 5JDFA 3C4WA 4I43B 4QH1A 4MBQA 2EHOD 4LFBT 2VASA 3CVRA 5LG3A 4JI2T 3AE8A 4YFSA 4UEMA 1MMNA 1US7B 3PDYA 1KFYA 2M67A 2HH7A 3CX6B 3RPUA 3RC3A 3JADA 2ODVA 4O2AE 3RH3A 2CE7A 3KV5A 4OK0A 1IJ6A 4C90A 2VKOA 4HFHA 1JNRA 2PBIA 2V7IA 2D2SA 1YKHB 4Q25A 2XQ4A 1MMAA 1B7TA 2C5KT 4GKJT 3N9NA 3HKBE 4A5XA 5FL1A 1EZ3A 1XMQT 2FJEA 2DWKA 3ANWB 2H3RA 5JDQA 4P0BA 2XAFB 4QWNB 2SPCA 3AEFA 4PK6A 2VKJA 2C5JA 3CKDA 2JJ9A 4TWDA 3P4RA 3UUBA 2L3LA 4ILCA 2Y48B 4CI3B 1X9BA 3AE9A 2UUCT 4B3ST 3TLSA 1OEDE 5F8PA 4HGAA 1MMDA 4PAGA 5AQMB 4PJJA 5L3DB 1IBMT 3UU6A 2EHOC 4H9RC 4TZ4C 4TUYE 3MXZA 4EIWA 3RGLA 3PUWF 3AE4A 2HPJA 5ABFA 2JMKA 3KV4A 1YQ3A 4HKAA 5HYAA 2UUBT 4B3MT 3RKGA 3OYZA 1UX5A 3P4QA 4GOUA 3RQWA 2KMFA 4ZEYA 2DLRA 2V6YB 2XUEA 1UURA 2H88A 3EDUA 2CXFA 5AQKB 1IJ5A 5C2TA 4DV6T 4DMVA 1HFAA 2KXPB 2XJ7A 4F8HA 4YJ2E 4MFRA 2QGSA 4QXHB 5LMUT 4O4JE 1FIOA 3NZPA 2FJAA 3JC6C 2UXCT 1U4QA 2X66A 4HFBA 4E7ZA 3ANWA 3MA9A 1BR1A 2A3DA 2FBWA 2OV9A 5HXEA 4EEDA 2VKHA 3PUGA 4CQIA 3NRXA 3N2KE 3EDVA 4Z90A 3AEEA 4U2YA 2WBLA 5EK4A 3I9YA 3RIUA 4HWIB 2CHOA 3P4SA 5JR9A 4X1KE 4FJOA 2RP4A 3LBXB 3R84B 4CN4A 4IT4A 4KX6A 4O4IE 3N2GE 2HHHT 4IDOA 4DR3T 3WAKA 2Q9QA 3AAEB 1KEYA 2D5UA 2JRKA 1N32T 5EK2A 2XQ6A 4MALA 3RC8A 2N9DA 3KBUA 5GONE 3AVRA 2V6YA 3HR0A 4P09A 2N2NA 2MPKA 3CMLA 3P50A 4EEBA 2YDQA 3VRBA 3RF1A 3A8YC 3OKQA 5JRCB 3UU8A 4UV9B 3OTOT 3PE0A 2E2AA 3ZYLA 2ES0A 4AKIA 1YD8G 4CXYA 2J47A 3UQ7A 2YKSA 3PJAA 2IIUA 4DR4T 2CEAA 2WWVA 2BS3A 2DI4A 4AKLA 5JREA 2WZHA 2NP9A 2HN1A 1YW0A 2BS2A 2ACXA 4WYVA 3FZHB 2XQ9A 1HNWT 1ZOYA 4TNWA 2KINB 4H9OC 2G0UA 3ZEFB 2C0SA 2ODUA 3M3ZB 2BBJA 2LSKA 4ADZA 3LBXA 3K1SA 4CXXA 5CGMA 3Q9DA 1LVFA 2CWOA 4L0RA 4WBOA 5F5WA 3FXDB 2IC6A 4JI5T 4AI6A 3QNUA 4KMCA 4DV0T 2LSIA 4YHJA 3ZPOA 4UELA 2CWYA 5AQLB 2XAJB 4AISA 4ISTA 5L3FB 2V8SV 5A1LA 4JI0T 5FVLA 2CBJA 3ETVA 4UF0B 5HXSA 4OFZA 3MZKB 5L3BB 1D0YA 3B13A 5LP6E 4KHZF 1HNZT 4IDNA 3PU3A 1HNXT 5JRCA 5IUXA 4B3TT 2WDRA 2BS4A 4X5TA 3PUQA 3ZCIA 4DV3T 3RQUA 4CXWA 4EYYR 4EYUA 4I0UA 3NRYA 5JDHA 5C3JA 3RHWA 4B3RT 3L39A 3S4UA 2LRLA 2I6HA 2VL0A 2W63A 1BR4A 4H9PC 3ONLC 5HEJA 1HG5A 5AQGB 1XNQT 1WYBA 2XQ7A 1D1AA 5E0OA 4E7SA 1CUNA 2OLTA 2OA5A 3CWZB 3P7IA 2HPLA 1E1HB 2CXDA 2BKOA 5AQUB 4AQYT 5CB4E 2CLYB 3JAFA 1OWAA 3AE5A 1XWMA 1WYCA 3M65A 4EOZB 2DCFA 2YK0A 2NW8A 2W0GA 1XDPA 5AQTB 4A56A 3UFEA 1UK5A 4IE6A 2JMHA 4ZHQE 4HFVA 3SWHA 2CA5A 1T72A 2LSGA 2V1DB 5LA6E 3OBVE 1JNZA 3E0ZA 5DQVA 3P4PA 2VQFT 3U3IA 2W4XA 2MBGA 3RIFA 4EAHA 1G73A 5J1GA 3AEAA 4QH5A 5IHYA 5LJMA 3D0TA 4DUZT 2V6XA 3PUZF 1H7CA 2PFVA 3LDQB 2YN6A 3ZLIA 2XAQB 5JDNA 4UF0A 1Y01A 3V5SA 2M6IA 4QKNA 4YHHT 3RX6A 1N36T 4JV5T 4HFEA 3LK2B 4JI8T 1HX1B 3RYFE 1MIWA 4JI3T 3R6NA 3VU7H 3C4ZA 5LHGB 2LOPA 2NR4A 2YU1A 3N9PA 1ZEEA 3BQIA 1NAFA 2X9XA 4LFAT 4JUYA 5LCYA 2VVSA 2WY2A 4H63V 1MMGA 2XM1A 2J1DG 3AA1B 4LF4T 2WDQA 4LF5T 5LG4A 2KSRA 3RYCE 4ILBA 1J1JA 3CQXC 4IL9A 5FVKA 1D1BA 4IE7A 2V7KA 1ZP0A 4AKRB 2X0YA 5DABA 5LGUB 2BG9E 4HEAA 3QC9A 2BZBA 5C8YE 4M1PA 4ILAA 3C64A 3ZMSB 5M4YA 2W00A 3SRZA 5KX5E 4PK4A 5FXXA 4PK5A 4FI5A 4MLKA 1NEKA 4O4HE 2WU2A 4HE8A 5FY1A 4DBQA 4ISSA 5L2LA 3J7Yq 2MAWA 3H3AA 5EZYE 2EHOB 5HXCA 1MNEA 3ZJ1A 4DR1T 1Y64B 4K0KT 1SA0E 4OHFA 3O1HA 5AQNB 2NWBA 3HL6A 3PV0F 4IGUA 2KNDA 2R6GF 3F2EA 5JQGE 3UT5E 4BJMA 4AQFC 2YOEA 5HCMA 2D9DA 4IIJE 2QA7A 3ZMVB 4NIQA 3OJAA 3E08A 2UU9T 3ZN1B 1UX4A 1LVKA 3VR9A 2BDEA 5JH7E 1VOMA 2UXBT 5HEGA 3DP7A 5KDMC 1FMWA 5LGTB 4B6XA 4JI4T 4XAXB 3KINB 4HWDA 4YSZA 2JIWA 4KI0F 2NTYA 1I6ZA 3NWIA 1KNZA 5L3CB 2MYSA 5AQPB 3AE1A 5DJQC 3Q2MA 4AQGA 2CPTA 5J2TE 3Q5XA 3NBXX 2VVNA 2WCAA 3I9WA 4YSXA 4YT0A 3E22E 3HKEE 3RLFF 3N9QA 4J2CA 2B1EA 2WAUA 4NUVA 4KUMB 4ZOLE 1WCRA 5HWYA 4LF6T 2L8KA 2V7JA 2VL8A 3B57A 2N1GA 5KMGP 3W15B 4QX8B 5HEHA 2CCQA 5AQVB 2EHOA 2FUPA 1WR6A 2JPFA 1M7KA 2WZIA 2MTQA 4JEUB 5LJNA 2LLYA 2NOXA 3U78A 2K24A 3WI3A 3TLVA 4DMWA 5JDLA 4PJNA 4HFCA 4IE4A 2BG9C 2FJDA 4DUYT 3KV6A 1YQ4A 2H89A 4DNDA 4DIDB 4ZI2D 3KVAA 2XQYA 3ETUA 1HS7A 4QXBB 1ZKEA 3J9X1 2YU2A 2J4GA 2X9YA 3SFEA 4I4TE 3IHRA 5BR8T 1W0AA 2DNXA 3LSVA 4DR2T 4L5GA 5J2UE 4ANJA 4CI2B 5AQFB 3UTKA 2MOZA 2XSAA 