5LJNA

Structure of the hoip pub domain bound to spata2 pim peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
173
structure length
173
Chain Sequence
GEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPATA2 Links CYLD to LUBAC, Activates CYLD, and Controls LUBAC Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 56
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2016-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5ljnA00
2HPLA 4JUYA 4P09A 4P0BA 2CCQA 4P0AA 2D5UA 4OYKA 5LJNA 5LJMA 2HPJA 2CM0A 4OYJA
chains in the Genus database with same CATH superfamily
2ZM2A 1M7KA 1LVKA 4U2YA 5C3JA 2XQAA 1B7TA 3KV9A 3UU4A 1HG5A 2X66A 2K3WA 3P4SA 3NRYA 4EV6A 5ABFA 3FXDB 3C4XA 4ZEYA 5HEUA 4N78D 4IDOA 4O4IE 4PW8A 1FEWA 1T7SA 2QYWA 5FY1A 5AQFB 5JDLA 4U31A 1L0VA 3AE8A 3H37A 3V5SA 2R6GF 3ESLA 4H9PC 4AKGA 1LRZA 2K5BB 2CMRA 2NTYA 1VCTA 1WCRA 2YN6A 3JCFA 2BDEA 3N9PA 4GOUA 5EK4A 1M62A 2DNXA 3ZKRA 4AKHA 1D0ZA 1FIOA 3PURA 3HI2A 3MXZA 4X65T 3J7Yq 4JI7T 4HN9A 3PUVF 2KMFA 5ABFB 3LBXA 3PU8A 3B5MA 4OYKA 1HX1B 4TWDA 5AQLB 4OK0A 1UX5A 3ZYKA 4EGWA 1HNWT 2WWUA 4UV8B 2H7OA 4TV8E 3ONXA 4EEDA 5L47A 2LSJA 1YKEB 3CWZB 3AA0B 3KVAA 4HFBA 4ZZBA 4OX9T 4IIJE 2JQHA 4JEUB 1HS7A 4DV0T 4CI3B 3RX6A 3ANWA 5AQVB 3J9X1 5ABHA 5HXHA 1D0XA 4H9OC 4TWHA 3VKHA 3FB2A 1X79A 4UVAB 3AA1B 3DTOA 5H6QB 3VR8A 4DIDB 2JQKA 2VVSA 2W62A 2N9DA 5LG4A 1R8IA 1KNPA 4DV6T 2J47A 5KDMC 1XMQT 2ODUA 2KXPB 2ZM0A 4HWFA 2ZM6T 2FJEA 3HA4A 3JAFA 3ZCIA 2X0HA 4DR7T 2MYSA 2E5VA 4X64T 3RH3A 2NTXA 1IZNB 3Q5XA 3NBXX 3CQCB 3ZPOA 4JBWF 4UR9A 5JDFA 4DR6T 4JI6T 3X1DA 4ILBA 4NXMT 2UXXB 2OLTA 3AEGA 3EI0A 1US7B 2D0TA 2BZBA 4TUYE 3U3IA 2H88A 4I55E 1MIWA 3I0QA 4TNVA 2UXBT 1XDPA 4IE0A 4Z91A 4AQFA 4QHOA 3RIUC 1HFAA 2NR4A 3UU8A 2M67A 3RYIE 4YXDA 2H7VC 5DQWA 2MBGA 4A97A 2XTLA 3N9OA 1ZP0A 2VL8A 1UUSA 5LHIB 3OTOT 2LSIA 3B13A 3P50A 2CWYA 2BS3A 1N36T 4ZI3C 3RIUA 1MMDA 1CUNA 3IF8B 4AKRB 2EHOC 4ERRA 1ZV4X 5ABGA 5C8YE 2WZIA 5CA1E 1LKXA 5CGMA 1NWMX 5L3FB 4TNWA 2W4XA 3K3OA 1WR0A 3ONLC 3Q5WA 3RI5A 2XPKA 3A7MA 2LHRA 1AJ3A 4CXXA 5HWYA 5AQPB 2YU2A 3IHRA 2CRBA 4ZS3A 4YSXA 4G63A 2LOPA 4B3TT 3LDQB 4L0RA 2LSKA 3F2EA 4CN6A 5ADXL 1HNXT 1V9DA 3AE9A 4LFAT 3O1JA 2V1DB 4MFRA 3R6NA 4KMCA 2JRKA 1XDOA 2AE9A 2HPJA 2SPCA 1SUMB 4TV9E 5FP3A 4A5XA 1E2AA 5F3JA 1X9BA 3HKDE 3KV4A 1G73A 2CBIA 3OYXA 4O2BE 4DV4T 4HWHA 4ILCA 1OEDA 4H63V 4K0UA 2W67A 4AQGA 1WYCA 3AE4A 4DV3T 3ANWB 5HEJA 3QUJA 4I4TE 2BBJA 4EZHA 2XQ8A 5LNKA 2V8SV 2FJBA 2WSSV 4U3CA 3ZT6A 1YQ4A 4QH5A 4DBQA 1KFYA 2KWHA 1Y01A 3PUXF 2E9XA 2G0UA 1XMOT 4JI0T 4EB6E 3OVUA 1NENA 2CXLA 2E9XD 5KX5E 2XQ6A 4OFZA 3M65A 5JDQA 4I0UA 1MNDA 3UU5A 4GKJT 1VOMA 3PUGA 4EYUA 2VQFT 5HXSA 1VCSA 5LGNB 3R84B 2X67A 2I6HA 5FXZA 2HH7A 2KZ7B 3B57A 1T8BA 3N9MA 1JNRA 5LBMA 1OEDE 5LBQB 3UULA 3VKGA 3FXEB 5LJMA 3AE7A 2ACZA 2V5CA 1ZEEA 2WBLA 3AA6B 4J2CA 4UV9B 1YQ3A 1HR0T 5AQNB 1N32T 3AEEA 2D2SA 2M6BA 4PFPA 5AFUL 3RC8A 4HGAA 4AXPA 4YHHT 2ZM8A 3GWHA 2Y6XA 3L39A 5M4YA 2XSBA 2IC6A 5JDGA 3ZC0A 2A3DA 3ZCJA 3PU3A 5HEHA 2XUEA 5F8PA 2UU9T 3CPZA 3P4PA 4KUMB 5JDHA 4LF4T 2DHRA 2KWIB 2XQ3A 4UIGA 2M6IA 3TLUA 3ZMUB 4XZCA 3WAKA 1BR1A 5EK2A 4LF7T 3RPUA 3PJAJ 4ISTA 4B6XA 4CXWA 1I94T 3PUWF 2JPFA 2CA5A 3P4WA 5EK3A 2BKOA 3ABVA 2LSGA 3AE5A 3C98B 3PJAA 2NW9A 3RYFE 4HWCA 3NRXA 2XM2A 4PJJA 4EZ4A 5FL1A 5L3DB 5LP6E 2VURA 1YD8G 3F31A 1S35A 3DJBA 3ZMSB 3I9WA 3EUHA 2HHHT 3MK7C 4WBOA 3CQXC 2W61A 4P1NA 3RHWA 1XNQT 3CX8B 2XQ5A 1WRDA 3QB5A 1LVFA 4P0BA 1OEDC 2C5KT 5GONE 4JI2T 3FHNA 2D9DA 5JDMA 4MLKA 3ZYLA 4UVCB 2KT9A 2XAFB 5FNVE 5DJQC 2ZLYA 1D1AA 1Z8UA 2WWVA 4IREA 2WMNA 3GA8A 1BR0A 3C51A 4DR1T 1UGOA 5FKYA 4PFOA 2BG9C 2GK9A 5AQMB 5HCJA 4C90A 4V1Av 3OYZA 2X68A 2XQYA 2VKJA 1DU2A 2QVAA 4JI4T 2XAJB 2Y8DA 3GN5A 2IIUA 4ZS2A 2BS4A 3UU3A 5JR9C 4Q25A 4DV1T 1Z0PA 3A8YC 3JC6D 5FY0A 4DO0A 3I0OA 4AISA 2VKDA 4CN4A 4K0KT 2WDVA 4E7ZA 5IWAT 1IJ6A 4MALA 4X20E 4H9SE 4FJOA 4IL4A 2W00A 3E0ZA 4NUVA 1KNRA 5J1GA 1J1JA 1E1HB 3LK42 3QOFA 4Z90A 4DBRA 3AECA 4AKIA 1W09A 5FXXA 1HTJF 4KHPT 3TLTA 4GK5E 2CLYB 2CXFA 4TX5A 2WCAA 4AQYT 1FJGT 3D0TA 2A9UA 2XQ9A 4ISSA 1HF8A 4ZHQE 2PBIA 4FI5A 2UUCT 4G2AA 2NWBA 4HFVA 4I50E 3ZYMA 4JI8T 3HL6A 3K8PC 2JIWA 3EHZA 5FYMA 2K9AA 2ES0A 4EOZB 5LYJE 2RPAA 2W0GA 5AQKB 5ABEA 4YTPA 5KXJA 2K48A 4PK6A 4NXNT 2CXDA 2N1GA 