5LKAA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
301
structure length
301
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Engineering a de novo transport tunnel.
doi rcsb
source organism Sphingobium japonicum
molecule tags Hydrolase
total genus 115
structure length 301
sequence length 301
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lkaA00
1UOQA 4YX9A 1ACLA 1XZDA 2J4FA 2XLBA 2C4HA 5T4BA 1DQZA 3FCXA 4DM7A 2BUCA 2DHDA 3WIBA 3FLAA 3FWHA 1USWA 5ALJA 1DU4A 4EY5A 5K3EA 2BAGA 3KWJA 3ICWA 1THTA 1P0IA 3STXA 1BE0A 2Q0XA 2G5PA 2HA0A 4BC0A 3ESBA 1YS1X 5ISMA 3L1IA 3O4HA 4KAAA 4P93A 4EUSA 2H7XA 4NS4A 4OB8A 3QPDA 2XMGA 1UOOA 4RE5A 3HC7A 4I4CA 1ACJA 5ALIA 2G5TA 3DD5A 3MUOA 3FYUA 1TCAA 2DQYA 2ACEA 1XQVA 3TJMA 2JGEA 4KE6A 3WYNA 4CI9A 5D6OA 1FFDA 1VA5A 1JT2A 2QZPA 2VJDA 4BBZA 4Y2PA 2XQJA 2HRQA 1EVEA 1K8QA 4G8BA 5LZ7A 4G4IA 1H2XA 3MVEA 4X6XA 4J0IA 1J1IA 5KWJA 2XUGA 1MTZA 1K5PA 2WU4A 1O6FA 3HSSA 2O2IA 4XX1A 2PBLA 2OAGA 5K3BA 4AO6A 2HM7A 2JBWA 2K2QB 5DYYA 4BTVA 3EQ8A 1VE6A 2JEYA 4K5QA 2JGIA 4PW0A 4MQMA 1YAHA 4UHEA 3C8HA 3C6ZA 4N5IX 4KRYA 2EEPA 5JD4A 2JIDA 2AJLI 4BZZA 5C81A 2FX5A 3KDAA 4EA6A 1WOMA 5AK4A 3FSGD 3ESAA 2FUKA 1AURA 1EDBA 4TPKA 4QNNA 1CUFA 4UBNA 3KWFA 4PV7A 3IVMA 5ALZA 4HVTA 3WA6A 5HQ3B 4A16A 5CH8A 1TKRA 3G9TA 1QTIA 4MYDA 4K6HA 4OCZA 4NVRA 3V48A 1MAAA 3OTQA 4MEAA 2QXTA 2H7YA 1MN6A 4EZIA 3BF7A 3M82A 2VAVA 4KAJA 1AQLA 4FHZA 3E3AA 4TVKA 5AJHA 4ARBA 4FLFA 4CCYA 4UBJA 4BP9A 4B6GA 2PSHA 4TGLA 5EFZA 1QFSA 1ZIYA 3DDUA 2WG1A 4MEBA 4Q34A 2OPHA 4OD0A 3DJYA 3UMJA 1ETHA 4B9EA 4FNGA 1X2BA 3STWA 4BVJA 2B9VA 5JALA 1CUWA 2Z8ZA 4X91A 2OQVA 3W05A 1KEZA 4Q3LA 5HKAA 3WK4A 4JEIA 4OU4A 1LPBB 5AK6A 4UBIA 1TRHA 3HRHA 4P92A 1QTRA 2D5LA 2PSFA 4Q05A 5CT8A 3FAKA 1K63A 3G0IA 1CUZA 4WDRA 1GT6A 1WPXA 1GQRA 4Y2SA 2H9YA 3H2HA 4MXDA 3CCBA 4RGYA 1J2EA 2ONCA 2H7CA 5IVKA 2OCKA 5AK5A 4Y2UA 4LIPD 3ZV7A 4YASA 5ALHA 1LZLA 2IITA 3CXUA 2H1IA 3M83A 1HDEA 3EF3A 1YS2X 3QZUA 1YASA 1Z68A 5AM5A 4X94A 5D7BA 2BUAA 1GKLA 3NWOA 3KXPA 4GEGA 4N8DA 3BF8A 1XZIA 4CFSA 2RHTA 4UFPA 5AIBA 1FFAA 2I3DA 1M33A 3EQ9A 5C8XA 2OG1A 1QJ4A 4I3FA 1R50A 5AI0A 2C5GA 3DEAA 4BVLA 3AZOA 1ZGBA 3DL4A 4Q1VA 1Q0RA 1QZ3A 1BCRA 3DCNA 5D3ZA 3K6KA 3C8DA 4KYVA 2AJCA 1BN7A 3L1JA 4PQEA 1DTEA 3PDCA 1IUOA 3STTA 4J0JA 4X6UA 1Y7IA 1F0PA 2Z8XA 3WK6A 5LP1A 4RE6A 5HF9A 2LIPA 3WL6A 3DQZA 3I2GA 5AKJA 2WHPA 3C45A 3F9CA 3QMMA 1UT6A 2Z5GA 4Y2QA 1G5FA 5A7GA 5SYNA 1E89A 3BDIA 3AIKA 1XZHA 4PSCA 5CXUA 1YA8A 1WCYA 3ANSA 4KE8A 1RWQA 1HL7A 2JGKA 2PL5A 1IZ8A 2OQIA 3AZQA 4FDMA 2Y6VA 3VXKA 2BUBA 1AZWA 1CUYA 2BFNA 1ORVA 2CMFA 2QXUA 1CUDA 4UHCA 3K2IA 3B3QA 2XUQA 3ILSA 3IUMA 1HKHA 1UZAA 4ZGBA 4IHAA 3QPCA 4Q82A 2FJPA 4ZRDA 4KJXA 1E8MA 3G9ZA 4H7FA 1HLGA 1DT3A 3H18A 5SYMA 1QGED 4H7KA 3OURA 3ZLVA 2CB9A 3ZI7A 4AXBA 5JAHA 3IB3A 4G5XA 5CT4A 2BGRA 1IMJA 1UK8A 3F98A 5ALSA 4UHDA 4DLNA 3WKEA 1VXRA 1O6GA 4HXEB 4AQDA 3AIOA 3BXPA 4G4JA 5AM0A 5ALOA 1R3DA 5A2GA 3MGAA 2ZSHA 4D9JA 3V9AA 2QJRA 2YH2A 3IIIA 4XVCA 2BJHA 1ZGCA 2QUAA 3SWWA 2XMRA 5K3FB 2WUFA 1L7RA 1BEZA 5CH3A 1AC5A 1RP1A 4UHFA 2CKMA 4BZWA 2GYUA 2HADA 2VAXA 3A6ZA 1YSCA 3D2BA 5FPQA 2XUIA 3CN9A 4PSUA 2PSJA 4QZVA 5EHXA 4Y9SA 1R9MA 4H7JA 3D59A 4Y7DA 3WZMA 1XZKA 2VATA 2XMQA 2QVBA 4FOLA 2HA2A 5T4HA 4CG2A 5LZ2A 3IUNA 5EGNA 3VDXA 4QEKA 1D07A 4H18A 3S8YA 3G0DA 3WIOA 1QIDA 2OGZA 2VT6A 1XFDA 2HRRA 1XZLA 3ED1A 4QWWA 2X76A 3O9VA 1LGYA 5EHNA 2JF0A 1N1MA 1CUBA 1GQSA 3FLEA 4N8SA 1IZ7A 2ZSIA 3I6MA 3LS2A 4OYLA 2PUHA 2E3JA 4RPCA 2WG2A 5AP9A 2X8BA 1CUJA 5CW2A 4C6HA 3PFCA 5DTJA 3QBJA 5A7HA 4GI1A 1W6RA 4QLAA 2V97A 4DIUA 4E15A 4QDXA 1ZIXA 1CR6A 1LPOA 2WUDA 2QRUA 3WK8A 4KE9A 5A62A 2B4KA 1SCQA 2V96A 4BAZA 2XUDA 4QDZA 5CT6A 5K3CA 3WL7A 4AO8A 2XQFA 3M3DA 4DYHA 4G1FA 3I2KA 5ALNA 4DSZA 1QIMA 5C7YA 2C58A 5FOQA 5HZGA 4LXHA 2OCGA 2XMBA 5LIPA 1CUGA 2WFLB 3BJRA 2PU5A 4JUIA 3P2MA 4HXGA 1L7AA 1TAHA 1XRRA 4FTWA 5AKXA 1TQHA 4PO3X 1LBTA 3C6XA 1ZICA 3G7NA 1CUIA 4X6YA 3W04A 3H2IA 4KAFA 1XZAA 1EB9A 2HA6A 3I1YA 5CURA 5ALLA 2I78A 4EY8A 2XUAA 4IH4A 1EHYA 3H04A 4W9RA 4ZWNA 2DQZA 5FRDA 1CQWA 5KBYA 1ZJ5A 1MPXA 1MX9A 1E8DA 4ZV9A 3B5EA 3G0GA 4WY8A 5HK8A 5ALFA 4HZGA 2VA9A 4Y2TA 3F97A 4LYDA 2ZYSA 4UBOA 3PUIA 1UKCA 3EIOA 1AX9A 1CV2A 1THGA 1R4ZA 5IVDA 1E66A 5JD6A 2PM8A 3WK5A 3BIWA 4P08A 4LHEA 3G0CA 3G9XA 1CUXA 3UUFA 1TCCA 4AX4A 5LZ9A 3A2MA 2AJDA 3I1IA 3QMWA 3ICVA 1ZI9A 1XLWA 3AIMA 5HKBA 2YYSA 5AKIA 4DNQA 3NUZA 1W76A 2CEKA 5HF8A 2C5FA 1ISPA 4ZI5A 1UKAA 4WY5A 1HQDA 1Y37A 1YA4A 3HI4A 4EB0A 2XUFA 5ALRA 3E1GA 5JADA 3DKKA 4BCCA 4X93A 2XI4A 4H7IA 3RK4A 2XUPA 1UXOA 3O4JA 3FNBA 1F0NA 1TK3A 3C6BA 2WHRA 5ALTA 1XZJA 2VEOA 2WG0A 1K4YA 4GWLA 4LKOA 1LPAB 4HS9A 1U4NA 3BL8A 1WM1A 1WB5A 1FFEA 3KOOA 2PKYX 3D2AA 1QE3A 3RM3A 2WIKA 3WWPA 4QA9A 1AGYA 1BS9A 1DT5A 3HYSA 1BN6A 4BRZA 1KU6A 1MAHA 4ETWA 1C4XA 2Y2UA 3G8YA 2EDAA 1QFMA 5ALDA 1WHSA 1EK1A 3QVMA 2WHQA 5AOBA 1XZEA 1EINA 4H35A 2ACKA 2XE4A 4A23A 3WWCA 2WFZA 3SK0A 1XQYA 4X85A 1UK7A 5AI8A 3VJMA 3WMRA 4N5HX 1S8OA 3OG9A 2HU7A 2QMQA 1Q0ZA 3LCRA 3DS8A 5F4ZA 5BOVA 3HABA 2GBCA 3FYUC 4FMPA 4QDOA 4J0CA 