3MACA 1OEDB 2LSYA 2YDRA 3EABA 3F31A 5FNVE 3ZYKA 3N9LA 1WRDA 1S94A 2NW9A 4X66T 4HWFA 1VCTA 2E9XD 3CX7B 2D0TA 4YXDA 4WNKA 4EGWA 3ZC0A 2V5CA 2W62A 5LB7B 1OEDC 1QUUA 3TKLB 4DR6T 4NXMT 2K3WA 1D1CA 5FY7A 2K48A 3OVUA 2WB5A 4IDZA 5LHHB 2L9QA 4TV9E 4WZXA 2YDSA 4ZI2C 2WM9A 3CQCB 3FBLA 5H6RB 1UCUA 4QX7B 3CK6A 3FXEB 3ONJA 2CBIA 4KHPT 4TWHA 4YTPA 4L9IA 4OYJA 4LFCT 3AEDA 3PUYF 1QSDA 3I1AA 3ZC1A 3GMIA 4UVCB 2JQHA 4IREA 3AE2A 3KVBA 1T8BA 5LOVE 4KBMB 4V1Av 3LJCA 3C98B 3NVOA 4KP3C 1X79A 2E9XC 3MKDA 3UULA 5FXVA 2IDOB 4GKKT 2ACZA 3QB5A 4LMLA 3NKZA 1UGOA 3IA3A 4G63A 4DR5T 5JTGA 3P8CD 3PUVF 1IZNB 4BJNA 3KDSE 1VRBA 5LXTE 3UUNA 2WU5A 3MK7C 5LHIB 5LBMA 5LMNT 5FP3A 3FZKB 2X68A 3RYHE 5F3JA 1HR0T 4ZS3A 2BVLA 4NUUA 1KNPA 4IHJE 2LSJA 2WMOA 3SOLA 4JBWF 4TX5A 4U7YA 4H63H 4TV8E 4ZZBA 2J62A 2ZM2A 5EK3A 2XY8B 2PTFA 4BAYB 2ZM8A 3ZT6A 3SFDA 1LKXA 3O1IA 2V7MA 2W2UA 1W09A 4NXNT 3BQLA 5AFUL 4CN6A 5L47A 1BR2A 2ZM6T 3NZQA 4OYKA 5HAXA 2XQ8A 3FZLB 2LT3A 2NTXA 2B76A 3X1DA 3OPCA 4HWHA 3QOFA 2RPAA 4JYAT 4EXTA 1N34T 2H7OA 2LEHA 3AECA 3VHLA 1HCIA 2Y6XA 4YTMA 3ZN0B 3IBPA 2LJLA 3PUSA 4IE0A 4UXNB 5FXZA 2C5IT 2X0LB 3HI2A 1NENA 3AA7B 3PUAA 4H9NC 2BKNA 1YXRA 2AE9A 4UV8B 1W0BA 3LK42 3O9XA 3LFMA 3PURA 4X20E 3ZCJA 3EHZA 2Y8DA 4ZS2A 2IAKA 3JAEA 3DTOA 4XBFB 3WAJA 4YY3T 3N9OA 1I94T 4C91A 3RI5A 2XAGB 1R8IA 2JQ9A 3GA8A 2LRKA 5ETWA 2YEVC 1D0XA 3H3MA 5IYZE 1N33T 1FEWA 4X62T 2X51A 3O1JA 4ZXLA 5ABFB 4GK5E 4CZZB 5HXRA 3AA6B 3DJBA 4DBRA 1E2AA 4DV7T 2YINA 2VWAA 1WLXA 2KZ7B 2W61A 3RRCA 3ZJ2A 1IAPA 4QXCB 5LGNB 2LM9A 5FKYA 4DO0A 4IDQA 5L4EA 2A2FX 4I50E 3KV9A 4QHOA 5BMVE 2D0UA 4G2AA 2I0MA 1L0VA 4LMJA 3C51A 4EZHA 2V26A 3UFGA 4JI1T 3L3PA 3AXJB 4YSYA 3QK6A 5CJ5A 3UU3A 4U3CA 2Q9QD 2VQET 4AKHA 4H9SE 3T1HT 3AAAB 5AQSB 1Z8UA 2LM2A 4Z8XA 3KBTA 3AEBA 1ZV4X 3JC6D 4GIWA 3TLTA 4X1IE 2IW5B 1U5PA 5LNKA 3O4XE 1O3XA 3H37A 5ABEA 1J5ET 5JR9B 4YLHA 1HG2A 1DU2A 2XHEB 3EVYA 4F6RC 3FZFB 3TLUA 1MIVA 2CMRA 4HN9A 2Q9QB 3P4WA 2JQKA 3GN5B 2RA1A 3RIUC 5LYJE 4U31A 4JLEA 1SE7A 1VCSA 5AQHB 5FYMA 1T7SA 5JR9C 5JDGA 3ZSTA 3ZMZB 2ZLYA 2XM2A 3K8PC 4U72A 3C4XA 4Z91A 4AXPA 3HA4A 4IL4A 3AE3A 4GYSA 2E5LT 3KFWX 3ONXA 4DR7T 1KK7A 3Q5DA 1UUSA 2Q9QC 2QVAA 3FZMB 4WBNE 2BG9B 5FMNA 3UU5A 4AQFA 4AIUA 4CI1B 1LRZA 2IHR1 3ZMUB 3ZT5A 2XQ3A 4EV6A 1IBKT 2ZM0A 3HKCE 3AXJA 2W66A 3HKDE 3RKOA 3N2OA 4JI6T 1XDOA 3IF8B 4UR9A 3AB3B 1FMVA 3ZSSA 4ZI3D 1QLBA 5HWXA 3TLWA 4JI7T 5L3EB 2VK9A 3AAIA 5AQQB 4TN7B 5CA0E 2V5DA 4IDPA 4PFOA 2WQYA 2KT9A 2CM0A 3AE7A 3CQGB 3LG7A 4UIGA 2LE8A 4ASKA 2QYWA 2XZEA 5HEOA 5ABGA 3T1YT 2F4VT 1D0ZA 4DVDA 5TAOA 3GN5A 3EUHA 3Q5EA 3L09A 5HCJA 3PUXF 1G8XA 3ZYMA 1ZHCA 2XQAA 4GYRA 3ESLA 5JVDE 4UVBB 3AVSA 5KXJA 1V9DA 5L3GB 1SUMB 4LMKA 4ZI3C 2IC9A 3G06A 3BQKA 4DV4T 2BG9A 5AQIB 2X9HA 3FHNA 1XZYA 2KWHA 5IWAT 4LF7T 4AKGA 2LHRA 2DL1A 2GK9A 3SS1A 4CN1A 4HTEA 3ZMTB 4I55E 4EZ4A 2E9XB 2X9WA 2DHRA 2WDVA 2PJQA 1BR0A 2LKGA 2UXXB 3AA0B 2LOSA 3UUXB 4COFA 2PG8A 5FL0A 4X1YE 3EAMA 2FJBA 2HN2A 4XZCA 5FY0A 2ZMAA 5AQJB 4QH4A 3AE6A 3BK9A 3PTRB 2BVMA 3K3NA 2WWUA 3PJAJ 2VKDA 4TNVA 1OEDA 5J0ZA 4BA9A 2XSBA 4PW8A 2LKHA 3VKGA 3QUJA 4ERRA 4X65T 3B5MA 1J5WA 2XPKA 1M62A 3L8RA 2XTLA 2QRXA 2CXLA 2BKPA 1CHUA 2KWIB 2VB6A 2K9AA 2WMNA 2XAHB 2W67A 4U2ZA 4O4LE 3RIAA 4OX9T 4IE5A 4X64T 3F57A 5AQRB
chains in the Genus database with same CATH topology
3HR0A 4P09A 2N2NA 4PJMA 4C91A 3DP7A 5KDMC 3CMLA 1FMWA 5LGTB 2XAGB 4B6XA 3GA8A 4XAXB 5ETWA 3V5UA 3KINB 4O2BE 4UVAB 2YEVC 4WW0A 2NTYA 1D0XA 2WSSV 1MNDA 2V7LA 4GK0E 5IYZE 5CA1E 1FEWA 4U74A 1KNZA 5L3CB 1Z0PA 2MYSA 2X51A 3OKQA 5JRCB 3K3QC 3O1JA 4UV9B 4GK5E 4CZZB 5HXRA 3AA6B 3DJBA 4DBRA 1HX8A 3N9MA 3PE0A 3Q2MA 5DJQC 3ZYLA 2ES0A 4AKIA 4AQGA 5HXHA 2YINA 3C50A 2VWAA 5J2TE 1YD8G 3Q5XA 2E9XA 4CXYA 3NBXX 3I9WA 4JEHB 1S35A 3N5LA 1WLXA 2KZ7B 3E22E 4EB6E 3HKEE 5JDMA 3N9QA 2UXNB 2W61A 4J2CA 2B1EA 2WAUA 4NUVA 3RRCA 4KUMB 3OYXA 2CEAA 3I0OA 4ZOLE 5HWYA 2DI4A 3ZJ2A 2XASB 1IAPA 2L8KA 2A72A 4QXCB 2V7JA 2VL8A 3B57A 4AKLA 5LGNB 5ADXL 3RRWA 2N1GA 5FXWA 3UUMA 5JREA 2LM9A 3W15B 5KMGP 4DO0A 4QX8B 2NP9A 1YW0A 2A2FX 3A5XA 4I50E 2CCQA 2ACXA 2EHOA 