5LKAA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
301
structure length
301
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering a de novo transport tunnel.
doi rcsb
source organism Sphingobium japonicum
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 115
structure length 301
sequence length 301
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lkaA00
2BUBA 3WJ2A 1BEEA 3U1TA 3MVEA 4MXDA 3IUJA 3STWA 4Y2JA 5LKAA 3FLEA 4HXFB 5JADA 5JASA 2B20A 5ALVA 1HQDA 1LPNA 3AUKA 2V98A 5ALPA 2Y6UA 1QO7A 1K5PA 4KEAA 3WZLA 2ACEA 1XZBA 3BWXA 2CB9A 3OOSA 3M3DA 4B82A 4AQDA 3AILA 3STXA 4Q3OA 2HA2A 2XI4A 5K3EA 5AM4A 4BCDA 2HHAA 4OCZA 4UBMA 3K9BA 5EIEA 2H9YA 3W04A 2X5XA 4UPDA 5AOBA 4BTVA 3FYUB 2QMQA 3I6MA 1GKLA 1H2YA 2JGMA 4QLAA 1J07A 4KE9A 2QUBA 3CN9A 3QMWA 1WOMA 3W9UA 5JARA 4Y2PA 2JGLA 4ZGBA 1UK8A 3ZLUA 1QIEA 3WZMA 1ZI6A 1WPXA 3ESAA 3C8HA 2BJHA 5CH8A 4G5XA 1CUWA 4AN0A 3OURA 4XVCA 4CG1A 1YB7A 4Q3KA 1G42A 1L7RA 1FFBA 1MO2A 1DQZA 2WTNA 1DWPA 5IH7A 3IVMA 2C7BA 3QVMA 2QT9A 4EY6A 2VEOA 1EK2A 1LLFA 3GELA 5DNVA 3ILSA 4L72A 3ZI7A 3WK6A 3R3WA 2HFJA 3KD2A 1YSCA 5DYTA 3HI4A 4KR0A 5EGNA 4RNCA 1IZ8A 3A2NA 4MQLA 4BVJA 4C89A 1ODSA 1XZEA 3ZWQA 4LYDA 4UFOA 4UFNA 2QRUA 1QIMA 1W52X 5FV4A 1J1IA 1DWQA 4UHDA 3Q0TA 3W2TA 3DCNA 3GFFA 4DYHA 4RE5A 4CIBA 4S0XA 4MQMA 1SCIA 3F96A 5C7YA 5IVIA 4B0OA 3WKEA 5DYYA 5AKKA 3N0TA 2O7RA 2VA9A 3R3XA 4U2EA 5CW2A 4BBZA 4DNFA 4BZWA 3H2HA 2FX5A 1QOZA 5EHNA 2Y6VA 3BJRA 2WHPB 3QPAA 3R3VA 3IUQA 3D0KA 3FSGA 4PW0A 2WIJA 1JMYA 1E89A 5E4JA 3O9VA 1J2EA 3V1MA 4BTLA 3Q8WA 1LPOA 3E3AA 1ZIYA 4AZ3A 2QZPA 4OYLA 4B83A 5FXMA 1G66A 2JGFA 4OPMA 3GROA 5SYMA 4GWLA 1XLUA 3YASA 1FJ2A 4K5QA 2I03A 5C8VA 4FTWA 4B80A 2PKYX 4INZA 4MEBA 1YAHA 3LIPA 3G9ZA 2ZJ6A 1MX9A 5JATA 3HEAA 3R3YA 3QITA 3V1NA 2ES4A 2XUQA 3H19A 5CT8A 3AIMA 4TGLA 1CUIA 2HM7A 1A88A 3KOOA 1JFRA 4G4JA 3ESCA 1X2EA 4N5HX 5K3AA 1N5RA 3H2GA 3IULA 1UKCA 1ORVA 4WDQA 4OSEA 4F0JA 1CVLA 4E11A 1CIJA 2PSEA 4LXHA 4KRXA 4BP8A 4UFPA 2WJ6A 4LYEA 1GPNA 3PICA 1EVEA 4TVKA 1W4LA 3AZOA 4H77A 4B81A 4PV7A 3DKRA 5LZ5A 2WIDA 1RWQA 3U0VA 2YH2A 4CFSA 1YS1X 5CT6A 4YASA 5HKAA 4G9GA 4EY8A 5AM0A 4J0KA 3STYA 5A62A 2J3QA 3BXPA 2J4CA 3AIKA 2O2IA 4RE6A 2XLCA 1L7QA 4OB8A 2VTVA 4KAFA 4BAGA 2OGZA 5CXXA 1CUSA 2WJ3A 3PI6A 4FOLA 5ESRA 2Z5GA 1H2XA 2HADA 3WWEA 3I2FA 1HDEA 2VATA 1P0MA 1PFQA 2WHRA 1MPXA 1CUFA 4NS4A 1P0PA 1E8NA 3B12A 4FLEA 4L3WA 4BDTA 1LBTA 4HS9A 1QTRA 1AGYA 4Q82A 4D9JA 3VDXA 3QMVA 3WL6A 5EHXA 1I6WA 1CUEA 3D7RA 3H1BA 5C81A 4QDXA 4WFIA 2VAXA 4L0CA 2XMCA 2XMSA 4E15A 5ALRA 2QVBA 5CMLA 3C6YA 4B7ZA 2WFLA 1MJ5A 2Y1KA 3FWHA 2VSQA 