4X71A 4KEAA 4AN0A 1K6EA 3GROA 1MO2A 3LIPA 4MYSA 3WL8A 5E4TA 4G9GA 4QE3A 1WHTA 2G4LA 2NW6A 2ECFA 3O4GA 3WK9A 2Y2VA 5AKEA 3IUQA 4KE7A 5D3KA 3R3WA 4B80A 3VJKA 1ZD5A 3I28A 3R3UA 4DGQA 5JASA 4KRXA 2PX6A 1G66A 1AUOA 4FBLA 3I6YA 2WILA 3HACA 5ALVA 2ZVDA 5A6VA 1PJAA 5ALWA 4ARAA 1TCBA 2GZSA 5JANA 2ZJ6A 4K6KA 4DNOA 5AKGA 2PVSA 4W63A 5HQ3A 4DTCA 5IVIA 3D4LA 3FSGA 3QPAA 1QIHA 3AFIA 4C4YA 3R40A 2C7BA 1B41A 4X3CA 5AKYA 2VJCA 1FFBA 4MJ3A 1QIFA 2QS9A 1SC9A 1ZI8A 2CJPA 1VE7A 4KACA 1N5MA 1H2ZA 1HPLA 2JGLA 1IUPA 5YASA 3WKDA 3H1BA 5IH7A 3YASA 2VT7A 5CH5A 1DWPA 3ESCA 3FOBA 3WLAA 4B85A 2ZJFA 4DMFA 3RARA 4J3JA 4HAIA 3W06A 2WJ4A 3A2NA 1U8EA 4UBMA 4WFJA 5LKAA 4JYMA 4NZZA 3HEAA 5LZ4A 3V1LA 1ODSA 1MNAA 1IUNA 2HFJA 2OGTA 1FFCA 2HU8A 3W9UA 3KSRA 3FYTA 4L9AA 5AK3A 1CLEA 4L3WA 2WSLA 1LNSA 1H22A 4X90A 4M0FA 2B61A 3QITA 4ZXFA 4QWMA 3M81A 2HA4A 5AOAA 2JGJA 5JARA 3ESDA 1CUAA 3AINA 5T4EA 3ZLTA 4UFNA 1A8UA 5AI4A 5HF5A 3AILA 1LBSA 4GBGA 5DJ5A 4AZ0A 2OAEA 5DYWA 5FP0A 3D0KA 4BATA 3D5EA 3BE8A 1J07A 4J0KA 1XRNA 2PU7A 2GYWA 2CBGA 1UWCA 2Z3WA 1DQYA 7YASA 4AMYA 2I03A 5I7UA 3STVA 2DSNA 4C89A 1GKKA 1NX9A 2BKLA 4UUQA 3O9MA 2VSQA 3HJUA 2G63A 5AI6A 2Z3ZA 5AH0A 3IBTA 1Q83A 2XUOA 4BB0A 3I2FA 3NOXA 3ZWQA 1UFOA 2C0PA 2XUJA 1E5TA 6YASA 1XRMA 1ORWA 5JATA 4L0CA 4XIIA 3S2ZA 4J03A 5FKJA 2XT0A 1KU0A 1X2EA 5AM3A 5T4FA 4EY6A 4HTAA 5BWCA 2R8BA 3E0XA 4B84A 4OUKX 2ZYIA 3FVTA 3LLCA 1UOPA 2XMDA 4BCDA 3G9UA 3JYHA 4X00A 1GGVA 3IUJA 4E46A 5K3DA 1YCDA 2ORYA 4GLBA 4GHWA 5DLPA 2WTNA 1EB8A 5AO9A 1DX4A 2PUJA 2JGFA 1W4LA 4FLEA 4BRSA 3NGMA 2EDCA 1QIKA 2PPLA 2DHEA 4J0HA 1OCEA 2ZYHA 3GELA 5AOCA 1P0QA 3FLBA 1GPLA 4W1PA 1ZOIA 4CIBA 1EXWA 1H23A 3G02A 1QIIA 3TGLA 2OCIA 4GW3A 2XLCA 1G42A 4G8CA 2WQZA 3DKRA 4AMZA 4L72A 3F96A 3R0VA 4OU5A 5ALGA 1RYYA 3IA2A 2DFPA 1LPPA 5I9IA 1BRTA 2VJAA 5FPPA 3VKFA 1CUSA 3QM1A 3PE6A 2W22A 1W75A 2V98A 4JNCA 4BDSA 4QDUA 5FDFA 3E4DA 4X7BA 1LLFA 3WZLA 2O7RA 3N0TA 1ZJ4A 2O2HA 1EA5A 2CZQA 1EDEA 3UUEA 4AZ3A 2WIGA 1MNQA 1QO9A 5FV4A 2WIDA 3W2TA 1JU3A 1BCSA 5CT5A 3F67A 3CCCA 3VVLA 3GBSA 1J06A 1R1DA 2HA5A 2HHAA 3WWOA 1XRPA 3IDAA 2J3QA 4UHBA 3L1HA 3FVRA 4FFVA 5FXMA 1E3QA 4DMHA 3FYUB 1CVLA 4V2IA 4MWTA 1QONA 3ZLUA 2ROQA 1GPKA 1XZBA 3STYA 1QIJA 4F21A 1GPNA 1EX9A 2VTVA 2WIJA 2AJBA 4X95A 5C8ZA 5ESRA 4RNCA 1BEEA 2Y6UA 4XWGA 2HU5A 4B82A 3H0CA 5E4YA 5HFNA 2RHWA 1XZFA 2R11A 4Y2XA 5AHXA 4U2GA 5K3FA 2DR0A 4BE4A 1WB6A 5DNVA 3WKAA 4FKBA 3R3ZA 1E8NA 1IVYA 4IQ4A 3STUA 4M0MA 2QKYA 1BU8A 2IIVA 4IO0A 3F8SA 1ODCA 4C88A 1XROA 3AUKA 5K5EA 4E14A 4WFKA 5LLSA 4O08A 4H7HA 5JZ9A 4F60A 1R88A 2QTBA 3OPMA 5I8PA 4EHBA 4ZREA 3HLKA 4ROTA 2RI6A 1UKBA 3V1MA 2ZJ7A 3N2ZB 5AM4A 5DTIA 3BJMA 2GZRA 4EBBA 4W1QA 4S0XA 5BV7A 3C6YA 4LXGA 2HIHA 5JIBA 2D0DA 1H2WA 3ZPXA 5AM2A 3GA7A 4B81A 4CCYB 3VISA 4A5SA 3IULA 3T52A 4UHHA 3OM8A 4G4GA 1T4MA 4HXFB 3WI7A 2B20A 2HA7A 3KD2A 4U2FA 2AXEA 2YASA 3R3XA 3V1NA 3LP5A 5EHQA 3AJAA 3H19A 2RIPA 1U2EA 3WA7A 3GZJA 4K2AA 5JYCA 1F8UA 3O4IA 4BAUA 3H1AA 2W6CX 3DYVA 1YB7A 1ZD3A 3OC0A 3A2LA 4BYMA 5JZSA 1JU4A 2WFLA 1XZCA 4K6GA 5HF6A 5ALYA 5E2IA 1XRLA 1SOMA 5AKLA 3VJLA 3WQHA 1GZ7A 4B83A 2BGNA 5IVHA 3D2CA 2PSDA 3H2GA 1CPYA 3Q0TA 1A88A 5K3AA 1W1IA 3X3HA 5DNWA 5EIAA 5ALPA 4MQLA 1YAJA 4ZV7A 1HBJA 1NU6A 4NMWA 1DX6A 3LIIA 4F5ZA 3EQ7A 3QH4A 4OB6A 3WKCA 1VXOA 4DSAA 3R3VA 2QM0A 3SX4A 2VF2A 4YK7A 1JJFA 1N5RA 3I2IA 3O0DA 1QO7A 5AI5A 3GFFA 3H2JA 1PFQA 3H2KA 4FLMA 4Q3OA 5CBKA 2ZYRA 5LZ8A 3PF8A 5ALXA 1B6GA 3FBWA 1A8QA 5A71A 2HFKA 1XQWA 1BROA 2WJ6A 3R41A 4BCBA 1CEXA 4INZA 2JGMA 4DMKA 5LKRA 2X5XA 5EIHA 4WJLA 2I3ZA 1A8SA 5EHZA 4G9EA 4OSEA 4DNPA 4UFOA 4CG3A 1FJ2A 5E4JA 1A7UA 4BE9A 3PUHA 4Y2RA 1JJBA 5DNUA 4Y2YA 3V1KA 1OXMA 1DINA 2WUEA 4EY4A 2XMSA 2XQGA 4LYEA 2OCLA 2OLEA 3I6ZA 2XDWA 4J0DA 3U0VA 3FCYA 1OILA 4W1RA 1MU0A 3QMVA 5AKZA 3BIXA 2WUGA 1LPSA 1LZKA 1DWQA 3K9BA 4XJVA 1C7JA 4UBLA 2GBIA 4OYYA 4J7AA 2WLSA 2WHPB 2QJWA 2RAUA 2XQKA 3BWXA 2CUTA 1UK9A 5HCUA 3RKSA 3DYIA 2BCEA 1JJIA 2QT9A 1VA4A 1XZMA 2RGUA 2C0QA 1VZ3A 1QOZA 1LPMA 4OB7A 1CUUA 3IURA 1DWOA 1XRQA 4EY7A 1SCKA 4UBKA 4FNMA 2HA3A 5CRIA 1JKMA 3DNMA 2WIFA 4Y2JA 2WKWA 2Y1KA 4GXNA 4IH1A 3TRDA 4BP8A 5BWBA 1I6WA 2VJBA 1X70A 2AJ8A 1CIJA 4M0EA 1QLWA 5CMLA 3DOIA 1XLUA 4BDTA 3C5VA 1C7IA 3PFBA 2QR5A 3W9BA 4KR0A 1VOTA 2WTMA 1L7QA 4AO7A 1ODTC 1H2YA 3HXKA 1Y7HA 2GYVA 2XQIA 3EBLA 3R3YA 5J3JA 1MT3A 3SC2A 5EI5A 2GBGA 1CFJA 1XLVA 3G0BA 4Y2VA 3C5WP 4N8EA 5KREA 3DL7A 1ZI6A 5JD5A 1SFRA 2WFMA 5JAPA 2JEZA 4C87A 4HRXA 3T4UA 2HL6A 2XMZA 2YXPX 2DCMA 5ALQA 1WPRA 1T2NA 2O7VA 3WK7A 1LPNA 2VQ6A 4FWBA 2P8SA 5DYTA 3U1TA 5FLKA 4U2EA 5CT9A 1EDDA 2FJ0A 3DOHA 3OOSA 4U2CA 2J3DA 4YPVA 4MWSA 3I2HA 4B9AA 2WU3A 2OGSA 4I19A 5JAUA 1UK6A 4P9NA 5EIEA 4GECA 4OPMA 5AIAA 2V9ZA 1EI9A 4ITVA 1CUHA 1ZD4A 1QIEA 5CTAA 3JW8A 5JAOA 4PSDA 5ALMA 5AKKA 1G4HA 3D7RA 1W52X 3H17A 4H0CA 4WFIA 4C01A 4X97A 4X92A 1JFRA 4DMCA 3A70A 4U2DA 2QOEA 1N8SA 2WM2A 1CQZA 3O95A 4B0OA 4UPDA 5IKXA 2J4CA 5AI9A 5H3HA 3GUUA 4B7ZA 3TEJA 1YB6A 1U65A 1R9NA 3CN7A 4BVKA 4JH0A 3WJ1A 4DNFA 4Z49A 1ZD2P 1XQXA 4JYPA 1CRLA 4QLOA 5ALUA 1JMKC 2HDWA 5LZ5A 