5LKAA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
301
structure length
301
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a de novo transport tunnel.
doi rcsb
source organism Sphingobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 115
structure length 301
sequence length 301
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lkaA00
2XUGA 1MNAA 4F21A 2H7CA 1XQWA 1E89A 4UPDA 5DYTA 2OPHA 1ORWA 3GELA 3DQZA 2C7BA 4PW0A 4BE4A 4F60A 3E3AA 3I6MA 1XZBA 3G0CA 4L72A 3VJMA 1VZ2A 1ZD4A 3O0DA 1TIBA 5CT8A 1XLUA 3CN9A 4KE7A 4ITVA 3HLKA 2V9ZA 4OD0A 5ALJA 1GPLA 4F5ZA 5T4BA 2XUHA 4DM7A 2WIJA 4DMCA 4W1RA 4C4ZA 1PFQA 1VOTA 3FAKA 1E8NA 1C7IA 2PSHA 1IZ8A 2XUDA 4CG1A 1MNQA 1ZD3A 4I19A 3AUKA 3IUQA 2HFKA 3DOIA 5C8VA 3G9TA 2JGLA 2PUJA 5HK8A 2XQIA 4C87A 3QITA 2ZYIA 4CI9A 2CBGA 2FJPA 1LPMA 4FTWA 2OGSA 5AM1A 3WYNA 4FKBA 2Y6UA 1UWCA 1E8MA 4LXHA 4EBBA 3WWPA 4Y2YA 3EIOA 5HKAA 3D2AA 4G8BA 2ECFA 5CMLA 5J3JA 4K6HA 1AMNA 3WK8A 4Y2JA 3QM1A 3HYSA 4B0PA 4GI1A 3VISA 3UUFA 3PDCA 3DOHA 1CRLA 3BIWA 2QKYA 1QIHA 1U65A 2Z3ZA 4KE9A 3ED1A 3STXA 5AKZA 1K8QA 4Q3LA 3UMJA 4QDOA 4CFSA 5E4YA 2ZJ7A 3H1AA 5ALFA 2ONCA 1XRMA 3C5VA 2ZJ6A 1XZGA 1QIGA 4BZZA 1C4XA 4C4YA 4AZ0A 5LP1A 4UBNA 3HZOA 1H2WA 1VLQA 2RHTA 1ZJ4A 2O7RA 2XUQA 3ICWA 4C89A 4Z49A 4BP8A 2I78A 3V1KA 4AZ3A 2XE4A 1XRRA 1BS9A 3WKCA 3JYHA 4KR0A 5AM2A 4PV7A 5LZ7A 3G0IA 3FSGD 3MVEA 2PM8A 4U2GA 5AI8A 3LIPA 4LXGA 4X93A 4F0JA 4A23A 4X92A 3O9VA 4K6KA 2VJBA 3HRHA 4D9JA 1GQSA 1VJ5A 3R41A 5AO9A 4J3JA 2W22A 5EHNA 3BDIA 1QONA 5BV7A 1ACJA 2FX5A 4MYSA 1QE3A 4MQLA 3I2IA 4G4GA 4YK7A 3W06A 2WJ6A 3DD5A 3HI4A 3H2KA 3WK5A 1O6FA 2WLSA 1ZD5A 1CUZA 1CQWA 1XRLA 2I3ZA 2HA4A 4Q1VA 1YSCA 2V98A 4FLEA 4DLNA 3B3QA 5CT4A 1NU6A 2ZSHA 3QPAA 3C6BA 3T52A 4ZWNA 3V1NA 5ALWA 1QFMA 1XKTA 2WTNA 1R88A 2HHAA 2VT7A 3DYIA 5DTIA 4UFNA 4RPCA 1WM1A 3NOXA 2XMZA 5DYWA 3FYUC 1CFJA 2WUEA 5AOAA 4KRXA 3I6YA 4W1PA 4E14A 4AN1A 4ETWA 5JIBA 4H7DA 1QO7A 3O4JA 1CQZA 5HF6A 2HIHA 5ALVA 1AUOA 4H7JA 1EK1A 3H2IA 1G5FA 3O4GA 2D5LA 3R3ZA 3AZQA 5K3CA 4MEBA 2R11A 3HEAA 1BEEA 4YX9A 3HC7A 1G4HA 1WPXA 2GZSA 3H18A 4BVLA 1BROA 1TCAA 4FWBA 4OSEA 1LPBB 3ICVA 4O08A 3STYA 3VVMA 3EQ9A 5JAHA 4DMHA 1EK2A 5ISMA 5HZGA 2BUCA 1QTRA 5JAUA 3F67A 1M33A 4OB8A 1N1MA 1TCBA 2HA0A 3RK4A 5A6VA 1JJBA 3WKEA 3DDUA 2QUAA 4FHZA 3KD2A 4IH1A 4RE5A 3WK6A 1WPRA 5CT5A 1K6EA 5AKGA 5LYYA 1X70A 4BBZA 1J06A 2OGTA 1HLGA 1F8UA 1XQXA 4GDMA 4IH9A 1BCRA 2XMBA 5AM4A 1EDDA 1IMJA 3H04A 5LZ2A 1SCIA 1QIEA 2DSNA 1L7RA 3WLAA 5AM5A 2AJCA 5FRDA 3UUEA 4AXBA 3H2HA 4HXGA 3C6ZA 3H1BA 3CXUA 4X71A 4BE9A 2OXEA 4IH4A 3W2TA 2GBCA 5FUMA 2VF2A 3CCBA 5LKAA 3A70A 1H2ZA 1W6RA 3FOBA 1F6WA 4KYVA 5HQ3A 1R50A 5ALLA 3TGLA 5E2IA 2HU7A 4AMZA 3Q8WA 4JNCA 5JASA 4N5HX 2PSDA 3A6ZA 3IULA 4J0DA 2VTVA 4CIBA 5JD6A 5JADA 2WUGA 1EVQA 3D3NA 2JBWA 3L1JA 3AFIA 4IO0A 4W1QA 4DYHA 4FFVA 2OCKA 1YB7A 3N0TA 3VXKA 2WIKA 5DNVA 1AGYA 3FVRA 3A2LA 3MGAA 4BCDA 3HJUA 4AX4A 4ZGBA 2VAVA 2PKYX 3G0DA 4H7KA 4X6XA 1UT6A 5AM0A 2JEZA 1GQRA 3C43A 4U2FA 3FYUB 2WJ3A 1AZWA 1Y37A 4QDTA 4UHHA 1BN6A 1YR2A 3BF7A 4IQ4A 3TRDA 4MEAA 1DU4A 3KDAA 1UK6A 1W76A 2DR0A 2PX6A 5CH3A 5AKJA 4WCVA 5SYMA 4A5SA 3BF8A 4XVCA 3WIBA 4DNOA 2G5TA 5AI4A 5K3FB 3WL5A 1JMKC 1UKAA 1TQHA 2Y2UA 1AKNA 3F8SA 1GPNA 4Y2RA 1VE6A 3G8YA 2UZ0A 3F96A 3SK0A 3K2IA 2QT9A 4X3CA 3OG9A 4B83A 5T4HA 4H18A 1XRNA 4W63A 4J0CA 4EB0A 4C6HA 5ALYA 2BJHA 1CUXA 4PF1A 1TK3A 2B20A 4FDMA 2QXUA 1CUUA 2C5GA 1WB5A 2WG0A 3WQHA 4QNNA 4FLFA 3W04A 1UOOA 1DT5A 1LZLA 3R3UA 1MT3A 3HACA 1CUVA 3TEJA 2ZYHA 3E1GA 1XZAA 5AJHA 2HDWA 3FWHA 1NU8A 5AIAA 1DTEA 3FLAA 2W6CX 1UOPA 1YCDA 1FFBA 2ZSIA 1OXMA 1XZCA 2WKWA 1MX9A 4WDQA 1QIFA 4BAZA 4X91A 4RNCA 4FBMA 4ZREA 1CEXA 2BKLA 2QR5A 1LZKA 5KBYA 4HZGA 5JD5A 4C4XA 4JH0A 5AK6A 1T4MA 2ZYSA 2CJPA 4EUSA 4MWTA 4OU4A 4KAFA 1EXWA 4PSUA 4HXFB 7YASA 4W9RA 5BWCA 5FP0A 5JZSA 2IX9A 3I1YA 1A8QA 1YASA 2D0DA 2WSLA 3WWEA 2Y2VA 4L9AA 1LPSA 3H2JA 3F98A 3M3DA 4BC0A 1HQDA 3C5WP 1E8DA 2HA7A 3FSGA 2VQ6A 3QBJA 4Y2UA 4E46A 2BFNA 4BAUA 3DEAA 3TJMA 3K9BA 4CG2A 2ZJFA 3WA7A 2WM2A 1YA8A 5AKKA 3I2FA 5C81A 1IVYA 3PUHA 2WUFA 1F0PA 2ZVDA 1VXOA 1CUHA 3BE8A 3VKFA 2AXEA 3ZLTA 5JATA 3WKBA 3WWCA 4OPMA 1ZOIA 3WA6A 3DNMA 4J7AA 3T4UA 4QDZA 4ROTA 1JU3A 1TAHA 2JGKA 3WKAA 4BTLA 4HAIA 4P9NA 3GROA 2Y6VA 1J2EA 4B80A 1ZD2P 3VVLA 2ZYRA 4I4CA 2P8SA 5ALOA 3LS2A 4AB1A 1Y7IA 3QVMA 2C58A 1H2YA 2X76A 1ACLA 2WFMA 4KACA 1ZGBA 2QRUA 4HTAA 4KAJA 3STVA 1QO9A 2WJ4A 5CT9A 6YASA 2PSJA 2QTBA 4BYMA 4M0EA 3FBWA 5A7FA 2RAUA 4HXEB 4B84A 3BL8A 2B4KA 2JEYA 2HU5A 2PPLA 3G0BA 5CURA 3B5EA 4TPKA 1CUJA 1I6WA 5FLKA 4NVRA 4LHEA 1QIMA 2AJ8A 2BUAA 1SCKA 1T2NA 3AIOA 2GBGA 4DMFA 3IURA 5I7UA 1R1DA 3I6ZA 3SWWA 3HSSA 2ORYA 2DFPA 4FNGA 4GLBA 1C7JA 1EHYA 3D2CA 5AKXA 2PU7A 3PICA 2QS9A 4XX1A 3H0CA 3ESBA 3ZWQA 2NW6A 5ALMA 2BUBA 2VT6A 3PE6A 3PI6A 1ODTC 2ROQA 4B85A 3D5EA 4S0XA 1YAJA 3QZUA 2WTMA 2AJBA 3IBTA 5K3BA 2OCLA 5AKIA 4G8DA 1ORVA 2VAXA 1W52X 2OG1A 2RI6A 4QWMA 4QE3A 2H7YA 5JZ9A 1PV1A 4Q05A 2QZPA 2LIPA 1QJ4A 1EI9A 1YS1X 1A8UA 3WL6A 5EIAA 4CCYA 1XZLA 2YYSA 4Q3OA 5EHXA 2XUAA 1CUGA 1RP1A 