2NW7A 3CX8B 1WR6A 2JPFA 2MTQA 3KV9A 4JEUB 4YJ3E 2KINB 4QHOA 3I0QA 5BMVE 5LJNA 2D0UA 4H9OC 1AJ3A 2G0UA 3ZEFB 2Z6EA 4N78D 2NOXA 2C0SA 4G2AA 2ODUA 2K24A 3U78A 2LSKA 3WI3A 3C51A 4EZHA 2V26A 4ADZA 2H7VC 1NWMX 2K5BB 4DMWA 3L3PA 5JDLA 3LBXA 3QK6A 4PJNA 4IE4A 4CXXA 2JQQA 2P9BA 3KV6A 3Q9DA 1LVFA 1HTJF 2CWOA 4L0RA 4WBOA 4DNDA 2Q9QD 2CLYC 3FXDB 4AKHA 2IC6A 4K0UA 3KVAA 4ZI2D 4H9SE 2XQYA 3AAAB 3ETUA 1HS7A 1OXZA 4QXBB 1ZKEA 3J9X1 4Z8XA 3FBZA 2YU2A 2X9YA 4AI6A 3KBTA 4I4TE 1ZV4X 3IHRA 4KMCA 3MJXA 3JC6D 2LSIA 5DQWA 1MIYA 2DNXA 4L5GA 4GIWA 4YHJA 4ANJA 4CI2B 3ZPOA 5J2UE 4UELA 4MHCA 4X1IE 2CWYA 2IW5B 1U5PA 3UTKA 5LNKA 3O4XE 2XAJB 4ISTA 3LK3B 5L3FB 1O3XA 3H37A 4PJLA 5A1LA 3VKHA 5JR9B 3ETVA 4YLHA 2MOZA 4UF0B 2LHNA 3MACA 5HXSA 2LSYA 4OFZA 3MZKB 1HG2A 3RYIE 2XHEB 5L3BB 4ILUA 5LBQB 3EVYA 4F6RC 3F31A 1D0YA 3B13A 5FNVE 5LP6E 3ZYKA 2KLQA 3N9LA 1WRDA 1S94A 2DWGA 1MIVA 1HF8A 3PU3A 4PFPA 2NW9A 5JRCA 1YKEB 3CPZA 2CMRA 4HN9A 2Q9QB 3FB2A 2E9XD 3GN5B 3PUQA 3CX7B 3ZCIA 1T98A 4H9QC 2RA1A 3Q5WA 5LYJE 3K3OA 4JLEA 4CXWA 4EYYR 5H6QB 2D0TA 4O8SA 4PNIA 5FYMA 2E8IA 3NRYA 4EYUA 4WNKA 5JDHA 3ZC0A 3GWHA 5JR9C 3S4UA 3IEEA 2W62A 5JDGA 2I59A 1QUUA 2W63A 3TKLB 1BR4A 1SHZC 2X67A 4H9PC 3ZMZB 2ZLYA 1HG5A 3PU8A 3K8PC 1WYBA 4U72A 3T8OA 4ZI7E 4P0AA 3C4XA 1D1CA 5FY7A 3HA4A 1D1AA 5JDFA 4AXPA 2K48A 3C4WA 5E0OA 4IDZA 4GYSA 5LHHB 3KFWX 1CUNA 4I43B 2L9QA 4TV9E 4E7SA 3ONXA 4MBQA 2EHOD 1KK7A 2OA5A 3CWZB 2VASA 3CVRA 3P7IA 2Q9QC 2HPLA 4ZI2C 1E1HB 2CXDA 4YFSA 4UEMA 4WBNE 1MMNA 2WM9A 3CQCB 5FMNA 1US7B 4AQFA 3PDYA 5CB4E 3FBLA 2CLYB 4CI1B 2HH7A 2M67A 3CX6B 3RPUA 1OWAA 5H6RB 3RC3A 2ODVA 1UCUA 4O2AE 1WYCA 3M65A 4QX7B 3RH3A 2CE7A 1LRZA 3KV5A 4OK0A 3FXEB 1IJ6A 3ZMUB 4C90A 4EOZB 2VKOA 2PBIA 2DCFA 2YK0A 2V7IA 2NW8A 2W0GA 2ZM0A 3HKCE 4A56A 3UFEA 2D2SA 4IE6A 2JMHA 4L9IA 1YKHB 3HKDE 4HFVA 4OYJA 3SWHA 4ZHQE 2CA5A 2LSGA 1QSDA 1MMAA 1B7TA 2V1DB 3OBVE 5LA6E 3RKOA 3I1AA 3N2OA 2C5KT 3IF8B 3N9NA 3ZC1A 3HKBE 1EZ3A 3AB3B 3GMIA 1FMVA 4UVCB 3E0ZA 4ZI3D 2DWKA 3ANWB 2H3RA 3KVBA 5DQVA 5HWXA 5JDQA 4P0BA 3U3IA 5LOVE 2XAFB 4KBMB 4QWNB 2SPCA 2MBGA 4PK6A 4V1Av 5L3EB 2VKJA 3LJCA 3C98B 4KP3C 4EAHA 1X79A 2C5JA 3CKDA 2JJ9A 2VK9A 1G73A 2E9XC 3AAIA 5J1GA 4TN7B 5CA0E 5IHYA 5LJMA 3MKDA 3UULA 3D0TA 2L3LA 4PFOA 2KT9A 5FXVA 1H7CA 2PFVA 2Y48B 4CI3B 3ZLIA 2XAQB 5JDNA 4UF0A 3V5SA 4QKNA 2CM0A 3CQGB 3LG7A 5F8PA 4HGAA 4G63A 3RX6A 1MMDA 4PAGA 4UIGA 2LE8A 3LK2B 4ASKA 3P8CD 4PJJA 5L3DB 3RYFE 1MIWA 2EHOC 4H9RC 1D0ZA 3R6NA 1IZNB 4BJNA 4TZ4C 3C4ZA 3VU7H 4TUYE 4DVDA 2LOPA 2YU1A 3MXZA 3N9PA 3GN5A 1ZEEA 3EUHA 5TAOA 5LHGB 4EIWA 3BQIA 1NAFA 2X9XA 3KDSE 4JUYA 2HPJA 5LCYA 1VRBA 5LXTE 2JMKA 3L09A 3UUNA 1G8XA 4H63V 3KV4A 1MMGA 4HKAA 5HYAA 3MK7C 2J1DG 3ZYMA 3AA1B 5LHIB 5LBMA 3OYZA 1ZHCA 1UX5A 5FP3A 3RYHE 2X68A 5LG4A 4GOUA 2KMFA 4GYRA 3RYCE 5F3JA 4ZS3A 2BVLA 3ESLA 5JVDE 2DLRA 4UVBB 4NUUA 3AVSA 3CQXC 2XUEA 4IHJE 2LSJA 1D1BA 1V9DA 5L3GB 2WMOA 3EDUA 2CXFA 3SOLA 4TX5A 4IE7A 1IJ5A 2V7KA 4ZI3C 2IC9A 4AKRB 4H63H 4TV8E 3BQKA 4DMVA 1HFAA 2ZM2A 5DABA 5EK3A 5LGUB 2X9HA 3FHNA 2KWHA 2KXPB 4HEAA 2ZM8A 4BAYB 1LKXA 4YJ2E 4MFRA 2QGSA 3QC9A 4AKGA 3O1IA 2LHRA 2BZBA 4QXHB 2GK9A 5C8YE 4M1PA 2V7MA 1FIOA 4O4JE 3SS1A 3BQLA 3NZPA 5AFUL 4HTEA 3ZMTB 3C64A 4I55E 4EZ4A 2E9XB 3JC6C 2X9WA 3ZMSB 2DHRA 1U4QA 1BR2A 2X66A 5M4YA 3NZQA 2PJQA 2W00A 3SRZA 4OYKA 1BR0A 5KX5E 5HAXA 4PK4A 5FXXA 4PK5A 4E7ZA 3ANWA 2UXXB 3MA9A 4FI5A 1BR1A 2A3DA 4MLKA 3AA0B 5HXEA 2VKHA 3PUGA 2LT3A 4CQIA 2NTXA 4O4HE 4HE8A 2LOSA 5FY1A 3UUXB 4DBQA 4ISSA 5L2LA 3NRXA 3J7Yq 3N2KE 3EDVA 4EXTA 3H3AA 5EZYE 2H7OA 2EHOB 2LEHA 5HXCA 2PG8A 1HCIA 2WBLA 1MNEA 3VHLA 4X1YE 3ZJ1A 2Y6XA 1Y64B 5EK4A 3I9YA 1SA0E 3ZN0B 3IBPA 4OHFA 2LJLA 3O1HA 4XZCA 5FY0A 2ZMAA 3BK9A 3PUSA 4IE0A 3PTRB 2NWBA 2BVMA 4UXNB 3K3NA 5FXZA 5JR9A 2WWUA 2C5IT 2X0LB 2VKDA 3HI2A 4X1KE 3HL6A 3AA7B 3PUAA 4FJOA 4BA9A 2RP4A 3LBXB 4H9NC 4IGUA 2KNDA 3R84B 3F2EA 4O4IE 3N2GE 5JQGE 4PW8A 3UT5E 4UV8B 4AQFC 4BJMA 3VKGA 3LK42 3QUJA 4ERRA 3O9XA 3LFMA 3PURA 4IIJE 2QA7A 3ZMVB 3OJAA 4X20E 3E08A 3ZCJA 2XTLA 2CXLA 2KWIB 3WAKA 2Q9QA 3AAEB 3ZN1B 2VB6A 2K9AA 2WMNA 2D5UA 1UX4A 2Y8DA 1LVKA 2XAHB 4ZS2A 2JRKA 4O4LE 2IAKA 2BDEA 5EK2A 4MALA 3RC8A 2N9DA 4IE5A 5JH7E 3DTOA 4XBFB 3KBUA 1VOMA 5GONE 3AVRA 3F57A 3WAJA 3N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CM0 A;  4P09 A;  2CCQ A;  4OYJ A;  5LJN A;  2HPL A;  4P0A A;  4JUY A;  2HPJ A;  4P0B A;  5LJM A;  4OYK A;  2D5U A; 