1BEZA 5EI5A 2ECFA 4PSUA 4X94A 2ONCA 5E4YA 2ZSIA 4W1PA 4CG2A 4EUSA 1PJAA 2WIKA 1WHSA 3SWWA 2BCEA 4WFKA 2OGSA 2XE4A 4KAAA 3HZOA 3W06A 3O4JA 3I2HA 5LZ4A 1VE7A 5JIBA 1XZFA 2GYWA 2GBIA 1C7IA 1BU8A 3FBWA 1VE6A 3M82A 1QFSA 2VT7A 5CBKA 1ODCA 2QXTA 1EXWA 2OG1A 1G4HA 1K8QA 2HA3A 2WJ4A 5JD6A 4BCBA 5JANA 4Y9SA 4UUQA 2ZYSA 4LHEA 3CCBA 1VZ3A 5K3FA 3BL8A 5AK5A 3RLIA 3D5EA 2WG2A 4ZWNA 3X3HA 2DHCA 3SC2A 4AZ0A 3C6XA 2VJCA 2C58A 5IVHA 3JWEA 3C43A 4C6HA 3E0XA 4N5IX 1CQZA 4IH4A 5HFAA 2DCMA 2XMGA 2H7YA 4GW3A 4UBKA 5CRIA 5ALIA 4M0EA 4QEKA 1BROA 4FLFA 5J3JA 5ALOA 4Q1VA 1DT5A 2FJ0A 4QDZA 1TQHA 4Y2QA 2YXPX 2D5LA 2VF2A 2QJRA 1UOOA 3WQHA 1C4XA 3WK4A 2WILA 2QUAA 2AJLI 3HSSA 3E4DA 5AJHA 1EHYA 2WKWA 3I2KA 4ZV7A 5IVKA 2DR0A 2GBCA 2WUFA 3CCCA 3WL7A 4CCYB 3LIIA 1XRMA 2VAVA 3D2AA 2HRRA 4HAIA 3VXKA 4X7BA 3QBJA 5LIPA 1CUJA 1XRQA 5HF9A 1U2EA 4E14A 4DLNA 3AJAA 5AI9A 5AK6A 2XUGA 1FSSA 2PSHA 4FHZA 5CH3A 4P92A 4IH1A 1G5FA 3DYIA 4J03A 3A6ZA 2HFKA 1BS9A 1ZI9A 4B84A 2X8BA 1GT6A 1CR6A 1VXRA 2G5PA 3MGAA 4FFVA 2OAEA 2XB6A 2PPLA 2XUAA 2XMZA 4AMZA 2J4FA 3O9MA 4AN1A 2HA0A 3FSGD 3OG9A 3DKKA 1UK9A 2QJWA 4U2CA 3F9CA 1UWCA 3EQ8A 3DEAA 2XUHA 3L1HA 1QIIA 3I1IA 5ISMA 1CEXA 5AIAA 1TCAA 4GECA 4QZVA 1SCQA 1R50A 2V96A 5I7UA 1N1MA 1WM1A 5HQ3A 2XUJA 4FKBA 4KE8A 3WA6A 2XUIA 3I28A 3FAKA 4G4GA 4EBBA 5ALSA 1DX6A 2C5GA 5DYWA 2PSFA 1K6EA 2VT6A 4G8BA 4ZI5A 2XUOA 1Z68A 3PUHA 1O6GA 3I6ZA 5HFNA 4BB0A 3JYHA 4G8CA 4UBJA 4F60A 1ZGCA 1HPLA 1FFDA 5FPQA 1XZJA 4H7JA 4V2IA 4DGQA 1P0QA 1USWA 2XQKA 1GPKA 2ACKA 3NUZA 2JGEA 3R41A 5LYYA 2PX6A 1IUPA 1CUUA 3L1IA 5AM2A 3C70A 3C8DA 2ZYRA 1XRPA 4DMHA 1H2WA 3DDUA 4X93A 1T4MA 4QDOA 2GZRA 1ZICA 4W9RA 1E8DA 5LKRA 2WFZA 4FFWA 4KACA 3WA7A 3VKFA 3VJMA 1QFMA 2EDCA 3R3ZA 1ZIXA 3O4IA 4AB1A 2PM8A 1XZLA 1IMJA 1HBJA 3WKBA 1CRLA 3M81A 2WG0A 4F5ZA 4EZIA 2I3ZA 3GZJA 3HLKA 2DSNA 1XRLA 4OUKX 5LLSA 4MYSA 1ISPA 5CT9A 2V9ZA 1DWOA 1AQLA 2VJDA 5FLKA 1D07A 4DNOA 5AO9A 2HA7A 5AI8A 1GKKA 3PE6A 5JAPA 4OU5A 4OYYA 3EIOA 4YX9A 4P9NA 5LP1A 3F98A 1SCKA 2H7XA 2HU5A 3A2LA 1VLQA 4BC0A 3LLCA 1P0IA 1H23A 2HIHA 2HRQA 2XQJA 4Y2TA 5AICA 2G63A 2CMFA 2H1IA 3G0GA 4X90A 1AUOA 4I4CA 3G9TA 2BGRA 3F8SA 2P8SA 1MU0A 1Q0ZA 3TEJA 1WB5A 1ORWA 5A7GA 2Z8XA 3H18A 2BGNA 1SFRA 1EDEA 2OCGA 3H04A 3I2GA 1K63A 4N8EA 5ALJA 1TAHA 4H7DA 4X6YA 3G02A 4A16A 5AKYA 1XLWA 5A71A 2QKYA 4P08A 1CUVA 5FPPA 3ANSA 2JEZA 1CUBA 2XMRA 3FVRA 2RONA 1UK7A 4W63A 2JBWA 1EI9A 4J0JA 4KYVA 5JD5A 3BDVA 1KEZA 3ZV7A 2W22A 3HACA 3WIOA 1MT3A 4XWGA 1AKNA 2YYSA 4DMKA 2R11A 5AM5A 2PL5A 4EY7A 1MX5A 1H22A 4K6GA 2QXUA 1ODTC 4X00A 1MN6A 4GDMA 2PU7A 3DQZA 3WWPA 2ZYIA 3OTQA 