3QPDA 2YASA 4Q3KA 1ZI8A 3R0VA 5C7YA 3O95A 1HL7A 5HQ3B 1ZI6A 4CG3A 4OB7A 4J0HA 1MN6A 4QLOA 5ALSA 2E3JA 3RARA 3R3WA 1U2EA 1EH5A 4H7HA 2WFZA 3GZJA 4DNPA 5AK3A 1ZGCA 1A8SA 3B12A 4E11A 4RGYA 2QVBA 5AKYA 2GYUA 3DJYA 1Z68A 4L3WA 1CLEA 3YASA 2RGUA 4B9EA 1DX4A 5EFZA 5JANA 4N8SA 3D4LA 3GA7A 1ZIYA 4QLAA 4FMPA 1P0PA 3G7NA 4BCBA 1VKHA 1ZIXA 5K3AA 2OGZA 1XZDA 2GYWA 1R3DA 4PNZA 1U8EA 3FYUA 3GFFA 4JUIA 2XI4A 1GXSA 3AINA 4XWGA 4Y2SA 2XQGA 5HF9A 2QJWA 3LIIA 5CRIA 4B9AA 5DLPA 1EVEA 4M0MA 4M0FA 1JJFA 4FFWA 3ANTA 2CEKA 4TVKA 1CUWA 4YASA 2X5XA 1QZ3A 4AO8A 2Z3WA 1AURA 3OOSA 4OB6A 5ALEA 5K3FA 1HPLA 5CXXA 5HCUA 3AIKA 3BIXA 1G66A 1JU4A 5JYCA 4OCZA 1XRPA 2OAGA 1HBJA 2GZRA 2I3DA 1LNSA 3WJ1A 1A88A 4G4JA 4KEAA 3DL7A 5LZ5A 5KWJA 3QPCA 5AM3A 1UK8A 4KE6A 1E5TA 1FJ2A 1CR6A 1LPNA 2JGEA 4G9GA 4IHAA 5AI5A 2ACKA 5A71A 5AKHA 5DYYA 1GPKA 3AJAA 3O4IA 1QTIA 2QXTA 5AKLA 3QMVA 3I2HA 5F4ZA 1GZ7A 3HXKA 1WCYA 4EY8A 4BVKA 1GGVA 1CUCA 2VEOA 4N8EA 5A2GA 3Q0TA 4EHBA 5D6OA 1PJAA 4UHEA 5D7BA 3GBSA 1MO2A 3G02A 1LPPA 5EGNA 2K2QB 2WHPB 4WFJA 2B9VA 1H2XA 2OCIA 1DINA 1UXOA 4OU5A 3RM3A 2QUBA 1W1IA 4UFPA 3H2GA 5LKRA 5BWBA 1DWQA 2PSEA 3F97A 4KAAA 2C4HA 3DCNA 4KRYA 2DQYA 3STTA 4DGQA 2XMSA 5ALNA 3FVTA 5AOCA 3PFBA 3C8DA 4Q82A 5H3HA 4LYEA 4J03A 4UHCA 5T4EA 3FCXA 2WFLA 5HFAA 4X85A 1KEZA 3CCCA 2XUFA 2RIPA 3WJ2A 1OCEA 4QDUA 2XUKA 4C01A 5JAOA 4B6GA 4OYLA 5AK5A 4QZVA 3C45A 4WY5A 2WHRA 1JMYA 4U2BA 2IITA 4AO7A 2HADA 2VSQA 3S2ZA 3BDVA 3WK7A 1S8OA 3D2BA 2XDWA 2EDAA 2XMRA 5CH5A 1XQVA 4ZRDA 2I03A 4EA6A 3DKKA 3ANSA 3C87A 1UOQA 4LIPD 3U0VA 4LXIA 2XLCA 5I8PA 3STWA 3IB3A 4J0IA 1WB6A 5LZ8A 4NMWA 3BXPA 3LLCA 4K2AA 1LBSA 2CUTA 1ZJ5A 1VXRA 4NS4A 1K63A 1RWQA 4BZWA 5ALXA 1EDBA 2B61A 5CTAA 4UBMA 2RHWA 1QIDA 2JGFA 3PFCA 1UFOA 1MAAA 4MXDA 3R3YA 5ALTA 4UHFA 2J3DA 4OUKX 4L0CA 3WK9A 1MU0A 3QMWA 2XUOA 4ZXFA 5AHXA 4DNFA 3VDXA 1ODSA 4Y9SA 1QIIA 3KOOA 3MUOA 2WIGA 4BRZA 2VJAA 3QYJA 1U4NA 2DHDA 1B6GA 5FOQA 4X6UA 2BAGA 2DQZA 1WHTA 2QMQA 5D3KA 3SC2A 4WFIA 1P0QA 2CZQA 3V1LA 3I1IA 4HRYA 4QDXA 4XJVA 4UBIA 3W9UA 1CUEA 5DWDA 4X97A 4H7IA 3AZPA 2XT0A 5CW2A 3HABA 3OM8A 4A16A 4B81A 5HFNA 3EQ7A 2G5PA 4X00A 5IKXA 4B7ZA 2ES4A 5ALKA 2RONA 5JAPA 1EB9A 5T4FA 2XUJA 4W1SA 1AC5A 5ALHA 1JT2A 1ZICA 1XRQA 3W05A 3I2JA 5HF5A 2Q0XA 3G9XA 3R40A 3G9UA 1LLFA 4G4IA 5LZ9A 1HDEA 4PQEA 5SYNA 1FFEA 4UHBA 1P0MA 4J0GA 3ZV7A 4Q34A 4BATA 2XUIA 4H35A 2Z5GA 3ZLUA 5IVDA 4RE6A 3C6XA 3WYDA 1L7AA 1K4YA 5HK9A 5I9IA 2HRRA 2HM7A 3WL7A 3IVMA 2XMCA 2XMDA 2XMGA 4P08A 4U2DA 2HA5A 4WDRA 5FDFA 2JIDA 5AI0A 2JGIA 3ZI7A 4GW3A 1P0IA 4Y2TA 1VA4A 2PBLA 5IVHA 5AOBA 3L1IA 1UZAA 2GYVA 2DCMA 4FBLA 4X94A 4MQMA 4BDTA 4CCYB 3OC0A 2WIFA 5KREA 2H1IA 4UBOA 1XZMA 2C5FA 2HU8A 4DNQA 2VJCA 5LLSA 1JI3A 5A7GA 2FJ0A 5CBKA 2WU4A 3NGMA 4PSCA 1KU0A 5EHQA 4I3FA 2XQJA 2WHQA 5JARA 4BCCA 4BVJA 4QWWA 5AICA 1VA5A 5YASA 1CVLA 5A7HA 4ZV7A 4BAGA 3V48A 4LKOA 1XZJA 3BJRA 1MTZA 2WQZA 4HS9A 5C8ZA 4X95A 4J0JA 5ALIA 5E4TA 3S8YA 3WMRA 1E3QA 1G42A 3C70A 1D07A 3PF8A 3U1TA 5AKEA 4DTCA 2OQIA 1ETHA 4H7EA 5JZBA 3AZOA 3VJLA 5EI5A 3M82A 4X90A 5ESRA 5EHZA 5C8XA 3DYVA 4PSDA 4EY4A 4UFOA 3FLEA 5FPPA 1NX9A 4BP9A 3DKRA 5FV4A 4H7FA 1FSSA 1UK7A 4H0CA 3VJKA 2GBFA 5ALZA 1BN7A 1J07A 1R4ZA 1F0NA 5LZ4A 4GWLA 2HFJA 1EINA 3F9CA 1CUIA 3H19A 1YA4A 4EY5A 1MX5A 2XQKA 4GECA 1AX9A 3WK4A 1EDEA 3ESCA 5D3ZA 3MUNA 5ALPA 1W75A 2XB6A 5ALUA 3LP5A 4MWSA 3WIOA 3DL4A 1QIJA 2YXPX 5LIPA 4J0KA 4TGLA 1FFAA 1JFRA 3WL8A 1UK9A 2QOEA 5AP9A 3OTQA 4ARBA 1GKKA 2DHCA 4AMYA 1JKMA 1TCCA 4G5XA 1XZIA 4BC1A 2AJDA 1E66A 1XLWA 3V1MA 2XUPA 3D7RA 3IUNA 2PU5A 3I2KA 4UBJA 2OLEA 3WWDA 2GBIA 4WFKA 1XKLA 2PL5A 1SCQA 1KU6A 4N5IX 4GHWA 4LYDA 2JGMA 2JGJA 4JEIA 5FKJA 1W4LA 3OPMA 5E4JA 2CKMA 4WY8A 4FNMA 1A7UA 2C0QA 1ISPA 1DWPA 2O2IA 3KWFA 3KXPA 4BRSA 2QM0A 2EEPA 5A62A 1EX9A 3FYTA 1MX1A 5EIEA 4X6YA 2WHPA 3H17A 4AQDA 3RKSA 4V2IA 2JF0A 4MYDA 5AI6A 5CXUA 3IUMA 4GXNA 3D0KA 3O9MA 4JYMA 5FPQA 1VZ3A 3WZLA 4DSZA 2FUKA 3KWJA 1DWOA 1VE7A 1N8SA 1QGED 2CMFA 3I28A 1IUNA 4EY7A 3M83A 3FLBA 3AIMA 1LPOA 2OAEA 5JALA 2EDCA 1Q84A 1DQZA 3EQ8A 3STUA 1LPAB 3ILSA 4GBGA 1YAHA 5AK4A 3C6YA 2WFLB 3QH4A 1O6GA 2WG1A 4MJ3A 5EIHA 1HKHA 4FLMA 1CUSA 1QOZA 1H22A 3X3HA 2QJRA 5AI9A 5DJ5A 1IUPA 5FXMA 2VATA 5BOVA 4G9EA 4YPVA 1B41A 2BGRA 3NUZA 3DLTA 1QFSA 5K5EA 2HRQA 1EB8A 4JYPA 2CB9A 2PVSA 4H77A 3FNBA 4UHDA 3WI7A 2Y1KA 4DSAA 1J1IA 1ZI9A 1BRTA 2O2HA 1GT6A 4UUQA 3K6KA 5JD4A 5HKBA 1UKBA 3ESDA 3G0GA 3L1HA 1OILA 3N2ZB 3P2MA 2BGNA 1QLWA 1THGA 4ZI5A 3EF3A 2HA2A 2C0PA 3ZLVA 4ARAA 1XFDA 2VJDA 2WIDA 1THTA 2HA3A 1XZFA 2WG2A 4P92A 4B82A 1TKRA 5CT6A 1UKCA 1N5RA 2DHEA 3CN7A 4E15A 2IIVA 1BU8A 2Z8XA 1ODCA 4UBLA 3E4DA 1FFDA 1XLVA 4XIIA 3WKDA 5ALGA 5AIBA 4HVTA 1SFRA 4EZIA 1USWA 1MJ5A 5IVIA 3IUJA 4GEGA 4G1FA 2AJLI 1YS2X 3ESAA 3EBLA 1WOMA 4K5QA 4Y2PA 1Q0ZA 1L7QA 1R9MA 5DNUA 1CIJA 5K3EA 5KWIA 3JWEA 1CUDA 2HA6A 1LGYA 1JJIA 5HF8A 1CUYA 1BE0A 2O7VA 4G8CA 5ALDA 2V97A 2HL6A 5IVKA 4FOLA 1XQYA 3BWXA 4U2CA 1SOMA 2OQVA 2J3QA 5K3DA 1GKLA 1R9NA 4B0OA 4BTVA 1YB6A 3I2GA 4OYYA 2PSFA 2X8BA 1DQYA 3IA2A 3JW8A 3RLIA 2ACEA 2G4LA 3WZMA 1XZEA 1IUOA 2R8BA 3M81A 3PUIA 4Y2VA 2G63A 1LBTA 4KJXA 2VA9A 3NWOA 3GUUA 1DT3A 4P93A 3E0XA 1XROA 5ALQA 1DX6A 1N5MA 4UBKA 2XQFA 4Y2XA 3IIIA 3PF9A 1Q83A 1XZKA 3W9BA 3A2NA 5AH0A 4BB0A 1MPXA 3R3VA 1QIKA 1EA5A 1Q0RA 4X7BA 3QMMA 1RYYA 1Y7HA 1IZ7A 1CUFA 4ZV9A 3BJMA 1CV2A 4DIUA 4QA9A 1WB4A 1WHSA 3SX4A 4QEKA 2XMQA 3A2MA 5ALRA 2BCEA 2OCGA 1AQLA 4INZA 3ZPXA 4AO6A 1CUBA 2O2GA 3WWOA 5CH8A 4U2EA 3FCYA 4Y7DA 2V96A 3R3XA 3DS8A 4CCWA 4HRXA 1MAHA 3V9AA 5DTJA 2J4CA 4AN0A 2WILA 2PUHA 1X2EA 3LCRA 4CIAA 4PO3X 3O4HA 1CPYA 1CUAA 1H23A 1SC9A 1X2BA 4NZZA 1XZHA 1K5PA 1BCSA 3OURA 2H9YA 3G9ZA 3C8HA 1BEZA 4N8DA 3IDAA 2H7XA 2WU3A 3KSRA 4C88A 1FFCA 2J4FA 2YH2A 5IH7A 2XLBA 1TRHA 5DNWA 4KE8A 4K6GA 4DMKA 3AILA 4BDSA 4EY6A 2Z8ZA 4Y2QA 4WJLA 3D59A 2WUDA