2LKGA 3CMLA 3TLVA 3L09A 4DMVA 2X0LB 2WZHA 2LSYA 4OHFA 2JQ9A 5CB4E 3IBPA 3RRCA 3ZJ1A 3E08A 4CI2B 4H9RC 2E9XB 3C64A 3LK2B 3AAAB 3F57A 5EZYE 4LFBT 3P4RA 5HXRA 1U5PA 2BKPA 3CX7B 3CQGB 3HKEE 3RQUA 4YT0A 2EHOD 4NPPA 5HXEA 2VVNA 4IDZA 4JI1T 4E7SA 1VRBA 2OV9A 3LBXB 4H9QC 1WR6A 1ZOYA 4YJ3E 4M1PA 4O2AE 5H6RB 2V6YA 3GMIA 5AQUB 3VRBA 4DV2T 4ZXLA 2LE8A 3P8CD 1UX4A 3UU6A 2DLRA 2BG9E 5LHGB 4Z8XA 4AKLA 4QXHB 3MACA 3UFGA 1OEDB 1Y64B 5F5WA 2BVLA 5FXWA 3FZHB 4YSYA 3I9YA 3AXJA 5LG3A 3OPCA 1FMWA 2D0UA 1U4QA 3K1SA 4BJNA 4QXBB 5J0ZA 3KINB 2JMHA 2CHNA 3KBUA 3Q5EA 4NIQA 4TWFA 2Q9QC 5FMNA 4LF8T 2Y48B 3RQWA 2P9BA 3FBZA 3CIRA 2VL0A 3AE3A 3SRZA 3ZMVB 4ANJA 3RGLA 5AQJB 3UUBA 4EIWA 4ZI2D 1KNZA 1D1BA 2XM1A 4ZI7E 4QWNB 2L9QA 5JR9A 3WI3A 2Q9QA 3ZMTB 5BR8T 4WW0A 4UXNB 1W0AA 1FMVA 2KLQA 1EZ3A 2AXDS 2JJ9A 3N9LA 3PUSA 1OXZA 2FJAA 2WY2A 3KVBA 3NZPA 2YK0A 1WYBA 1MIYA 5LA6E 3M3ZB 5HCMA 3VU7H 4IE6A 1IBLT 2BG9B 1ZKEA 2BG9A 4BA9A 5CA0E 3PUAA 2C5JA 5LMNT 5LGTB 1BR4A 4ZOLE 2MAWA 4L5GA 2WU5A 4H9NC 3O1IA 2LKHA 3AEBA 4PJLA 4ILUA 2V7MA 3SFDA 4QH4A 2H3RA 5C2TA 2E9XC 4U7YA 3U78A 4QX8B 2XZEA 4CZZB 4ADZA 2JQQA 4AI6A 3BK9A 2OA5A 4XBFB 3ZEFB 2LLYA 3AVRA 3RKGA 5L3GB 2X51A 3MA9A 2UXDT 5AQGB 4IHJE 1J5ET 2IC9A 3EVYA 3RLFF 4EYYR 2X9YA 4HFDA 3FBLA 5CJ5A 1T72A 4WBNE 4EAHA 4U72A 3UQ7A 1E7PA 1HG2A 5FL0A 4B3ST 4ZI2C 4YFSA 3ONJA 2BKNA 2WAUA 1IBMT 4B3MT 4GYRA 4IGUA 3ZC1A 3ZSSA 2HN2A 4LFCT 3NZQA 3SS1A 4DV5T 5AQHB 1ZHCA 5HEGA 3UUXB 4LF9T 1MNEA 2WDRA 3JADA 1OWAA 1SA0E 3N9NA 4COFA 5JQGE 2DCFA 3LJCA 4PAGA 2DI4A 4PNIA 1HX8A 1MMNA 2YKSA 3N2OA 4DNDA 4O8SA 1I6ZA 5FVLA 4HWIB 2CPTA 3A5XA 4DR5T 5JREA 2ACXA 2B76A 2FBWA 4O4JE 3TLWA 4H63H 3ZN1B 1D1CA 1MMGA 3PTRB 4ILAA 2NOXA 4NUUA 3O9XA 1MMAA 4PJMA 3H3AA 5E0OA 5JVDE 2LRLA 3O1HA 4KX6A 4IL9A 3SWHA 3AEFA 4P09A 5L4HA 3DP7A 4LMLA 4U33A 4DUYT 2UUAT 5IHYA 3ZJ2A 4JYAT 1QUUA 5IYZE 2WB5A 2FJDA 4GIWA 4IE7A 1KEYA 2CM0A 2V7KA 5FVKA 2A72A 2ODVA 4HFCA 2XQ4A 4BAYB 3AE2A 1HNZT 2CHOA 2YINA 2YOEA 4GYSA 4UEMA 3ZLIA 2RA1A 4DV7T 5FXVA 4GKKT 2V7IA 2HN1A 2XQ7A 3G06A 4O4LE 3VHLA 3ZT7A 1IAPA 4UF0B 4LMKA 2E5LT 1D0YA 3JC6C 3WAJA 4DVDA 1W0BA 2IHR1 4I43B 3UQ4A 4OYJA 2UXNB 4QKNA 3L3PA 3MJXA 5LCYA 2ZMAA 3W15B 4DR2T 3PV0F 2LEHA 2QRXA 3AAEB 1O3XA 2VKHA 3ETVA 3OJAA 2X9WA 3Q2MA 4HWDA 5FY7A 2LM2A 2Q9QB 2YDSA 2DL1A 3CK6A 2RP4A 5JR9B 2V26A 3HKCE 3PUYF 3P4QA 5LOVE 2LRKA 5AQRB 2H89A 2C0SA 2B1EA 4AIUA 4ASKA 1S94A 2WMOA 4YTMA 5LJNA 3IEEA 2W63A 5A1LA 1T98A 2NW8A 4X1IE 3BQIA 2IUBA 5L4EA 3V5UA 4HE8A 1XNRT 5L3BB 3AXJB 4O4HE 3K3NA 4WNKA 3MKDA 3ZT5A 4HEAA 2FUPA 2NP9A 2D5UA 2PFVA 4IE5A 3AEAA 4TZ4C 2VWAA 2WM9A 3H3MA 4U74A 3ZN0B 3KFWX 3PUZF 4F8HA 1KF6A 3T8OA 1YW0A 1MIVA 3C50A 3SFEA 1G8XA 3ZSTA 2X9HA 5L3EB 1YXRA 3Q9DA 3CKDA 2J62A 5JDNA 1WFDA 3RIFA 3N9QA 5HXCA 2V7LA 2K24A 4CI1B 2A2FX 5HEOA 4LF5T 4HFIA 4JV5T 4DMWA 3N2KE 3E22E 2V5DA 2VKOA 2BS2A 2I0MA 3AVSA 3N5LA 1XWMA 2C5IT 3IA3A 2YDRA 4X62T 4WYVA 5LB7B 2NW7A 1N33T 2MPKA 4C91A 2WS3A 2WDQA 4DR4T 1UCUA 3SOLA 3O4XE 2CEAA 4LMJA 4GK0E 1SE7A 2QGSA 2E8IA 5HWXA 2WU2A 1UK5A 1H7CA 3RF1A 2UXCT 1IJ5A 4YLHA 3RC3A 4WZXA 5DQVA 2LT3A 5IUXA 2W2UA 3AB3B 5BMVE 2X9XA 2V6YB 3RIAA 4HFHA 4B3RT 5J2TE 3I1AA 3LK3B 4JI3T 3AE6A 3FZLB 2L8KA 3LG7A 3NKZA 3PE0A 2CBJA 2I59A 4QXCB 2LM9A 5LXTE 4KP3C 5AQSB 3AEDA 2XAGB 2XASB 3TLSA 2HPLA 2YDQA 5AQOB 4CQIA 5J2UE 5JRCA 2QA7A 2XY8B 2YEVC 5AQTB 4IE4A 3VR9A 3Q5DA 4KHZF 4L9IA 4YJ2E 2JMKA 2EHOB 3HR0A 4KI0F 2V7JA 2VK9A 3N2GE 2MTQA 4EEBA 3RYHE 4MHCA 1J5WA 4IT4A 2CLYC 3OKQA 2Z6EA 3K3QC 4JUYA 4X66T 3EAMA 2V6XA 3ETUA 2VASA 4QH1A 4X1YE 3RKOA 2XSAA 3TKLB 4HKAA 3UUMA 1QSDA 1W9RA 2DWGA 4IDPA 4YY3T 2KSRA 4A56A 5KMGP 2UUBT 2MOZA 3BQKA 2X0YA 5ETWA 2Q9QD 2IMLA 4U7IA 3RRWA 1IBKT 3S4UA 2BVMA 3T1YT 4LF6T 2CE7A 5AQIB 3UTKA 2LJLA 4BJMA 2XAHB 1YKHB 3QC9A 3KV6A 2CWOA 3UT5E 3CX6B 5DABA 2BBHA 3BQLA 4JLEA 3HKBE 4DUZT 3C4ZA 4DR3T 1GQEA 4IDNA 4ZZCA 2LOSA 3GN5B 4MBQA 2DWKA 4PJNA 3KDSE 3LSVA 4PK5A 4YHJA 5HYAA 3VRAA 2WQYA 2KINB 3QK6A 5HAXA 4F6RC 3QB5K 1XZYA 3LFMA 3RYCE 1SHZC 3EDUA 2XHEB 3FZKB 3PDYA 4A98A 2CCQA 1KK7A 2YU1A 1HCIA 3QNUA 4PK4A 1NEKA 4QX7B 2IW5B 3AA7B 1JNZA 3KBTA 1N34T 4ZI3D 4YSZA 2LHNA 2VB6A 2E2AA 4X1KE 5LGUB 2VQET 4CXYA 4YTNA 4P0AA 3EDVA 3FZMB 3MZKB 1BR2A 4XAXB 4HTEA 4IDQA 3UFEA 1CHUA 3L8RA 3ZMZB 1WLXA 4EXTA 2J4GA 2KNDA 2PTFA 5CFBA 1NAFA 2XAQB 3T1HT 2IDOB 3EABA 3NWIA 4UVBB 3NVOA 3PUQA 2IAKA 4TN7B 5AQQB 4U2ZA 3C4WA 3OBVE 5TAOA 3CVRA 5JTGA 4HFEA 2N2NA 3JAEA 2L3LA 4KBMB 2PG8A 2WP9A 3AE1A 3UUNA 5JH7E 2EHOA 2PJQA 3KV5A 4UELA 3AAIA 2XJ7A 5L2LA 1UURA 3FZFB 5LHHB 4UF0A 5JRCB 4X5TA 4AQFC 4CN1A 4JEHB 5LMUT 2W66A 4JI5T 2F4VT 2J1DG 3P7IA 5L3CB 1QLBA