5A7HA 1L7AA 5JALA 2HA6A 4LXIA 4B0PA 5LZ2A 4AO6A 4C01A 3HYSA 1IZ7A 1XKLA 1IUOA 3I1YA 1UK6A 3UUEA 1EX9A 4RGYA 4EB0A 5AKEA 5F4ZA 2K2QB 4LXGA 3IIIA 5BOVA 1NU6A 5K3DA 2ZVDA 3VISA 4OU4A 3H2KA 1BN6A 5JZ9A 1NX9A 5ALQA 1YAJA 3QH4A 1ZI8A 1UFOA 1EVQA 3O0DA 5C8XA 3WK8A 1QIJA 4AX4A 1JMKC 2HA5A 4H7FA 5HCUA 1OXMA 3KWJA 2GBGA 2VJBA 4EA6A 3DOHA 5AK3A 2OAGA 4H7EA 1R88A 2XUKA 4W1RA 4PNZA 4GXNA 1FFAA 3G8YA 3AZPA 2Z3ZA 4G8DA 2WHQA 1QIHA 5JAHA 2HL6A 3GA7A 2DFPA 1YCDA 2WG1A 3O4GA 4WY5A 1R9MA 3DOIA 3PF9A 1UOQA 4Y2VA 3I2JA 2AJBA 4B9AA 1QLWA 3BDIA 4NMWA 5AKLA 2IIVA 3S8YA 1A8UA 4WY8A 2WIFA 1XLVA 2XMQA 5H3HA 4HRYA 1VOTA 4KJXA 4J0DA 3L1JA 3ESDA 3WI7A 1EINA 1TK3A 5D3KA 5KREA 2QS9A 2BAGA 3VVLA 4BAZA 5JD4A 1XZGA 1J06A 1TCBA 4QWWA 3VJLA 4BRZA 4UHBA 5LZ8A 1AZWA 4I19A 5ALWA 5T4FA 1FFEA 3HABA 5CTAA 3A2MA 2CEKA 2HDWA 5K3FB 4H35A 1CUCA 1LGYA 5I8PA 3HJUA 3TRDA 3FYUC 4HRXA 4Y7DA 2JEYA 4XIIA 2ORYA 2C4HA 5JYCA 3W05A 1TCCA 3C45A 5AI5A 1BCSA 4UHCA 5HKBA 1XQYA 3LCRA 3WLAA 2BFNA 5BWCA 5AKJA 1BRTA 4QWMA 3G9XA 1DT3A 1JJIA 3VJKA 3O95A 1EK1A 4I3FA 1XZIA 3DNMA 1F8UA 3MUNA 1QONA 4U2BA 1CFJA 2G5TA 2QOEA 4X3CA 5ALEA 5DNWA 2CKMA 3VVMA 2XQIA 3STVA 5C8ZA 4CIAA 4H7HA 3WKAA 1W1IA 3C6ZA 5LZ9A 5BV7A 2OCKA 2OCLA 3G0CA 4IH9A 4BP9A 2OPHA 2G4LA 1GGVA 2PSDA 2WFLB 5DJ5A 4BAUA 1IUNA 4K6HA 4NVRA 3G0DA 5ALMA 4Y2UA 3DLTA 1Y37A 4PF1A 3UUFA 1LZKA 3KDAA 3ESBA 5ALUA 4QLOA 1NU8A 2DHDA 2D0DA 5AKXA 4DNPA 2C0PA 2E3JA 2WLSA 1FFCA 2RGUA 5FOQA 1B6GA 2ROQA 2AJCA 1GZ7A 5CURA 1MAHA 1HKHA 1U65A 4FDMA 1AC5A 3I6YA 4BE9A 1CUYA 1THGA 4ZV9A 3WL5A 5HZGA 3RARA 2O2GA 1LNSA 3FYUA 5K3CA 4DSAA 1HLGA 2W6CX 5ALDA 3TJMA 4X95A 3BJMA 2WUGA 5FKJA 1N5MA 1HL7A 1CV2A 3FYTA 4QE3A 3C5WP 3V1LA 3GBSA 1BN7A 4YK7A 4DM7A 3ZPXA 1ZD3A 1WPRA 4KE7A 3D2CA 3E1GA 1JT2A 4EHBA 2LIPA 2WHPA 4ARAA 4KAJA 4QA9A 1JU4A 2Y2UA 4HXEB 1E3QA 2XQFA 1U8EA 2RI6A 4WFJA 3HRHA 3UMJA 2B4KA 4DSZA 1EA5A 1KU0A 4BATA 2JGIA 5EHZA 4AMYA 5CH5A 4O08A 1Y7IA 2CUTA 1EDDA 1UT6A 3OC0A 1UKAA 4MYDA 5E4TA 3BF8A 3IA2A 1OILA 4FMPA 1U4NA 3F67A 1SC9A 4L9AA 4ZREA 3V9AA 2WUEA 1CUHA 4B85A 1AX9A 4J7AA 2GYUA 2JF0A 1A8QA 2C0QA 3N2ZB 3ED1A 2JIDA 4G1FA 3QM1A 1R9NA 5FDFA 4C87A 5BWBA 5ALTA 4HTAA 5IVDA 4BCCA 1S8OA 1C7JA 4G9EA 2Z3WA 5ALLA 1EB8A 1BE0A 3KSRA 3HXKA 3BF7A 4UBIA 4Q3LA 4UHHA 5AKIA 4OB7A 5LZ7A 5AP9A 4MJ3A 3FVTA 4FLMA 1QO9A 2QTBA 4AXBA 3H2JA 4J0GA 5HF6A 4BYMA 5ALYA 3PUIA 4BZZA 2XUPA 1KU6A 1Q0RA 3RKSA 3C5VA 4FBLA 4EY4A 1XZKA 3WK9A 4WCVA 3B5EA 3BE8A 1RYYA 5ALZA 1XRRA 2XMDA 3EBLA 5JAOA 1LPPA 3FCYA 1MX1A 2WU4A 3WK7A 1CPYA 1CUDA 4TPKA 2J3DA 1GPLA 5JAUA 5AI0A 4MEAA 3DYVA 4A5SA 4IQ4A 2I78A 2FJPA 4CCWA 