chains in the Genus database with same CATH superfamily
4L4ZA 5AHKA 3HDHA 4IL5A 4U63A 1FZQA 4G23A 2XNKA 1HG1A 4IDBA 2H7CA 3UGQA 3M6FA 4WY2A 2HRCA 1E89A 3FRHA 1N9KA 4UPDA 3ZHBA 4B7CA 2AG1A 2YHAA 3OZXA 5DYTA 2OFFA 2I4NA 1MDFA 1Z6QA 2V7QA 1FNBA 1ORWA 2GK4A 3GELA 3PGKA 3G23A 3KQOA 1PEYA 1VPDA 3IQEA 3IILA 5EWLA 1IY0A 1WMBA 3FHTA 3GH3A 3RYFA 1C5KA 1A8IA 3ANYB 4FGWA 3C85A 4DCOA 3FCSB 4BE4A 4ETNA 2F1IA 5FWYB 2JB9A 1XZBA 4INPA 4ZO6A 4QEDA 5KYYA 2QSYA 1UDXA 2P27A 2EFCB 4L72A 5EHIA 3SVLA 4W9MC 2QBYA 1KI7A 5F9HA 4FI3C 3X1YA 4CV2A 1ZD4A 2WAYA 3O0DA 4OBBA 1H2EA 1Z83A 3WB2A 5EIWA 1ZMOA 3C6MA 4K03A 9MHTA 2VP5A 1HEIA 3AESA 3QKRB 4XFDA 1KTVA 1SKAA 4IDCA 4ZJYA 5CX1A 3SGLA 3CN9A 5JSQA 5K8CA 3AFOA 1M9NA 2YWBA 1DQPA 3OE7A 5CM9C 4CM4A 1TJNA 2Z4RA 5CITA 5D7NA 3D7KA 1VPVA 1EJ2A 2ID8A 3ONDA 3DZHA 3PG5A 4H3HB 5SY4A 4LFAB 4JI3B 3RVJA 3CZCA 2XBMA 4EO9A 3OKCA 4A0HA 5EMMA 2YW9A 5LBTA 1RYHA 4U0JA 5IK2D 4G4SP 4A0FA 5ALJA 4ICIA 4NMLA 1PR4A 2J0QA 5T4BA 3DMFA 2FEWB 4XLZA 1E9DA 2IHTA 2OZVA 2R8PA 2GI4A 4JP5A 2QT1A 3RBXA 1Q74A 3ITKA 3ZYZA 1I2BA 4B3DA 3GGCA 2WTXA 3VKWA 5E8RA 4LF6B 2CWDA 3LUCA 3NUGA 4FMDB 4EHIA 1QS0B 3LWBA 1KZGB 1P2VA 1PFQA 1LJUA 1U9YA 1YZUA 1ZMTA 2GASA 3DHNA 3QEBZ 3T12A 4ETMA 121PA 2AZDA 4H4EA 2JBAA 3I5MA 3CG4A 3LUGA 3VVCA 3DEZA 4JELA 3VOTA 5I7HA 3NR2A 2AWNA 2W00A 2CSXA 4GQBA 1E9BA 1LWOA 1XMXA 1WZEA 3PDWA 2O59A 1MNQA 5IW8A 1ZD3A 2C4NA 2EQAA 3BFKA 3I3OA 4P5PA 3ZHTA 9ATCA 1VHWA 3UM9A 4RVOA 3SD7A 2GM5A 2BFCA 3EVBA 1LDEA 1OASA 5C8VA 2Z1DA 1Z7YA 3UAWA 1K0FA 1D1SA 1WP4A 2OORC 2A35A 2PTGA 2IA5A 1ECGA 2PUJA 2YXNA 4Z9AA 3HBLA 4EG7A 3G7UA 3FPLA 4RMNA 1SU6A 1ORDA 1K8ZB 2SHKA 2PUTA 2XQIA 4KTTE 2H4JA 1TVEA 2QX9A 3FUUA 2ZTVA 4LFCB 5BN5A 4DSUA 4HYYA 4XCQA 5J40A 4CLHA 2GZ1A 3JRXA 4K46A 1CC1S 1JILA 3TSOA 4G6ZA 5AW1A 3E5MA 4E3WA 1L8LA 4HPWA 4KU4A 5B7NA 1GNPA 2Q2QA 3WYNA 4LVCA 1XTTA 4TRMA 3GQBA 5JQGA 1UWCA 2J48A 4MZDA 4FCVA 4DPMA 3A4NA 2NU7A 3PHLA 4HAYA 1NXWA 4JGGA 4JOQA 2Q1SA 1X8JA 1QQ5A 1VL1A 1IY2A 2CCKA 3QVWA 3EIOA 1AGRA 4Q6WA 4RH3A 4ZYTA 1QF7A 2BFBA 5HKAA 4P38A 5J3JA 3K96A 1Z5GA 4HD8A 2PKRA 3H11A 4DADA 3EOZA 4U1RA 1OX4B 3RYCA 2X5JO 4CWAA 3AVXA 1QVRA 4GKVA 2HN9A 3HYSA 4CN8A 1G8HA 4TYPA 1RXWA 1ECPA 1ZA1A 3LDUA 4KXQA 4YP5A 5TEVA 2W2PA 1TUIA 4GT1A 2GCOA 2VNSA 4GLJA 1EQUA 3UFBA 3DOHA 2CVQA 3EJWA 3I5YA 2OBFA 1ZOOA 1RHKA 4WKBA 1WD7A 3OMLA 4JT2A 2XJ9A 1U65A 2FMXA 1KO4A 1U7ZA 2Z3ZA 5GONA 3ED1A 1V8ZA 2X4GA 3A9VA 4JR2A 2QPLA 3BXOA 3IKTA 1Y89A 2R6DA 1C3EA 1F4VA 5JS1A 1G9SA 3RWBA 3TBKA 4FFOA 5A0FA 2MMGA 4LOIA 4BLSA 5KVSA 4OIMA 5JD3A 4PC3A 2CV2A 1MJFA 1EBFA 5IASA 4XGKA 3SVZA 1O4VA 2OCBA 5GQSA 2FR0A 3P9QA 1E4EA 1A5ZA 4AZTA 4BOYA 1XRMA 3E48A 5BNIA 3QIVA 1IQUA 3ELDA 4AKHA 1P74A 1RYBA 3A9WA 1SBIA 3C5VA 2VOJA 3PHBE 1V8PA 4HQNA 1V16A 4CM3A 2IPAB 4YYZA 1PV2A 2A2ZA 2H18A 3NATA 2GAJA 5BSFA 4I1PA 2C82A 3OKFA 4C4YA 1IIRA 4IQ8A 4RGBA 1NJSA 1U0FA 1L7DA 3HR8A 4UBNA 4BV2A 1NJ8A 2D0IA 4IIXA 3WSWA 2RHTA 4CIVA 5SZIA 2RBKA 5IFKA 2XUQA 4Y6RA 3GRKA 1BMFD 3ICWA 2R751 2XMPA 4HEA1 1G64A 4WNCA 4AJ4A 5COBA 5LMCA 5GJBA 1M8PA 1V3TA 2VCEA 3PRJA 4R9RA 1GEGA 4X1IA 1T4GA 4GOOD 5DHRA 1V5GA 5FAXA 1V1JA 3UB3A 1KJYA 1T3LA 1PTKA 2XE4A 2JGDB 2I3GA 1BWRA 4NOJA 3NC1C 1DGQA 5CW1A 1LBHA 2RHBA 1ADCA 1BS9A 1XRRA 2CBXA 1Q7TA 4NE7A 4ZTBA 3UAXA 3Q7SA 5K2OA 3EY4A 4ARUA 4YUYA 4L57A 4RD3A 5AM2A 4DJ5X 3A8TA 5EPUA 1XLTC 1DL5A 4MH0R 1BS2A 1Q16A 1QR2A 4G0QA 2EFEB 4U2GA 4YJ3B 3HBNA 3PDIA 2QV7A 2X8JA 2H48A 1UZLA 3IAS6 1FU8A 2ZJBA 1ZFNA 3CM0A 4R2KA 3OOHA 2CLFB 1EWTA 3WFZA 1IIBA 4IEFB 1RADA 2XCUA 4UOQA 4O4JF 1NC1A 3ZLBA 4U9HS 4RTNA 1UP4A 4OLBA 5CJ2A 2Q4DA 3R77A 2HIMA 4KIUA 4DEYA 3AETB 4BLRA 3R41A 1DCFA 4IGKA 2YWHA 3MCVA 5TQJA 4ER0A 2P0AA 5EHNA 2PTHA 3BDIA 3D3WB 3GJRA 4GYJA 2PUEA 2VXCA 4TRJA 7MHTA 4U7JA 1MQSA 4ESHA 1U8AA 4LDJA 4C7KA 2X7JA 4GO1A 1LTKA 3CS3A 4MVXA 1P6UA 1ADGA 3G5AA 4JUDX 4BUZA 2I67A 3NAZA 4D9NA 2P9JA 1I5EA 1ULUA 1UBKS 2ZTUA 3AR4A 3FPBA 3I9NA 5DGXA 5J5AA 3RR2A 2A0FA 2ZZNA 3SHWA 4ZFNA 1ZYUA 5AW8A 2XEDA 2HK6A 2DE0X 3IEUA 1U7OA 3GDFA 3BWBA 1ZD5A 2Z3VA 2Z5LA 1KMQA 3OESA 3LFHA 3AI1A 3DPIA 1G19A 3LBAA 3HO1A 2E6UX 5U9CA 4TLDA 2PUFA 1VIAA 2RI1A 2AUMA 5AT1A 2P3QA 2OO5C 5LQKA 1N7GA 1T91A 2IPXA 4J2TA 4C21A 2J5XA 4PC1A 3HO8A 1OX6A 2ETXA 4FUQA 4BLTA 5B3AA 1JB9A 1L5VA 3VR5H 3A1NA 2IUSA 3QNUA 2QAIA 5I7AA 1DC5A 