chains in the Genus database with same CATH topology
2ZM2A 1LVKA 3KV9A 1B7TA 1HG5A 2X66A 3NRYA 3FXDB 3C4XA 4N78D 4O4IE 4PW8A 1FEWA 5FY1A 5JDLA 3H37A 3V5SA 3ESLA 4H9PC 4AKGA 1LRZA 2K5BB 2CMRA 2NTYA 3N9PA 5EK4A 4AKHA 2BDEA 4GOUA 2DNXA 1D0ZA 1FIOA 3PURA 3HI2A 3MXZA 3J7Yq 4HN9A 2KMFA 3LBXA 3PU8A 4OYKA 3ZYKA 4OK0A 1UX5A 2WWUA 4UV8B 2H7OA 4TV8E 3ONXA 2LSJA 1YKEB 3CWZB 3AA0B 3KVAA 4IIJE 4JEUB 1HS7A 4CI3B 3RX6A 3ANWA 3J9X1 5HXHA 1D0XA 4H9OC 3VKHA 3FB2A 1X79A 4UVAB 3AA1B 3DTOA 5H6QB 2W62A 2N9DA 5LG4A 5KDMC 2ODUA 2KXPB 2ZM0A 3HA4A 3ZCIA 2MYSA 3RH3A 2NTXA 1IZNB 3Q5XA 3NBXX 3CQCB 3ZPOA 5JDFA 2UXXB 3U3IA 1US7B 2D0TA 2BZBA 4TUYE 4I55E 1MIWA 3I0QA 4IE0A 4AQFA 4QHOA 1HFAA 2M67A 3RYIE 2H7VC 5DQWA 2MBGA 2XTLA 3N9OA 2VL8A 5LHIB 2LSIA 3B13A 2CWYA 4ZI3C 4ERRA 1MMDA 1CUNA 3IF8B 4AKRB 2EHOC 5CA1E 1ZV4X 5C8YE 5LP6E 5L3FB 1LKXA 1NWMX 3K3OA 3Q5WA 2LHRA 1AJ3A 4CXXA 5HWYA 2YU2A 3IHRA 4ZS3A 4G63A 2LOPA 4L0RA 2LSKA 3F2EA 5ADXL 1V9DA 3O1JA 2V1DB 4MFRA 3R6NA 4KMCA 2JRKA 2HPJA 5FP3A 4TV9E 2SPCA 5F3JA 3HKDE 3KV4A 1G73A 4O2BE 3OYXA 4H63V 4K0UA 4AQGA 1WYCA 3ANWB 3QUJA 4I4TE 4EZHA 5LNKA 2WSSV 4DBQA 2KWHA 2E9XA 2G0UA 4EB6E 2CXLA 2E9XD 4OFZA 3M65A 5JDQA 1MNDA 1VOMA 3PUGA 4EYUA 5HXSA 5LGNB 3R84B 2X67A 5FXZA 2HH7A 3B57A 2KZ7B 3N9MA 5LBMA 5LBQB 3UULA 3VKGA 3FXEB 2WBLA 1ZEEA 3AA6B 4J2CA 4UV9B 2D2SA 4PFPA 5AFUL 3RC8A 4HGAA 4AXPA 2ZM8A 3GWHA 2Y6XA 2IC6A 5JDGA 3ZC0A 2A3DA 3ZCJA 3PU3A 2XUEA 5F8PA 3CPZA 4KUMB 5JDHA 2DHRA 2KWIB 4UIGA 5EK2A 3ZMUB 4XZCA 3WAKA 1BR1A 3RPUA 4CXWA 4ISTA 4B6XA 2JPFA 2CA5A 2NW9A 5EK3A 2LSGA 3C98B 3RYFE 4EZ4A 4PJJA 3NRXA 5L3DB 3F31A 1YD8G 1S35A 3DJBA 3ZMSB 3I9WA 3EUHA 3MK7C 4WBOA 3CQXC 2W61A 3CX8B 1WRDA 1LVFA 4P0BA 2C5KT 5GONE 3FHNA 5JDMA 4MLKA 3ZYLA 4UVCB 2KT9A 2XAFB 5FNVE 5DJQC 2ZLYA 1D1AA 2WMNA 3GA8A 1BR0A 3C51A 4PFOA 2GK9A 4C90A 4V1Av 3OYZA 2X68A 2XQYA 2VKJA 2XAJB 2Y8DA 3GN5A 4ZS2A 5JR9C 1Z0PA 3JC6D 5FY0A 4DO0A 3I0OA 2VKDA 4E7ZA 1IJ6A 4MALA 4X20E 4H9SE 4FJOA 4NUVA 2W00A 3E0ZA 5J1GA 5KX5E 1E1HB 3LK42 4AKIA 5FXXA 1HTJF 4GK5E 2CLYB 2CXFA 4TX5A 3D0TA 4ISSA 1HF8A 4ZHQE 2PBIA 4FI5A 4G2AA 2NWBA 4HFVA 4I50E 3ZYMA 3HL6A 3K8PC 5FYMA 2K9AA 2ES0A 4EOZB 5LYJE 2W0GA 2K48A 4PK6A 2CXDA 2N1GA 3CMLA 4DMVA 3L09A 2X0LB 2LSYA 4OHFA 5CB4E 3RRCA 3IBPA 3ZJ1A 3E08A 4CI2B 4H9RC 2E9XB 3C64A 3LK2B 3AAAB 3F57A 5EZYE 5HXRA 1U5PA 3HKEE 3CX7B 3CQGB 2EHOD 5HXEA 4IDZA 4E7SA 1VRBA 3LBXB 4H9QC 1WR6A 4YJ3E 4M1PA 4O2AE 5H6RB 3GMIA 2LE8A 3P8CD 1UX4A 5LHGB 2DLRA 4Z8XA 4AKLA 4QXHB 3MACA 1Y64B 2BVLA 5FXWA 3I9YA 1FMWA 2D0UA 1U4QA 4BJNA 4QXBB 3KINB 2JMHA 3KBUA 5FMNA 3O9XA 4DBRA 2Q9QC 5M4YA 2Y48B 3SRZA 3FBZA 2P9BA 3ZMVB 4ANJA 4ZI2D 4EIWA 1KNZA 1D1BA 4ZI7E 4QWNB 2L9QA 5JR9A 3WI3A 2Q9QA 3ZMTB 4WW0A 4UXNB 1FMVA 2KLQA 1EZ3A 3N9LA 2JJ9A 3PUSA 1OXZA 3NZPA 3KVBA 2YK0A 1WYBA 1MIYA 5LA6E 3VU7H 4IE6A 1ZKEA 4BA9A 5CA0E 3PUAA 2C5JA 5LGTB 1BR4A 4ZOLE 4L5GA 4H9NC 3O1IA 4PJLA 4ILUA 2V7MA 2H3RA 2E9XC 3U78A 4AI6A 4QX8B 4CZZB 4ADZA 2JQQA 3BK9A 2OA5A 4XBFB 3ZEFB 3AVRA 5L3GB 2X51A 3MA9A 4IHJE 2IC9A 3EVYA 4EYYR 2X9YA 3FBLA 4WBNE 4EAHA 4U72A 1HG2A 4ZI2C 4YFSA 2WAUA 4GYRA 4IGUA 3ZC1A 3NZQA 3SS1A 3UUXB 1ZHCA 1MNEA 5JQGE 1OWAA 1SA0E 3N9NA 2DCFA 3LJCA 4PAGA 2DI4A 4PNIA 1HX8A 1MMNA 3N2OA 4DNDA 4O8SA 3A5XA 5JREA 2ACXA 4O4JE 3ZN1B 4H63H 1D1CA 1MMGA 3PTRB 2NOXA 4NUUA 1MMAA 4PJMA 3H3AA 5E0OA 5JVDE 3O1HA 3SWHA 4P09A 3DP7A 5IHYA 3ZJ2A 1QUUA 5IYZE 4GIWA 4IE7A 2CM0A 2V7KA 2A72A 2ODVA 4BAYB 2YINA 4GYSA 4UEMA 3ZLIA 2RA1A 5FXVA 2V7IA 3VHLA 4O4LE 1IAPA 4UF0B 1D0YA 3JC6C 3WAJA 4DVDA 4I43B 4OYJA 2UXNB 4QKNA 3L3PA 3MJXA 5LCYA 2ZMAA 3W15B 2LEHA 3AAEB 5FY7A 1O3XA 2VKHA 3ETVA 3OJAA 2X9WA 3Q2MA 3UUMA 5LJMA 2Q9QB 2RP4A 5JR9B 2V26A 3HKCE 5LOVE 2C0SA 2B1EA 4ASKA 1S94A 2WMOA 5LJNA 3IEEA 2W63A 5A1LA 1T98A 2NW8A 4X1IE 3BQIA 3V5UA 4HE8A 5L3BB 4O4HE 3K3NA 4WNKA 3MKDA 4HEAA 2NP9A 2D5UA 2PFVA 4IE5A 4TZ4C 2VWAA 2WM9A 4U74A 3ZN0B 3KFWX 3T8OA 5L3EB 1YW0A 3C50A 1MIVA 1G8XA 2X9HA 3Q9DA 3CKDA 