#chains in the Genus database with same CATH topology
 4PJM A;  2M6B A;  2A9U A;  3ZKR A;  4DV1 T;  3V5U A;  4UVA B;  4O2B E;  4LF9 T;  1GQE A;  3AEG A;  4WW0 A;  2WSS V;  1MND A;  2V7L A;  4A98 A;  4GK0 E;  5CA1 E;  3A7M A;  4U74 A;  1Z0P A;  3K3Q C;  2XQ5 A;  2WS3 A;  1HX8 A;  3N9M A;  4P1N A;  4YTN A;  5HXH A;  3C50 A;  2E9X A;  3CIR A;  4JEH B;  4NPP A;  2UXD T;  2VUR A;  1S35 A;  3N5L A;  3VR8 A;  1E7P A;  4EB6 E;  2WP9 A;  5JDM A;  3VRA A;  2UXN B;  1FJG T;  3OYX A;  3I0O A;  2XAS B;  3UU4 A;  2A72 A;  5ADX L;  3RRW A;  5FXW A;  2UUA T;  3UUM A;  3A5X A;  4A97 A;  4HFI A;  2AXD S;  2NW7 A;  3CX8 B;  4TWF A;  1XMO T;  2CRB A;  4YJ3 E;  3I0Q A;  2CHN A;  1AJ3 A;  1KNR A;  2Z6E A;  4N78 D;  2H7V C;  1NWM X;  2K5B B;  3ABV A;  2E5V A;  1W9R A;  2JQQ A;  2P9B A;  1HTJ F;  4DV5 T;  2CLY C;  4K0U A;  2IUB A;  1OXZ A;  3EI0 A;  1WR0 A;  3FBZ A;  5HEU A;  3ZT7 A;  3MJX A;  5DQW A;  1MIY A;  1IBL T;  1KF6 A;  4MHC A;  4ZZC A;  5AQO B;  3LK3 B;  4LF8 T;  4PJL A;  3VKH A;  5ABH A;  4U7I A;  2LHN A;  3RYI E;  2X0H A;  2BBH A;  4ILU A;  5LBQ B;  2KLQ A;  5CFB A;  3JCF A;  4U33 A;  2DWG A;  1HF8 A;  4PFP A;  1YKE B;  1WFD A;  3CPZ A;  3QB5 K;  1XNR T;  3FB2 A;  4HWC A;  5L4H A;  1T98 A;  4H9Q C;  2IML A;  3Q5W A;  3K3O A;  4DV2 T;  3UQ4 A;  5H6Q B;  4O8S A;  4PNI A;  2E8I A;  4HFD A;  3GWH A;  3IEE A;  2I59 A;  2X67 A;  1SHZ C;  3PU8 A;  3T8O A;  4ZI7 E;  4P0A A;  5JDF A;  3C4W A;  4I43 B;  4QH1 A;  4MBQ A;  2EHO D;  4LFB T;  2VAS A;  3CVR A;  5LG3 A;  4JI2 T;  3AE8 A;  4YFS A;  4UEM A;  1MMN A;  1US7 B;  3PDY A;  1KFY A;  2M67 A;  2HH7 A;  3CX6 B;  3RPU A;  3RC3 A;  3JAD A;  2ODV A;  4O2A E;  3RH3 A;  2CE7 A;  3KV5 A;  4OK0 A;  1IJ6 A;  4C90 A;  2VKO A;  4HFH A;  1JNR A;  2PBI A;  2V7I A;  2D2S A;  1YKH B;  4Q25 A;  2XQ4 A;  1MMA A;  1B7T A;  2C5K T;  4GKJ T;  3N9N A;  3HKB E;  4A5X A;  5FL1 A;  1EZ3 A;  1XMQ T;  2FJE A;  2DWK A;  3ANW B;  2H3R A;  5JDQ A;  4P0B A;  2XAF B;  4QWN B;  2SPC A;  3AEF A;  4PK6 A;  2VKJ A;  2C5J A;  3CKD A;  2JJ9 A;  4TWD A;  3P4R A;  3UUB A;  2L3L A;  4ILC A;  2Y48 B;  4CI3 B;  1X9B A;  3AE9 A;  2UUC T;  4B3S T;  3TLS A;  1OED E;  5F8P A;  4HGA A;  1MMD A;  4PAG A;  5AQM B;  4PJJ A;  5L3D B;  1IBM T;  3UU6 A;  2EHO C;  4H9R C;  4TZ4 C;  4TUY E;  3MXZ A;  4EIW A;  3RGL A;  3PUW F;  3AE4 A;  2HPJ A;  5ABF A;  2JMK A;  3KV4 A;  1YQ3 A;  4HKA A;  5HYA A;  2UUB T;  4B3M T;  3RKG A;  3OYZ A;  1UX5 A;  3P4Q A;  4GOU A;  3RQW A;  2KMF A;  4ZEY A;  2DLR A;  2V6Y B;  2XUE A;  1UUR A;  2H88 A;  3EDU A;  2CXF A;  5AQK B;  1IJ5 A;  5C2T A;  4DV6 T;  4DMV A;  1HFA A;  2KXP B;  2XJ7 A;  4F8H A;  4YJ2 E;  4MFR A;  2QGS A;  4QXH B;  5LMU T;  4O4J E;  1FIO A;  3NZP A;  2FJA A;  3JC6 C;  2UXC T;  1U4Q A;  2X66 A;  4HFB A;  4E7Z A;  3ANW A;  3MA9 A;  1BR1 A;  2A3D A;  2FBW A;  2OV9 A;  5HXE A;  4EED A;  2VKH A;  3PUG A;  4CQI A;  3NRX A;  3N2K E;  3EDV A;  4Z90 A;  3AEE A;  4U2Y A;  2WBL A;  5EK4 A;  3I9Y A;  3RIU A;  4HWI B;  2CHO A;  3P4S A;  5JR9 A;  4X1K E;  4FJO A;  2RP4 A;  3LBX B;  3R84 B;  4CN4 A;  4IT4 A;  4KX6 A;  4O4I E;  3N2G E;  2HHH T;  4IDO A;  4DR3 T;  3WAK A;  2Q9Q A;  3AAE B;  1KEY A;  2D5U A;  2JRK A;  1N32 T;  5EK2 A;  2XQ6 A;  4MAL A;  3RC8 A;  2N9D A;  3KBU A;  5GON E;  3AVR A;  2V6Y A;  3HR0 A;  4P09 A;  2N2N A;  2MPK A;  3CML A;  3P50 A;  4EEB A;  2YDQ A;  3VRB A;  3RF1 A;  3A8Y C;  3OKQ A;  5JRC B;  3UU8 A;  4UV9 B;  3OTO T;  3PE0 A;  2E2A A;  3ZYL A;  2ES0 A;  4AKI A;  1YD8 G;  4CXY A;  2J47 A;  3UQ7 A;  2YKS A;  3PJA A;  2IIU A;  4DR4 T;  2CEA A;  2WWV A;  2BS3 A;  2DI4 A;  4AKL A;  5JRE A;  2WZH A;  2NP9 A;  2HN1 A;  1YW0 A;  2BS2 A;  2ACX A;  4WYV A;  3FZH B;  2XQ9 