3ANTA 1F6WA 2DHCA 4HRYA 1WB4A 1EK2A 1FSSA 2OXEA 4B0PA 5AKHA 3Q8WA 3D3NA 5AICA 5HK9A 1NU8A 2UZ0A 4QDTA 3JWEA 2XMCA 5FUMA 2O2GA 3WL5A 3C87A 1JI3A 1CUCA 1SCIA 1TIBA 4Q3KA 4PF1A 5AM1A 4CIAA 2QUBA 2GBFA 3PI6A 5DWDA 3WWDA 2RONA 3WYDA 5HFAA 1VLQA 4FBMA 1AKNA 3MUNA 1XZGA 4F0JA 1PV1A 3PF9A 3PICA 1JMYA 4U2BA 5KWIA 4WDQA 2XUKA 4AN1A 1AMNA 1P0PA 1XKLA 1YR2A 3VVMA 3WKBA 4GDMA 4J0GA 1VKHA 4C4ZA 3QYJA 4W1SA 2WJ3A 3WWEA 4BC1A 2ES4A 1MX1A 1MJ5A 4CCWA 4WCVA 3HZOA 1MX5A 4H7EA 1CUEA 2IX9A 1QIGA 4BAGA 4G8DA 2PSEA 1P0MA 4H7DA 4PNZA 3AZPA 3BDVA 5CXXA 3DLTA 4AB1A 1EVQA 4FFWA 4E11A 5C8VA 4IH9A 4H77A 3B12A 3WJ2A 1Q84A 1VZ2A 5LYYA 4BTLA 2XB6A 2XUHA 4C4XA 1GXSA 3RLIA 5JZBA 3I2JA 1XKTA 5ALKA 4CG1A 5ALEA 3C70A 1EH5A 4LXIA 1CUVA 5A7FA 1VJ5A 3C43A
chains in the Genus database with same CATH superfamily
2J9YB 4OXIA 4RM2A 5FCDA 4B7XA 3BSSA 5K8UA 4YX9A 1SNYA 1XEWX 3LT2A 5FA6A 4M38A 4NHEA 3T7JA 4C76A 1SVMA 1XZDA 3LOQA 5CP8A 2AE1A 3WNCA 1B93A 3ZCQA 2GEUA 2H8GA 1UKZA 4KU4A 5T4BA 3IELA 1DQZA 1J0BA 2CXQA 3FCXA 2P5TB 4TYNA 1DAHA 4ZAZA 1DDIA 3DHVA 1CU1A 1G3RA 1USWA 2P9JA 1G41A 3GVXA 4CF5A 1M75A 1DU4A 3IKVA 3HXMA 5TC4A 3NV9A 3B3GA 4CHTA 4R2LA 4M83A 4HT3B 4RZ3A 3PENA 4HX2A 4EY5A 4NBUA 3A6HA 1BHQ1 1DG3A 1F2VA 1UDAA 2KX7A 5K3EA 4PLPA 3E5MA 3KVOA 4HUQA 1THTA 2J41A 4L57A 1E9VA 2RKOA 1E5XA 2WWVD 1UT8A 3QFHA 3TZ6A 5TT0A 4KIFA 4RY0A 4F8EA 1K3UB 3PGKA 4LGCA 3DE2X 4BC0A 1VKNA 1DHTA 4NZOA 4D92A 5EIXA 2XF8A 4FXPA 4MR8B 3L8DA 1J49A 1W35A 4FFOA 3VR5D 1A7JA 4JENA 3KR0A 4NS4A 3L1KA 2BV3A 4J0QA 3CZ9A 4OB8A 3CCFA 1U63A 1VHWA 4EVRA 2XMGA 4M8SA 1XCMA 1T1GA 4RE5A 3LSTA 4H4CA 3HC7A 1PZGA 1QFJA 5ALIA 4CKXA 4I46A 1GPUA 1BXRA 1EUQA 1XCGB 1TCAA 1XTTA 3C6QA 4B74A 1U28C 4ESEA 5HSGA 3FPHA 3QW2A 1GSAA 3QU2A 4PZYA 1VL1A 4YRPA 1WHSB 1DAOA 1YR7A 3D64A 2DOKA 4KGDA 3TJMA 2ZJ8A 2JGEA 5C1PA 2D2VA 3NYRA 2R2GA 4KE6A 5CFOA 4ZQCB 3U7RA 1VA5A 4F04A 1JT2A 1UC8A 2VJDA 5JO9A 2ZS7A 3AK4A 2HX1A 1PGPA 2YV3A 3I3OA 3MCAA 4P4SA 4RKQA 4KBFA 2CFOA 1O97C 2QMUA 3HA2A 2NVOA 3PRJA 3QELA 2XQJA 3BFXA 2HRQA 2RHRA 3Q10A 4YRBA 2Q6IA 1J56A 2JATA 4MK4A 2GN6A 5CDYA 3OQMA 1GNTA 4BFWA 3QUCA 1RTTA 3QVJA 3Q12A 3DAGA 3KSBC 3IMEA 1Z9BA 3D1JA 3VHLB 1SVUA 3HY6A 5AW5A 4KPEC 5BYJA 1HDZA 1HRKA 1YK1A 3FI0A 3S40A 4DEYA 2QW1A 1J1IA 1NG1A 3N0XA 2C4MA 1GZ6A 5FWYA 5CIWA 2JLAA 1QFZA 3TQTA 3V34A 3VO8A 5KZMB 2WU4A 1E1CB 2O2IA 4D74A 4KH0A 4UAGA 2PBLA 4EPRA 4FQ5A 1FVXA 5K3BA 3IP6A 4AO6A 2AZXA 4HADA 1ENYA 4G1EB 1WHTB 1H1DA 1E79D 4OGLA 1ISFA 4KOEC 3GBVA 5HJEA 2V7PA 3EQ6A 5EZYB 4HGZA 2OOSA 4CKWA 4N0DA 3VO1A 1SHLA 1IOVA 1GPWB 2FU5C 2IA5A 3NBQA 1RYEA 2OCXA 4N5IX 2P2YA 4KRYA 4ZDJA 5JD4A 2JIDA 2N42A 4YRDA 3TFOA 4G0VA 1M6VB 2RGBA 3OTGA 5EINA 4BNWA 4ADSG 3BE5A 2FX5A 4C6TB 1I9CA 4DC9A 4EA6A 1SKYE 2WAAA 3TVTA 4EQ6B 1CJCA 3AJEA 2AI2A 2C4TA 1ESNA 4MVJD 5AK4A 1NNLA 5TS3A 3VNUA 1JE1A 4KXVA 4FINA 4Q4HB 4IKPA 4QULA 1YDHA 2C0CA 4O4LA 1AURA 1QWOA 1AQJA 1U0JA 3SM3A 1A7KA 3C98A 5FTNA 4RV5A 2QE7D 5KNCH 1EDBA 1QGZA 3NTOA 3TM5A 3UKOA 2P7HA 4J1TC 3ADDA 3A6PC 3QX7A 4CMGA 4EGFA 4TKZA 5LQMA 1J22A 4X8HA 2FZGA 5ALZA 4HVTA 1GFZA 4J7XA 4Q1BA 2YZGA 1FTSA 4KBYA 3SEFA 3UENA 4A15A 1FDTA 4IPTA 4AROA 5CH8A 2QTVB 2IPMA 3G9TA 1U1IA 3FDXA 5DM4A 5CG2A 3VQTA 8GPBA 2XYPA 3L0SA 1T9ZA 4F9EA 4KVAA 2Q27A 1G5TA 1WU8A 2I54A 3PC6A 2X6RA 2ZE6A 1WDMA 3LQRA 5LR6A 2LP4Y 5CYOA 2C94A 2H7YA 5FR1A 3U3ZA 4M6WA 5LYJA 1PR3A 1KY5A 3U9SA 4ONEA 4DUZB 3URMA 1DKUA 1QRAA 2IX3A 4QUIA 3W4JA 4P3PA 2V5UA 1UJCA 2E18A 4KAJA 4Q9LA 1AQLA 3P2EA 1QF9A 2ZT8A 1RAFA 3IH5A 5J2UB 3A11A 3D9QX 3NOQA 5DM60 4LJRA 3PLAE 4EAQA 1LVGA 3KJXA 4GGPA 2DKOA 2Z2KA 421PA 5K5EA 3ENKA 1FFYA 3HDTA 1ATZA 1K88A 5LNK1 5AD1A 1Z8DA 1FA9A 2GPTA 1PS8A 1OR8A 1BS1A 4TGLA 2GM5A 4D56A 2QGNA 1H8HD 2P41A 2YHIB 3Q2KA 4J49A 4JT9A 5EFZA 1J33A 1IXYA 3RI3A 1LSJA 1SJ9A 1WUIS 4JGBA 4Z1MA 1CS0B 3K8YA 3CLTD 2GX6A 3I32A 5DTMA 5F5XA 2H4JA 1O95C 4KPUA 2XKKA 3GPLA 3N8DA 3R44A 1FDOA 4B35A 1T8WA 4WK4B 4Z0HO 5REQA 2SBTA 1VPVA 2Y1WA 3BMOB 5KVCA 1VDZA 2RGDA 3GQVA 4FYJA 4MPTA 3TQRA 4UM9B 1CG6A 3U6KA 1USKA 4HQRA 1HA3A 5J1TB 1B26A 3N2KB 1JHZA 1E3EA 1DC7A 1K27A 1H1LA 1AKRA 1T8UA 1T8SA 3P26A 4GYWA 5A5GA 5HVNA 2X6TA 4MRNA 1YR6A 5E2BA 1QHXA 4E03A 5CX4A 1FJXA 3W05A 4F3TA 4K28A 1JHXA 3THRA 1OTXA 2A5JA 5HEKA 1A1SA 2WSBA 4PYLA 4OMDA 4KWHA 4HDQB 1JIIA 3DLIA 2B30A 4L9RA 1BFUA 4JN6B 3E27A 3U4QA 3GG2A 1LPBB 2A78A 4XQGA 2E6KA 4QD3A 3HB4X 1N77A 4V38A 1T1JA 3DW1X 4KPYA 4QHTA 3B52X 3FKSD 3ZCTA 4YQFA 2AN9A 3G49A 3QKUA 1GRRA 3IT0A 1QK4A 4RQAA 3UHJA 1YS4A 2KPOA 1UBNA 4KWCA 2CLEB 4D2IA 1K8ZB 1DBVO 4BMNA 2OK8A 3DVAA 2O8CB 3QPWA 3IQEA 3T6KA 4GKBA 3P0HA 3VAZA 4AS3A 3J81k 2CNKA 5CT8A 1YZNA 5JECA 3REQA 3L40A 4DLSA 4QOGA 2Y0PA 3GOHA 2PRKA 4GP6A 1EK0A 1FF9A 3AR4A 1T13A 4DWVA 4YCJA 1X1SA 2PBRA 4RXUA 1KP3A 1REQB 4JYCA 3WLNA 1CJMA 3O75A 1I3CA 3PNPA 3O03A 1A98A 3TX6A 2D13A 1GQRA 1A9YA 3Q85A 3KSZO 3DEIA 2VI5A 3BWBA 2H9YA 4JBNA 1R8QA 4NY1A 1UAAA 2FZ4A 4OLHA 2WYHA 3OJLA 4I4NA 4L4UA 5GMOA 3TH5A 4DS3A 4HNUA 1J2EA 1DEKA 3HFSA 3BORA 3CRQA 2V4UA 2R6AA 3OPYA 1XVLA 3Q3IA 5ENVA 3SYLA 1XA4A 1JQEA 4LIPD 5JDCA 