5JDNA 3N9QA 5HXCA 2V7LA 2K24A 4CI1B 2A2FX 4DMWA 3N2KE 3E22E 2VKOA 3AVSA 3N5LA 2C5IT 2NW7A 4C91A 1UCUA 3SOLA 3O4XE 2CEAA 4GK0E 2QGSA 2E8IA 5HWXA 1H7CA 1IJ5A 4YLHA 3RC3A 5DQVA 2LT3A 3AB3B 5BMVE 2X9XA 5J2TE 3I1AA 3LK3B 3LG7A 3PE0A 2L8KA 4QXCB 2I59A 2LM9A 5LXTE 4KP3C 2XAGB 2XASB 2HPLA 4CQIA 5J2UE 5JRCA 2QA7A 2YEVC 4IE4A 4L9IA 4YJ2E 2JMKA 2EHOB 3HR0A 2V7JA 2VK9A 3N2GE 2MTQA 3RYHE 4MHCA 2CLYC 3OKQA 2Z6EA 3K3QC 4JUYA 3ETUA 2VASA 3RKOA 4X1YE 3TKLB 4HKAA 1QSDA 2DWGA 4A56A 5KMGP 2MOZA 3BQKA 5ETWA 2Q9QD 3RRWA 3S4UA 2BVMA 2CE7A 3UTKA 2LJLA 4BJMA 2XAHB 1YKHB 3QC9A 3KV6A 2CWOA 3UT5E 3CX6B 5DABA 3BQLA 4JLEA 3HKBE 3C4ZA 2LOSA 3GN5B 4MBQA 2DWKA 4PJNA 3KDSE 4PK5A 4YHJA 5HYAA 3QK6A 2KINB 5HAXA 4F6RC 3LFMA 3RYCE 1SHZC 3EDUA 2XHEB 3PDYA 2CCQA 1KK7A 2YU1A 1HCIA 4PK4A 2IW5B 4QX7B 3AA7B 3KBTA 4ZI3D 2LHNA 2VB6A 4X1KE 5LGUB 4CXYA 4P0AA 3EDVA 3MZKB 1BR2A 4XAXB 4HTEA 3UFEA 3ZMZB 1WLXA 4EXTA 2KNDA 1NAFA 2XAQB 4UVBB 3PUQA 2IAKA 4TN7B 5TAOA 3C4WA 3OBVE 3CVRA 2N2NA 4KBMB 2L3LA 2PG8A 5JH7E 3UUNA 2EHOA 2PJQA 3KV5A 4UELA 3AAIA 5L2LA 5LHHB 4UF0A 5JRCB 4AQFC 4JEHB 2J1DG 3P7IA 5L3CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPL A;  4JUY A;  4P09 A;  4P0B A;  2CCQ A;  4P0A A;  2D5U A;  4OYK A;  5LJN A;  5LJM A;  2HPJ A;  2CM0 A;  4OYJ A; 
#chains in the Genus database with same CATH topology
 2ZM2 A;  1M7K A;  1LVK A;  4U2Y A;  5C3J A;  2XQA A;  1B7T A;  3KV9 A;  3UU4 A;  1HG5 A;  2X66 A;  2K3W A;  3P4S A;  3NRY A;  4EV6 A;  5ABF A;  3FXD B;  3C4X A;  4ZEY A;  5HEU A;  4N78 D;  4IDO A;  4O4I E;  4PW8 A;  1FEW A;  1T7S A;  2QYW A;  5FY1 A;  5AQF B;  5JDL A;  4U31 A;  1L0V A;  3AE8 A;  3H37 A;  3V5S A;  2R6G F;  3ESL A;  4H9P C;  4AKG A;  1LRZ A;  2K5B B;  2CMR A;  2NTY A;  1VCT A;  1WCR A;  2YN6 A;  3JCF A;  2BDE A;  3N9P A;  4GOU A;  5EK4 A;  1M62 A;  2DNX A;  3ZKR A;  4AKH A;  1D0Z A;  1FIO A;  3PUR A;  3HI2 A;  3MXZ A;  4X65 T;  3J7Y q;  4JI7 T;  4HN9 A;  3PUV F;  2KMF A;  5ABF B;  3LBX A;  3PU8 A;  3B5M A;  4OYK A;  1HX1 B;  4TWD A;  5AQL B;  4OK0 A;  1UX5 A;  3ZYK A;  4EGW A;  1HNW T;  2WWU A;  4UV8 B;  2H7O A;  4TV8 E;  3ONX A;  4EED A;  5L47 A;  2LSJ A;  1YKE B;  3CWZ B;  3AA0 B;  3KVA A;  4HFB A;  4ZZB A;  4OX9 T;  4IIJ E;  2JQH A;  4JEU B;  1HS7 A;  4DV0 T;  4CI3 B;  3RX6 A;  3ANW A;  5AQV B;  3J9X 1;  5ABH A;  5HXH A;  1D0X A;  4H9O C;  4TWH A;  3VKH A;  3FB2 A;  1X79 A;  4UVA B;  3AA1 B;  3DTO A;  5H6Q B;  3VR8 A;  4DID B;  2JQK A;  2VVS A;  2W62 A;  2N9D A;  5LG4 A;  1R8I A;  1KNP A;  4DV6 T;  2J47 A;  5KDM C;  1XMQ T;  2ODU A;  2KXP B;  2ZM0 A;  4HWF A;  2ZM6 T;  2FJE A;  3HA4 A;  3JAF A;  3ZCI A;  2X0H A;  4DR7 T;  2MYS A;  2E5V A;  4X64 T;  3RH3 A;  2NTX A;  1IZN B;  3Q5X A;  3NBX X;  3CQC B;  3ZPO A;  4JBW F;  4UR9 A;  5JDF A;  4DR6 T;  4JI6 T;  3X1D A;  4ILB A;  4NXM T;  2UXX B;  2OLT A;  3AEG A;  3EI0 A;  1US7 B;  2D0T A;  2BZB A;  4TUY E;  3U3I A;  2H88 A;  4I55 E;  1MIW A;  3I0Q A;  4TNV A;  2UXB T;  1XDP A;  4IE0 A;  4Z91 A;  4AQF A;  4QHO A;  3RIU C;  1HFA A;  2NR4 A;  3UU8 A;  2M67 A;  3RYI E;  4YXD A;  2H7V C;  5DQW A;  2MBG A;  4A97 A;  2XTL A;  3N9O A;  1ZP0 A;  2VL8 A;  1UUS A;  5LHI B;  3OTO T;  2LSI A;  3B13 A;  3P50 A;  2CWY A;  2BS3 A;  1N36 T;  4ZI3 C;  3RIU A;  1MMD A;  1CUN A;  3IF8 B;  4AKR B;  2EHO C;  4ERR A;  1ZV4 X;  5ABG A;  5C8Y E;  2WZI A;  5CA1 E;  1LKX A;  5CGM A;  1NWM X;  5L3F B;  4TNW A;  2W4X A;  3K3O A;  1WR0 A;  3ONL C;  3Q5W A;  3RI5 A;  2XPK A;  3A7M A;  2LHR A;  1AJ3 A;  4CXX A;  5HWY A;  5AQP B;  2YU2 A;  3IHR A;  2CRB A;  4ZS3 A;  4YSX A;  4G63 A;  2LOP A;  4B3T T;  3LDQ B;  4L0R A;  2LSK A;  3F2E A;  4CN6 A;  5ADX L;  1HNX T;  1V9D A;  3AE9 A;  4LFA T;  3O1J A;  2V1D B;  4MFR A;  3R6N A;  4KMC A;  2JRK A;  1XDO A;  2AE9 A;  2HPJ A;  2SPC A;  1SUM B;  4TV9 E;  5FP3 A;  4A5X A;  1E2A A;  5F3J A;  1X9B A;  3HKD E;  3KV4 A;  1G73 A;  2CBI A;  3OYX A;  4O2B E;  4DV4 T;  4HWH A;  4ILC A;  1OED A;  4H63 V;  4K0U A;  2W67 A;  4AQG A;  1WYC A;  3AE4 A;  4DV3 T;  3ANW B;  5HEJ A;  3QUJ A;  4I4T E;  2BBJ A;  4EZH A;  2XQ8 A;  5LNK A;  2V8S V;  2FJB A;  2WSS V;  4U3C A;  3ZT6 A;  1YQ4 A;  4QH5 A;  4DBQ A;  1KFY A;  2KWH A;  1Y01 A;  3PUX F;  2E9X A;  2G0U A;  1XMO T;  