A;  1HNW T;  1ZOY A;  4TNW A;  2KIN B;  4H9O C;  2G0U A;  3ZEF B;  2C0S A;  2ODU A;  3M3Z B;  2BBJ A;  2LSK A;  4ADZ A;  3LBX A;  3K1S A;  4CXX A;  5CGM A;  3Q9D A;  1LVF A;  2CWO A;  4L0R A;  4WBO A;  5F5W A;  3FXD B;  2IC6 A;  4JI5 T;  4AI6 A;  3QNU A;  4KMC A;  4DV0 T;  2LSI A;  4YHJ A;  3ZPO A;  4UEL A;  2CWY A;  5AQL B;  2XAJ B;  4AIS A;  4IST A;  5L3F B;  2V8S V;  5A1L A;  4JI0 T;  5FVL A;  2CBJ A;  3ETV A;  4UF0 B;  5HXS A;  4OFZ A;  3MZK B;  5L3B B;  1D0Y A;  3B13 A;  5LP6 E;  4KHZ F;  1HNZ T;  4IDN A;  3PU3 A;  1HNX T;  5JRC A;  5IUX A;  4B3T T;  2WDR A;  2BS4 A;  4X5T A;  3PUQ A;  3ZCI A;  4DV3 T;  3RQU A;  4CXW A;  4EYY R;  4EYU A;  4I0U A;  3NRY A;  5JDH A;  5C3J A;  3RHW A;  4B3R T;  3L39 A;  3S4U A;  2LRL A;  2I6H A;  2VL0 A;  2W63 A;  1BR4 A;  4H9P C;  3ONL C;  5HEJ A;  1HG5 A;  5AQG B;  1XNQ T;  1WYB A;  2XQ7 A;  1D1A A;  5E0O A;  4E7S A;  1CUN A;  2OLT A;  2OA5 A;  3CWZ B;  3P7I A;  2HPL A;  1E1H B;  2CXD A;  2BKO A;  5AQU B;  4AQY T;  5CB4 E;  2CLY B;  3JAF A;  1OWA A;  3AE5 A;  1XWM A;  1WYC A;  3M65 A;  4EOZ B;  2DCF A;  2YK0 A;  2NW8 A;  2W0G A;  1XDP A;  5AQT B;  4A56 A;  3UFE A;  1UK5 A;  4IE6 A;  2JMH A;  4ZHQ E;  4HFV A;  3SWH A;  2CA5 A;  1T72 A;  2LSG A;  2V1D B;  5LA6 E;  3OBV E;  1JNZ A;  3E0Z A;  5DQV A;  3P4P A;  2VQF T;  3U3I A;  2W4X A;  2MBG A;  3RIF A;  4EAH A;  1G73 A;  5J1G A;  3AEA A;  4QH5 A;  5IHY A;  5LJM A;  3D0T A;  4DUZ T;  2V6X A;  3PUZ F;  1H7C A;  2PFV A;  3LDQ B;  2YN6 A;  3ZLI A;  2XAQ B;  5JDN A;  4UF0 A;  1Y01 A;  3V5S A;  2M6I A;  4QKN A;  4YHH T;  3RX6 A;  1N36 T;  4JV5 T;  4HFE A;  3LK2 B;  4JI8 T;  1HX1 B;  3RYF E;  1MIW A;  4JI3 T;  3R6N A;  3VU7 H;  3C4Z A;  5LHG B;  2LOP A;  2NR4 A;  2YU1 A;  3N9P A;  1ZEE A;  3BQI A;  1NAF A;  2X9X A;  4LFA T;  4JUY A;  5LCY A;  2VVS A;  2WY2 A;  4H63 V;  1MMG A;  2XM1 A;  2J1D G;  3AA1 B;  4LF4 T;  2WDQ A;  4LF5 T;  5LG4 A;  2KSR A;  3RYC E;  4ILB A;  1J1J A;  3CQX C;  4IL9 A;  5FVK A;  1D1B A;  4IE7 A;  2V7K A;  1ZP0 A;  4AKR B;  2X0Y A;  5DAB A;  5LGU B;  2BG9 E;  4HEA A;  3QC9 A;  2BZB A;  5C8Y E;  4M1P A;  4ILA A;  3C64 A;  3ZMS B;  5M4Y A;  2W00 A;  3SRZ A;  5KX5 E;  4PK4 A;  5FXX A;  4PK5 A;  4FI5 A;  4MLK A;  1NEK A;  4O4H E;  2WU2 A;  4HE8 A;  5FY1 A;  4DBQ A;  4ISS A;  5L2L A;  3J7Y q;  2MAW A;  3H3A A;  5EZY E;  2EHO B;  5HXC A;  1MNE A;  3ZJ1 A;  4DR1 T;  1Y64 B;  4K0K T;  1SA0 E;  4OHF A;  3O1H A;  5AQN B;  2NWB A;  3HL6 A;  3PV0 F;  4IGU A;  2KND A;  2R6G F;  3F2E A;  5JQG E;  3UT5 E;  4BJM A;  4AQF C;  2YOE A;  5HCM A;  2D9D A;  4IIJ E;  2QA7 A;  3ZMV B;  4NIQ A;  3OJA A;  3E08 A;  2UU9 T;  3ZN1 B;  1UX4 A;  1LVK A;  3VR9 A;  2BDE A;  5JH7 E;  1VOM A;  2UXB T;  5HEG A;  3DP7 A;  5KDM C;  1FMW A;  5LGT B;  4B6X A;  4JI4 T;  4XAX B;  3KIN B;  4HWD A;  4YSZ A;  2JIW A;  4KI0 F;  2NTY A;  1I6Z A;  3NWI A;  1KNZ A;  5L3C B;  2MYS A;  5AQP B;  3AE1 A;  5DJQ C;  3Q2M A;  4AQG A;  2CPT A;  5J2T E;  3Q5X A;  3NBX X;  2VVN A;  2WCA A;  3I9W A;  4YSX A;  4YT0 A;  3E22 E;  3HKE E;  3RLF F;  3N9Q A;  4J2C A;  2B1E A;  2WAU A;  4NUV A;  4KUM B;  4ZOL E;  1WCR A;  5HWY A;  4LF6 T;  2L8K A;  2V7J A;  2VL8 A;  3B57 A;  2N1G A;  5KMG P;  3W15 B;  4QX8 B;  5HEH A;  2CCQ A;  5AQV B;  2EHO A;  2FUP A;  1WR6 A;  2JPF A;  1M7K A;  2WZI A;  2MTQ A;  4JEU B;  5LJN A;  2LLY A;  2NOX A;  3U78 A;  2K24 A;  3WI3 A;  3TLV A;  4DMW A;  5JDL A;  4PJN A;  4HFC A;  4IE4 A;  2BG9 C;  2FJD A;  4DUY T;  3KV6 A;  1YQ4 A;  2H89 A;  4DND A;  4DID B;  4ZI2 D;  3KVA A;  2XQY A;  3ETU A;  1HS7 A;  4QXB B;  1ZKE A;  3J9X 1;  2YU2 A;  2J4G A;  2X9Y A;  3SFE A;  4I4T E;  3IHR A;  5BR8 T;  1W0A A;  2DNX A;  3LSV A;  4DR2 T;  4L5G A;  5J2U E;  4ANJ A;  4CI2 B;  5AQF B;  3UTK A;  2MOZ A;  2XSA A;  3MAC A;  1OED B;  2LSY A;  2YDR A;  3EAB A;  3F31 A;  5FNV E;  3ZYK A;  3N9L A;  1WRD A;  1S94 A;  2NW9 A;  4X66 T;  4HWF A;  1VCT A;  2E9X D;  3CX7 B;  2D0T A;  4YXD A;  4WNK A;  4EGW A;  3ZC0 A;  2V5C A;  2W62 A;  5LB7 B;  1OED C;  1QUU A;  3TKL