4HS4A 4XOIA 4YASA 4OBXA 3ORHA 3P9ZA 1C3LA 2VCEA 2VRCA 5ALHA 3T94A 4BMYA 1EZZA 4DQLA 1ZPDA 5C5DA 2JGAA 1EFRA 2XVYA 4Y7CA 5PGMA 1RZ3A 4I5FA 4Y9UA 3EF3A 4IQFA 4GLLA 2J67A 1ONNA 3BKWA 4RYLA 2AHRA 9ABPA 4WNYA 2WB2A 3I9JA 2HBQA 4S12A 1D1QA 3X0DA 3IOEA 2LDBA 5FEMA 1KFJB 2WVAA 3SY8A 2GDZA 1VB5A 3NOOA 4AQ7A 2JBAB 1QRSA 4XQEA 2D1YA 3EW7A 3KVVA 3KOWA 4ER7A 3U3OA 3D8BA 3SLRA 5CA1A 2X4DA 3PFFA 4FSHA 1UMDB 3RS4A 4C5AA 1G0OA 3KXPA 2P0AA 2HIMA 3OIUA 2QN7A 4B48A 4QXQA 2BH9A 4PFJA 3KYCB 4N8DA 2ZUUA 2PV0A 3EVBA 5E6RA 4UE2A 5G1PA 2C92A 3ZWVA 5AR1A 5K8JB 2JRLA 3JVEA 2RBGA 4JJGA 1AQYA 1RFGE 3NBXX 4P7BA 1XOIA 4GFDA 5DLQC 4D4KA 5AIBA 5I4CA 1TZKA 2J9RA 4E7PA 4TXMA 1Q1NA 4S1OA 1LX6A 3TIXB 4ITUA 3T7SA 3VR4H 3M1IA 3CRRA 3GJQA 4WNAB 4KN5A 3UUGA 4O3MA 2DFVA 2YWRA 4ND5A 2J0EA 1II8A 1QCDA 4OHXA 3TW0A 5BPFA 2RD2A 2A9FA 4BNMA 3WGTA 4Y6RA 1N8KA 4I3FA 4C1BA 4IOKA 1WMDA 3HU3A 4MQFA 1R50A 4TTSA 5KQPA 3R0IA 5ITSA 3DEAA 4UXIA 4GM4A 4ED9A 2I2AA 1OH8A 1OQAA 2ODBA 4PYQA 2QVZX 4DLBA 2VF4X 4RHYA 1QZ3A 1Y81A 2P2ZA 4C0JA 1EBBA 4HQOA 5D3ZA 5DLDA 1B14A 2PUEA 3UATA 4P22A 2UYQA 1XJQA 3NEJA 1V2GA 2RH5A 1A69A 5HCIA 4BNZA 3U4IA 5DASA 3ELYA 3K6JA 4QFCA 2EKQA 3GRCA 1Y33E 3OY7A 4TKVB 1HH4A 1BXKA 2F3RA 3FPAA 4HVAA 5EYPB 1GZDA 2ZYAA 3IB6A 1DQRA 1S1CA 3OOYA 1DTEA 1D7OA 4NICA 1IHOA 1GRVA 4KO3S 5EZSA 1IUOA 4GI3A 3STTA 2ZRAA 1CY1A 5HUHA 2YDXA 1L7NA 3Q3GE 3D1LA 3UANA 4Q3EA 3K9CA 4HEHA 1JFLA 4DSNA 1T1EA 2BF4A 3F2IA 3JPWA 1SOAA 2H31A 4RE6A 3Q0EA 4L73A 5HF9A 4YV2A 3HUTA 1YRAA 5FBRB 4D4LA 4AJPA 5K0EA 3AR9A 3DQZA 4KVGA 5FI1B 3AL0C 4G0QA 3VPBA 3U44B 2I6UA 3IT2A 1RJEA 1R6BX 2A3RA 2G06A 3JR3A 3NM5A 3OT1B 3QUBA 3D6UA 4IHJF 1RI1A 4D8YA 5ADVA 1U1CA 2J5XA 2C7QA 2DLNA 1UAGA 3DMFA 4D9BA 2BDEA 4ASUA 4HLUC 4Z3OA 4Y2QA 3FPBA 5A1TA 4DIMA 1JBKA 4DLXA 1TAGA 3VMFA 2EG9A 4D6XA 3H87A 1V25A 1Y5RA 2FN4A 3BA1A 4FOSA 4ZOLF 4P7JA 1IHXA 1KEEA 3TW8A 2N1BA 1J4AA 3U4DA 4D8VA 3BHMA 1KSJA 1CXZA 2B7CA 1P6QA 3N8NA 1QP7A 2JGKA 1PRYA 1WV0A 3M34A 3DUWA 4BVGA 5ITWA 1IZ8A 4R6XA 5DZSA 5KPJA 1RWXA 3F6RA 2NVWA 2OQIA 1KJ8A 2W6MA 2PS0A 2ZRIA 3H5WA 1R0BA 5EIBC 4ZVQA 4GR9A 2E1RA 3QKSA 2P1ZA 1YZVA 4HEA1 1NE7A 1JQKA 1NVDA 2QMEA 4KKVA 4G1VA 4DDHA 2Y6VA 3O26A 3GGJA 2ZAYA 5LP6F 1U99A 3L6EA 5FAXA 5MN6A 1KKLA 2FSUA 5LQUA 2XGMA 2OO7A 2C7GA 1MC5A 1CUYA 4RCYA 4TL8A 2PKCA 1ORVA 3PXAA 2HYIC 1MZVA 4DG5A 2QY9A 4LNUB 2XUQA 3I2YX 2I29A 3JZIA 4KSYA 1XEXA 5C5EA 3L8GA 1NUUA 1UZAA 4J4BA 1HE3A 2XKAA 2C2YA 3GLIA 3VUEA 2EW8A 1QGOA 5EMLA 3CVWA 4G9BA 3RRXA 1GZUA 1JPNA 2YV2A 2VC2B 4F85A 1RAHA 4ZMRA 4YMLA 1K8YB 3D3WA 3ESXA 1WZEA 1E8MA 3G2OA 2Z4SA 5EWMA 3B2QA 1ZINA 4GKJB 3VNSA 1QFXA 1XAHA 4FFBB 3TB6A 4L8VA 2IT1A 3B2EA 5JVDB 3ZGNA 4FT4A 3BBLA 1WEKA 4WMLA 5C5IA 1QV6A 2D1SA 2C59A 1VPWA 1NBIA 3MK31 5FYQA 3ZLVA 1NAHA 2O06A 4NZMA 4MO2A 1QX4A 4W9MC 4Z86A 2P9FA 5JSQA 2WU8A 4DHEA 4CV0A 5JAHA 3K16A 4BFTA 1CY4A 5KNDA 1RIFA 3VO9A 4R9VA 4HMOA 3OPNA 4BE7B 4OHCA 3OLXA 1GNLA 2BFEB 4G5XA 2WJGA 5FF9A 4NKRA 4TXNA 1MFPA 5IHPA 3THXA 2HRBA 2F1HA 4HRVA 1UK8A 3PXCX 1ZD9A 3A28A 2I80A 2ZUSA 2FEMA 4UUAA 4DLNA 2BKUA 3NBUA 3M1LA 3DCIA 2IYRA 1VXRA 3MHPA 4QVGA 1SZDA 3L4KA 2LVBA 4HXEB 4KUGA 4ALMA 4G1BA 4XGRA 3IQGX 3SR3A 4ID3A 4GBMA 2HRDA 2VDNB 3OQBA 3FPKA 1ZNXA 5AM0A 4J07A 1MJHA 3ZH9B 3D1VA 3V8PA 1PT6A 4EF6A 2FGKA 2GAAA 1IFXA 2FLVA 3EUWA 1ZXLA 4XSHA 4FNOA 3MGAA 2ZSHA 4YBRA 3TQCA 5J4KA 1DTWA 1ODJA 1UQTA 2QJRA 2YH2A 4NJOA 3OCVA 3KYBA 4XVCA 1C8LA 1ZGCA 2PAAA 3AF0A 4TVSA 3SWWA 1L7EA 1QHFA 3OEYA 3DJFA 1IAVA 3ETNA 3K0AB 3RSSA 1Y98A 1BEZA 1TKAA 5DPMA 5BSEA 5EXTA 1DRKA 2Z2XA 4HDRA 3IVAA 4KI0A 4B6RA 4QGSA 3DOUA 3MWDB 5HW0A 3L77A 2NUAA 1E32A 3A6EA 3BQ9A 4GH5A 3MQ2A 4CMCA 4EYOA 4KSBA 4KO8A 3AV0B 4B46A 1RRKA 3SFVA 2RHDA 1YDWA 3SSOA 1J00A 2HADA 1TLFA 5BMVF 1YSCA 4RULA 1VIVA 3KLOA 4UVHA 4UZEA 4XARA 4KVZA 1DFIA 1MOSA 5FPQA 2M6KA 1XU7A 1J99A 3AFGA 3MZ0A 3HJCA 3HB1A 5JEDA 2FK7A 3N8GA 3QLUA 1TGYA 1E1QD 1ATIA 2C00A 2NM0A 2Z1MA 4Y9SA 1COWD 5LWQA 4LJYA 5H9VA 4PHFA 2HJWA 5K6AC 5IC6A 3WGVA 4PANA 4RELA 1XZKA 1ABFA 1P8AA 4F91B 2HQOA 3A14A 3IP5A 1CF4A 4FOLA 3OEHD 3QUTA 2ADOA 2JFVA 3OZBA 1PZNA 3QBVA 4PTZA 4XFKA 2DTDA 4P86A 2YWDA 5FO1A 5BT9A 3ZHYA 5K7SA 3QY0A 1ULZA 5T4HA 4REQB 3UT5B 1FP2A 5DGCA 3GCWA 3VDXA 1RLIA 3B6EA 3A4MA 3ZU6A 3ZVKA 5FAKA 2J3JA 3UVEA 4CLRB 2QZZA 3S8YA 2UUCB 3G0DA 2M1ZA 4CKEB 3FIJA 4QL3A 3S7ZA 3BGWA 1E1YA 1L4KA 4RVGA 3WIOA 4AP6A 1QIDA 5FBZA 4ZYUA 3P9IA 4H1HA 2RK4A 1SQ5A 2VT6A 2W2LD 1D7AA 4RY8A 2Z3VA 1V1JA 3AGQA 3N39C 4OI1A 3VZRA 3EPHA 4RANA 2JIQA 2GR9A 1JFFB 4NPCA 3ED1A 4UOZA 3A4IA 4CKBA 3ZJYA 4ZOEA 3SXPA 1TVEA 3O9VA 1LGYA 1Q7BA 1R0XA 3LAWA 5BSGA 4DCNA 1Y6JA 4CIYA 3IL2A 1Q12A 2CYBA 3VI4B 1GQSA 4JROA 3FLEA 5EJ7A 1S2LA 3I6MA 2IYTA 5F77A 2XXAB 4IOMA 3FUXA 4DCJA 1ZGJA 2FW9A 3LP8A 2PUHA 4OYLA 1UUFA 4X66B 2UKDA 3OZCA 1LW6E 1GL6A 2E6UX 4RPCA 2QD4A 1CRZA 2BBWA 3MGGA 5AP9A 3VNAA 1NAIA 4W5NA 1CUJA 5CW2A 1NIJA 2ZROA 4PAGA 2WWRA 4C6HA 3NRCA 3PFCA 2NU8A 1E64A 1VDMA 3RK1A 4HUJA 5JSZB 2PEYA 1XNGA 1BRMA 3QBJA 5A7HA 2ZQ5A 3MMZA 1AKWA 3ETEA 4FGZA 1RHRA 2YVAA 3D81A 3MJDA 3S0JA 5IFKA 2YKGA 1PO7A 4YIHA 1D2MA 