4JI0 T;  4EB6 E;  3OVU A;  1NEN A;  2CXL A;  2E9X D;  5KX5 E;  2XQ6 A;  4OFZ A;  3M65 A;  5JDQ A;  4I0U A;  1MND A;  3UU5 A;  4GKJ T;  1VOM A;  3PUG A;  4EYU A;  2VQF T;  5HXS A;  1VCS A;  5LGN B;  3R84 B;  2X67 A;  2I6H A;  5FXZ A;  2HH7 A;  2KZ7 B;  3B57 A;  1T8B A;  3N9M A;  1JNR A;  5LBM A;  1OED E;  5LBQ B;  3UUL A;  3VKG A;  3FXE B;  5LJM A;  3AE7 A;  2ACZ A;  2V5C A;  1ZEE A;  2WBL A;  3AA6 B;  4J2C A;  4UV9 B;  1YQ3 A;  1HR0 T;  5AQN B;  1N32 T;  3AEE A;  2D2S A;  2M6B A;  4PFP A;  5AFU L;  3RC8 A;  4HGA A;  4AXP A;  4YHH T;  2ZM8 A;  3GWH A;  2Y6X A;  3L39 A;  5M4Y A;  2XSB A;  2IC6 A;  5JDG A;  3ZC0 A;  2A3D A;  3ZCJ A;  3PU3 A;  5HEH A;  2XUE A;  5F8P A;  2UU9 T;  3CPZ A;  3P4P A;  4KUM B;  5JDH A;  4LF4 T;  2DHR A;  2KWI B;  2XQ3 A;  4UIG A;  2M6I A;  3TLU A;  3ZMU B;  4XZC A;  3WAK A;  1BR1 A;  5EK2 A;  4LF7 T;  3RPU A;  3PJA J;  4IST A;  4B6X A;  4CXW A;  1I94 T;  3PUW F;  2JPF A;  2CA5 A;  3P4W A;  5EK3 A;  2BKO A;  3ABV A;  2LSG A;  3AE5 A;  3C98 B;  3PJA A;  2NW9 A;  3RYF E;  4HWC A;  3NRX A;  2XM2 A;  4PJJ A;  4EZ4 A;  5FL1 A;  5L3D B;  5LP6 E;  2VUR A;  1YD8 G;  3F31 A;  1S35 A;  3DJB A;  3ZMS B;  3I9W A;  3EUH A;  2HHH T;  3MK7 C;  4WBO A;  3CQX C;  2W61 A;  4P1N A;  3RHW A;  1XNQ T;  3CX8 B;  2XQ5 A;  1WRD A;  3QB5 A;  1LVF A;  4P0B A;  1OED C;  2C5K T;  5GON E;  4JI2 T;  3FHN A;  2D9D A;  5JDM A;  4MLK A;  3ZYL A;  4UVC B;  2KT9 A;  2XAF B;  5FNV E;  5DJQ C;  2ZLY A;  1D1A A;  1Z8U A;  2WWV A;  4IRE A;  2WMN A;  3GA8 A;  1BR0 A;  3C51 A;  4DR1 T;  1UGO A;  5FKY A;  4PFO A;  2BG9 C;  2GK9 A;  5AQM B;  5HCJ A;  4C90 A;  4V1A v;  3OYZ A;  2X68 A;  2XQY A;  2VKJ A;  1DU2 A;  2QVA A;  4JI4 T;  2XAJ B;  2Y8D A;  3GN5 A;  2IIU A;  4ZS2 A;  2BS4 A;  3UU3 A;  5JR9 C;  4Q25 A;  4DV1 T;  1Z0P A;  3A8Y C;  3JC6 D;  5FY0 A;  4DO0 A;  3I0O A;  4AIS A;  2VKD A;  4CN4 A;  4K0K T;  2WDV A;  4E7Z A;  5IWA T;  1IJ6 A;  4MAL A;  4X20 E;  4H9S E;  4FJO A;  4IL4 A;  2W00 A;  3E0Z A;  4NUV A;  1KNR A;  5J1G A;  1J1J A;  1E1H B;  3LK4 2;  3QOF A;  4Z90 A;  4DBR A;  3AEC A;  4AKI A;  1W09 A;  5FXX A;  1HTJ F;  4KHP T;  3TLT A;  4GK5 E;  2CLY B;  2CXF A;  4TX5 A;  2WCA A;  4AQY T;  1FJG T;  3D0T A;  2A9U A;  2XQ9 A;  4ISS A;  1HF8 A;  4ZHQ E;  2PBI A;  4FI5 A;  2UUC T;  4G2A A;  2NWB A;  4HFV A;  4I50 E;  3ZYM A;  4JI8 T;  3HL6 A;  3K8P C;  2JIW A;  3EHZ A;  5FYM A;  2K9A A;  2ES0 A;  4EOZ B;  5LYJ E;  2RPA A;  2W0G A;  5AQK B;  5ABE A;  4YTP A;  5KXJ A;  2K48 A;  4PK6 A;  4NXN T;  2CXD A;  2N1G A;  2LKG A;  3CML A;  3TLV A;  3L09 A;  4DMV A;  2X0L B;  2WZH A;  2LSY A;  4OHF A;  2JQ9 A;  5CB4 E;  3IBP A;  3RRC A;  3ZJ1 A;  3E08 A;  4CI2 B;  4H9R C;  2E9X B;  3C64 A;  3LK2 B;  3AAA B;  3F57 A;  5EZY E;  4LFB T;  3P4R A;  5HXR A;  1U5P A;  2BKP A;  3CX7 B;  3CQG B;  3HKE E;  3RQU A;  4YT0 A;  2EHO D;  4NPP A;  5HXE A;  2VVN A;  4IDZ A;  4JI1 T;  4E7S A;  1VRB A;  2OV9 A;  3LBX B;  4H9Q C;  1WR6 A;  1ZOY A;  4YJ3 E;  4M1P A;  4O2A E;  5H6R B;  2V6Y A;  3GMI A;  5AQU B;  3VRB A;  4DV2 T;  4ZXL A;  2LE8 A;  3P8C D;  1UX4 A;  3UU6 A;  2DLR A;  2BG9 E;  5LHG B;  4Z8X A;  4AKL A;  4QXH B;  3MAC A;  3UFG A;  1OED B;  1Y64 B;  5F5W A;  2BVL A;  5FXW A;  3FZH B;  4YSY A;  3I9Y A;  3AXJ A;  5LG3 A;  3OPC A;  1FMW A;  2D0U A;  1U4Q A;  3K1S A;  4BJN A;  4QXB B;  5J0Z A;  3KIN B;  2JMH A;  2CHN A;  3KBU A;  3Q5E A;  4NIQ A;  4TWF A;  2Q9Q C;  5FMN A;  4LF8 T;  2Y48 B;  3RQW A;  2P9B A;  3FBZ A;  3CIR A;  2VL0 A;  3AE3 A;  3SRZ A;  3ZMV B;  4ANJ A;  3RGL A;  5AQJ B;  3UUB A;  4EIW A;  4ZI2 D;  1KNZ A;  1D1B A;  2XM1 A;  4ZI7 E;  4QWN B;  2L9Q A;  5JR9 A;  3WI3 A;  2Q9Q A;  3ZMT B;  5BR8 T;  4WW0 A;  4UXN B;  1W0A A;  1FMV A;  2KLQ A;  1EZ3 A;  2AXD S;  2JJ9 A;  3N9L A;  3PUS A;  1OXZ A;  2FJA A;  2WY2 A;  3KVB A;  3NZP A;  2YK0 A;  1WYB A;  1MIY A;  5LA6 E;  3M3Z B;  5HCM A;  3VU7 H;  4IE6 A;  1IBL T;  2BG9 B;  1ZKE A;  2BG9 A;  4BA9 A;  5CA0 E;  3PUA A;  2C5J A;  5LMN T;  5LGT B;  1BR4 A;  4ZOL E;  2MAW A;  4L5G A;  2WU5 A;  4H9N C;  3O1I A;  2LKH A;  3AEB A;  4PJL A;  4ILU A;  2V7M A;  3SFD A;  4QH4 A;  2H3R A;  5C2T A;  2E9X C;  4U7Y A;  3U78 A;  4QX8 B;  2XZE A;  4CZZ B;  4ADZ A;  2JQQ A;  4AI6 A;  