4OK6A 4FDTA 4BO9A 4M0KA 3V5NA 3VC1A 4B3BA 2HHAA 2H29A 2OZEA 3QHAA 1WDTA 4REQA 4HNQA 2JI8A 1NVKA 3NOXA 3SF0A 1GNVA 4D9EA 3D6TB 2QSZA 3OQIB 4DNXA 4AKGA 3Q2KA 4PTZA 1Z0FA 4YJFB 1EJBA 4J43A 4CM8B 1FRNA 5A4FS 1L1QA 4RESA 2NNLD 3QFFA 4ZQIA 3FYUC 1CFJA 2WUEA 3QELB 5AOAA 4EWLA 2DETA 3JAMA 1M2WA 1IEXA 1N32B 2FPSA 1TYAE 2CL0X 3ZXSA 1EUDB 2DM6A 3DB1A 3GNSA 3T5BA 2P69A 2ZVJA 1SA0A 2CE2X 2IFTA 1UOEA 2VNHA 3VM6A 3WYEA 4ETWA 2JD1A 3GFRA 1QCCA 2Z58A 3FPHA 4HP8A 3ZK7A 3U60B 2WSSD 2AH5A 4HWOA 5CB0A 1O9GA 4MKFA 2CDNA 3ECAA 5HF6A 5CB4F 1E9SA 2CUZA 3GMDA 3MTIA 1EFVA 3VOSA 1Z4IA 3DEYX 4NU6A 3L3BA 5CK4A 4CKWB 4Z4CA 2Q3JA 3E4CA 2YMLA 1EK1A 2V58A 3EMKA 3H2IA 2J7PA 3ZU3A 2YUIA 3IJEB 2BRUC 3NNNA 3ILVA 2F3PA 2QYSA 3DE0X 3O83A 1KK1A 3UJAA 3R3ZA 4BE7B 4MEBA 2HDOA 3L6RA 1TYCA 1KNQA 1TNDA 2DTDA 2QK4A 2WA1A 3FGPA 1AY0A 1C9NA 1G8GA 2DY1A 3NBUA 3PGJA 3OETA 1BEEA 4TLAA 1VYVA 1N6LA 3PZRA 4G9BA 2MHCA 1SCUB 1YNOA 3HC7A 4I9NA 1KZHA 1WPXA 1ZD1A 1GNTA 3RSOA 1C1DB 1MC5A 1YHZA 4P5DA 4UNQA 1I2AA 2VHXA 2VBIA 2CXNA 1TCAA 3FWYA 4JR1A 4U5XA 5K8TA 2DJ5A 2EYUA 3O21A 2PXAA 2E5LB 4FWBA 1RZUA 1KAQA 1X86B 4E5NA 3OPVA 2AI3A 3FWNA 3RABA 3IA7A 2CNNA 1MIHA 3K0CC 4HSEA 4O08A 3STYA 4EJSA 1VHQA 4LMAA 1Y3CE 1QYWA 3I9JA 4EYKA 1PNOA 2IWRA 3ZXIA 2QJTA 1TZJA 4OY3A 5TY0A 2FWJA 4IDGA 1V7CA 5HZGA 5ISMA 2BUCA 4R0NA 3SU8A 1D1PA 3KJHA 1T4CA 2GM9A 5JAUA 1AQUA 3UJ8A 4D8TA 2DHRA 3D6AA 1XXHA 5A4JA 4DJJA 1Y5NA 3DD1A 4MGZR 1GL6A 2QG6A 4MW5A 1H1DA 1MG0A 1JJBA 3BORA 2P2GA 4FB5A 5A6VA 1BD4A 2MMCA 1PNVA 4EMTA 4B5KA 2F67A 2QUAA 4QXPA 5KYUA 3RKUA 4A4DA 2BYTA 4OHYA 1P5JA 3OWHA 4XM0A 1TFRA 4B6QA 1A2OA 3M33A 4M46A 2CXQA 4Q4HB 3WNBA 4ZU3A 3EY9A 1GFZA 1U1IA 4BGEA 2NAFA 4AIIA 5C5DA 2FLWA 4XQEA 2IEYA 3PWZA 2WJJA 3RRMA 4ZJUA 2XITA 1G21A 2XVYA 4PHGA 5C8YB 1EESA 3CT6A 4CI0B 3B3GA 4MDYA 5HRUA 3LQYA 4JLAA 4MKHA 2GHIA 3NNDA 4BBZA 3AXSA 1BC5A 2KLBA 1DBPA 1KEUA 4WA8A 2A5JA 1HLGA 4KQ2A 4I9UA 4MQ5A 3S0JA 3GD7A 3OCCA 1WXIA 4HYEA 4QU8A 3TL3A 1SCAA 2Q46A 3Q87B 3UO8B 5C3MA 1OZHA 4XARA 3HB1A 1HDYA 2F7SA 4YR7A 1NASA 1OWPA 2AUNA 2Q3EA 5AM4A 1X7DA 4FOOA 4KSYA 5LZ2A 3UHPA 5ESDA 3W9SA 1QIEA 1GTJ1 2DSNA 3TW0A 3AUAA 4OM7A 4IUYA 4IHQA 4JASB 5KWSA 4S2EA 3EQZA 3I37X 3KX2A 3UUEA 1O0CA 4GPD1 3R6WA 5I9LA 4ZZ2A 1VG0B 2OT3B 3QJ5A 1XDGA 4PTLA 4ZAZA 2PMKA 3KVVA 3QVSA 4OHKA 5EMLA 1GO2A 2FDCA 4AG6A 2PK3A 1OVMA 3PLNA 4NIMA 5BPFA 1K8RA 3GVCA 1SULA 3L4EA 4IH4A 3I92A 3OQVA 5CFNA 4RELA 3C6QA 3FDIA 1Z18A 3TW8A 1J8MF 1K27A 3FOBA 3AH8A 4KVZA 5IP5A 2IDKA 2VQEB 2F8TA 3VMFA 5HQ3A 1P73A 2R84A 4ZPXA 1VCHA 4PVDA 5ALLA 4RC9A 2A33A 4RTSA 4AP5A 4GYYA 4QPZA 1OIVA 3Q8WA 2O8NA 1R74A 4KO1S 2FUCA 3LD9A 1Y8RB 3KBBA 2JJMA 3MUEA 2X19A 3KAPA 4J0DA 3O92A 5KHOC 2QL7A 2AHOA 2C3MA 2BGWA 3E8MA 3LUDA 3CLKA 1PJBA 1ZRNA 2P9BA 3QU2A 3H9QA 3RIHA 2K7FA 4FFNA 3DAPA 2V9CA 3MSCA 4W5JA 1HE1C 2D5AA 1EKXA 3UMRA 3PEUA 2YRXA 2RH4A 1ZGHA 1NQXA 4HFMA 5F64A 5E9WA 2HTFA 2N3ZA 2YV2A 2FJUA 1CJUC 3S1AA 3UOAB 1SVWA 3K5PA 1L5HB 5BQXA 2OHHA 4BX3A 4HNUA 1ZMXA 1IZ0A 4MA0A 1N2CE 4PZLA 4C7BA 1EJ6A 4RLFA 4BCDA 5EKSA 3RRXA 4ZVQA 1VLJA 1Z75A 3NUQA 4JQCA 4MOWA 1QGYA 4C9BA 4LJLA 5BXQC 3SS9X 3GGSA 4GQAA 4YAOA 4M53A 2R1VB 3T1OA 1EFKA 2VAVA 3I42A 1NVFA 3HFRA 3RS0A 2G8LA 2PKYX 3I6QA 1W4RA 1T8TA 2C59A 4UTXA 3C3XA 4JBWA 4NECA 1LSJA 5SZKB 4E70A 2ZQYA 2PT6A 2A6PA 3JQQA 5T57A 3ESRA 4WACA 4F4UA 2Q9AA 3G5UA 4B5LA 5KU7A 3VNVA 3LQKA 1V96A 1AZWA 4K3VA 3S2SA 2F8SA 5COAA 3IR5A 2IT1A 4QEZA 3VZPA 5LJLA 3D6MA 4UE3S 2Q6TA 4RVDA 1NXOA 1IXKA 2IXBA 2P2YA 2ZJ5A 2B9EA 4M76B 5KTTA 1QK3A 4HLDA 3A31A 2VNJA 4B7XA 5IPFA 1E1CB 2GD6A 3ANMA 1SQ0A 3LOQA 3KDAA 4JI8B 5LM3A 4JOCA 1W6UA 1GUYA 1M2GA 2NUBA 2PD4A 2QN3A 2WNHA 1ZHOA 3GARA 2FG6C 2W8BB 1PQ4A 4KXUA 4WCVA 4ESOA 3COZA 3AFHA 1U0LA 3BF8A 3FOCA 5AHRA 4ZMSA 5EE1A 2DVMA 4XE5A 3L6OO 1Q12A 2Y9MB 2B3TA 3GJ7A 3A1UA 4Q1BA 5C7OO 1SCNE 1T4BA 1G17A 3C1AA 2DBZA 4OAQA 3FOFC 3R9XB 4HUTA 4X65B 2H8KA 1N7JA 1QAMA 1SVOA 4I1IA 2JFVA 4Q7EA 2VWQA 1WXXA 5E9JA 3BL6A 3FA2A 3FYCA 4N3CA 3N2LA 3MTDA 2I4OA 4KYTA 2XKKA 8AT1A 3ZE7A 5K3FB 4HB4A 4U02A 1SUCA 3C7DB 3M6IA 4EPVA 5BNZA 5HOQA 4D26A 4N0PA 4U2KA 5CGZA 5HOEA 3DAGA 2C8KA 2EATA 1IHXA 1KA9H 1W88B 1GR0A 2IYLD 2QD2A 2Y2UA 4MUKA 5F5NA 4B2PA 821PA 2JZNA 4CE6A 3AU9A 2OCDA 2ZXFA 1X7GA 3SKVA 1U3DA 1RKBA 5FNVB 3TGPA 4X5OA 3OFND 4XFKA 1U94A 1CR2A 2PHZA 4CZ2A 3IGFA 3D7LA 2UZ0A 3F96A 1PQUA 3PT9A 1NVMB 2AOUA 2DWQA 3FR7A 4TQGA 2NM0A 5CLIA 3MTQA 3BWDD 4RZIA 4US1R 1AGNA 3EXEA 4IJVA 2H9IA 5AHWA 3OQ6A 4Q1DA 2ZP1A 3LV8A 1P5FA 2JAHA 2J0VA 3VSEA 3PPWA 1Z5OA 1JG3A 4MRNA 3R75A 2H1CA 4Q12A 4Q21A 3DV0A 3ZX5A 2P6MA 1FVXA 4W63A 3VPHA 2I2AA 5LIRA 3G3EA 4JJ6A 3ZOZA 2ZAIA 4PLGA 4EB0A 5AUNB 1OTHA 2ZIAA 3Q88A 2CMKA 4CLOA 1YE8A 1TUBB 3SXJA 3P2EA 2FZCA 2B20A 4PG4A 1SMKA 4DPLA 1QKJA 3DMYA 3KJGA 3NTUA 5KNCH 5FOTA 2CVZA 4OKNA 4R3NA 1ZGAA 3SAJA 3P9NA 3G1TA 1T9AA 3A1SA 3JAKB 1DP4A 1HE5A 4YH1A 4ZHQF 3DT9A 4Q93A 1RLMA 5A3QA 2QVLA 2R7KA 5FLYA 1I24A 1IBLB 2VJMA 1UOOA 4KZPA 2CNWA 5IJWA 1XNQB 2HO4A 2NXCA 2P5SA 2R60A 1T1GA 4QYSA 3R3UA 2NU7B 4GLLA 2Y93A 4X66B 3W8NA 5IXJA 4FNAA 1PS9A 5K03A 4Y6PA 