3O8LA 1CQIA 2BM1A 5EKUA 2AL7A 1NI5A 2NSDA 1B43A 1L4NA 1LBIA 1Q21A 2OBLA 1AXEA 5FR2A 4E15A 4A36A 3HU1A 1LPOA 4JQOA 3ZI4A 1IJEA 3K1JA 3LI2A 1JQ3A 2ZSAA 2W6PA 3WK8A 5I7WA 1JSZA 4TTJA 3QKRA 5JYDA 1B8NA 4G85A 1NZFA 3KT0A 4OYHA 4U02A 5B2EA 3CEPB 2CLFB 3M2PA 3E15A 3G23A 2VPQA 3DMHA 3JPYA 3R2JA 2XUDA 1OXSC 3RVOA 4AQYB 1YNSA 5CT6A 2E49A 4GPTA 5BSKA 4LF8B 1N0IA 3IIKA 2XQFA 4YXFA 3OX3A 3BILA 3M6IA 4KDFA 2IF2A 1PGOA 4EQZA 1SXGA 1ZSNA 2PLAA 3UK1A 2HHJA 3UK7A 2HBRA 4WBXC 1AKEA 4MHOA 5EZ6B 1E4OA 4ECEA 5A4JA 2DP4E 4TV9A 2MU1A 5JHGB 4FN4A 1SN7A 3EIHA 3DR5A 3GUCA 5HZGA 2YC2C 1R7RA 3G9QA 4LXHA 4Y1FA 5TNXA 1FU4A 1C81A 2VSYA 2XMBA 4DJJA 5B6IA 2BPOA 1CUGA 1EFDN 1U1GA 2D54A 4J0FA 5D5PA 3UXYA 2PU5A 5DT9A 2DRIA 4WN9A 1AO3A 4FYPA 4HXGA 1UKYA 1NHGA 3V8VA 1DRVA 1C0KA 1RP7A 1NL3A 3C97A 4LTMA 1CDOA 5EKTA 1PHPA 1YB4A 2GM9A 1P18A 4FTWA 4G01B 1FL9A 5IDWA 1UCFA 3R8FA 2JVIA 4GSLA 1KH3A 4J1TA 4REMA 1C1DB 1TQHA 4M86A 4PYNA 6PFKA 4HFNA 3FTEA 2QYTA 4OJNA 1IVSA 1LBTA 4BP3A 1KAGA 2DH6A 1GPYA 1RWPA 1XVIA 1R12A 4WGFA 1QORA 4CEIA 3NC0C 1JG3A 1XZAA 4CLXA 5CNIA 3O47A 3SZRA 4XUGB 2XUAA 1RLJA 2FPIB 3H04A 1TW2A 1UQRA 4X8OA 4RIHA 4ZYYA 2DQSA 3GCZA 5FRDA 3G88A 1SOUA 2GWRA 1J6UA 4LF6B 2CD7A 2TYSB 4ZEOA 1RI5A 4PZUA 4MSUA 1PFWA 1JU9A 1LRKA 4PYMA 4CTOA 1ZJ5A 4Q12A 1FUEA 3L79A 4RV4A 1FYVA 1NV8A 3WVNA 2CD9A 3NBYC 3BA6A 2AH5A 5ICFA 1MPXA 4QXOA 1JXOA 1ST2A 2EL7A 4KQHA 4ZV9A 3VYSB 2BMDA 3Q7EA 3P0FA 3G0GA 1OWLA 4NSNA 3AERB 1LLQA 4WY8A 1B76A 2O8VA 1BA3A 3GFGA 2VHUA 4AKEA 4ZK6A 2QMOA 2RB5A 3EPJA 3V7YA 3E03A 4XVRA 2XA2A 5KTTA 5LDHA 2VA9A 3RVLA 5EESA 2LDXA 2ZYSA 3EMVA 3PUIA 3VR6H 5IJ0B 1UKCA 1AS0A 3O1LA 1KIAA 1JH8A 3DDCA 1AX9A 2QQ0A 3IEKA 4HFRA 2O05A 3FOWA 4IWYA 4GOXA 4YJ3A 3MXTA 2GWHA 2H5JA 4G0PA 5IVDA 1KYZA 5JD6A 2PM8A 3QWIA 2IE8A 4CODB 4HH1A 1J70A 1DSSG 2CLHB 2W93A 2V6JA 3FZEA 4PGHA 3OQPA 1P2FA 4EHDA 1JVSA 3I9V1 2B35A 1CUXA 1MR3F 1V16B 3AEQB 1TCCA 2QV7A 4A6DA 1M2KA 4OBWA 1V6SA 1W1UA 1EJBA 3PPIA 3W0LB 4AX4A 2HEGA 3JQ8A 5JCXA 5AHOA 4R2WA 3IJ5A 1XHFA 3L6BA 4WLOA 2HNAA 3E48A 3TMYA 5JTUA 2X8JB 2O8BA 2VCYA 3HL4A 2DB3A 4BLQA 1TD1A 2RHCA 1SCNE 1VJGA 3D4PA 3JR7A 3CH6A 4Q1FA 4I4LA 2VUUA 1E1KA 1U3CA 1JQAA 1SD5A 2H4YA 1Z7GA 3U6BA 3SXUB 5K0BA 4QT0A 4R41A 4URWR 4AIIA 2O7NA 4RPJA 3I8XA 4R1MA 2PN1A 4HOYA 3JD0A 2FR0A 5G3ZA 1FRNA 3W7BA 3KQPA 2C7OA 5E7QA 5TEVA 3PUJA 4D5EA 2C5HA 2BLNA 1II0A 4BNDA 1HY3A 4F96A 3F6PA 1RPNA 3L8CA 2BMVA 1O87A 2XUFA 3VNVA 4TWAA 4AZSA 1G20A 1I1HA 1U0FA 1HT0A 1PHRA 2CVOA 4IIJA 3M89A 2WZCA 4U00A 3A7EA 2NZWA 3DQPA 1W19A 3HADA 2H06A 3SHVA 4YJ2A 1E6KA 4K6OA 4H7IA 2ZI3A 4LWQA 2XUPA 4RTKA 1PI3A 1MC8A 3ABZA 3TF5A 3T7DA 3VH1A 4YHHB 3IALA 1P33A 1F4VA 4NE2A 4NBLA 1F0NA 3Q3EA 4JBWA 3WNDA 4AU1A 1K7CA 5ENZA 4DF3A 4YFYA 1AMUA 3ZWXA 5IAAA 2FP4A 1HDXA 2I6SA 4PG4A 4MPPA 1ONPA 1PWEA 2RGCA 3OPYI 4LTNA 5T8KC 1JLLB 1F12A 1E2BA 3TN7A 1QLJA 1YUMA 1IK4A 4E88A 5KDDA 4TLMB 5B7PA 3DZKA 3K0EA 4GWLA 3PXUA 4LKOA 2ID8A 2FE1A 4Y6GB 1MO3A 3G5TA 3QF4B 1XDBA 3G2JA 4Y6OA 4BLPA 1FVHA 3SJBA 3QEJA 1LPAB 4I1VA 1XVTA 3E4CA 4MROA 2G9UA 3UXMA 2PKEA 2WV9A 4DV6B 2EZ9A 3HS3A 4M3NA 3HJNA 4OKIA 2WHXA 3OI7A 1KYTA 5TR9A 3UYKA 1WM1A 5IWCA 1EFHA 2Q3HA 3HY3A 2A0XA 2WJZB 1YVRA 3NJRA 1OX5A 4XR9A 2VDWB 3TJRA 3KOOA 1QF6A 1WL8A 4GZ3A 4RMIA 1N2EA 5IAGA 5JRZA 4ZTUB 2CNNA 3EY9A 2H5EA 3NU1A 3C5HA 4EFNA 1GIAA 3INYA 5H70A 4MHTA 1XD9A 4EG1A 2J6IA 3VR3D 5KJEA 1YB5A 4Q1CA 3TPZA 3ZQ4A 1PL6A 1PFKA 2IYWA 3BIJA 5EZ5A 5EWJA 3FCCA 4QA9A 3KCNA 3RODA 2BELA 1YDGA 2GVZC 4EW1A 2VKQA 3OFND 4YAIA 3HYSA 1BN6A 3ETLA 5ARDA 3HKBB 3R75A 4BRZA 4E08A 4IFTA 2JG3A 1C4XA 1N7IA 5K1ZA 5I9TA 1YQ9A 1XDUA 2POQX 4OKNA 3OIYA 2VP9A 1SXJB 1KE1A 3Q87B 3T7RA 3QVMA 3L6RA 4UMEA 1JAIA 1KR2A 1UBEA 2QRPA 2WWTA 2Y0BA 4K88A 5IK2D 3OICA 1EINA 5ELMA 3DE6X 2E4WA 2XE4A 3C1AA 4MJ7A 4WKGA 4YP9A 4A23A 3H11A 4BMDA 4EA7A 3D4OA 4FZRA 4JP2A 3LGSA 3VR5A 4ZEVA 5B4TA 4X85A 1Q2UA 1UK7A 2YYYA 4H6XA 3HNPA 3VJMA 4D9KA 1KFCB 1W88A 3CG0A 4YJGB 5JS7A 3WB9A 1JKFA 1ZJYA 3RG2A 1YZFA 2YOHA 2QMQA 3OG9A 1UMCA 2IQ5A 3H2ZA 1Q0ZA 4RSMA 3HG7A 3N70A 4LZZA 3BHNA 1ORDA 4S1VA 2VDQB 2HSEA 5F4ZA 1M2FA 3CVYA 3EBPA 3BERA 1L4FA 4NFLA 1ZOSA 2PUWA 2GCEA 3EQZA 2ATIA 4RA9A 3HABA 4AL4A 2WE7A 3FYUC 3P9RA 3S2FA 4QDOA 3M9LA 1X74A 1RU3A 5CG1A 1T24A 3TLZA 1HORA 2H18A 1GG8A 5HCNA 3NYIA 5AUPB 1XD8A 2OBYA 4ZU1X 1MO2A 4D3DA 3MWEA 3NM4A 3IQIX 3AF2A 4O6VA 1LF0A 3I05A 3M5WA 3HEBA 4FT2A 4MYSA 4RX1A 2AIRA 3RFUA 1CD5A 3UB4A 5AVJA 2JAWA 4WACA 3OLWA 1T9BA 2JFWA 2R60A 4GMXA 1SXIA 1F14A 4FP9A 4L07A 1UJ6A 3I4FA 1LLDA 5BP7A 4CF7A 2GCOB 2BM0A 1L1EA 3Q88A 3IUYA 3TLBA 5JV5A 4JI4B 4P8RA 3VJKA 5I7VA 1D09A 2IHJA 3CWCA 3S2GA 4ZT4A 3R0QA 2BSXA 4PRZA 3TI9A 1OSNA 5HUJA 2WF5A 1CLUA 2C4KA 2V7TA 3BJZA 4M8IA 2Q1TA 1I5OA 1FMTA 2PQ6A 2PX6A 5CVUA 3C5EA 2IBTA 4P5DA 4FBLA 8OHMA 3VZPA 4LCEA 5CB8A 2VHXA 2WILA 1E79A 1J25A 4LE1A 5C8YA 2WVJA 3DOCA 3I23A 4RH1A 4I55B 1MQAA 1E20A 3H7IA 1FPQA 5ALWA 5AUQA 1N7HA 2IYSA 2P2CA 5K20A 4LNAA 4MICA 4EPTA 4JJIA 4IUDS 4F3RA 3RYFA 2GSDA 5HE8A 3CR3C 4EA8A 4R40A 4CM4B 1R4NB 3TS1A 2VAWA 3O8OB 4A03A 5D3MB 3GJ0A 3FYCA 3I73A 