2O2HA 1XQVA 4CG3A 1DTEA 5KWIA 1TKRA 4DTCA 3G7NA 3EQ7A 4WDRA 3W9BA 2AJDA 3H2IA 4Y2RA 3I2IA 4JNCA 1W76A 3LS2A 5AH0A 3MUOA 3V1KA 3WWCA 2OCIA 3C6BA 1VKHA 3DJYA 4JYPA 3R3UA 4ARBA 2WQZA 4G4IA 4UBOA 3BIXA 5EIAA 4Z49A 1XROA 2IITA 2ZJFA 4M0MA 3P2MA 4BC1A 4JYMA 2UZ0A 4C4YA 3PFCA 3IUMA 3K2IA 1O6FA 3M83A 4HVTA 3RK4A 3WK5A 4BVLA 4X91A 3TGLA 1XKTA 1CQWA 2PVSA 2IX9A 4BRSA 1E66A 4GHWA 5AKHA 1CLEA 2XLBA 1ZJ5A 4KRYA 1XFDA 4UHFA 3AIOA 3IDAA 2DQYA 2RHWA 1THTA 4K6KA 4PSCA 3WKDA 4FNGA 4XJVA 1UZAA 2Q0XA 3T4UA 5HF5A 1QIDA 3ICWA 3STUA 3D4LA 4QDUA 3WIBA 5FP0A 1TRHA 4C4XA 4Y2XA 1WB6A 5KBYA 4UHEA 5EHQA 4X97A 4H7KA 3H1AA 5DNUA 2XUDA 2CJPA 1ZD2P 4JH0A 4B9EA 4WJLA 3LP5A 4BVKA 5HK8A 1JJBA 2HU8A 1VXOA 4A23A 4DNQA 3AINA 1YR2A 3ZLVA 5E2IA 2RIPA 3ZLTA 1XQWA 4J0CA 3CXUA 1MAAA 4H18A 1UOPA 5YASA 5HQ3B 4X85A 2CZQA 4KE6A 4IHAA 3K6KA 2QR5A 4GBGA 1LZLA 4ITVA 1ZOIA 2BUAA 1QE3A 3R40A 3D3NA 3DL7A 3H0CA 3PF8A 2EEPA 1WB4A 2VJAA 2Y2VA 2AXEA 3ANTA 1LPBB 4LKOA 4QNNA 3DD5A 2XUFA 1QIFA 3DS8A 4CI9A 5K5EA 3GUUA 4UBLA 2Z8ZA 5AHXA 3AZQA 2GZSA 4LIPD 1W6RA 1WHTA 5T4HA 5D7BA 4GEGA 1X2BA 2EDAA 1M33A 4CCYA 7YASA 2JGJA 4W1SA 4RPCA 2HU7A 3KWFA 5JZSA 1JKMA 1VZ2A 5CXUA 3WL8A 4EY5A 1ETHA 2OLEA 3IBTA 4P93A 3CN7A 5CT4A 5AIBA 1X70A 5ALNA 5AM1A 1Q83A 1QIGA 4AO7A 1MNAA 5FRDA 2ZJ7A 1LPSA 1CUAA 5K3BA 3D2BA 5DTJA 1ACJA 3SK0A 2WU3A 4W1QA 3STTA 2DQZA 4PO3X 2WUDA 3DL4A 1ZD5A 4M0FA 2XDWA 1QGED 5HF8A 3IB3A 1W75A 4F21A 4C88A 2VQ6A 1XZMA 2WIGA 3WYDA 5AKGA 1F0NA 5A2GA 4OD0A 1OCEA 4N8DA 3QYJA 5I9IA 5FUMA 4DIUA 5HK9A 1E5TA 5ALFA 3QMMA 1XZAA 5ALKA 2WSLA 1VA4A 4GLBA 1YA8A 4X6UA 2JGKA 1Y7HA 4H0CA 4U2DA 2WFMA 4B6GA 1JU3A 1RP1A 2I3DA 4J0HA 3NGMA 1YASA 1QJ4A 1GQRA 1N8SA 4NZZA 5JZBA 4Q34A 2XT0A 2DHEA 3NOXA 1QIKA 1ZD4A 1EH5A 1UXOA 2YASA 1CUGA 1VA5A 1ZGBA 2C5FA 2RHTA 1DX4A 2PSJA 1AURA 1XRNA 2PUHA 3WYNA 5DTIA 4JUIA 1MNQA 2GYVA 4MWSA 1Q84A 1WCYA 3QPDA 5AOCA 3QZUA 3WWOA 5AOAA 1E8MA 1DQYA 3OM8A 1TIBA 2NW6A 2ZYHA 3KXPA 4H7IA 4X92A 3V48A 4PSDA 3G9UA 1ACLA 4J0IA 3RM3A 1SOMA 3G0IA 4FWBA 3WKCA 3FLAA 5CT5A 2CBGA 3T52A 3B3QA 1QZ3A 4Y2SA 4IO0A 4FNMA 1DINA 3OPMA 2R8BA 3PDCA 2OQVA 3AFIA 4GI1A 5D6OA 3FOBA 6YASA 4UBNA 4BDSA 3H17A 1JI3A 1LPMA 2XMBA 5AI6A 5ALXA 4AO8A 4FBMA 1H2ZA 4YPVA 4JEIA 1XQXA 5T4EA 2FUKA 4QDTA 5ALHA 3FLBA 5DLPA 4C4ZA 3IUNA 5AI4A 1A7UA 4DMCA 3FCXA 2H7CA 2OGTA 1ZJ4A 1IVYA 4ETWA 4BE4A 1LBSA 3HC7A 1XZHA 1A8SA 5D3ZA 3IURA 5AKZA 3EQ9A 1PV1A 3ICVA 1EB9A 3C87A 4E46A 2WM2A 4DMFA 2HA4A 5A6VA 1R1DA 1YS2X 4HZGA 4U2FA 3FNBA 3S2ZA 1BCRA 1B41A 2PBLA 2OXEA 5SYNA 2WTMA 3WJ1A 1CUZA 2X76A 1XZCA 3QPCA 1T2NA 5EIHA 1MTZA 1GQSA 4Q05A 4J3JA 1XZDA 5AM3A 