5AJHA 1XZAA 2JATA 1U6JA 2I9PA 3JYLA 3JTMA 1CEQA 3OY7A 5JNLA 4JYZA 1OX4A 5AIAA 4TQUS 1SURA 1ZOSA 3PL5A 4OXRA 2F4VB 4TZ6A 2F90A 3T1NA 2W6CX 4J6EA 4N18A 3ETDA 5B5SA 3UGTA 3OJWA 3AM5A 4RGVA 3O26A 4G0XA 2GXAA 1Y3DE 3LF2A 1N1DA 3DWEX 5FBKA 3UV7A 7ABPA 1H8HA 3QHQA 3H5IA 4MPTA 1QQ6A 5F76A 4P34A 2ALJA 4DLLA 5FYQA 3T1YB 3PNVA 3OZAA 3P52A 4C5AA 1PYOA 2XV1A 1OAKA 4HUQA 1XVAA 2W4QA 3GPLA 2HDNB 5KPJA 1BD3A 1VLLA 3T4PA 5BYAA 2C4KA 2PX0A 1HQYE 4OHCA 3F5QA 4DB4A 1U04A 4ESEA 2V7VA 1QIFA 1XJ5A 4QPCA 4X91A 1G3QA 2AC2A 4GMXA 3DBIA 3HJFA 2C57A 1FYXA 4IDNA 4FBMA 4RZUA 3N0VA 4ZREA 2QRJA 4G36A 4N6NA 1G21E 1CEXA 3G8CA 1BNCA 1FMLA 2QR5A 2YZKA 5DTRA 3TI9A 5KBYA 3RYTC 1KS9A 3R23A 4XR4A 2QD3A 4HH0A 2D4HA 1XK7A 3AHEA 5JD5A 2VPIA 4JP2A 1RKVA 3SG0A 1T4MA 2F3QA 2LGJA 4IIHA 2BEVB 1L9XA 3B82A 1RQNA 1ZISA 1OA0A 4TMVA 2C54A 2XD9A 4BZQA 1EYZA 3GHYA 1ZCZA 4EUSA 4AZ0B 3I34X 3DBLA 1MJGA 3ETGA 3A6EA 3CPHA 1EP2B 1Z6PA 1ZGJA 2Q3HA 3L18A 7YASA 1VJTA 4CEIA 2HO5A 1E1DA 4PFQA 1HZJA 1QQAA 2QL6A 4RIIA 4JXZA 1KH3A 4EYGA 1KJJA 2IX9A 3OP4A 5BVGA 2QN6A 1T0JB 3O8RA 4QUKA 3SY8A 1NYRA 3LO8A 4DT1B 4LF5B 2CD7A 3RF7A 3T7TA 1B6SA 1EXVA 3T3MB 3D43A 2XXAB 1QQ7A 1F2UA 4KWTA 5L8VA 3UMMA 4QGAA 1V9LA 1IVNA 2Y2VA 4ZVUA 5HCIA 3CURA 1ZU5A 2VDOB 4PHTA 4Q4AB 4EMUA 5A4AA 1LBIA 1UBFA 2BW0A 1FTYA 2CXUA 2IHBA 2QENA 2QTTA 3PQ8A 3H2JA 4L9AA 3F98A 5K20A 1UDCA 2M6SA 3HU1A 4KQWA 2ZUDA 3WQQA 2CHEA 4QO7A 1XX6A 2M6RA 4BNWA 3FHLA 1KMHB 1HDGO 1N0IA 3BIOA 4A03A 5KOIA 1OFUA 4IZIA 4BN4A 3KTAB 1GFIA 1I32A 1MRSA 2IVFA 4HB3A 4LVOA 4R1PA 4NU8X 4UTZA 4F93B 2HHHB 2EEZA 1SM4A 1SCDA 2ZB2A 3PWSA 3EEFA 2XKAA 1ZSYA 2X8JB 2YWFA 3GLQA 2AC4A 3JSXA 2CFOA 3DEAA 4PPNA 1OFHA 4QUBA 3ESYA 2I6FA 2ID9A 3K9BA 5DWVA 2ZRMA 1L6IA 3C24A 2XYGA 3ILYA 4J76A 5C81A 2AN5A 3JQAA 1BQ3A 3I5XA 4DC1A 4AJ9A 2WUFA 4PO8A 3SXPA 1E92A 4ZDJA 2M98A 2ZVDA 4LY3A 3OJLA 3KHSA 5ICCA 1VXOA 4RTLA 1KEWA 1KBQA 3ZLTA 5CD1A 4Q4JB 5JATA 1AG9A 4ZVPA 3KETA 5FBQB 1YDFA 1RQLA 2YMQA 1ELOA 3A0RB 5CNKA 4J7AA 2V7XA 3S55A 1VRWA 5JZOA 2CLHB 2Q45A 2YXDA 4QDZA 4ROTA 5BSWA 3CLRC 4OF4A 3RC7A 5DHFA 2JGKA 5KVAA 3NAQA 1Y8ZA 2OWEA 4ADSG 3GROA 4K81B 3EGDB 3T3HA 2Z09A 1I6MA 1PZFA 2ZT8A 2MSEB 2E37A 3QI7A 3S29A 2HCBA 1ZN2A 2YRWA 3G8AA 4GOJA 1T1RA 4ID9A 1JXOA 4RK7A 3EGXA 3ZXYA 2FUG6 4AB1A 4EJ2A 3LWDA 1JZSA 4BNKA 3V34A 3IKMB 5K0CA 1HDXA 1OUMA 5DHAA 1GA6A 1VSUA 3ENVA 4F71A 2PLWA 2PY6A 2QUHA 3DZBA 4BB6A 2PLRA 4HV4A 1U28C 4MSUA 4L5CA 2V6JA 1EE9A 2XRZA 2Y1WA 3B6EA 1X1EA 5KOJB 2RARA 4H15A 5BUQA 3KV3O 2XCTB 3G59A 3HA5A 4ZI7A 3Q7PA 2QTNA 3RHTA 1WTCA 1ZGBA 3GZ4A 3T1TA 4LISA 1T36A 3KSUA 2YHSA 4EUNA 1X19A 1ISFA 1Y4ZA 1PFVA 2RC5A 1QO9A 3OIVA 4BFSA 4ZO9A 3RTGA 2DFNA 5MFPA 5T7BA 1WRBA 4EKDA 1CZHA 4REQB 3GGGA 4PN7A 4Z3DA 2RHCA 2PSJA 2OE2A 3MJFA 3RREA 2VQ3A 2PZEA 3S5UA 3BQ9A 3BTUA 4URZR 4CM8A 2VSOA 3OHPA 1LSUA 4C20A 3P2JA 3PE4A 3VPDA 2XRYA 1EZ1A 1PL0A 2FPIA 2VQFB 1NR1A 4M87A 1CJMA 4DC0A 3GCDA 1SN7A 2XWPA 2VUUA 3L0ZA 4PQGA 5BUSA 1M2KA 3HN6A 1OU0A 4HXEB 3ZQUA 5D5HA 3RSHA 1V35A 4MVJF 4DQKA 5I47A 2WQ6A 1U02A 2YZMA 4MRRA 1LJLA 2G4VA 3UH1A 3F6EX 3SXUB 2HU5A 5A9SA 3OZGA 2LZ0A 2FSVA 3SHQA 3HWRA 5HGXA 4KFCA 3NMUF 3I04A 2WB4A 3G0BA 1LI4A 3B8HA 3NWBA 4MV6A 3ABSB 4ZHQA 4WJZA 1DUVG 2J1LA 3CNOA 5L3SB 3FTQA 1DAGA 3M4ZA 3Q11A 1H69A 4FR2A 1I6WA 4C0QC 4KWCA 5C3UA 1ECCA 4NVRA 5IHPA 4M83A 3RFVA 2W2LA 3VTAA 1UBLS 3E7XA 2XE6A 1C9YA 1YVUA 1RJWA 1QIMA 1UODA 1RJDA 3QI2A 5F78A 3E9ZA 4R1SA 2BUAA 3KLPX 3WXBA 3L0BA 3ZDZB 1GIAA 3CEPB 2GBGA 2HPHA 3BL5A 1DTWB 3GNLA 4N5NA 4LMBA 3PNMA 4GUDA 4RS3A 1R1DA 1AQNA 4O4HA 1RAGA 1V9SA 4HJXA 2ORYA 2DLCX 3VDMA 3HDVA 4FNGA 4GLBA 4KHZA 2YFYA 4C06A 1FBTA 5DOVA 5B4UA 1IN1A 1KF0A 2FP4A 2EIXA 4MUEA 3R8XA 2ZJ0A 5AKXA 1BU5A 4TXJA 4XYMA 1DXYA 1JAXA 3SC3A 3UT0A 4JDPA 4Z3OA 4UZSA 3WNDA 2CNBA 3H0CA 3ND7A 1W85B 3E22A 3IAAA 1JZTA 3ESBA 2HT6A 2RG1A 4HDNA 3JQBC 4U3JA 5I01A 3ZWQA 1M72A 2VTKA 1XAIA 4V0RA 3CSSA 4PAOA 3QEJA 5ALMA 1IHOA 2JNWA 2R4UA 3VOAA 4OIFA 4UNRA 1Z5PA 2B99A 5CXQA 4WQMA 3P2KA 4ITUA 4OSPA 2ZQZA 4C0BA 1UAAA 1CR4A 1Z0ZA 2Q5HA 3A3PA 1WMFA 1YAJA 5GIOE 1GZUA 2EJCA 4IHJA 2FQXA 3N2GA 3N3AC 4F56A 1B23P 1H2BA 2AD5A 1JNYA 3I04M 3QBEA 4WNYA 4RTKA 4BN5A 2VNKA 1RQ2A 2BGJA 1H3FA 2OG2A 1TF7A 3B2QA 4Q66C 2ARKA 2EJUA 1RS0A 3HSYA 3C7TA 4N3GA 4R3UC 5AW0A 4Q7QA 3K16A 3G88A 1YL7A 2VAXA 3G79A 2WNIA 4ZCSA 3LMKA 3IQGX 4RTQA 4QBHA 1OLSA 1GCIA 1P4HA 4GPZA 5MGNA 5D84A 4QWMA 4BXOA 2D3WA 3NIBA 5DM1A 1C9KA 1BGWA 1JECA 1GQQA 2ZWMA 1H5QA 5L3QA 2X4LA 3I8XA 1IVSA 2VHVA 2X2PA 3T4EA 2ZR9A 5IJ9B 4WSOA 3M3HA 1A8UA 2QUZA 3OLCX 4JKIA 5EIAA 2V6FA 1JLMA 1GLNA 1KZ1A 3ENNA 3IUBA 5EP3A 5AOVA 1FUUA 1T6NA 1XTQA 4LNAA 2PZ8A 4OMCA 2QI9C 3BERA 4KQCA 4FNOA 4YP7A 4Q3OA 3OSUA 5IMSA 3BRCA 4EPWA 2W2QA 1CUGA 1U3UA 2CYBA 4OQMA 5HS6A 3V4ZA 3HJHA 2YASA 3LE8A 1TRKA 1JQJC 3BE6A 3X44A 1JLSA 2HJHA 5F98A 2DAPA 4MICA 4Y6QA 3TKAA 4UOZA 5LB2A 5IBCA 2O3QA 3Q3IA 3IJPA 2ZUBA 3M6MD 3A2KA 2GD2A 3MQ2A 1YACA 3CUTA 3KKOA 4I55F 4M0DA 5C1PA 5EE5B 5JS6A 1GNQA 3AUJB 3OIDA 3N7TA 1PYGA 3TQQA 1MN6A 3CEJA 4NABA 3QKWA 3O73A 5H80A 1ABEA 1Y8RA 3K72B 4QYIB 1V4BA 2P2ZA 3E8SA 