3WLEA 4I0WB 5BN5B 1YRQA 3CLHA 4K9SA 4BVEA 2P6PA 4Q3CA 3D4LA 1CFZA 1NUAA 4GRDA 1NSTA 3L41A 4MVJA 2EF1A 4C4YA 1U9CA 5CTJA 4F3KA 4J1SA 2FW8A 2C99A 2JVJA 1AB6A 1E69A 3R40A 3S28A 3PIRA 3L0OA 4DIKA 5AKYA 1JEOA 4YPFA 4N65A 1RI2A 1FFBA 4JX8A 4Q6BA 2QE7A 4ZO7A 3N2GA 3NTXA 4ZFNA 4J2HA 3HMQA 1OYVA 4MJ3A 3NOVA 3C39A 4R4JA 3TDMA 1YS6A 3H9UA 4FEAA 4LQLA 3ZIAD 4TT8A 4DDUA 1PJ2A 4YS6A 2J9FA 5LQNA 3OO1A 1VE7A 1UEJA 3GPIA 2BHRA 3M5PA 4NU8X 3F6BX 1VCIA 3EMBA 4AY3A 4I3GA 1GCOA 3WOVA 1XEFA 2RGNA 3WKDA 1GTJ1 5DEOA 4D6PA 1U2DC 1L6RA 2WVGA 3CLSD 1Z5WA 1ZITA 1OHHD 1H6DA 2QHXA 2WM9B 3DAHA 1U3GA 3GHHA 2J4DA 3H5VA 4YVFA 5IMBA 3SP1A 3TSCA 4BO3A 3KZKA 1AD2A 4J7CA 1HNZB 1O3YA 1OY1A 2Q1YA 3QU5A 1XTZA 4UD2A 1FU8A 1X3SA 3ICQB 2CJWA 3UKDA 2DBZA 1Q3KA 1KEWA 3GWZA 4HLQB 4J3JA 2JKVA 1UZMA 4HAIA 5E6UB 4TOIA 3P2OA 5JCOC 1WDTA 1A27A 1U2QA 2F1RA 5LC1A 1U8EA 4PYJA 4GXTA 4O4HB 2XYQA 5JSHA 1GCUA 1PEYA 5C32A 1XHEA 4UQLA 1AHHA 3P0RA 5LDGA 5LZ4A 2BGJA 4KNYA 3V1LA 4JJ7A 5HIJA 3ADBA 3KOZA 3J7AC 1AKTA 1G0NA 1H8HA 4W5RA 3ZHRA 2JLWA 2Q6OA 3OQOA 2DT8A 5DWQA 3V7UA 4D4HA 2HXGA 2R1VA 1SC1A 3WFJA 1QRUA 4C4PA 1Y3HA 3F71A 4CRWB 2FWPA 3R3HA 4CYMA 4P38A 3KSRA 3UHPA 3MMSA 1LH0A 1WXFA 3AB8A 4RVFA 3QEMB 3A1SA 1H0KA 1I2CA 3WNBA 1K6XA 1N6PA 3LLVA 5GJVC 3DXYA 3UIEA 2VDPB 2HPVA 4PONA 3JD2A 1E3IA 1JDBC 2V45A 3FHOA 4QU0A 4KQXA 4ATNA 3NR2A 4ER3A 5D87A 3L9WA 4JVLA 1YVUA 2QL6A 1E4EA 1VMKA 2H1VA 5M04A 2IY9A 2CZGA 3MYYA 3NG1A 4TV8A 1Z7YA 3REGA 2YQ5A 4EW6A 1I7DA 1PFUA 1CNMA 2MIIA 2HJGA 1XSEA 3A9WA 3H9EO 1T6XA 3HTXA 2H5LA 1OOEA 3TAHA 3NNDA 3AY6A 4GG1A 2XA9A 4YXWD 4I8XA 2RI1A 2Q5CA 4TM7A 2JGJA 1A9XA 2KBEA 1TQ8A 3AW8A 3ESDA 3VC1A 3ZHSA 4YAKA 2B8TA 1RXUA 5DX1A 1Q92A 3FKSA 1NJ6A 5I7AA 5A05A 4QU8A 3DM9B 1EWRA 1FP6A 1FMCA 3HJFA 1A8UA 1GSIA 4EUKA 3RRNA 1KMHA 2XYVA 4IXTA 4QRHA 3RNLA 4JOSA 4BN5A 3A37A 1Z12A 5IH3A 4AZ0A 4CBVA 5LQDA 4R5MA 3AT1A 3E7FA 4O2BA 3NB0A 4X3PA 4HK4A 3B2NA 2P2GA 3D0KA 3IP3A 4M7WA 1OXVA 1QC5B 3NH9A 4G5SA 1XFAA 2HYDA 2PX3A 5GJCA 5TVGA 4BATA 4DE5A 1EP1B 5DTEA 5CITA 4DPMA 3EZ7A 1PGQA 2R6CA 3FMIA 3VHXB 1VMAA 1L5WA 2UDPA 4KLRA 2FWMX 1U6KA 1J07A 1P2GA 5MGNA 4ZO8A 3HH8A 2IXDA 2V9PA 4MCIA 2GYWA 1E9SA 1MC4A 4INPA 1EWVA 1KOLA 2RE8A 2QVGA 3G68A 4P7GA 2X9VA 1RHQA 2Z3WA 3K09C 1DQYA 2AXPA 3K31A 2J07A 3LUAA 1U3FA 4MQBA 1CJUC 3H97A 4C89A 1SKUA 5J5CA 4F7DA 1V8PA 2AMFA 1UH5A 2AOWA 1EX1A 2CF6A 2OO3A 2XE6A 3RIYA 3D3QA 2B0CA 1O08A 3O9MA 4IIEA 2FF5A 2BFBB 2CJYA 2G63A 2BD0A 3HJAA 1G3MA 1Z6YA 1FUUA 2V1XA 3N75A 4PYOA 4JQCA 1Q83A 1V5EA 2EHJA 3I2FA 1TPYA 3NOXA 2O5EA 2YWEA 3QWFA 4DQVA 1BH2A 1E1LA 4Q3NA 3BHJA 9LDTA 3C3DA 4G2TA 5I7OA 1GAJA 4RK0A 1GA4A 4ZO4A 4TS4A 1E5TA 2PMBA 1GP2A 3QOYA 5I7SA 3DC2A 2GPWA 3I4CA 4J76A 5TPZD 3SJZA 1NBMA 1XRMA 3F3YA 4UMVA 2GN8A 3KPUA 3KQHA 1Z08A 4FOTA 3UGJA 1Z7BA 3JVUA 1KQ3A 1I4TD 2BC9A 2O2EA 4XIIA 1D2EA 3S68A 4DSUA 5BR4A 1BJKA 3AC0A 4MUYA 2GZHA 4JIMA 5FKJA 1D6SA 4P84A 1JHDA 3W2EA 3DE1X 2QRQA 1D2NA 3RIMA 2XRZA 5ITZB 4JUDX 4PQYA 1M2OA 1ZK0A 1JLSA 1L4UA 1BXGB 4QJ3A 4B84A 3ZCXA 3I9KA 1FPMA 1ACMA 4OUKX 3VGPA 4X7RA 4DDWA 1UPXA 4ND3A 2B94A 2PUTA 5BYAA 3COJA 2HSJA 1FDWA 1GRNA 3DLCA 2P1DA 1TECE 3ZY5A 1L4HA 3GAZA 1SY7A 3G9UA 1Z4JA 2B99A 3MW8A 3CNNA 3QWHA 4YFVA 1Z5VA 2AFHE 3FCUB 4QG7A 1P62B 3UJHA 3IO3A 2YUIA 4BNIA 3RANA 4CIXA 1EK6A 3HKDB 3B1JA 4XEHA 3I9OA 1CK4A 2I4RA 4E31A 1GR0A 4GLBA 1MA0A 5DLPA 4Y2HA 2JFPA 2M6RA 2AR9A 3GRPA 4M0KA 2H65A 4LGYA 2PMEA 3V4FA 5JYBA 4JLOA 3LHDA 2JGFA 4B6JA 4YMUA 3NC4A 4G5OA 3GUZA 1M2GA 3L7BA 1N5IA 2FW6A 2R68A 1DJMA 4BRSA 5CX1B 1DV2A 3SZMA 3ZXSA 3L04A 1KOGA 3BXEA 3K70B 3K53A 2V8BA 5CJ2A 2CY0A 2DHEA 2P0EA 1QCYA 1R6TA 1DIGA 1HTWA 2CHEA 2F8SA 3QVUA 3ETHA 2HJHA 4Z9XA 1EP9A 1W36C 1NNEA 3QE3A 4ZO6A 1YMUA 2OM2A 1QPZA 4EO4A 3F9RA 5AYVA 3KTAA 1GPLA 4W1PA 2VP3A 3FFBA 3I5MA 3OF3A 1JDSA 1E58A 1EXWA 4HN9A 5DBOA 2OCIA 2XTZA 3WRYC 2BSQA 6Q21A 1T3HA 3A9CA 3TTWA 3K8OE 1G42A 4I1RA 4TTQA 3DKRA 3HP4A 4MAMA 3SLKA 4L72A 4YDHB 4EJSC 2B4YA 4OU5A 2A1TS 5ALGA 4Y0AA 3VPSA 3KAKA 1XXLA 2ZE5A 4R3NA 1I7LA 3AUJB 5I9IA 2A33A 2ZJYA 1FNSA 3IESA 5K3SA 1KQNA 3EVDA 3SQLA 1J2TA 1HDYA 3TLKA 4E1VA 1G5IA 1DFGA 1XN1A 1CUSA 5EP1A 1TVMA 3QM1A 3RSOA 1TM4E 2DJ5A 4X1IA 4ZZ2A 4IF6A 4BDSA 1KXZA 5BNTA 3DM5A 2COUA 3DONA 4R2JA 3TNDA 4DCPA 1ZW1A 3E4DA 3OSUA 3D6VA 1Q7TA 1C30A 3WO1A 1ILEA 3N0WA 1T8TA 3MGCA 2WJHA 3CNBA 3DKVA 4HAVA 3CINA 2O2HA 3CBGA 2HBYA 1EA5A 1KGSA 1EE9A 1PR2A 1QYCA 3OOHA 2G88A 4K3VA 2GFQA 4XCXA 5IJZA 4Q7QA 1TQ4A 1EDEA 4TT3D 4MB6A 4HUQB 2ID9A 5J2TF 4AZ3A 3FPEA 4N7BA 4QO7A 3UJBA 5BUQA 1I9GA 2HUNA 1MHTA 3GZ4A 3OX1A 1SKMA 1AT1A 3RDPA 3I61A 3TCNA 1M5RA 3W2TA 1XPRA 4EVQA 1JU3A 2G9RA 4HL6A 1BCSA 1SUWA 2PR2A 3CRMA 4MV9A 1GOTA 1YJ8A 3FPCA 3VKUA 4IJQA 2XCOA 4P33A 3N7AA 4YRSA 3H1PA 2BGKA 5LBIA 2FUG6 2C3MA 2HA5A 2HHAA 2Y76A 1DS6A 2FEPA 1DE0A 2J3QA 3AW9A 3L1HA 2P6UA 1IXKA 2XCUA 1Q6ZA 3ZZNA 4ZAWA 2A94A 1BXRB 3VAYA 2I67A 1OBCA 2V3VA 4J6FA 4MWTA 1ZSVA 4QBTA 4K9OA 3OKPA 5NLLA 2PUDA 4CIDA 1QONA 1FMFA 2PT5A 1JJ7A 2ROQA 2REBA 4BO7A 3A36A 1Z4QA 4KV9A 3LQ4A 1LW7A 1OREA 2GHTA 4BNYA 3USCS 3QU4A 4R83A 1YD7A 2GVDC 2XTNA 