3WMRA 1R3DA 2B61A 1YA4A 2V97A 1F6WA 1UKBA 2ZSHA 3F97A 3G0BA 4ZRDA 5AK4A 3BIWA 3PFBA 1YB6A 3EF3A 2B9VA 1JJFA 1CUXA 3NWOA 4MWTA 2RAUA 3D59A 5IKXA 3JW8A 2QM0A 4X6XA 4XX1A 4U2GA 1GXSA 5EFZA 4N8SA 1K4YA 2AJ8A 3A70A 4OB6A 3O4HA 1F0PA 2BKLA 1DU4A 4HXGA 4ZXFA 5A7FA 5T4BA 2GBFA 2PU5A 5ALGA 4Y2YA 2OQIA 4ROTA 1VJ5A 5DWDA 2BUCA 5KWJA 1QTIA 2XQGA 1R4ZA 3R0VA 3SX4A 3WWDA 1EDBA 2O7VA 4PQEA 1LPAB 2PUJA 1AMNA 4K2AA 4X71A
chains in the Genus database with same CATH superfamily
3Q3GE 2BUBA 4UEJA 3A6GA 4ME6A 3AVPA 4EPWA 4HYEA 3DSRA 1BEEA 1J9ZA 2QPLA 4DILA 2TMKA 2F43A 4R2WA 3U1TA 2XXJA 2AMYA 2FRXA 2OFWA 3MVEA 4MICA 2MINA 4UCFA 3KEGA 1Z56C 1NC1A 4FE3A 4MUXA 3RT7A 2B30A 4EG4A 3WLHA 3UGJA 4DR1B 1Y1KE 5LB4A 3STWA 1QMPA 5LKAA 3TINA 2O3UA 3KBOA 3E8SA 3GNTA 4G9BA 4LYFA 5JADA 3TNJA 2NXCA 1E9DA 1ESEA 1T5IA 4BKMA 5A1TA 1E0JA 1GYRA 3ANYB 2QU8A 4LGVA 3H1GA 2QVCA 1UUFA 5JROA 4DPMA 4JLDA 5TQJA 1TOAA 2WJVA 1VI6A 1QO7A 4JXJA 1K5PA 1YR8A 2ACEA 2FSSA 1M75A 5ENDA 3WK4A 1GSOA 5BSVA 1W9HA 4E5KA 4B82A 1SIWA 1JG7A 3OX1A 1SHTX 4KZKA 4YMTA 2XKJE 3I9KA 1HG1A 3AF5A 4Q3OA 4L8GA 4CLRA 1DIGA 1L3BA 3CE9A 5D5QA 1F3LA 5K3EA 1J97A 2DTXA 2WFAA 3WNBA 4CT0A 3KWMA 4HDAA 1DZIA 4WZBB 5U1PA 1GDHA 1P91A 2HHAA 1MEJA 5A5EA 2PD6A 1MO3A 3DBOB 2AN3A 3Q7PA 5KKAA 3VR1A 2A9RA 2V7TA 3M5PA 1E7WA 1GRNA 1D0IA 1ZC4A 3ZY6A 2BGJA 4TMTA 2ZR0A 4I50F 1OLUA 4JSRA 3THOA 4CM8A 3C7DB 2ZPUA 1JPVA 3TL2A 3GRRA 4L4UA 1OV6A 4E3ZA 2JGMA 3SF8B 4RPJA 4ZZ1A 1Z62A 5GIPE 3UG6A 4RK4A 1E2JA 1EYZA 4GYYA 4E7PA 3K5HA 2GHIA 4HZIA 4ZCSA 1FBNA 4KE9A 5C31A 3CN9A 3QBEA 4IOMA 3EX7C 1OGYA 3R8CA 5I51A 2N42A 5ES3A 1P17A 1DJPA 5JARA 3HN7A 1PQPA 1KP3A 1Z8HA 1K8ZB 3HCOA 1DCTA 3KOMA 1PLKA 2AI2A 1LTQA 1U7XA 3KU4A 1P4SA 3QKRA 4P82A 3F1KA 3JPWA 4JI4B 3C3BA 1J8FA 1ZI6A 1VLVA 5E8RA 2R86A 3C24A 4YAKA 1I1QB 3G8BA 3QYPA 4AWAA 4G5XA 3UF0A 3RVJA 1L5FA 1PT5A 1CUWA 3PEVA 4I4TB 4C2AA 2VDPB 2BDEA 1XXHE 3OX4A 4BB5A 4CG1A 1WB9A 3KJZA 3LBYA 4BMYA 1C5KA 3EFOB 4IEEA 5DBIA 4A8JC 5KQPA 4I66A 3HGTA 1G59A 1MG0A 4QGGA 3I32A 4XB1A 1DQZA 4D4IA 1DWPA 3ZHOA 2GAFA 4YFYA 5IH7A 3UHJA 1JDJA 2YICA 4MKHA 3L0SA 4EA7A 2GX6A 4F2WA 3EA5A 2B5OA 3BIOA 1I9CA 1GG9A 3QVMA 4RH0A 4UM9B 2VEOA 1VHQA 1ULHA 1EK2A 3T12A 1NNI1 4NDNE 3QBTA 2FB9A 2CLOB 4L72A 4L9SA 4XD7A 3BXOA 2ZT8A 3QVWA 4F6RB 5AHWA 3H99A 1Z33A 3KD2A 1N6RA 4O8ZA 2PUBA 3KQSA 3HMQA 2ZB2A 3DO6A 4YMSA 1F2VA 5J4YA 1KRHA 3NV9A 4YCLA 4BGUA 4E94A 3KJQA 1G8PA 4CLRB 4DDKA 1MW8X 5EZ6B 4REOA 2JFFA 2QD3A 3UXEA 1AV6A 4KMOA 4UDXX 4IRUB 3IJEB 3NI2A 3A2NA 4C89A 5JUWA 2HJHA 5BWOA 1X15A 2QRZA 7REQB 4JC5A 4Z4FA 4YRBA 4DV7B 3M6WA 2C9MA 4XVUA 4FMCB 2OD2A 