5M3BA 3N7UA 3NYQA 3M34A 1DQSA 1JHAA 1U8TA 4H7HA 4MULA 5EXEA 2O7QA 5H9WA 5BN3B 4N5LA 4AG5A 4AP6A 2R66A 5G40A 2W7TA 3B12A 1I9CA 2YV1A 3MNFA 2DWCA 3LNCA 3Q3JB 4REMA 1ESZA 4MLCA 3SE0A 2IZOA 3BMOB 3C3KA 4JI7B 4LSGA 4I3GA 3EEYA 3DJYA 4N1AA 1N8KA 3RVPA 3RFXA 4AURA 1Z0DA 5AXAA 1GSHA 4X1KB 4AJOA 2V7TA 1CLEA 3LECA 4IOMA 4DSTA 3YASA 1G55A 2RGUA 3BB3A 1YB1A 1Z35A 3ZV6A 4YCCA 5B64A 1DX4A 4TTRA 4M9ZA 5ITSA 1XEWY 2SNIE 4LYFA 1U7TA 1JNXX 2B36A 3FR8A 2APJA 1Q1BA 4MW0A 4MYCA 2R1VA 4IQFA 2CNOA 2XXJA 3G7NA 4BCBA 4DIOA 2XGJA 3C3AA 2JH9A 3Q8XB 4DBLC 1SIUA 4IP0A 4JLVA 4I46A 1XWIA 3A6KA 4PSKA 2OGZA 2IV3A 1WS6A 1OMOA 3QF4A 4ER5A 1XV5A 4UKDA 5EE0A 2GYWA 3UPTA 1GYPA 4UTRA 3TLXA 1JHUA 2MYTA 2JVIA 2FSPA 4WASA 3HU2A 1E1YA 4ZOLB 1DBWA 3HCFA 3F73A 2XI4A 1J0BA 4M1ZA 2YJZA 4PGAA 4FYMA 4DFDA 5HF9A 4LDNA 1KWGA 1ZJJA 4KOEC 1O5OA 1GVHA 4JOSA 4B9AA 2XSZA 1C81A 3N28A 2HWUA 1KBOA 2O5VA 3I39X 3PKJA 5F2EA 4D0LB 1PE0A 3E1KA 5AJVB 4BL5A 1SHLA 1E1RD 2Y1FA 3ONVA 1DBRA 4PCLA 1I0ZA 4WN9B 2RD2A 4U9UA 4AULA 2G7ZA 2IYXA 2X5NA 2WVHA 5FUYA 4IDEA 3BKXA 1VTKA 3T0IA 5A5FA 3AVQA 2W6ID 3F4BA 5CGQB 4YRKA 2MYUA 1OI7A 1W47A 1HEYA 4RMGA 1OX5A 3THXA 4HWPA 1YRYE 4F9EA 3I9V1 4FS3A 3GP8A 1WETA 1ZVKA 2Z3WA 3P20A 4X8HA 5FL7D 2F43A 3RIGA 3ZCPA 4B1FA 4W5OA 1VG9B 1V7PC 3P4YA 3PIIA 4M60A 1U63A 5AUPB 2P9TA 4YCMA 1Z2AA 5ALEA 2QSUA 3IE0A 4LOHA 1P91A 2GBLA 3CWZA 4J0FA 3ZQ6A 1SU4A 3JSAA 1HPLA 4RDCA 1SIBE 3R9KA 2CUNA 3WAKA 3G0HA 4FFMA 3EXG1 1P7ZA 1XRPA 2FK7A 5CIQA 1L4LA 1CR1A 1X9HA 2ZUTA 3G2PA 4AL4A 5K8VA 1KAOA 1MVOA 1X1DA 3DWFA 1GADO 4NU0A 1L5OA 3KCQA 1FOEB 3X2FA 3ZDRA 3OJXA 4TKUB 2QTVA 5JO0A 2Z6UA 3RSZA 1LNSA 4A8TA 2PMBA 2X1MA 1A88A 3L06A 3KKZA 4RSMA 4KEAA 3CLTC 1D6JA 3EXEB 2QU7A 1SWVA 3Q1KA 2X58A 1E1KA 4M8IA 1UK8A 3EAGA 4LZNA 1UXJA 3ORFA 3M4YA 3OWXA 4AJKA 1CJKC 3VH1A 4K0RA 3MOIA 4OGWA 4YJHA 3DV0B 4MV0A 2GZDA 2JGEA 2BFEA 3IAUA 5K6AA 1NPTO 3P9KA 4MP3A 4OQQA 4DAEA 5A71A 3NWPA 4ANFA 2GEUA 1R64A 2HF7A 2VRWA 4LSMA 4IDQA 1M2JA 2Y76A 2HI0A 1SB8A 5AKLA 4NOMA 1ZUNB 5A4MS 3JARA 2W2KA 4J6FA 1PW5A 3L07A 2BR3A 1GZ7A 1BDIA 4EY8A 3EB9A 4A0SA 1OZFA 3MBOA 4ZQFA 1CUCA 4E6PA 2R85A 2ZGVA 1YGYA 5A2GA 1CYEA 4HGOA 3TRKA 4YMTA 4JWTA 3E5RA 3EASA 2Q2WA 4QOHA 1JKIA 1ID1A 2A0YA 3X1MA 4UHEA 3H5LA 3U81A 1PGPA 2BE7A 1XYGA 2LVBA 2AR9A 4I55B 3GH1A 4FW8A 3DC2A 2FFHA 3C3MA 4CLRB 1QYDA 1K3UB 2RB4A 1GU1A 1KYZA 3N05A 2JJ2A 3FFXA 4HNTA 3HXMA 4GSLA 1Z0AA 1S2IA 1RZVA 4WFJA 3B1YA 4Q00A 1E0DA 3HDGA 4ZHQB 3F3YA 3ABRB 3PYMA 3UAZA 1IEVA 3NFRA 3TIXB 2OCIA 1C9EA 1Z4QA 2VJLA 4GBJA 1DINA 4GEKA 3V2IA 5L3VA 4XEHA 4O0LA 3JTEA 4UFPA 4IJWA 3H2GA 1VBNA 1MB2A 4FYJA 4LGMA 2G1JA 3T5CA 4IVNA 1LC0A 4EKEA 4JYAB 2FI1A 4MQ6A 3FTNA 3KUXA 3MHTA 3N2EA 2B0CA 2I6UA 2HEGA 2YZ7A 2BHRA 1M6YA 2OQRA 1WCV1 4UATA 2JHFA 3AQ4A 2ZTLA 3RC2A 4DABA 5LKRA 1HX7A 3KQNA 1RWWA 2XA1A 2OAQ1 2ZI5A 1L7XA 3KM0A 3STTA 2FR8A 3IL2A 2V9PA 1LEHA 3PNPA 1BJKA 5KWVA 1KMNA 1OC2A 4DGQA 3CWCA 5A5DA 3GNTA 3FVTA 4QSHA 4HYQA 4QYXA 2N1BA 4ZVOA 2X41A 4PG6A 3CZAA 3DC7A 4WOKA 1OZAA 1ZM9A 3EUAA 3F5SA 1RC0A 2I66A 2BFAA 5H3HA 4EI8A 3H6GA 1ZA2A 4DR1B 4XUDA 4J03A 1JHMA 1H6AA 1CYDA 3L0IB 1AZLA 3NHFA 4TROA 4BLWA 2I2CA 4EGSA 2HPAA 3NM6B 4GKJB 1F17A 3L8HA 3QW4B 4RVSA 5HFAA 1KEZA 1SOAA 2BI4A 2WD8A 2YJ6A 3K0FA 5DP2A 1D5CA 4CEIB 3ZIAD 2RGDA 2MWMA 2RIPA 2OK7A 4KNVA 3WWYA 2Q8PA 5BVGB 5EJ5A 5KVVA 4XM2A 2P9FA 1U2TA 2BEKA 3DYBA 2QE7D 1VBFA 1H5UA 1ZKDA 3LOPA 4D79A 5KOYA 2JVKA 2XUKA 4BECA 2H92A 2JHPA 4OBEA 4I4TF 4B6GA 4KP7A 2BBWA 2ONZA 3I4LA 3B9QA 3X2EA 3FCEA 3OEWA 3GMIA 2CXTA 4QBIA 2VHEA 3C45A 4RVNA 4Z3KA 1AQ6A 4PLWA 5FR2A 1NV8A 1WXHA 4U2BA 2RAVA 3OAAA 1H85A 4GSKA 4JFRA 2A4MA 1AVTA 1OYYA 2CLMB 2QJOA 1W19A 5C4IA 1AN0A 2FMKA 2QIOA 4JGIA 3WNCA 1SVUA 2I1VB 1S8OA 2FSHA 5ITZB 3WMWA 1Z47A 2XDWA 3JWPA 4JHLA 1V1RA 2YOFA 2X0DA 2YV4A 4OA5A 3S2GA 1GGFA 1KSFX 2HGZA 4ZRDA 5E7IA 1I3CA 3TD6A 1Z06A 1QRTA 3ZUGA 3C87A 1P0CA 5KPDA 4RTPA 2YR0A 1DQRA 1RPZA 2OBYA 2YY5A 3E3OA 1NL3A 3N76A 3NNSA 3Q7EA 521PA 2I7VA 2VHYA 1IL0A 3R6LA 2XOKA 4DIKA 1NLMA 1R5OA 3U0VA 2HRZA 2XLCA 3NIDB 4PR0A 1OFTA 4CM1A 4X61A 1GZ5A 2PXHA 2NU9A 3JQAB 2A5GA 1M2NA 1PR3A 2FMIA 2Q5JA 2WTAA 2XCLA 3K31A 4PQFA 4J4BA 4NMWA 3TFWA 4EELA 3DMGA 5FFNA 4D3ZA 3PJEA 1U31A 4DY6A 1FRFS 5EZ5A 2R6HA 4Z4EA 2FCRA 4F4DA 3U4CA 4BS9A 4EO4A 1E3JA 3V9PA 4WJKB 1CE8B 1LTQA 5DDIP 3B60A 3PGVA 1DRVA 3V4OA 3B1XA 3OOJA 3OCUA 1FX0A 3TB4A 1E3TA 3ANNA 3SVTA 2IS6A 1ZVQA 1FXSA 4F86A 2AX3A 3HWWA 3OZRA 4BZWA 5C5EA 4FEAA 2HXGA 3U7HB 4KXVA 3FRIA 4W5RA 2O0KA 4M6WB 2QTGA 1CRQA 2AR7A 3GBPA 4EW6A 2FW6A 4L4XA 3ILHA 4PYQA 1LCIA 1E5QA 2CF6A 4R40A 5HDBB 3SF8B 4HAZA 3H3FA 3JQ8B 4UQPA 4MXDA 4QU0A 1GRRA 2QRVB 1K89A 1X0VA 5ALTA 1OBFO 3R7SA 1LV7A 1LX6A 1NNSA 1H94A 1T15A 1LK7A 2UUOA 4Y1GA 3KNZA 3W5HA 4D44A 3M2PA 4O0MA 1A1VA 2NMVA 1WMDA 4EEXA 4KMOA 1V3VA 2XUOA 5HWSA 5HJ2A 4DNFA 1PHRA 1Y8CA 3GR6A 2DU8A 4DR6B 1V9CA 3CKMA 4G5QA 2C7RA 1P1BA 4IYRA 5DSTA 4QTUB 4N9QA 5K3OA 4IKEA 4TSFD 1JFTA 4K9OA 4MIOA 1EWQA 3QYJA 2DHDA 1HE4A 2X6TA 3MERA 1DS6A 4IIJB 5HE8A 5FOQA 1NBME 2AMFA 2QNIA 3GOQA 4X6UA 1X8LA 2DCUA 4CPDA 1V0JA 1ZN9A 