2NXEA 3CPSA 1HSOA 1UM9A 3LCCA 4B34A 2Z8YA 1XKXA 1BKSB 4P4SB 3BG5A 3QELB 1OH5A 3CLSC 1VYUA 1M2WA 1PTKA 1D3AA 2H1RA 2I7XA 3BH0A 1E6LA 3DZ8A 3MD0A 3B8HA 3QX3A 1JSLA 5C8ZA 2ZDQA 2QP9X 1W4RA 4ND6A 3GDOA 3PC3A 4I8DA 4JP1A 1ZXBA 1U2TA 2HU5A 2Q41A 2EFCB 4B82A 3TTTA 1AXRA 3H0CA 1KSHA 1SU8A 4JLKA 5E4YA 4P0PB 5LB2A 2FZEA 1XTJA 1PJTA 2YZNA 1EDZA 3BWEA 5IXSA 3EDCA 2R11A 3Q7TA 1W9MA 2I7DA 3IODA 3HP7A 5F3RA 3HFJA 2NT4A 4MP6A 4U2GA 4WY2A 2VK2A 2EFEB 3C3KA 1U8XX 4XUDA 5K3FA 4W5WA 2FI1A 2YY6A 4BE4A 2ZIWB 1NR5A 2YW2A 4JNKA 5GOTA 4URYR 5DNVA 4A91A 4FJ0A 3R9WA 3R3ZA 2HT1A 4ZT3A 4IQ4A 1G19A 3PYLA 4P3KA 4M0MA 2G5GX 3J7TA 4WW0A 3UT6A 4HB4A 4CKWB 1T9KA 1Y9EA 4GPBA 1X7HA 5K0ZA 2KMLA 1Z28A 2OO5C 2IW1A 1GTVA 4W4TA 1LUAA 2O2JA 2LV8A 2ZJ2A 3I64A 1UXHA 4QBHA 5CFQA 3M9XA 1EUDA 1T2UA 4QIHA 1TF2A 3N7TA 2IIVA 3AYZB 4GOLD 4EMBA 3F8SA 1Z15A 5I9LA 1OPRA 2IZ1A 1I80A 4UVIA 2QRGA 4XPIA 1QGDA 1VLMA 4UTPA 4L0DA 1H0RA 7MDHA 1LBEA 2C61A 1E4YA 2DC1A 1YZLA 4Z7JA 3ZXYA 4D9NA 5IZCA 3AVXA 1SUCA 1T8RA 1FC0A 2IVFA 4O4LB 1EUZA 3FAZA 5JC8A 1ZN7A 4EJ6A 5FBVB 3BL5A 1QH8A 2BP7B 3E70C 5F7XA 4DA7A 3UC5A 5HZHA 3DULA 1E5DA 1JG2A 3FROA 4TWIA 1KRXA 4KXWA 1TT7A 1IBMB 3OPMA 4QYMA 3HV0A 5E0OA 2CVHA 2F1KA 1Z4MA 2Z2IA 4H1TA 4OMCA 3A1NA 4JGGA 4ROTA 4OQLA 2P9QA 2RI6A 4E13A 5JBQA 1ISIA 1E1QA 3C7AA 3LQ1A 4KXUA 4MW1A 4TUYB 3WNQA 1COWA 1JA0A 3T9FA 1BKYA 2AZ4A 4DBVO 2YHSA 3N2ZB 1R6XA 5AM4A 4OXYA 1FTQA 4IGEA 4CL3A 2XT6A 4AAYA 2PX0A 5GIOE 2FN9A 3U7GA 4MQ6A 5KNBH 1PL7A 2QLTA 2Q4OA 4LOLA 4QECA 2J0SA 4PLWA 5LXTF 2O8DA 4HRAA 3CEMA 4EZBA 2Q28A 3NRJA 4ZXPA 3NUQA 3ITKA 4PHGA 5F7ZA 5BV7A 2IV2X 1XQ6A 4LZAA 4M6WB 4WK2B 5LYJB 4XRRA 4UW9A 1L6IA 3REOA 1F4PA 2WU1A 1GFWA 5CGZA 2Q2VA 3CLRD 5JIBA 1EVYA 1E94E 5HTOA 3ER9A 2NG1A 2YXBA 3KZNA 2AG8A 4LF7B 2AEFA 5HF8A 4KO4S 2DPMA 3UJ6A 3WLIA 4A1OA 2W2LA 1WBDA 3PGMA 4M9QA 1W25A 1UP4A 2CDAA 3KP1A 4ZO9A 5HGXA 3OX4A 3VISA 3WNZA 1XVVA 2R5WA 4HSGA 4V1CA 3RVQA 2YRXA 2I4OA 5A4IS 3HJHA 1DXHA 4ZVTA 4IJUA 4G4GA 5SICE 4HXFB 2ZI7A 5EIWA 1NW4A 3PHGA 4UU1A 3GVCA 1DEOA 3CZCA 2O52A 2OM6A 3E05A 1XCJA 2DECA 4K7JA 2B20A 4U3JA 1M54A 1NY6A 4DUGD 2PXHA 4R2KA 4KPUB 5F1PA 3T9CA 3UHFA 4U2FA 1E3LA 3ISVA 3H8WA 2YASA 3CJTA 3FY4A 5REQB 2P6RA 4DV5B 2G1AA 2C4VA 1N2CA 5EAIA 2A4KA 2PIDA 4EG8A 1FSZA 1VCOA 4EHIA 1VG0B 1NX6A 3LQKA 2I6TA 3DMTA 3E9EA 4KW7A 1M2JA 3EW9A 1M6HA 4OHOA 4RDHA 1TU0A 4B40A 5JROA 1F8UA 1H1LB 4L0MA 1DRUA 1RLUA 1HG0A 1A9QA 3PE4A 3GRFA 2YN0A 2ZFUA 4UCQA 2IHNA 1E6WA 2F3UA 4XGQA 4CDRA 3B38A 3IUPA 3L0PA 4F6CA 3WGZA 4OLBA 1YB7A 1AK1A 2H4WA 3WLRA 4BYMA 3ITNA 4OJMX 1PN3A 4ARCA 1NM5A 1DI0A 3MB5A 3ASVA 1NQAO 1OJ7A 1AE1A 1V5FA 1XZCA 3O0TA 1ECFA 2IZOA 3LGXA 2GO7A 4K6GA 1P2SA 3VKWA 4CMBA 4YUZA 1CC1S 1M8JA 5E2IA 1CR4A 1Q19A 1XRLA 3GLQA 4XDYA 5DRTA 4EY3A 2QTLA 1SOMA 3FDZA 4IS3A 5K6AA 2X19A 3D6HA 16PKA 4B83A 1LTHR 1CDDA 4FX2A 3AM5A 4H1WA 1NI4A 2BGNA 2ID7A 3IHWA 2P11A 5KEIA 4DRZA 3DVAB 4CGYA 5BNZA 2NZYA 1CQPA 2WB4A 1L4BA 3Q0TA 4GI7A 3P96A 2V59A 3EVGA 4B7UA 2X2FA 1RBQA 1T36A 2MINA 1NVBA 4AM8A 8ADHA 2UYHA 2YJTD 4MVJI 3REQB 1W1IA 3X3HA 5JWRA 5KVAA 5JOQA 5DNWA 2OHGA 5KC8A 3VJRA 3L92A 3BKXA 4N5DA 5IWAB 3WAGA 3CVJA 4XCVA 3RS9A 1GR1A 2X3UA 4H0FA 4X5OA 4M0DA 2O1XA 4LY3A 3OAAD 4EEXA 5DVZA 3K2QA 2CLOB 1JSXA 1QBGA 1YVEI 2VOEA 2PMDA 3G2NA 3PPWA 3BMQB 3FCSB 1ESCA 1U0OC 2Z1NA 3VRHA 5EJ5A 1ZK4A 1NXXA 3HL0A 3LA8A 1N5RA 4DZZA 2H5IA 2I6FA 1Q2XA 1NVFA 1VRWA 2VBGA 4RGQA 3UQYS 4QJ5A 1C0EA 3C0KA 4GXRA 3ZE0B 3ENWA 3DAYA 3TI7A 3Q5EA 1QO7A 3U7IA 2NO7A 2IHYA 3DSRA 3C8ZA 2ZYWX 4NAHA 3W8DA 2YW9A 4R9RA 1Q11A 3H2KA 1N33B 1PT8A 4Q3OA 5CBKA 1Y3IA 4GT1A 3SMQA 1YTLA 3TCKA 3QBTA 1MT0A 3E2MA 3ZCPA 1B6GA 3FBWA 5K09A 5GADl 3COSA 1CJTC 3OM1A 1ZEMA 2F1OA 1ZJ6A 2COKA 2WJ6A 4W5TA 2IODA 3U48A 3R41A 4BCBA 4ZT2A 1SBHA 3G2KA 5TS2A 3M4YA 2HY7A 5J4VA 1LRJA 2CV2A 3E22A 3K9GA 3FPFA 4FDAA 5CA1B 1RJ9A 2JGMA 2FSPA 2I99A 3AHEA 3GF4A 1YHNA 4L8YA 4P5PA 5BW8A 3N8IA 1S9DA 4JZYA 4II7A 1K8XB 2QDKA 1PZMA 2X5XA 5EIHA 1YQUA 1I2MA 3SICE 4EGSA 4WJLA 6AT1A 2BONA 3O73A 4WKPA 5E6RB 1ODKA 4G9EA 2C3YA 4JD5A 1ADCA 4OSEA 3OUZA 5FNVA 1CETA 1Z06A 3HM2A 4A27A 1FLAA 2C7PA 5JXJA 1GNSA 1IEVA 2AD5A 1K89A 1TO2E 3EXIA 2CLDX 2VYFA 4LJ8A 4QUGA 3FR8A 4CNQA 2FX2A 1WSBA 1HT2E 1PJQA 1RBZA 3PUHA 4MP8A 2YS6A 4QFMA 3L7AA 5AW0A 1II8B 3P2IA 2IH5A 1BD4A 1NN0A 1YQGA 1G64A 3AI7A 3TQIA 3MINA 4FDUA 2QF7A 3HVRA 3ENNA 3FHLA 4MQFB 4RH3A 5KTOA 4Q1DA 1DCTA 1X7WA 4YROA 1W85A 4ZYVA 3V4RA 4QOEA 1Q77A 3N0RA 1X14A 1VE9A 2FAXA 2Q1WA 1QXSA 1DFHA 1PX0A 3F73A 2BHNA 4NJEA 2XMSA 2XQGA 1ZMXA 2FSVA 3WTBA 1K9VF 1PL8A 5K0GA 1WDLA 4YI5A 1GUZA 2OCLA 4OUDA 4LGMA 1X6VA 2OFFA 2OZPA 5F73A 4BASA 1LX7A 1Q7EA 3E7XA 1U7WA 4J0DA 4C1NA 2WZQA 1HE1C 4KMRA 2F59A 4W1RA 2NV6A 2XH8A 2QIPA 3HO8A 3M70A 3QMVA 4L3VA 3ZQKA 4DCSA 4DV7B 2Y99A 3LQYA 2AA3A 2R86A 4PLGA 3ROGA 3TTYA 1LZKA 2YVLA 5KQLA 4KKXB 4XJVA 3KELA 2HRZA 4Y0NA 1M66A 4BOYA 1D1SA 4I50F 1AS3A 1N4DA 1UBGA 3I5XA 3IDSA 3ZU4A 4J7AA 5EJEA 3PA8A 3GFPA 3ZS8A 2PYDA 4YT8A 2QJWA 3U4AA 1SPBS 4RJ2A 1XB2A 4L4SA 2XQKA 4G8JA 4XPZA 2RGAA 4LZOA 2O3QA 5U4XA 5AW7A 4ZQFA 3D6TB 3RJ9A 