B;  4DR6 T;  4NXM T;  2K3W A;  1D1C A;  5FY7 A;  2K48 A;  3OVU A;  2WB5 A;  4IDZ A;  5LHH B;  2L9Q A;  4TV9 E;  4WZX A;  2YDS A;  4ZI2 C;  2WM9 A;  3CQC B;  3FBL A;  5H6R B;  1UCU A;  4QX7 B;  3CK6 A;  3FXE B;  3ONJ A;  2CBI A;  4KHP T;  4TWH A;  4YTP A;  4L9I A;  4OYJ A;  4LFC T;  3AED A;  3PUY F;  1QSD A;  3I1A A;  3ZC1 A;  3GMI A;  4UVC B;  2JQH A;  4IRE A;  3AE2 A;  3KVB A;  1T8B A;  5LOV E;  4KBM B;  4V1A v;  3LJC A;  3C98 B;  3NVO A;  4KP3 C;  1X79 A;  2E9X C;  3MKD A;  3UUL A;  5FXV A;  2IDO B;  4GKK T;  2ACZ A;  3QB5 A;  4LML A;  3NKZ A;  1UGO A;  3IA3 A;  4G63 A;  4DR5 T;  5JTG A;  3P8C D;  3PUV F;  1IZN B;  4BJN A;  3KDS E;  1VRB A;  5LXT E;  3UUN A;  2WU5 A;  3MK7 C;  5LHI B;  5LBM A;  5LMN T;  5FP3 A;  3FZK B;  2X68 A;  3RYH E;  5F3J A;  1HR0 T;  4ZS3 A;  2BVL A;  4NUU A;  1KNP A;  4IHJ E;  2LSJ A;  2WMO A;  3SOL A;  4JBW F;  4TX5 A;  4U7Y A;  4H63 H;  4TV8 E;  4ZZB A;  2J62 A;  2ZM2 A;  5EK3 A;  2XY8 B;  2PTF A;  4BAY B;  2ZM8 A;  3ZT6 A;  3SFD A;  1LKX A;  3O1I A;  2V7M A;  2W2U A;  1W09 A;  4NXN T;  3BQL A;  5AFU L;  4CN6 A;  5L47 A;  1BR2 A;  2ZM6 T;  3NZQ A;  4OYK A;  5HAX A;  2XQ8 A;  3FZL B;  2LT3 A;  2NTX A;  2B76 A;  3X1D A;  3OPC A;  4HWH A;  3QOF A;  2RPA A;  4JYA T;  4EXT A;  1N34 T;  2H7O A;  2LEH A;  3AEC A;  3VHL A;  1HCI A;  2Y6X A;  4YTM A;  3ZN0 B;  3IBP A;  2LJL A;  3PUS A;  4IE0 A;  4UXN B;  5FXZ A;  2C5I T;  2X0L B;  3HI2 A;  1NEN A;  3AA7 B;  3PUA A;  4H9N C;  2BKN A;  1YXR A;  2AE9 A;  4UV8 B;  1W0B A;  3LK4 2;  3O9X A;  3LFM A;  3PUR A;  4X20 E;  3ZCJ A;  3EHZ A;  2Y8D A;  4ZS2 A;  2IAK A;  3JAE A;  3DTO A;  4XBF B;  3WAJ A;  4YY3 T;  3N9O A;  1I94 T;  4C91 A;  3RI5 A;  2XAG B;  1R8I A;  2JQ9 A;  3GA8 A;  2LRK A;  5ETW A;  2YEV C;  1D0X A;  3H3M A;  5IYZ E;  1N33 T;  1FEW A;  4X62 T;  2X51 A;  3O1J A;  4ZXL A;  5ABF B;  4GK5 E;  4CZZ B;  5HXR A;  3AA6 B;  3DJB A;  4DBR A;  1E2A A;  4DV7 T;  2YIN A;  2VWA A;  1WLX A;  2KZ7 B;  2W61 A;  3RRC A;  3ZJ2 A;  1IAP A;  4QXC B;  5LGN B;  2LM9 A;  5FKY A;  4DO0 A;  4IDQ A;  5L4E A;  2A2F X;  4I50 E;  3KV9 A;  4QHO A;  5BMV E;  2D0U A;  4G2A A;  2I0M A;  1L0V A;  4LMJ A;  3C51 A;  4EZH A;  2V26 A;  3UFG A;  4JI1 T;  3L3P A;  3AXJ B;  4YSY A;  3QK6 A;  5CJ5 A;  3UU3 A;  4U3C A;  2Q9Q D;  2VQE T;  4AKH A;  4H9S E;  3T1H T;  3AAA B;  5AQS B;  1Z8U A;  2LM2 A;  4Z8X A;  3KBT A;  3AEB A;  1ZV4 X;  3JC6 D;  4GIW A;  3TLT A;  4X1I E;  2IW5 B;  1U5P A;  5LNK A;  3O4X E;  1O3X A;  3H37 A;  5ABE A;  1J5E T;  5JR9 B;  4YLH A;  1HG2 A;  1DU2 A;  2XHE B;  3EVY A;  4F6R C;  3FZF B;  3TLU A;  1MIV A;  2CMR A;  4HN9 A;  2Q9Q B;  3P4W A;  2JQK A;  3GN5 B;  2RA1 A;  3RIU C;  5LYJ E;  4U31 A;  4JLE A;  1SE7 A;  1VCS A;  5AQH B;  5FYM A;  1T7S A;  5JR9 C;  5JDG A;  3ZST A;  3ZMZ B;  2ZLY A;  2XM2 A;  3K8P C;  4U72 A;  3C4X A;  4Z91 A;  4AXP A;  3HA4 A;  4IL4 A;  3AE3 A;  4GYS A;  2E5L T;  3KFW X;  3ONX A;  4DR7 T;  1KK7 A;  3Q5D A;  1UUS A;  2Q9Q C;  2QVA A;  3FZM B;  4WBN E;  2BG9 B;  5FMN A;  3UU5 A;  4AQF A;  4AIU A;  4CI1 B;  1LRZ A;  2IHR 1;  3ZMU B;  3ZT5 A;  2XQ3 A;  4EV6 A;  1IBK T;  2ZM0 A;  3HKC E;  3AXJ A;  2W66 A;  3HKD E;  3RKO A;  3N2O A;  4JI6 T;  1XDO A;  3IF8 B;  4UR9 A;  3AB3 B;  1FMV A;  3ZSS A;  4ZI3 D;  1QLB A;  5HWX A;  3TLW A;  4JI7 T;  5L3E B;  2VK9 A;  3AAI A;  5AQQ B;  4TN7 B;  5CA0 E;  2V5D A;  4IDP A;  4PFO A;  2WQY A;  2KT9 A;  2CM0 A;  3AE7 A;  3CQG B;  3LG7 A;  4UIG A;  2LE8 A;  4ASK A;  2QYW A;  2XZE A;  5HEO A;  5ABG A;  3T1Y T;  2F4V T;  1D0Z A;  4DVD A;  5TAO A;  3GN5 A;  3EUH A;  3Q5E A;  3L09 A;  5HCJ A;  3PUX F;  1G8X A;  3ZYM A;  1ZHC A;  2XQA A;  4GYR A;  3ESL A;  5JVD E;  4UVB B;  3AVS A;  5KXJ A;  1V9D A;  5L3G B;  1SUM B;  4LMK A;  4ZI3 C;  2IC9 A;  3G06 A;  3BQK A;  4DV4 T;  2BG9 A;  5AQI B;  2X9H A;  3FHN A;  1XZY A;  2KWH A;  5IWA T;  4LF7 T;  4AKG A;  2LHR A;  2DL1 A;  2GK9 A;  3SS1 A;  4CN1 A;  4HTE A;  3ZMT B;  4I55 E;  4EZ4 A;  2E9X B;  2X9W A;  2DHR A;  2WDV A;  2PJQ A;  1BR0 A;  2LKG A;  2UXX B;  3AA0 B;  2LOS A;  3UUX B;  4COF A;  2PG8 A;  5FL0 A;  4X1Y E;  3EAM A;  2FJB A;  2HN2 A;  4XZC A;  5FY0 A;  2ZMA A;  5AQJ B;  4QH4 A;  3AE6 A;  3BK9 A;  3PTR B;  2BVM A;  3K3N A;  2WWU A;  3PJA J;  2VKD A;  4TNV A;  1OED A;  5J0Z A;  4BA9 A;  2XSB A;  4PW8 A;  2LKH A;  3VKG A;  3QUJ A;  4ERR A;  4X65 T;  3B5M A;  1J5W A;  2XPK A;  1M62 A;  3L8R A;  2XTL A;  2QRX A;  2CXL A;  2BKP A;  1CHU A;  2KWI B;  2VB6 A;  2K9A A;  2WMN A;  2XAH B;  2W67 A;  4U2Z A;  4O4L E;  3RIA A;  4OX9 T;  4IE5 A;  4X64 T;  3F57 A;  5AQR B; 
#chains in the Genus database with same CATH homology
 3HR0 A;  4P09 A;  2N2N A;  4PJM A;  4C91 A;  3DP7 A;  5KDM C;  3CML A;  1FMW A;  5LGT B;  2XAG B;  4B6X A;  3GA8 A;  4XAX B;  5ETW A;  3V5U A;  3KIN B;  4O2B E;  4UVA B;  2YEV C;  4WW0 A;  2NTY A;  1D0X A;  2WSS V;  1MND A;  2V7L A;  4GK0 E;  5IYZ E;  5CA1 E;  1FEW A;  4U74 A;  1KNZ A;  5L3C B;  1Z0P A;  2MYS A;  2X51 A;  3OKQ A;  5JRC B;  3K3Q C;  3O1J A;  4UV9 B;  4GK5 E;  4CZZ B;  5HXR A;  3AA6 B;  3DJB A;  4DBR A;  1HX8 A;  3N9M A;  3PE0 A;  3Q2M A;  5DJQ C;  3ZYL A;  2ES0 A;  4AKI A;  4AQG A;  5HXH A;  2YIN A;  3C50 A;  2VWA A;  5J2T E;  1YD8 G;  3Q5X A;  2E9X A;  4CXY A;  3NBX X;  3I9W A;  4JEH B;  1S35 A;  3N5L A;  1WLX A;  2KZ7 B;  3E22 E;  4EB6 E;  3HKE E;  5JDM A;  3N9Q A;  2UXN B;  2W61 A;  4J2C A;  2B1E A;  2WAU A;  4NUV A;  3RRC A;  4KUM B;  3OYX A;  2CEA A;  3I0O A;  4ZOL E;  5HWY A;  2DI4 A;  3ZJ2 A;  2XAS B;  1IAP A;  2L8K A;  2A72 A;  4QXC B;  2V7J A;  2VL8 A;  3B57 A;  4AKL A;  5LGN B;  5ADX L;  3RRW A;  2N1G A;  5FXW A;  3UUM A;  5JRE A;  2LM9 A;  3W15 B;  5KMG P;  4DO0 A;  4QX8 B;  2NP9 A;  1YW0 A;  2A2F X;  3A5X A;  4I50 E;  2CCQ A;  2ACX A;  2EHO A;  2NW7 A;  3CX8 B;  1WR6 A;  2JPF A;  2MTQ A;  3KV9 A;  4JEU B;  4YJ3 E;  2KIN B;  4QHO A;  3I0Q A;  5BMV E;  5LJN A;  2D0U A;  4H9O C;  1AJ3 A;  2G0U A;  3ZEF B;  2Z6E A;  4N78 D;  2NOX A;  2C0S A;  4G2A A;  2ODU A;  2K24 A;  3U78 A;  2LSK A;  3WI3 A;  3C51 A;  4EZH A;  2V26 A;  4ADZ A;  2H7V C;  1NWM X;  2K5B B;  4DMW A;  3L3P A;  5JDL A;  3LBX A;  3QK6 A;  4PJN A;  4IE4 A;  4CXX A;  2JQQ A;  2P9B A;  3KV6 A;  3Q9D A;  1LVF A;  1HTJ F;  2CWO A;  4L0R A;  4WBO A;  4DND A;  2Q9Q D;  2CLY C;  3FXD B;  4AKH A;  2IC6 A;  4K0U A;  3KVA A;  4ZI2 D;  4H9S E;  2XQY A;  3AAA B;  3ETU A;  1HS7 A;  1OXZ A;  4QXB B;  1ZKE A;  3J9X 1;  4Z8X A;  3FBZ A;  2YU2 A;  2X9Y A;  4AI6 A;  3KBT A;  4I4T E;  1ZV4 X;  3IHR A;  4KMC A;  3MJX A;  3JC6 D;  2LSI A;  5DQW A;  1MIY A;  2DNX A;  4L5G A;  4GIW A;  4YHJ A;  4ANJ A;  4CI2 B;  3ZPO A;  5J2U E;  4UEL A;  4MHC A;  4X1I E;  2CWY A;  2IW5 B;  1U5P A;  3UTK A;  5LNK A;  3O4X E;  2XAJ B;  4IST A;  3LK3 B;  5L3F B;  1O3X A;  3H37 A;  4PJL A;  5A1L A;  3VKH A;  5JR9 B;  3ETV A;  4YLH A;  2MOZ A;  4UF0 B;  2LHN A;  3MAC A;  5HXS A;  2LSY A;  4OFZ A;  3MZK B;  1HG2 A;  3RYI E;  2XHE B;  5L3B B;  4ILU A;  5LBQ B;  3EVY A;  4F6R C;  3F31 A;  1D0Y A;  3B13 A;  5FNV E;  5LP6 E;  3ZYK A;  2KLQ A;  3N9L A;  1WRD A;  1S94 A;  2DWG A;  1MIV A;  1HF8 A;  3PU3 A;  4PFP A;  2NW9 A;  5JRC A;  1YKE B;  3CPZ A;  2CMR A;  4HN9 A;  2Q9Q B;  3FB2 A;  2E9X D;  3GN5 B;  3PUQ A;  3CX7 B;  3ZCI A;  1T98 A;  4H9Q C;  2RA1 A;  3Q5W A;  5LYJ E;  3K3O A;  4JLE A;  4CXW A;  4EYY R;  5H6Q B;  2D0T A;  4O8S A;  4PNI A;  5FYM A;  2E8I A;  3NRY A;  4EYU A;  4WNK A;  5JDH A;  3ZC0 A;  3GWH A;  5JR9 C;  3S4U A;  3IEE A;  2W62 A;  5JDG A;  2I59 A;  1QUU A;  2W63 A;  3TKL B;  1BR4 A;  1SHZ C;  2X67 A;  4H9P C;  3ZMZ B;  2ZLY A;  1HG5 A;  3PU8 A;  3K8P C;  1WYB A;  4U72 A;  3T8O A;  4ZI7 E;  4P0A A;  3C4X A;  1D1C A;  5FY7 A;  3HA4 A;  1D1A A;  5JDF A;  4AXP A;  2K48 A;  3C4W A;  5E0O A;  4IDZ A;  4GYS A;  5LHH B;  3KFW X;  1CUN A;  4I43 B;  2L9Q A;  4TV9 E;  4E7S A;  3ONX A;  4MBQ A;  2EHO D;  1KK7 A;  2OA5 A;  3CWZ B;  2VAS A;  3CVR A;  3P7I A;  2Q9Q C;  2HPL A;  4ZI2 C;  1E1H B;  2CXD A;  4YFS A;  4UEM A;  4WBN E;  1MMN A;  2WM9 A;  3CQC B;  5FMN A;  1US7 B;  4AQF A;  3PDY A;  