2YWCA 1FU7A 4M4SA 1NTOA 1QK5A 4UFOA 2JH3A 5AW7A 2Q2VA 2K7ZA 5IZCA 1YH3A 2PLFA 3DV0A 3DM9B 3IKLA 3PQ5A 3Q9UA 3U1VA 1YULA 3T4PA 4A6EA 3LF2A 1J1IA 2MR5A 1L5YA 1ADYA 1ML4A 1WCWA 3EWAA 1GT91 3LPLA 1AHIA 4B8ZA 3DXXA 4JQCA 4Q4AA 1PD1A 3AXSA 3EMDA 4M88A 3DCNA 1RQRA 3CUVA 4RABA 2YDXA 2PUTA 4QASA 1DAHA 1S0UA 1KJ8A 4MQMA 2J31A 1VRVA 3HFGA 5C7YA 2YCBA 4F9TA 4FYMA 4BMZA 2XYQA 7REQA 4MRSA 3CF2A 2GEDA 4RGBA 3M3HA 1KI6A 1NFRA 2XWJI 1F20A 2ZS8A 3QFFA 4XQEA 1SKUA 1ITZA 1GAQA 1NFQA 1SU8A 3QU2A 2WV7A 4MQEB 2O7RA 3ZZ1A 4ENUA 3EK2A 1YFZA 4ZT7A 4EJMA 3VOSA 3RTDA 4ENVA 4BZWA 5BUCA 1DC5A 1V4NA 4ILEA 4R2XA 1O6BA 5J1TB 4TZTA 3DE4X 4KPGA 3JPYA 1CE8B 2XBMA 1DPFA 2BCGY 5CK5A 5B36A 2VCYA 3AI3A 1RM3A 5C1BA 5CYGA 4PTYA 3IEXA 1FXWA 1EGMB 2BHRA 1D2GA 2GK6A 1GPDG 1QOZA 1OC4A 1XKQA 2MWMA 2OD7A 1G18A 3NHZA 4FZ3A 3WDSA 1FNMA 1ESCA 1UMBA 1ZJZA 2CNNA 1T9CA 4PCLA 4PS1A 3IB6A 2JLRA 2WNHA 3R3VA 1P74A 2OLJA 3CEJA 4AXXA 1ATZA 1ELOA 2LW7A 2MIIA 3DO5A 2QGNA 3HVKA 4JLKA 4CCSA 3PXEA 1IJKA 4I5IA 4KITB 4NSNA 1JBEA 4S12A 1B2LA 1N25A 3IP6A 3VQTA 2ECPA 3LW7A 1UFRA 3I61A 2IQIA 5FT9A 2XE7A 1EP3B 3O9VA 4R2JA 2XIQA 1RVV1 4H27A 1WKVA 3NM4A 2D5AA 4F2HA 1J2EA 2K6GA 5D00A 2KB0A 2IBMA 5HM8A 1WMEA 3SNKA 4ZHQF 4ML3A 5DIFA 2W83A 3TQQA 3VYRB 2EQBA 4HWKA 5F3DA 3RJ9A 1SEVA 2XRFA 3R0IA 5EKSA 1O58A 5F64A 3C4VA 4TMFA 4IHKA 2ZBDA 2QZPA 3ZV6A 2IBTA 1NSFA 3TLKA 3BTOA 4KMMA 5EY5B 5DGHA 2EC5A 3IVRA 3QBVA 3GROA 1C0EA 3PPYA 4IOJA 5C8VA 5CFRA 4FB4A 3FG9A 1V7PC 1NY6A 2A30A 1WY7A 4FTWA 4BJ3A 3PEEA 1G7CA 1ZG3A 4HJXA 5ENVA 1FJXA 3GPLA 2UVPB 2ZE7A 3TQFA 4FDAA 1SC1A 4BLTA 1V7ZA 1J8VA 3T3GA 1O6ZA 3M7IA 3DOCA 4YP7A 4DHWA 1KK0A 1N6PA 5K51A 1S2IA 2Q7XA 5BO5A 3JQAB 2ODBA 4GC9A 3JQRA 4JBGA 4RK1A 4XX0A 5DNEA 4HVLA 1BXKA 5ITZA 3QITA 4D98A 2XUQA 1XG5A 3H0KA 4EW2A 2FHPA 2P65A 3VU1A 2JCYA 1IYZA 2PTHA 4OLBA 3VNVA 3AIMA 5B4UA 2GEJA 1E1NA 1GN9A 2X3YA 1H42A 4NFHA 3CEAA 5DASA 2HREA 1C9YA 3CISA 1D5CA 3MWGA 1KPIA 1ZOLA 3SQOA 1YKSA 3ZGNA 1PHPA 3MS2A 4YP6A 4E5PA 5TVGA 1RWWA 4ONEA 1IOZA 4EHDA 2WR8A 3JQ7B 3HU1A 4QXRA 2XZOA 3W6ZA 4N5HX 2H17A 3TDMA 3MJVA 1QNLA 4CBVA 1QF7A 5AJTA 1DTWB 3IOBA 3KB1A 3V4VB 1D6SA 3A3PA 3H5VA 1BH6A 1VCHA 2DPLA 4WLNA 1Y4AE 4EI8A 3K35A 1H05A 1UQRA 1CY1A 4WDQA 3LUJA 4OSEA 2LZ0A 2HF2A 1CVLA 4ZCLA 5L7WA 3UWKA 3HU3A 2WA1A 2C97A 3GJTA 2OHVA 2ZIAA 1U1DA 1L5GB 3DTYA 4BP8A 3GLGB 1VB3A 2GJAA 2Z43A 3GG2A 3N6XA 1IPFA 4KQ1A 4OLFA 3SY8A 1RJWA 1ZK0A 4QYMA 1W4LA 3VH3A 1QZTA 4NU0A 4QJ5A 2I71A 1ZMTA 2PS3A 3MLAA 5DBHX 1GTG1 1UDBA 4ZQEA 3QEAZ 1A1VA 4PAOA 1HEUA 4H77A 5H1YA 3TIGA 4B81A 5LQAA 1BVYF 4ATNA 1YDMA 3DKRA 4DV5B 3MPOA 2E4UA 5LZ5A 