1RYMA 1M6VA 2BGLA 5KEIA 2ZT6A 3LUBA 3NTXA 4HDAA 3V1LA 1N2ZA 3AF1A 3I1IA 4HRYA 4XJVA 1MEOA 4O02B 1Z74A 3QBVA 3WLJA 2BH9A 2X4IA 2OTCA 3H3JA 1QZUA 3A6FA 3W9UA 3LYHA 1CUEA 4HX9A 3FUXA 2YJ4A 4F3YA 3INYA 2P90A 5J5VA 3NKFA 5KNBA 3L79A 3P7MA 1KVRA 2VAWA 4BBPA 3KEOA 3EVCA 3ZHCA 2IOFK 4H7IA 2ZBPA 3TLJA 4EK9A 1XCOA 5AYVA 2FFJA 4Y9TA 4GXRA 2IZ5A 1EWKA 2DY0A 3B38A 3AZPA 4FT2A 2XT0A 4ENRA 5L3SA 2WYHA 3HABA 3VMMA 3SHVA 3MF4A 3SQWA 2JLXA 3EQ7A 2Q21A 1RAEA 1WW3A 3BA6A 3WLSA 4ISBA 2X0FA 4J9VA 4EG8A 1JX6A 1NUTA 2XGGA 5IKXA 3GJSA 3ONWA 4MQFA 4R68A 1G2PA 3EWSA 5BSKA 5HZMA 4XI9A 1A27A 1DKQA 3K1JA 4X0EA 5AK0A 2HGSA 5J2TA 1EB9A 5K4AA 2GN4A 4MCJA 4W1SA 4MVWA 4PNHA 1AC5A 1TZMA 4R5MA 5KYVA 5A5VA 1MABB 3KXDA 3MJ4A 4ZGWA 1ZICA 1XRQA 4O2AF 5A4DA 3BWYA 2BM9A 2PUGA 3WQSB 2VI5A 5HF5A 4GVPA 1G6Q1 2Q0XA 2ZDGA 1XCPA 1O57A 3SX2A 4BVBA 4LECA 3FSEA 1BE1A 1Z7WA 4YRNA 3MRVA 2P79A 2RHRA 4RIGA 3F78A 3R76A 4N65A 5DBHX 4HDNB 3VR5A 1DRUA 4RVHA 4EA9A 4Z4HA 4JI0B 2VPPA 1HDEA 3HBJA 4RY8A 1KQFA 5SYNA 3MK31 1U0BB 4K9NA 1FFEA 1HK7A 3U1BA 4MW4A 2ZRGA 3ZV7A 5A03A 2JLZA 1XYVA 4TYYA 2Q1YA 4YRMA 4RTMA 4Z0NA 2VYCA 4RA9B 4IUDS 4BO7A 3IX7A 1JEJA 1YGPA 5EOVA 5EUCA 4D4GA 4IBOA 4R2WA 4G0WA 2BKAA 3BRWD 3K70D 3UK6A 2VJOA 3CPSA 3KEQA 4R2IA 1JBEA 1SD2A 1ZCAA 3W7AA 2RE8A 2R62A 4KX3A 5K8JB 4KUEA 3FPKA 4RE6A 5IVDA 2FFQA 3O90A 2ZDQA 4JVMA 4M1KA 5JJIA 5HK9A 4UMVA 1KQOA 3TUZC 5BSHA 5FA5A 1MO6A 1EFRA 1GPDG 2HRRA 3E0QA 3G68A 3PGXA 4PNPA 3UXMA 4QQNA 3BK7A 5JVDA 2XMCA 4KREA 4UPEA 3MQFA 2XMDA 4ZTUB 4XCVA 1CNEA 4UU7A 5CM8B 5DN9A 5J9FA 3IBCA 2B2XA 3QVGB 4ND4A 4DBZA 3FOWA 3RGGA 4BNNA 1VA4A 3IQZA 4CNBA 2AN1A 3X2SA 4ZVMA 1CJCA 1E1QA 1R8JA 1TM1E 1YBAA 4J7XA 4RYDA 4Z99A 1CW2B 3NO4A 5J1SB 4FBLA 4DQLA 5F3DA 4RADA 4YR9A 4KFTA 5CA1A 3VAZA 3RH0A 2ERYA 1XQ6A 5IYZF 3KZ1E 2YHIB 3DP7A 2H1IA 2K6GA 4MTCA 4IGFA 4WLOA 2QZZA 4UU8A 4D4LA 3N2YA 2BR4A 3B5JA 3NOQA 1RI2A 2DTEA 2YFKA 1H2HA 4ASUD 4KR2A 4V03A 1VGRA 1R7RA 3FFWA 3O75A 1VMEA 4DRZA 1V8BA 3Q6NA 3WIVA 1IBKB 3KAJA 4II7A 3BH0A 4N5DA 1VFPA 2WD7B 1E6UA 4AECA 2QW1A 5B53A 4C4RA 5EHQA 5ARBA 4KXLA 1NVVQ 4ZV7A 2NZUG 1X1SA 1BKDR 1PS8A 2WA2A 3TMKA 1BSVA 2OVBA 3MWEA 1VJDA 3OLYA 4OQYA 5EMNA 3V48A 4BN0A 3GLFB 1N2BA 1TTHA 2BHSA 3VTKA 4AWXA 1NUUA 1XZJA 3MMSA 4KBGA 1BCSB 2A14A 4YV0A 1V11A 3KQKA 4NZPA 3PUYA 1G4UR 2DC1A 2C9OA 3SSOA 3ISJA 4W9NA 3TTTA 1T8UA 3T06B 4K3UA 2YUTA 2G70A 1C7QA 4J0JA 4F2HA 4R2MA 3HVRA 3QWIA 5E4TA 1U1DA 2JCSA 2OBBA 4JBNA 3S81A 3QFSA 4JP1A 3HL4A 1YT5A 13PKA 1YOBA 4OJKA 5MFZA 1D07A 3LU1A 1K2WA 3IP5A 2I7DA 3QPUA 3ED5A 5AKEA 5IEBA 5TMEA 3NOOA 3RG2A 3RBVA 2OQIA 3IMFA 4O2BA 3GEMA 2W6JA 4OHVA 3B78A 2YOGA 3H5OA 1JL3A 3AZOA 1XXHE 2BBTA 3WHKA 4KGVA 5HKLA 2WQ7A 3M82A 3SJBA 1NFFA 3PD1A 3LAWA 1FZTA 1PJ8A 3IIEA 4FN4A 4X90A 1JBQA 1K7FB 1KVUA 4DQUA 3ZCSA 1C2YA 3H8WA 2AOXA 1N8NA 2ZS8A 2R00A 4HGQA 4KK4A 5CVDA 1CQIB 1H4VB 3DYVA 5I6DA 4PSDA 3GJ5A 2A1UA 1PK7A 4FKMA 4YWJA 3CE9A 3NDJA 1AT1A 2C31A 1WX1A 1MF7A 5A9TA 4EY4A 5I7FA 3D6FA 1YZLA 4P8RA 4LOLA 2PX4A 3KTOA 4BP9A 1WKVA 3DKRA 1T9CA 3HZRA 3ETHA 4Y1EA 1UK7A 1E0JA 1NN1A 1UF9A 2YJGA 3VJKA 1ODFA 5AO9A 3I9OA 3WHIA 1R4ZA 1Y4DE 3JQ9A 1U3FA 4HQRA 2PVCA 1S8FA 3B70A 2GCIA 4I8IA 4DCTA 4IXNA 1YB2A 2I6TA 2DP4E 1D7OA 3EDCA 1K86A 1VE3A 1OT5A 3PTZA 5HQTA 2HFJA 3L7NA 3M4NA 2PJDA 3NHPA 4FYHA 1J42A 2R4TA 4HATA 4NMMA 4ZQHA 1IBMB 1CUIA 1HNWB 1CY2A 7GPBA 3AEZA 3W6UA 5MDHA 4GP6A 2RAFA 4P83A 4E5PA 1DC4A 1RI1A 1VQ1A 2JJ2D 3IOCA 3QVXA 5TRTA 2QE7A 3DEKA 3L2OB 2IZ6A 4FEYA 3L0CA 1VG1A 3KZKA 1R18A 3F4KA 2WSBA 3F5MA 1M34B 4YRSA 1YMUA 2VJPA 2B82A 3KDPA 1F0YA 2EU8A 3LPLA 4KLAA 2VQSA 2ATIA 4DQDA 1DIOB 1GPBA 2JI4A 4V0ME 2HSWA 2XZDA 4LQDA 1C8LA 1Y5MA 1QIJA 1NRXA 2ZJ8A 5CLLA 4ZO4A 4K0KB 3SQDA 1ST3A 3KFXA 2JFWA 4EPRA 3FRJA 1FFAA 3D4BA 1GG9A 4FYKA 1LUAA 4UCQA 1Y5RA 4G5SA 3AP2A 4QUHA 2JH8A 3C6KA 4ND6A 2FUEA 1L8OA 4KN5A 3TBFA 3IFSA 2A9KA 2NXWA 5JC1A 4ZAGA 2DKOA 1R3UA 4M1OA 1B43A 4WEOA 2Q2OA 1TCCA 2ZI7A 4HTFA 1IOZA 4BMOB 4YV7A 3C3PA 3IHTA 2CJFA 1M2HA 1FA9A 1M66A 2XQVA 3NBMA 4B32A 4DT1A 5IDXA 2O14A 4GR4A 1EUCA 5J59A 4GSYA 2P6RA 1VLHA 1K06A 2B7CA 2R47A 1OH8A 2ZB3A 1U0NA 1V43A 2J67A 1GDTA 2HRDA 4NCNA 3V1MA 2XUPA 2H31A 4KQ9A 1KI9A 2L2QA 4QFCA 3IUNA 4MVCA 3I52A 3SBOA 3I4FA 3MN1A 4UBJA 4BVHA 4PHCA 1K7CA 1RXYA 1KC3A 2PL9A 1D2EA 4RKEA 5HUHA 4BQRA 2W2LD 3CNEA 4PRKA 2PL5A 2DT8A 4L16A 4OG2A 3W0LB 2L17A 4KDRA 4ARSA 4CF3A 1GOTA 3K9HA 3F46A 4ISCA 1YCFA 1YB5A 3ZBPA 5HM8A 2DHQA 3O1LA 1JEYB 3HCDA 3HCNA 4PPGA 2X8WA 4WXRA 3L7KA 4FNMA 5DTMA 4BO0A 4O4JB 2LCQA 1JPUA 2AN4A 2FFRA 2O4CA 2UKDA 1SBYA 1ISPA 4MROA 4M1QA 4XIJA 2C20A 4ENVA 4OK3A 2YQZA 4XZ3A 1Z15A 2Q5IA 3QSYA 1NBOA 1ZITA 4JN6B 1RHQA 1NONA 3ROXA 3K71B 4BRSA 4HMOA 1KTIA 4KFRA 1EAMA 3PPIA 2OC9A 2EEPA 2QM0A 4I55A 5DXAA 3HR4A 3IUEA 1TXGA 3HBAA 1N3BA 4L0MA 4PX3A 1MX1A 2JLCA 4Z9XA 4EP1A 1R6VA 5CLHA 1WCIB 2WHPA 1R37A 3R0JA 1N2SA 4URHA 4YQYA 1QPZA 1JAYA 1IN8A 3H17A 3TH5A 5FPKA 2FV8A 2PRZA 1WSWA 1GSOA 3DFKA 621PA 4MYDA 3A1FA 2YWRA 5AI6A 2CFTA 1RI5A 1XTZA 3FBGA 4ZOLF 5GONB 4RLSA 2GH1A 2XW6A 4HWTA 2JLBA 4BNJA 1D2AA 4EB6B 1W36C 1RE1A 