5CB4 E;  3FBL A;  2CLY B;  4CI1 B;  2HH7 A;  2M67 A;  3CX6 B;  3RPU A;  1OWA A;  5H6R B;  3RC3 A;  2ODV A;  1UCU A;  4O2A E;  1WYC A;  3M65 A;  4QX7 B;  3RH3 A;  2CE7 A;  1LRZ A;  3KV5 A;  4OK0 A;  3FXE B;  1IJ6 A;  3ZMU B;  4C90 A;  4EOZ B;  2VKO A;  2PBI A;  2DCF A;  2YK0 A;  2V7I A;  2NW8 A;  2W0G A;  2ZM0 A;  3HKC E;  4A56 A;  3UFE A;  2D2S A;  4IE6 A;  2JMH A;  4L9I A;  1YKH B;  3HKD E;  4HFV A;  4OYJ A;  3SWH A;  4ZHQ E;  2CA5 A;  2LSG A;  1QSD A;  1MMA A;  1B7T A;  2V1D B;  3OBV E;  5LA6 E;  3RKO A;  3I1A A;  3N2O A;  2C5K T;  3IF8 B;  3N9N A;  3ZC1 A;  3HKB E;  1EZ3 A;  3AB3 B;  3GMI A;  1FMV A;  4UVC B;  3E0Z A;  4ZI3 D;  2DWK A;  3ANW B;  2H3R A;  3KVB A;  5DQV A;  5HWX A;  5JDQ A;  4P0B A;  3U3I A;  5LOV E;  2XAF B;  4KBM B;  4QWN B;  2SPC A;  2MBG A;  4PK6 A;  4V1A v;  5L3E B;  2VKJ A;  3LJC A;  3C98 B;  4KP3 C;  4EAH A;  1X79 A;  2C5J A;  3CKD A;  2JJ9 A;  2VK9 A;  1G73 A;  2E9X C;  3AAI A;  5J1G A;  4TN7 B;  5CA0 E;  5IHY A;  5LJM A;  3MKD A;  3UUL A;  3D0T A;  2L3L A;  4PFO A;  2KT9 A;  5FXV A;  1H7C A;  2PFV A;  2Y48 B;  4CI3 B;  3ZLI A;  2XAQ B;  5JDN A;  4UF0 A;  3V5S A;  4QKN A;  2CM0 A;  3CQG B;  3LG7 A;  5F8P A;  4HGA A;  4G63 A;  3RX6 A;  1MMD A;  4PAG A;  4UIG A;  2LE8 A;  3LK2 B;  4ASK A;  3P8C D;  4PJJ A;  5L3D B;  3RYF E;  1MIW A;  2EHO C;  4H9R C;  1D0Z A;  3R6N A;  1IZN B;  4BJN A;  4TZ4 C;  3C4Z A;  3VU7 H;  4TUY E;  4DVD A;  2LOP A;  2YU1 A;  3MXZ A;  3N9P A;  3GN5 A;  1ZEE A;  3EUH A;  5TAO A;  5LHG B;  4EIW A;  3BQI A;  1NAF A;  2X9X A;  3KDS E;  4JUY A;  2HPJ A;  5LCY A;  1VRB A;  5LXT E;  2JMK A;  3L09 A;  3UUN A;  1G8X A;  4H63 V;  3KV4 A;  1MMG A;  4HKA A;  5HYA A;  3MK7 C;  2J1D G;  3ZYM A;  3AA1 B;  5LHI B;  5LBM A;  3OYZ A;  1ZHC A;  1UX5 A;  5FP3 A;  3RYH E;  2X68 A;  5LG4 A;  4GOU A;  2KMF A;  4GYR A;  3RYC E;  5F3J A;  4ZS3 A;  2BVL A;  3ESL A;  5JVD E;  2DLR A;  4UVB B;  4NUU A;  3AVS A;  3CQX C;  2XUE A;  4IHJ E;  2LSJ A;  1D1B A;  1V9D A;  5L3G B;  2WMO A;  3EDU A;  2CXF A;  3SOL A;  4TX5 A;  4IE7 A;  1IJ5 A;  2V7K A;  4ZI3 C;  2IC9 A;  4AKR B;  4H63 H;  4TV8 E;  3BQK A;  4DMV A;  1HFA A;  2ZM2 A;  5DAB A;  5EK3 A;  5LGU B;  2X9H A;  3FHN A;  2KWH A;  2KXP B;  4HEA A;  2ZM8 A;  4BAY B;  1LKX A;  4YJ2 E;  4MFR A;  2QGS A;  3QC9 A;  4AKG A;  3O1I A;  2LHR A;  2BZB A;  4QXH B;  2GK9 A;  5C8Y E;  4M1P A;  2V7M A;  1FIO A;  4O4J E;  3SS1 A;  3BQL A;  3NZP A;  5AFU L;  4HTE A;  3ZMT B;  3C64 A;  4I55 E;  4EZ4 A;  2E9X B;  3JC6 C;  2X9W A;  3ZMS B;  2DHR A;  1U4Q A;  1BR2 A;  2X66 A;  5M4Y A;  3NZQ A;  2PJQ A;  2W00 A;  3SRZ A;  4OYK A;  1BR0 A;  5KX5 E;  5HAX A;  4PK4 A;  5FXX A;  4PK5 A;  4E7Z A;  3ANW A;  2UXX B;  3MA9 A;  4FI5 A;  1BR1 A;  2A3D A;  4MLK A;  3AA0 B;  5HXE A;  2VKH A;  3PUG A;  2LT3 A;  4CQI A;  2NTX A;  4O4H E;  4HE8 A;  2LOS A;  5FY1 A;  3UUX B;  4DBQ A;  4ISS A;  5L2L A;  3NRX A;  3J7Y q;  3N2K E;  3EDV A;  4EXT A;  3H3A A;  5EZY E;  2H7O A;  2EHO B;  2LEH A;  5HXC A;  2PG8 A;  1HCI A;  2WBL A;  1MNE A;  3VHL A;  4X1Y E;  3ZJ1 A;  2Y6X A;  1Y64 B;  5EK4 A;  3I9Y A;  1SA0 E;  3ZN0 B;  3IBP A;  4OHF A;  2LJL A;  3O1H A;  4XZC A;  5FY0 A;  2ZMA A;  3BK9 A;  3PUS A;  4IE0 A;  3PTR B;  2NWB A;  2BVM A;  4UXN B;  3K3N A;  5FXZ A;  5JR9 A;  2WWU A;  2C5I T;  2X0L B;  2VKD A;  3HI2 A;  4X1K E;  3HL6 A;  3AA7 B;  3PUA A;  4FJO A;  4BA9 A;  2RP4 A;  3LBX B;  4H9N C;  4IGU A;  2KND A;  3R84 B;  3F2E A;  4O4I E;  3N2G E;  5JQG E;  4PW8 A;  3UT5 E;  4UV8 B;  4AQF C;  4BJM A;  3VKG A;  3LK4 2;  3QUJ A;  4ERR A;  3O9X A;  3LFM A;  3PUR A;  4IIJ E;  2QA7 A;  3ZMV B;  3OJA A;  4X20 E;  3E08 A;  3ZCJ A;  2XTL A;  2CXL A;  2KWI B;  3WAK A;  2Q9Q A;  3AAE B;  3ZN1 B;  2VB6 A;  2K9A A;  2WMN A;  2D5U A;  1UX4 A;  2Y8D A;  1LVK A;  2XAH B;  4ZS2 A;  2JRK A;  4O4L E;  2IAK A;  2BDE A;  5EK2 A;  4MAL A;  3RC8 A;  2N9D A;  4IE5 A;  5JH7 E;  3DTO A;  4XBF B;  3KBU A;  1VOM A;  5GON E;  3AVR A;  3F57 A;  3WAJ A;  3N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...