3BK9 A;  2OA5 A;  4XBF B;  3ZEF B;  2LLY A;  3AVR A;  3RKG A;  5L3G B;  2X51 A;  3MA9 A;  2UXD T;  5AQG B;  4IHJ E;  1J5E T;  2IC9 A;  3EVY A;  3RLF F;  4EYY R;  2X9Y A;  4HFD A;  3FBL A;  5CJ5 A;  1T72 A;  4WBN E;  4EAH A;  4U72 A;  3UQ7 A;  1E7P A;  1HG2 A;  5FL0 A;  4B3S T;  4ZI2 C;  4YFS A;  3ONJ A;  2BKN A;  2WAU A;  1IBM T;  4B3M T;  4GYR A;  4IGU A;  3ZC1 A;  3ZSS A;  2HN2 A;  4LFC T;  3NZQ A;  3SS1 A;  4DV5 T;  5AQH B;  1ZHC A;  5HEG A;  3UUX B;  4LF9 T;  1MNE A;  2WDR A;  3JAD A;  1OWA A;  1SA0 E;  3N9N A;  4COF A;  5JQG E;  2DCF A;  3LJC A;  4PAG A;  2DI4 A;  4PNI A;  1HX8 A;  1MMN A;  2YKS A;  3N2O A;  4DND A;  4O8S A;  1I6Z A;  5FVL A;  4HWI B;  2CPT A;  3A5X A;  4DR5 T;  5JRE A;  2ACX A;  2B76 A;  2FBW A;  4O4J E;  3TLW A;  4H63 H;  3ZN1 B;  1D1C A;  1MMG A;  3PTR B;  4ILA A;  2NOX A;  4NUU A;  3O9X A;  1MMA A;  4PJM A;  3H3A A;  5E0O A;  5JVD E;  2LRL A;  3O1H A;  4KX6 A;  4IL9 A;  3SWH A;  3AEF A;  4P09 A;  5L4H A;  3DP7 A;  4LML A;  4U33 A;  4DUY T;  2UUA T;  5IHY A;  3ZJ2 A;  4JYA T;  1QUU A;  5IYZ E;  2WB5 A;  2FJD A;  4GIW A;  4IE7 A;  1KEY A;  2CM0 A;  2V7K A;  5FVK A;  2A72 A;  2ODV A;  4HFC A;  2XQ4 A;  4BAY B;  3AE2 A;  1HNZ T;  2CHO A;  2YIN A;  2YOE A;  4GYS A;  4UEM A;  3ZLI A;  2RA1 A;  4DV7 T;  5FXV A;  4GKK T;  2V7I A;  2HN1 A;  2XQ7 A;  3G06 A;  4O4L E;  3VHL A;  3ZT7 A;  1IAP A;  4UF0 B;  4LMK A;  2E5L T;  1D0Y A;  3JC6 C;  3WAJ A;  4DVD A;  1W0B A;  2IHR 1;  4I43 B;  3UQ4 A;  4OYJ A;  2UXN B;  4QKN A;  3L3P A;  3MJX A;  5LCY A;  2ZMA A;  3W15 B;  4DR2 T;  3PV0 F;  2LEH A;  2QRX A;  3AAE B;  1O3X A;  2VKH A;  3ETV A;  3OJA A;  2X9W A;  3Q2M A;  4HWD A;  5FY7 A;  2LM2 A;  2Q9Q B;  2YDS A;  2DL1 A;  3CK6 A;  2RP4 A;  5JR9 B;  2V26 A;  3HKC E;  3PUY F;  3P4Q A;  5LOV E;  2LRK A;  5AQR B;  2H89 A;  2C0S A;  2B1E A;  4AIU A;  4ASK A;  1S94 A;  2WMO A;  4YTM A;  5LJN A;  3IEE A;  2W63 A;  5A1L A;  1T98 A;  2NW8 A;  4X1I E;  3BQI A;  2IUB A;  5L4E A;  3V5U A;  4HE8 A;  1XNR T;  5L3B B;  3AXJ B;  4O4H E;  3K3N A;  4WNK A;  3MKD A;  3ZT5 A;  4HEA A;  2FUP A;  2NP9 A;  2D5U A;  2PFV A;  4IE5 A;  3AEA A;  4TZ4 C;  2VWA A;  2WM9 A;  3H3M A;  4U74 A;  3ZN0 B;  3KFW X;  3PUZ F;  4F8H A;  1KF6 A;  3T8O A;  1YW0 A;  1MIV A;  3C50 A;  3SFE A;  1G8X A;  3ZST A;  2X9H A;  5L3E B;  1YXR A;  3Q9D A;  3CKD A;  2J62 A;  5JDN A;  1WFD A;  3RIF A;  3N9Q A;  5HXC A;  2V7L A;  2K24 A;  4CI1 B;  2A2F X;  5HEO A;  4LF5 T;  4HFI A;  4JV5 T;  4DMW A;  3N2K E;  3E22 E;  2V5D A;  2VKO A;  2BS2 A;  2I0M A;  3AVS A;  3N5L A;  1XWM A;  2C5I T;  3IA3 A;  2YDR A;  4X62 T;  4WYV A;  5LB7 B;  2NW7 A;  1N33 T;  2MPK A;  4C91 A;  2WS3 A;  2WDQ A;  4DR4 T;  1UCU A;  3SOL A;  3O4X E;  2CEA A;  4LMJ A;  4GK0 E;  1SE7 A;  2QGS A;  2E8I A;  5HWX A;  2WU2 A;  1UK5 A;  1H7C A;  3RF1 A;  2UXC T;  1IJ5 A;  4YLH A;  3RC3 A;  4WZX A;  5DQV A;  2LT3 A;  5IUX A;  2W2U A;  3AB3 B;  5BMV E;  2X9X A;  2V6Y B;  3RIA A;  4HFH A;  4B3R T;  5J2T E;  3I1A A;  3LK3 B;  4JI3 T;  3AE6 A;  3FZL B;  2L8K A;  3LG7 A;  3NKZ A;  3PE0 A;  2CBJ A;  2I59 A;  4QXC B;  2LM9 A;  5LXT E;  4KP3 C;  5AQS B;  3AED A;  2XAG B;  2XAS B;  3TLS A;  2HPL A;  2YDQ A;  5AQO B;  4CQI A;  5J2U E;  5JRC A;  2QA7 A;  2XY8 B;  2YEV C;  5AQT B;  4IE4 A;  3VR9 A;  3Q5D A;  4KHZ F;  4L9I A;  4YJ2 E;  2JMK A;  2EHO B;  3HR0 A;  4KI0 F;  2V7J A;  2VK9 A;  3N2G E;  2MTQ A;  4EEB A;  3RYH E;  4MHC A;  1J5W A;  4IT4 A;  2CLY C;  3OKQ A;  2Z6E A;  3K3Q C;  4JUY A;  4X66 T;  3EAM A;  2V6X A;  3ETU A;  2VAS A;  4QH1 A;  4X1Y E;  3RKO A;  2XSA A;  3TKL B;  4HKA A;  3UUM A;  1QSD A;  1W9R A;  2DWG A;  4IDP A;  4YY3 T;  2KSR A;  4A56 A;  5KMG P;  2UUB T;  2MOZ A;  3BQK A;  2X0Y A;  5ETW A;  2Q9Q D;  2IML A;  4U7I A;  3RRW A;  1IBK T;  3S4U A;  2BVM A;  3T1Y T;  4LF6 T;  2CE7 A;  5AQI B;  3UTK A;  2LJL A;  4BJM A;  2XAH B;  1YKH B;  3QC9 A;  3KV6 A;  2CWO A;  3UT5 E;  3CX6 B;  5DAB A;  2BBH A;  3BQL A;  4JLE A;  3HKB E;  4DUZ T;  3C4Z A;  4DR3 T;  1GQE A;  4IDN A;  4ZZC A;  2LOS A;  3GN5 B;  4MBQ A;  2DWK A;  4PJN A;  3KDS E;  3LSV A;  4PK5 A;  4YHJ A;  5HYA A;  3VRA A;  2WQY A;  2KIN B;  3QK6 A;  5HAX A;  4F6R C;  3QB5 K;  1XZY A;  3LFM A;  3RYC E;  1SHZ C;  3EDU A;  2XHE B;  3FZK B;  3PDY A;  4A98 A;  2CCQ A;  1KK7 A;  2YU1 A;  1HCI A;  3QNU A;  4PK4 A;  1NEK A;  4QX7 B;  2IW5 B;  3AA7 B;  1JNZ A;  3KBT A;  1N34 T;  4ZI3 D;  4YSZ A;  2LHN A;  2VB6 A;  2E2A A;  4X1K E;  5LGU B;  2VQE T;  4CXY A;  4YTN A;  4P0A A;  3EDV A;  3FZM B;  3MZK B;  1BR2 A;  4XAX B;  4HTE A;  4IDQ A;  3UFE A;  1CHU A;  3L8R A;  3ZMZ B;  1WLX A;  4EXT A;  2J4G A;  2KND A;  2PTF A;  5CFB A;  1NAF A;  2XAQ B;  3T1H T;  2IDO B;  3EAB A;  3NWI A;  4UVB B;  3NVO A;  3PUQ A;  2IAK A;  4TN7 B;  5AQQ B;  4U2Z A;  3C4W A;  3OBV E;  5TAO A;  3CVR A;  5JTG A;  4HFE A;  2N2N A;  3JAE A;  2L3L A;  4KBM B;  2PG8 A;  2WP9 A;  3AE1 A;  3UUN A;  5JH7 E;  2EHO A;  2PJQ A;  3KV5 A;  4UEL A;  3AAI A;  2XJ7 A;  5L2L A;  1UUR A;  3FZF B;  5LHH B;  4UF0 A;  5JRC B;  4X5T A;  4AQF C;  4CN1 A;  4JEH B;  5LMU T;  2W66 A;  4JI5 T;  2F4V T;  2J1D G;  3P7I A;  5L3C B;  1QLB A; 
#chains in the Genus database with same CATH homology
 2ZM2 A;  1LVK A;  3KV9 A;  1B7T A;  1HG5 A;  2X66 A;  3NRY A;  3FXD B;  3C4X A;  4N78 D;  4O4I E;  4PW8 A;  1FEW A;  5FY1 A;  5JDL A;  3H37 A;  3V5S A;  3ESL A;  4H9P C;  4AKG A;  1LRZ A;  2K5B B;  2CMR A;  2NTY A;  3N9P A;  5EK4 A;  4AKH A;  2BDE A;  4GOU A;  2DNX A;  1D0Z A;  1FIO A;  3PUR A;  3HI2 A;  3MXZ A;  3J7Y q;  4HN9 A;  2KMF A;  3LBX A;  3PU8 A;  4OYK A;  3ZYK A;  4OK0 A;  1UX5 A;  2WWU A;  4UV8 B;  2H7O A;  4TV8 E;  3ONX A;  2LSJ A;  1YKE B;  3CWZ B;  3AA0 B;  3KVA A;  4IIJ E;  4JEU B;  1HS7 A;  4CI3 B;  3RX6 A;  3ANW A;  3J9X 1;  5HXH A;  1D0X A;  4H9O C;  3VKH A;  3FB2 A;  1X79 A;  4UVA B;  3AA1 B;  3DTO A;  5H6Q B;  2W62 A;  2N9D A;  5LG4 A;  5KDM C;  2ODU A;  2KXP B;  2ZM0 A;  3HA4 A;  3ZCI A;  2MYS A;  3RH3 A;  2NTX A;  1IZN B;  3Q5X A;  3NBX X;  3CQC B;  3ZPO A;  5JDF A;  2UXX B;  3U3I A;  1US7 B;  2D0T A;  2BZB A;  4TUY E;  4I55 E;  1MIW A;  3I0Q A;  4IE0 A;  4AQF A;  4QHO A;  1HFA A;  2M67 A;  3RYI E;  2H7V C;  5DQW A;  2MBG A;  2XTL A;  3N9O A;  2VL8 A;  5LHI B;  2LSI A;  3B13 A;  2CWY A;  4ZI3 C;  4ERR A;  1MMD A;  1CUN A;  3IF8 B;  4AKR B;  2EHO C;  5CA1 E;  1ZV4 X;  5C8Y E;  5LP6 E;  5L3F B;  1LKX A;  1NWM X;  3K3O A;  3Q5W A;  2LHR A;  1AJ3 A;  4CXX A;  5HWY A;  2YU2 A;  3IHR A;  4ZS3 A;  4G63 A;  2LOP A;  4L0R A;  2LSK A;  3F2E A;  5ADX L;  1V9D A;  3O1J A;  2V1D B;  4MFR A;  3R6N A;  4KMC A;  2JRK A;  2HPJ A;  5FP3 A;  4TV9 E;  2SPC A;  5F3J A;  3HKD E;  3KV4 A;  1G73 A;  4O2B E;  3OYX A;  4H63 V;  4K0U A;  4AQG A;  1WYC A;  3ANW B;  3QUJ A;  4I4T E;  4EZH A;  5LNK A;  2WSS V;  4DBQ A;  2KWH A;  2E9X A;  2G0U A;  4EB6 E;  2CXL A;  2E9X D;  4OFZ A;  3M65 A;  5JDQ A;  1MND A;  1VOM A;  3PUG A;  4EYU A;  5HXS A;  5LGN B;  3R84 B;  2X67 A;  5FXZ A;  2HH7 A;  3B57 A;  2KZ7 B;  3N9M A;  5LBM A;  5LBQ B;  3UUL A;  3VKG A;  3FXE B;  2WBL A;  1ZEE A;  3AA6 B;  4J2C A;  4UV9 B;  2D2S A;  4PFP A;  5AFU L;  3RC8 A;  4HGA A;  4AXP A;  2ZM8 A;  3GWH A;  2Y6X A;  2IC6 A;  5JDG A;  3ZC0 A;  2A3D A;  3ZCJ A;  3PU3 A;  2XUE A;  5F8P A;  3CPZ A;  4KUM B;  5JDH A;  2DHR A;  2KWI B;  4UIG A;  5EK2 A;  3ZMU B;  4XZC A;  3WAK A;  1BR1 A;  3RPU A;  4CXW A;  4IST A;  4B6X A;  2JPF A;  2CA5 A;  2NW9 A;  5EK3 A;  2LSG A;  3C98 B;  3RYF E;  4EZ4 A;  4PJJ A;  3NRX A;  5L3D B;  3F31 A;  1YD8 G;  1S35 A;  3DJB A;  3ZMS B;  3I9W A;  3EUH A;  3MK7 C;  4WBO A;  3CQX C;  2W61 A;  3CX8 B;  1WRD A;  1LVF A;  4P0B A;  2C5K T;  5GON E;  3FHN A;  5JDM A;  4MLK A;  3ZYL A;  4UVC B;  2KT9 A;  2XAF B;  5FNV E;  5DJQ C;  2ZLY A;  1D1A A;  2WMN A;  3GA8 A;  1BR0 A;  3C51 A;  4PFO A;  2GK9 A;  4C90 A;  4V1A v;  3OYZ A;  2X68 A;  2XQY A;  2VKJ A;  2XAJ B;  2Y8D A;  3GN5 A;  4ZS2 A;  5JR9 C;  1Z0P A;  3JC6 D;  5FY0 A;  4DO0 A;  3I0O A;  2VKD A;  4E7Z A;  1IJ6 A;  4MAL A;  4X20 E;  4H9S E;  4FJO A;  4NUV A;  2W00 A;  3E0Z A;  5J1G A;  5KX5 E;  1E1H B;  3LK4 2;  4AKI A;  5FXX A;  1HTJ F;  4GK5 E;  2CLY B;  2CXF A;  4TX5 A;  3D0T A;  4ISS A;  1HF8 A;  4ZHQ E;  2PBI A;  4FI5 A;  4G2A A;  2NWB A;  4HFV A;  4I50 E;  3ZYM A;  3HL6 A;  3K8P C;  5FYM A;  2K9A A;  2ES0 A;  4EOZ B;  5LYJ E;  2W0G A;  2K48 A;  4PK6 A;  2CXD A;  2N1G A;  3CML A;  4DMV A;  3L09 A;  2X0L B;  2LSY A;  4OHF A;  