1Z8FA 4X9XA 5MF6A 1TM2A 1HDOA 3TQFA 1UK9A 5IM4F 4I9NA 1ZESA 3DYIA 2WWIA 3HFRA 1BWQA 1EGMB 1KEEB 4HNHA 5KPDA 1KK3A 2I1LA 4W8OA 4XD7A 3TW8B 4HVLA 2RGEA 1N7JA 4WZBA 2QPOA 1ZN9A 1PEKE 1XTPA 2I33A 3BB1A 3DDWA 1XZMA 3FETA 4FEEA 3ZCRA 2RGUA 3KZXA 2XMPA 2CT8A 4D26A 2C0QA 1UIMA 2GEKA 1Z2EA 1Y8QA 1H2EA 2Q0SA 3EA5A 1VZ3A 4FXOA 4GP9A 4PFKA 1EVLA 3IR6A 4JT8A 2XZPA 1C3OA 1KJYA 5BURA 5LB4A 2A58A 5BUSA 1CUUA 1DWOA 2Q1XA 3QKSB 1XR3A 2L2QA 4Q00A 2HHLA 1SCKA 4UBKA 4MVJP 1JBEA 3LKBA 5EPUA 3T9BA 1HYGA 4RK1A 3QF7A 4B4WA 2C1XA 5AQEA 1JKMA 2J32A 1U3UA 5TRTA 4AJHA 2QSZA 4YC7A 1AF7A 1KBQA 2WKWA 2Y1KA 2WNSA 4MVCA 4C5BA 1BYUA 4GXNA 2FWBA 2QZ4A 2CEAA 1S2DA 4V0OA 4KC0A 4I36A 5D1NA 1PYDA 4U9IS 1XEXB 3HUUA 4Z4QA 1A8HA 3GLIB 1VFNA 2N75A 1AB5A 1DRWA 1I2ZA 1FYDA 1VGQA 3VR3A 2CCJA 2W5UA 3ET5A 4BP8A 1E7SA 2OQ2A 4A10A 4V3CA 3WIEA 3ZZ1A 3D3WB 5JJLA 5BN3A 3QBDA 2AJ8A 5EWMB 3OCWA 4CEHA 4LI3X 4LX8A 5C2JB 2ZI9A 1SQ6A 3RGWS 4BX3A 3GY0A 1OWNA 1P4GA 2QZJA 4L1KA 3R4CA 1Z45A 2ZCJA 3C5VA 3E9RA 3G5LA 5IK2A 1GA6A 1MG0A 2JI6A 2IRWA 3KXLA 4KB5A 2BEJA 2HGSA 3PDHA 3PFBA 3V2HA 3ZHOA 5IF3A 4GGMX 3W9BA 4RADA 4LOJA 2DQKA 2OENG 1A04A 1L7QA 2HTFA 3EJ6A 3TTXA 3R7DA 1PYOA 1H2YA 1ENOA 4EKDA 5GGXA 2CFIA 3HYCA 3TZEA 3CLRC 4ZJUA 2V7VA 1RWNA 2XY4A 5BRNA 3THXB 1AKQA 3EBLA 3C3EA 3X1XA 3QUSA 5J3JA 2CCGA 3JQBC 3SC2A 5EI5A 2GBGA 1AGPA 1B0ZA 4XZ3A 2JD2A 1CFJA 4LJ6A 5I7EA 3E3NA 4L7QA 4RK4A 1ZRNA 1VCMA 2YS7A 3OUTA 2GZAA 2IYNA 3M1AA 1K2WA 3AOEC 4G86A 1ZMTA 2QRNA 2ZEJA 2FF7A 3EZGA 4K9PA 4DCUA 5K0TA 3CRNA 5HZKA 3HXPA 4PTLA 3TR5A 2Z83A 4RY9A 1OXTA 1UBLS 3A06A 4OMUA 4EZEA 3R76A 3H5TA 1DEHA 3KRTA 1P9NA 4FHDA 2CUKA 4FZ5A 5DW0A 4BO8A 2C54A 1OAAA 2HNKA 5BSRA 2NSJA 1DTWB 1WIWA 4CM8A 1KQOA 2C7RA 2GK3A 1E2GA 2JEZA 5K0LA 4R1TA 4B6PA 4C87A 6NULA 1FW6A 5JS1A 4TZ0A 1L1QA 2YXPX 1C9DB 2GA9A 2AMYA 3W1VA 4PEVA 1WX1A 5ALQA 1NRWA 2ZLBA 2QRLA 5JCJD 3N76A 4RZUA 4HDRB 1T2NA 1BZYA 1W4AA 2F00A 2O7VA 3JD4A 3MQ4A 4RSGA 4XGKA 5JH7F 3IJEB 5JFOA 3E9MA 4EABA 1QQBA 4D9EA 2VQ6A 2NUAB 2BRUC 3FM9A 2G1KA 3I92A 4D5GA 2E5FA 2VDRB 2XAUA 3HB9A 3UF0A 3U60B 3IPCA 5A0TA 1H05A 4EG5A 2WWHA 3ZHQA 4P4NA 2JANA 3T5TA 5CCXA 4CU5A 1WKVA 5F3DA 1Z47A 3L46A 1POWA 5TB5A 4C21A 2XTAA 4MWSA 4CL8A 1RJGA 3I2HA 2IF0A 1XDDA 4HAZA 2IXFA 2CHGA 5ED0A 4ZALA 4AECA 3IVGA 5EHGA 4FFSA 4GICA 4B3CA 7AT1A 3LC1O 3BN3A 2CCKA 4TTPA 4G1CA 5LMUB 1E7MA 4NV3A 3SQNA 1KS9A 1LWOA 4OL9A 4Z0TA 4ITVA 4BJ6A 4UNSA 4QARA 3EFOA 1U6JA 2ZBGA 3KFXA 2Z6VA 3EBOA 4HDKA 2HPHA 4FILA 3R7AA 3NTUA 3GCGA 3W1EA 4PYRA 4DDKA 3EB9A 1U3DA 2QAJA 1G4HA 1NKSA 4BO6A 1WUJS 2IOHA 2ZUEA 5EA2A 1NPYA 2JJ2D 5E6SA 4ARUA 3WGUA 2ET6A 3QXCA 1SUSA 3MWFA 3WE7A 5JAMA 1ADJA 1KTIA 1DHRA 1S2GA 3BXXA 3AVUA 4CKBB 2PUBA 1JFRA 3KKPA 4EECA 4UREA 3ZW9A 1T0UA 5B58C 3ZIAA 3LXMA 3QX8A 4OAOA 3K1ZA 3RU9A 5IPFA 3H8JA 3Q9NA 4JODA 5FUXA 2C2OA 3CF4A 4U2DA 1SVKA 1N8SA 2Q5FA 1A71A 2V6BA 3DHNA 1QK5A 3BTUA 1RPTA 4L85A 4ZVNA 4XJTA 5JZVA 2AHOA 3LBHA 3O95A 3HYLA 2O48X 4OXXA 4LRQA 3PD0A 4QXRA 3LC7O 3IPXA 3ZXIA 4EO7A 4LHYA 1OHHA 1EHCA 1TZCA 5AJYA 2NU8B 3PHBE 3A8TA 4WLVA 4C7XA 3OTOB 3MGBA 1CJBA 3UBTA 2IYOA 5CDTA 4HN2A 4WWHA 5HDQA 1BVUA 1W8IA 4ZK2A 4HQKA 3KAQA 3IO5A 3GCDA 1R9NA 3B89A 3MUEA 1VCNA 1CQIB 3QVKA 2QN2A 2RHMA 4PBTA 1Z6GA 2UUPA 1VI6A 1QDEA 5DP1A 2EX1A 4YCBA 4F8YA 3PCTA 1NIPA 1RC0A 2C8KA 2F62A 4LG1A 1FYEA 4YY3B 3DF7A 1MGPA 4LK2A 1E0DA 1U0SY 2ANCA 2CUNA 3NDRA 1TZJA 3ND9A 4YQEA 4A1FA 3QKRB 3MJTA 4HNTA 1D04A 4V0SA 2QLBA 1HEUA 1KKUA 4LOKA 4M1QA 5AJUA 3ZDRA 3WMEA 5AESA 2QW0X 1VP3A 5DHUA 4UARA 1ZUNA 5ALUA 2HDWA 3ZCUA 4RH0A 3GGPA 5LZ5A 2WJAA 1NXQA 2ZKIA 2DBRA 4UJ5A 3QUQA 1JNXX 2DHCA 2VAMA 4H1VA 3SI7A 4DKXA 3LXRA 4I5EA 1JW9B 4FHCA 1EK2A 2V6IA 3MTQA 2B6HA 4IJMA 4JFAA 4B0PA 1L8QA 2NT3A 2C5AA 3AL2A 4TV9B 2AKEA 1DC4A 1KFKB 3PNBA 2WTAA 2VLIA 3Q6IA 4CR8A 3ETGA 5HK9A 2XIJA 3CIOA 2O2SA 4F06A 3GLVA 4WN9B 3D8SA 1Z3IX 4K9DA 4IIYA 2PGJA 3T7CA 4TYMA 2Q3CA 4R1QA 4NCAA 1NOIA 2YXLA 2PKXA 2XBUA 3UK2A 2C5SA 1CB7A 1JI3A 1CUCA 2OAQ1 4X7PA 3TO5A 1O9HA 2RGWA 3UMVA 2GN9A 1IN5A 3JQCA 3P4YA 5B4VA 3MAAC 1VSTA 1XAIA 1RYMA 2Q9CA 3E7PA 3JYQA 4Q9AA 4DQKA 4CIAA 2QSYA 2QUBA 3FOCA 1VG9B 4PCAA 2GBFA 4CEIB 1JZTA 3F4LA 1YS7A 1I7PA 4R1UA 4YNBA 1N2ZA 2RONA 3SSMA 1PSZA 3WYDA 5C8DA 5JCPA 2C20A 4L5YA 4C0WA 3U37A 2HCFA 1C3JA 1VLLA 2Z6QA 3HBAA 4FBMA 4YRQA 3ZNOA 2LZ0A 4CFYA 1JPJA 1N5JA 2RMKA 1WAMA 2C98A 3PICA 4FCVA 3HBNA 2TRSB 4GX0A 3H1EA 1WVMA 2GEDA 1CS4C 4WDQA 4C4TA 4HP8A 4TL6A 1K6IA 4E3WA 1FUYB 1NUTA 1NF9A 3H99A 4N39A 3SHOA 1ZR2A 2A88A 4U7JA 5BRJA 4RTMA 1HF3A 2GMWA 4K05A 4D4JA 4JB3A 4UUBA 4WOBA 1MB2A 4YRIA 2B69A 3MFQA 2BEVA 3V4PB 1D9ZA 1K4KA 2WJ3A 3WWEA 1X0XA 4AY2A 2B5WA 2QGZA 3IKJA 3UGTA 4A73A 4CV2A 3S1SA 1IXZA 1NNI1 2XGJA 5JI2E 1I33A 1QDUA 1MENA 1KMCA 1U8YA 1MX1A 4G0MA 1MJ5A 1FNNA 1K8RA 1PG0A 1T1SA 1YZTA 2JBHA 3OZIA 4QEZA 3TEMA 4Z2YA 4CCWA 4ZCIA 1GTL1 3KAPA 3PLRA 4KLCA 1VQ1A 1Z0ZA 3MG9A 4MS4A 1SULA 4YJ3B 3ME5A 4TZKA 4ZQGA 3ZVLA 4HR7A 1MJFA 1QQAA 4IWXA 5DTQA 3FIUA 2FR8A 4JJFA 3VKVA 3SYKA 1IONA 5EEGA 2EIXA 4MLZA 3A26A 5TPZA 1IH8A 1NZJA 2BBOA 3HGMA 1X19A 2Q5HA 3OQIA 1KY4A 4LK3A