1U2GC 1M8KA 4BBAA 3IAHA 1ZESA 2Z1NA 3F6RA 2FUKA 5EQJB 2ZUEA 2Q9UA 3ZWWA 1DJMA 1TEZA 1QGED 5LL6P 1CY0A 1GTRA 3VSAA 4K87A 5HPYB 2JAWA 3GJ8A 4CUKA 1YC5A 2JHCA 4P84A 4E1BA 3CUSA 5HIMA 3V80A 3TDNA 3FLBA 1IY1A 3M6AA 3STHA 4C76A 4MV4A 4ZJPA 1FEZA 3I1JA 5K01A 3KQUA 3ZOKA 1RAAA 1Y4UA 3FJYA 3DBOB 2Y4NA 1CIPA 1Q84A 4C5BA 1P72A 2BDEA 1NM5C 3EQ8A 1U3CA 3UYLA 1PGNA 1Y33E 1LPAB 2OKCA 5ED0A 3UHOA 4PN3A 2DB3A 2QMOA 1ENYA 2W0SA 3C6YA 4WWHA 3GWZA 3V4RA 3KTFA 2AF4C 1SVSA 2WFLB 4NQZA 2BGUA 2WG1A 4CEJA 5EIHA 2ZU6A 1R0CA 1HKHA 1X80B 5CHEA 1CUSA 1QOZA 1Z5NA 4A8JB 2B94A 4C0XA 1BXZA 1KQPA 1R8YA 2UZIR 3BB4A 4J4TA 4ND3A 4WKCA 4XAQA 4B34A 2IU3A 1P7PA 2I55A 4KPFC 1E2DA 4P3PA 1SQGA 2G6BA 3I5AA 5DJ5A 2H2AA 4EYEA 5DCLA 4MARA 4KPGA 2R5WA 1J9EA 4HPXB 2V7EA 3LLVA 5EKTA 4BRWA 4EVRA 5JFTA 1QFSA 5IKEA 3PV0A 4Q19A 4IFEA 4XH9B 5GV7A 3D6UA 3NANA 3TXAA 3V4LA 1J49A 3DXYA 3R5HA 2PVSA 3HP7A 5LDDC 1G8MA 2NTEA 3GAAA 3KUCA 3L84A 2ID7A 4L8YA 4NV0A 1UFKA 5DMXA 3T7AA 4DSAA 4ZCTA 3RAJA 4KV7A 1KXZA 4D98A 2IBSA 3A9UA 1EG7A 5ITZA 1MEJA 4BFZA 3ABOB 4R7TA 3DVAB 3FUWA 3ZLJA 3KR0A 1D4AA 1YZNA 3K6KA 3PDIB 3KO8A 1UKBA 2AC7A 1KY4A 1C8KA 2REQB 2BKXA 3CZRA 2R96A 2VP2A 2PPVA 4M0LA 3L8FA 4HZUB 4OMDA 2HMVA 2JG3A 3P2MA 4HJRA 2XA2A 3TVTA 4KLRA 1H9CA 1JLRA 4FMBB 1QLWA 3QWBA 2B2CA 3U4QA 4IIUA 4LBYA 2F3UA 1U5BA 1GZDA 2DBRA 4WGGA 4QHSA 2QDXA 2W6QA 5M29A 1Y5LA 3AETA 4D4HA 2PT9A 2X8LA 2P9ZA 3C1OA 3OWOA 3OBIA 3MA0A 2OEPA 4HMQA 2ZS7A 2EP7A 4LPKA 4W6ZA 3ZLVA 2C2HA 4ARAA 4B4VA 5IT4A 1J2JA 2JJYA 2Q3BA 2V6GA 1NP6A 4RW0A 3FPGA 4BGUA 4H1WA 1RCTE 5LXTF 4B46A 2EJTA 2IYSA 4ZQGA 1QLJA 1W8DA 4MUBA 2X40A 2PZKA 5ECGC 5AQ1A 3D6HA 2D2FA 2WD9A 4PLYA 3ERCA 4E15A 3CN7A 4LMRA 5E6RB 3T1HB 1U5CA 2ISSD 4MS3A 4NESA 3ROMA 3HTXA 2I2XB 1I2CA 3IT2A 4MUYA 1ZD9A 4DIBA 2Q0QA 2O8FB 4G86A 4FYXA 1JKJA 3E4DA 5KWEA 2IOFA 4ZK2A 5FA8A 4L5IA 3NPMA 1FFDA 4PY2A 3RFFA 4XIIA 3Q72A 1UC4B 1LRJA 3ZKAA 1NC3A 5ALGA 3HR7A 1TI7A 1NY5A 4MW1A 1M8FA 3JQ8A 4EZIA 3EPHA 2FETA 4YJGA 3AF6A 1QC5A 5C46F 3IAEA 4RVUA 3B8EA 3IUJA 2VNAA 3SQXA 1YCGA 4G1FA 1F12A 2AN3A 2B8NA 2CDCA 3B48A 4KMRA 4O25A 4EFLA 4NLLA 1WXDA 3ESAA 3LY9A 3WB9A 2GNPA 3F0TA 3NTLA 2AFIB 3PQEA 1WOMA 2AQKA 4FOTA 4Z9BA 1Q22A 2XRMA 3N2NA 4JC4A 5GY7A 3W8EA 3HXOA 1FNNA 3VAYA 1TVCA 4JP3A 1Y48E 4ZKEA 4ALNA 2QMEA 3HM2A 1CIJA 1NLUA 4L95C 4FDAA 5K3EA 2I2FA 3N6VA 1C4OA 1E3LA 1ONOA 3EC2A 2EX0A 3IBFA 3TBHA 4KNWA 3A1WA 1G2IA 2H6EA 1SD1A 2WKSA 1IATA 2OFPA 2HA6A 2OBNA 2P5UA 3DJFA 3H0KA 4G0MA 1TAUA 5HF8A 3BWEA 3GO4A 2HLDA 1W25A 1BE0A 1M6VB 2JDIA 2LRHA 2VEDA 1BJRE 2HMAA 5DI3A 4ZVRA 5CEJA 2UZAA 4CQLA 3IXLA 3U7GA 1RRPA 3QBDA 3DCYA 4OFZA 4PS0A 4IEEA 1H1LB 3GFOA 4DDWA 4FOLA 1IOVA 1NXQA 1XQYA 2K5UA 1G0NA 3U7EB 3U4MA 2BP7A 3IRVA 1XR3A 4LN1A 4I1SA 1AS2A 1II0A 1OE0A 3AI2A 2WVAA 3AB7A 1LB1B 4YRAA 5ELXA 5DHPA 3PJDA 3HA3A 2HSGA 4JBXA 4TL7A 2Q62A 4OYYA 4RPJA 4NBKA 5HNKA 4LYJA 2BJVA 3JW8A 2VRBA 3EAQA 2JFHA 3RLIA 3KOWA 2G4LA 3P97A 1SRQA 1KOGA 3PEFA 3R0QA 3CJTA 3PC4A 3R9IA 1J5XA 4AY5A 3H8VA 3AV0B 4K26A 5LLTA 2IK8A 3H9CA 4RJIA 3W6PA 1USVA 3FXAA 4BNTA 3DMNA 4HLUC 4YIHA 1Z5ZA 2VA9A 4BV9A 4ZT2A 1F0KA 2NXJA 3NORA 1E6LA 1YQUA 3PFKA 2XE7A 4JJAA 4A26A 3HY4A 2XT6A 2QX7A 4P93A 4DUZB 3PVZA 4I4TA 5I9BA 2B1QA 2D6FA 5EIXA 3V7NA 1UT8A 4FGUA 3MJDA 4C1BA 1M0WA 2QF7A 3EWIA 1JEQB 2QTHA 3P71T 4UBKA 1KSGA 4EX7A 4OX9Y 1F60A 3ZGYA 3IIIA 3DLHA 1FL9A 1JSLA 1YKSA 4JX8A 2R8ZA 4GP9A 2Z6QA 2G6TA 1Q83A 1U99A 2WZQA 1ZAYA 5C7LO 1AKVA 2VR1A 4Y98A 2SKEA 2XOEA 4I9FA 5I7EA 2JD2A 3SN6A 1MPXA 2FYTA 2WZCA 3W5AA 2JIQA 1UDAA 2C2WA 3IESA 4GE0A 4HNGA 4ZALA 1FP7A 3E2MA 1LLUA 5JV5A 3EC1A 3H5WA 3QY9A 2JFYA 4GOXA 2VT3A 4X9XA 1ESEA 3ZH2A 3OQJA 1G21B 2PYZA 3E5NA 2GMWA 1NOKA 5T41A 4DCCA 3UFXA 1WDMA 5HBRA 5JVDB 3I09A 4DIUA 4Q7LA 3PFFA 4F04A 4F6RB 3K8YA 3PHCA 3PT5A 1ICEA 2V03A 4C08A 1D2CA 2B1IA 2H1HA 3DE1X 3ADPA 1V3UA 3OY2A 4EG1A 1S96A 4YIKA 1GD1O 1RR6A 2Q7DA 3SX4A 5KX5F 1EVKA 4EARA 1GU7A 4IILA 4U6QA 4WCDA 3OX1A 3Q3GE 2BCEA 4ZDWA 5CNJA 3CH7A 3VZSA 3QKTA 1T0IA 2VLIA 3HY3A 4CNQA 3CLRD 1B7GO 3SFTA 2FPGA 4YRZA 1YFLA 4NHEA 4QELA 4LGVA 1OBHA 3WY9A 5HUJA 5ARCA 4WAUA 4YCLA 3C7KA 3DEFA 4HEHA 1QG2A 4EJSC 1J0AA 3LQ2A 3ZNNA 2IV7A 4FDUA 5F7ZA 4MMXB 1KDTA 2IIBA 4EGQA 2XE8A 2WMDA 5C7IO 3J81A 3AEUB 4TV8F 1CP3A 3AUTA 4KMMA 2NGRA 4DR5B 3CF4G 4QG7A 4U2EA 3RJZA 3F6PA 4OX9B 1Q92A 4RM2A 2H0QA 4D6XA 1TEHA 1OW3B 3A4YA 4JODA 1MC4A 4A2QA 4LE1A 2CN1A 5JJBA 3KCNA 1QK5A 3DS8A 5IJ0A 3CX6A 4HRXA 3P0HA 2AGVA 3ZJTA 4JJZA 1VKOA 1SUIA 1MB9A 2J4CA 5JY6A 1VIYA 2HBYA 3EVEA 1A9RA 1YIAA 5EJMA 3UGKA 2H2DA 1I4LD 1Z73A 1T2DA 2DFLA 1L7MA 2WD7A 4L74A 3L40A 5TF0A 3W2FA 2Q0SA 4ZJZA 2WDZA 3LQRA 1TQ6A 1CY6A 3QV2A 4PO3X 3O4HA 1SXJD 5FTWA 3MWEB 4MRVA 5C4MA 2J0EA 1XWWA 2NZVG 1XZHA 2EBFX 3HZHA 1JU9A 1NLYA 1BCSA 3ML1A 3QF7A 2H9YA 3QLEA 1XMIA 2FRXA 4GOKA 1W48A 1YDHA 3SKXA 5JR3A 5B4TA 2H57A 5ICGA 4B40A 5EWJB 3ZYCA 1JYFA 2C5EA 2KJQA 1E6KA 4JU8A 4UQLA 1L0BA 1D0IA 5GGXA 5IJAA 1E6WA 3JZFA 3KJNA 3KT8A 4MWOA 3GVIA 4N49A 3R7FA 1SK8A 1W0KA 5EJ2A 5AHOA 1OTYA 2ZJYA 3ZKWA 2QORA 4PANA 4O2BB 1UM9A 3KLMX 4KKXB 1BHJA 3SSNA 4COKA 4EA7A