1UBMS 3I9V6 1EQ2A 1Y6QA 2G06A 3X1YA 5EJEA 1L5LA 3U0VA 3QLJA 2FEKA 2YH2A 4CFSA 5CT6A 3TQOA 4URXR 4AIRA 1TJ3A 2GPTA 2PZEA 2ID8A 2P77A 2YYZA 2XR1A 3D3EA 2AOXA 4RZXA 4YASA 5HKAA 3KQNA 2CDBA 3N1UA 4KPUB 4ESVA 4G9GA 1GZ6A 3BQNB 1TW2A 1A9TA 2Q28A 4TV8A 1W29A 1G8FA 4RA6B 1Q6YA 5FHQA 4EJ2A 1RM4A 1UEJA 1WXDA 1E3IA 5A62A 3I45A 3E27A 2X23A 3BXPA 3ONDA 4TTVA 2OKCA 2X0RA 5DHQA 1UDWA 2JVJA 3S3TA 3MN1A 2VTVA 5F7JA 1QVRA 3W5UA 2YXLA 1V5EA 4EZBA 2J6CA 5CXXA 5FO1A 4E09A 4LOKA 2Z6AA 4FD2A 1GFIA 3P9XA 2V8BA 1Z34A 3L84A 3F3KA 5DHPA 1PGPA 1AQUA 5CP8A 4B3HA 1VMKA 1UBNA 1YDWA 4HPXB 4BMDA 5IF9A 2JD0A 3EZGA 3GLSA 3T9FA 1N9GA 4W4TA 2QXYA 2YVKA 3P2JA 3KZNA 4E2WA 4WCDA 3EZ2A 1KJZA 2IYEA 4KPEC 2OD9A 3CNOA 3FCOA 5FJIA 5BYBA 4CEJB 4KP7A 4XVQA 4E4YA 1V8BA 3FSRA 2HMVA 1V71A 2GF2A 1P0MA 4P5PA 2VT3A 3AG5A 1I4OA 1BWPA 1PFQA 3K16A 4BB0A 2O8EB 4NS4A 1E1MA 1IG3A 3WX0A 4JBHA 3BFXA 2AFHA 1PW5A 4JOBA 1QGDA 2R7LA 2G72A 1ZOSA 3NHFA 3PJGA 3I04A 1P4GA 4Q18A 3ZNNA 4KKVA 1AGYA 1R9GA 3FDFA 3P5BA 1RWBA 1L4GA 3QNUA 4D9JA 3AW9A 3RBZA 3DCIA 4IY1A 3TD9A 5BSHA 1JKJB 3WBJA 5J40A 3NOQA 3NGLA 5KVCA 4ZU3A 3LGSA 4V1CB 4XWWA 3AVQA 1CUEA 3M6IA 2O8EA 4U4AA 3H7AA 2FSFA 3DQQA 3SBDA 2OO5C 4IFEA 1U2SA 4QQRA 1FUKA 2Q2NA 1QDUA 1W5AA 1TLFA 2B8TA 4QLBA 2OLKA 5JV5A 3LSYA 3ND5A 1N92A 1QC5B 4A0GA 2ZJ0A 5HGJA 3B1FA 1ONPA 2HWXA 3PXBA 3BZBA 4FFOA 2BZGA 2WWRA 3LW8A 3THRA 3VDRA 3CPEA 4RFLA 4RVUA 2D1YA 2D1QA 4ND8B 2DUUA 2YXNA 2WJJA 1R4AA 3GIWA 1FQJA 4ZC8A 3Q3HA 4YRKA 4L5CA 1Y6RA 4ROSA 5CMLA 1MVNA 5ICEA 1EWTA 1TEVA 4ARCA 5TQ2B 2X42A 4B7ZA 1MJ5A 2PRIA 1L7MA 4Q02A 3U3ZA 3GXOA 4HUTA 4F5EA 5K8JB 5FPSA 5KQGA 2YV3A 1X1AA 3FWHA 1UEXC 4O4HB 3S7ZA 1CK4A 1F2TB 2DPHA 2C07A 2CNOA 2FLVA 3BRWD 4W5HA 1ID8A 1CSEE 3X2EA 1WQ1R 4GXRA 3M2TA 3BIJA 5J63A 4AD8A 4BNYA 4W1PA 4IICA 4CG2A 2V7PA 1PJAA 1D2AA 2P4HX 3LVFO 4N4AA 1Z5ZA 2J48A 1U31A 2ATEA 2NU6B 5B58T 1CZNA 4LXXA 4QD3A 2EJWA 3KQVA 2W2NA 1WTCA 2C3YA 3G2IA 1V5GA 1X1SA 1PE0A 3AEXA 3EYAA 4K9LA 4WOCA 2OGSA 1L6RA 2HNKA 3SZOA 4CU2A 2X5JO 2XE4A 2ZM5A 3JZMA 3NDIA 4KAAA 4JS0A 1M8GA 2VNJA 4JMLA 1KC1A 2FW6A 2KBFA 3HZOA 1HI9A 3DTVB 4KVGA 1FC0A 3AEUB 3W06A 3O4JA 5HUHA 2X86A 1ZS9A 4MS1A 4Y1RB 2XTMA 4ZI7F 1Z7EA 2CL7X 3SJBA 5LZ4A 1E0SA 2VHQA 5G1PA 3UC5A 2YOHA 1RNLA 4YVFA 2PNFA 3A6PC 1VGQA 3AEZA 4MRPA 1FUYB 1UBKS 4P2BA 4I1YA 4KR3A 1RAGA 1E6CA 3R5KA 3NTQA 3I3SR 1PZGA 2IVZA 1KYQA 3PXXA 1MW9X 2DFKB 2DPYA 2I7DA 1CR1A 3L0CA 4KLNA 4GMDA 4Z0NA 3VOTA 2DVMA 5DB4A 3FCAA 4BO1A 2JJ2A 2OG1A 1AA6A 4Q3BA 5HKLA 3MAJA 4QJIA 2YY5A 4CM9D 3PJFA 3M0EA 4MS1B 1O54A 2HEIA 1QRAA 1B0UA 2JHPA 2JVKA 3TUZC 4BCBA 2FW8A 3KKEA 4UU1A 1I7LA 