5CB4 E;  3RRC A;  3IBP A;  3ZJ1 A;  3E08 A;  4CI2 B;  4H9R C;  2E9X B;  3C64 A;  3LK2 B;  3AAA B;  3F57 A;  5EZY E;  5HXR A;  1U5P A;  3HKE E;  3CX7 B;  3CQG B;  2EHO D;  5HXE A;  4IDZ A;  4E7S A;  1VRB A;  3LBX B;  4H9Q C;  1WR6 A;  4YJ3 E;  4M1P A;  4O2A E;  5H6R B;  3GMI A;  2LE8 A;  3P8C D;  1UX4 A;  5LHG B;  2DLR A;  4Z8X A;  4AKL A;  4QXH B;  3MAC A;  1Y64 B;  2BVL A;  5FXW A;  3I9Y A;  1FMW A;  2D0U A;  1U4Q A;  4BJN A;  4QXB B;  3KIN B;  2JMH A;  3KBU A;  5FMN A;  3O9X A;  4DBR A;  2Q9Q C;  5M4Y A;  2Y48 B;  3SRZ A;  3FBZ A;  2P9B A;  3ZMV B;  4ANJ A;  4ZI2 D;  4EIW A;  1KNZ A;  1D1B A;  4ZI7 E;  4QWN B;  2L9Q A;  5JR9 A;  3WI3 A;  2Q9Q A;  3ZMT B;  4WW0 A;  4UXN B;  1FMV A;  2KLQ A;  1EZ3 A;  3N9L A;  2JJ9 A;  3PUS A;  1OXZ A;  3NZP A;  3KVB A;  2YK0 A;  1WYB A;  1MIY A;  5LA6 E;  3VU7 H;  4IE6 A;  1ZKE A;  4BA9 A;  5CA0 E;  3PUA A;  2C5J A;  5LGT B;  1BR4 A;  4ZOL E;  4L5G A;  4H9N C;  3O1I A;  4PJL A;  4ILU A;  2V7M A;  2H3R A;  2E9X C;  3U78 A;  4AI6 A;  4QX8 B;  4CZZ B;  4ADZ A;  2JQQ A;  3BK9 A;  2OA5 A;  4XBF B;  3ZEF B;  3AVR A;  5L3G B;  2X51 A;  3MA9 A;  4IHJ E;  2IC9 A;  3EVY A;  4EYY R;  2X9Y A;  3FBL A;  4WBN E;  4EAH A;  4U72 A;  1HG2 A;  4ZI2 C;  4YFS A;  2WAU A;  4GYR A;  4IGU A;  3ZC1 A;  3NZQ A;  3SS1 A;  3UUX B;  1ZHC A;  1MNE A;  5JQG E;  1OWA A;  1SA0 E;  3N9N A;  2DCF A;  3LJC A;  4PAG A;  2DI4 A;  4PNI A;  1HX8 A;  1MMN A;  3N2O A;  4DND A;  4O8S A;  3A5X A;  5JRE A;  2ACX A;  4O4J E;  3ZN1 B;  4H63 H;  1D1C A;  1MMG A;  3PTR B;  2NOX A;  4NUU A;  1MMA A;  4PJM A;  3H3A A;  5E0O A;  5JVD E;  3O1H A;  3SWH A;  4P09 A;  3DP7 A;  5IHY A;  3ZJ2 A;  1QUU A;  5IYZ E;  4GIW A;  4IE7 A;  2CM0 A;  2V7K A;  2A72 A;  2ODV A;  4BAY B;  2YIN A;  4GYS A;  4UEM A;  3ZLI A;  2RA1 A;  5FXV A;  2V7I A;  3VHL A;  4O4L E;  1IAP A;  4UF0 B;  1D0Y A;  3JC6 C;  3WAJ A;  4DVD A;  4I43 B;  4OYJ A;  2UXN B;  4QKN A;  3L3P A;  3MJX A;  5LCY A;  2ZMA A;  3W15 B;  2LEH A;  3AAE B;  5FY7 A;  1O3X A;  2VKH A;  3ETV A;  3OJA A;  2X9W A;  3Q2M A;  3UUM A;  5LJM A;  2Q9Q B;  2RP4 A;  5JR9 B;  2V26 A;  3HKC E;  5LOV E;  2C0S A;  2B1E A;  4ASK A;  1S94 A;  2WMO A;  5LJN A;  3IEE A;  2W63 A;  5A1L A;  1T98 A;  2NW8 A;  4X1I E;  3BQI A;  3V5U A;  4HE8 A;  5L3B B;  4O4H E;  3K3N A;  4WNK A;  3MKD A;  4HEA A;  2NP9 A;  2D5U A;  2PFV A;  4IE5 A;  4TZ4 C;  2VWA A;  2WM9 A;  4U74 A;  3ZN0 B;  3KFW X;  3T8O A;  5L3E B;  1YW0 A;  3C50 A;  1MIV A;  1G8X A;  2X9H A;  3Q9D A;  3CKD A;  5JDN A;  3N9Q A;  5HXC A;  2V7L A;  2K24 A;  4CI1 B;  2A2F X;  4DMW A;  3N2K E;  3E22 E;  2VKO A;  3AVS A;  3N5L A;  2C5I T;  2NW7 A;  4C91 A;  1UCU A;  3SOL A;  3O4X E;  2CEA A;  4GK0 E;  2QGS A;  2E8I A;  5HWX A;  1H7C A;  1IJ5 A;  4YLH A;  3RC3 A;  5DQV A;  2LT3 A;  3AB3 B;  5BMV E;  2X9X A;  5J2T E;  3I1A A;  3LK3 B;  3LG7 A;  3PE0 A;  2L8K A;  4QXC B;  2I59 A;  2LM9 A;  5LXT E;  4KP3 C;  2XAG B;  2XAS B;  2HPL A;  4CQI A;  5J2U E;  5JRC A;  2QA7 A;  2YEV C;  4IE4 A;  4L9I A;  4YJ2 E;  2JMK A;  2EHO B;  3HR0 A;  2V7J A;  2VK9 A;  3N2G E;  2MTQ A;  3RYH E;  4MHC A;  2CLY C;  3OKQ A;  2Z6E A;  3K3Q C;  4JUY A;  3ETU A;  2VAS A;  3RKO A;  4X1Y E;  3TKL B;  4HKA A;  1QSD A;  2DWG A;  4A56 A;  5KMG P;  2MOZ A;  3BQK A;  5ETW A;  2Q9Q D;  3RRW A;  3S4U A;  2BVM A;  2CE7 A;  3UTK A;  2LJL A;  4BJM A;  2XAH B;  1YKH B;  3QC9 A;  3KV6 A;  2CWO A;  3UT5 E;  3CX6 B;  5DAB A;  3BQL A;  4JLE A;  3HKB E;  3C4Z A;  2LOS A;  3GN5 B;  4MBQ A;  2DWK A;  4PJN A;  3KDS E;  4PK5 A;  4YHJ A;  5HYA A;  3QK6 A;  2KIN B;  5HAX A;  4F6R C;  3LFM A;  3RYC E;  1SHZ C;  3EDU A;  2XHE B;  3PDY A;  2CCQ A;  1KK7 A;  2YU1 A;  1HCI A;  4PK4 A;  2IW5 B;  4QX7 B;  3AA7 B;  3KBT A;  4ZI3 D;  2LHN A;  2VB6 A;  4X1K E;  5LGU B;  4CXY A;  4P0A A;  3EDV A;  3MZK B;  1BR2 A;  4XAX B;  4HTE A;  3UFE A;  3ZMZ B;  1WLX A;  4EXT A;  2KND A;  1NAF A;  2XAQ B;  4UVB B;  3PUQ A;  2IAK A;  4TN7 B;  5TAO A;  3C4W A;  3OBV E;  3CVR A;  2N2N A;  4KBM B;  2L3L A;  2PG8 A;  5JH7 E;  3UUN A;  2EHO A;  2PJQ A;  3KV5 A;  4UEL A;  3AAI A;  5L2L A;  5LHH B;  4UF0 A;  5JRC B;  4AQF C;  4JEH B;  2J1D G;  3P7I A;  5L3C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...