4I0WB 4UCXA 3WQQA 5CGQB 5D3MB 2QENA 1UANA 2Q4BA 4ZHSA 3OFNA 1G7TA 1VZ3A 3PUVA 3QSYA 1LDYA 1QTNA 3DNPA 1D1SA 2Z9BA 1H8ED 2K5UA 2WG2A 1AS0A 4UUMA 1O0CA 1PZXA 1KO5A 2XHZA 3CZCA 4ZWNA 5IH3A 2NZUG 3EZFA 2JFQA 3ZDEA 3KJXA 2IU4A 3EDMA 3OEHA 3INRA 5KPDA 3KEFA 4Q4LA 4YMIA 2O3QA 1WS6A 3NHAA 4FHGA 3AVTA 4AZ0A 1TCUA 3C6XA 4AC9A 1NXSA 1DTSA 3EZLA 1DQSA 1JFFA 3W0LB 4WN3A 3J81k 4R1OA 5HBRA 4D99A 1QO0A 2GA9A 1RYNA 2OHIA 4IGFA 4ITRC 3W78A 2WM9B 4OA5A 4C6HA 4EHKA 3W8NA 4CM7A 5HFAA 3RFXA 4LCBA 1E5VA 3ZS8A 2DOKA 3IAAA 2G9VA 2JAOA 2XSZD 2ZI9A 4LFBB 2OVBA 4HQ0A 4FUQA 4ETNA 2VH2A 3SX0A 4MUEA 3ZWAA 5IU6A 4U6QA 4CMAA 1T9DA 1P18A 2IY8A 3DHNA 1OXUA 3QFTA 4GBED 4JOSA 4M0EA 1USIA 4QEKA 4GLOA 5CFQA 4ZT2A 3B1WA 1E1QA 1TQHA 2CFIA 3ADKA 3THWA 3OFJA 3TM4A 3TTWA 3RNOA 3KOWA 4KPFC 1PLJA 4O1HA 4RDIA 2GAJA 3LPAA 4GQAA 2VRNA 2YHBA 4HRAA 4IIJA 3IKVA 4JB3A 5DK6A 1N8TA 2JPDA 2X7JA 3HJAA 3QUCA 3LP8A 4X1YA 3EVZA 5TJHA 2AR0A 3E9ZA 4MO9A 3W6NA 4CV0A 1H5NA 3UKJA 1XO1A 1KI7A 1R0XA 1V35A 4HGYA 1AT1A 4DJAA 1JKXA 1G6Q1 1N5OX 4QYIB 3IXMA 2HBYA 3NHMA 3B85A 5AJHA 2QG6A 5IN4A 3K9HA 5D8DA 2WKWA 1ZNXA 2YDYA 5PGMA 1MRZA 4XZ3A 3D3WB 5IVKA 1UPXA 4RVDA 4RMIA 5L4SA 2WJIA 4JGGA 3ZD9A 1FSPA 2CVQA 3DTTA 1TFUA 3ZKAA 4IVPA 1Q1EA 3PDWA 4HYQA 4QXQA 3ABSB 4XGQA 3CCCA 3IP3A 1VCNA 2IP1A 5T3UA 3WL7A 4DLZA 3QNMA 1DPGA 1YZHA 2YY6A 4Q4HB 2HRRA 2I4TA 5JQGF 3VTFA 2Z83A 1WZ2A 1XK6A 5DP1A 4HAIA 1ZU5A 3EASA 3HUTA 2EKQA 2SCUB 3ETNA 5LIPA 3G5LA 1V16B 2BZ1A 1JNYA 3T38A 3F2VA 1IM5A 1IY9A 1F17A 4YBRA 5GONF 3ROEA 3U0BA 3V4RA 2CDRA 1J2YA 3KUUA 3PA8A 4FEAA 1ZH0A 5JCZA 3TEFA 1K5DA 1U0GA 3TBHA 5KYWA 3TTUA 1EVZA 3QV2A 4L50A 1LA2A 3GPCA 4XD7D 2C2ZA 4KQ2A 3S0JA 1AK9A 1VG1A 4KXXA 5EJ4A 2MSDB 1JHRA 4JLBA 2H1LA 4IR7A 1NWCA 3CO0S 3AJAA 4LI0A 4A8JB 3HHEA 5AI9A 3RU2A 4R54A 3UOAB 4HH0A 5K0CA 2PR7A 4YIKA 2RSLA 2PUEA 2ZDGA 4PYIA 5DGIA 3U3RA 1OQAA 3NRCA 5CVDA 5EP1A 4IH1A 4JT4A 4BU0A 4W9MC 1ZD1A 3IBCA 4HFNA 2DBVO 1PGQA 1G5FA 3LE8A 4DS3A 3C4QA 1CB0A 3K72B 3QLVC 2WSYB 5DXJA 2RK3A 1KVQA 3QI7A 4MARA 4ZPJA 4U7GA 3OCYA 5JS2A 5JSYA 2X8BA 1SKQA 1TMYA 1CR6A 1VXRA 3QFCA 3SD7A 1Z0UA 3MGAA 3B2NA 2G1PA 1PS9A 2BF4A 3EIHA 1AA9A 3IDSA 5TRTA 3LMKA 3WTCA 1V11B 1IUKA 2P5YA 2E82A 4IMJB 4A27A 5DULA 1D2EA 3QEMA 5ICMA 1KNQA 2OFXA 2NO9A 2Z8YA 4IIGA 4CLXA 2PRKA 4JJ7A 2BHLA 3ESRA 5THKA 4GUDA 2D5CA 4BNHA 3THXA 3BFKA 4L6AA 4L4RA 2C7PA 2CMGA 1V5IA 4YO7A 1UK9A 2G1AA 4B44A 2DETA 1EFRD 3EZNA 1E1KA 2DERA 1UWCA 4TYPA 5GJBA 4DJEC 1JZTA 2BEVB 5LIRA 2IXEA 1ND5A 2D0PB 2D1SA 3S5UA 5T8KA 3BREA 2TECE 3FWZA 3CRZA 1MR3F 1U7WA 1TT5A 3HYRA 1XSEA 3PC2A 3I1IA 4QUDA 3T5TA 5AIAA 1TCAA 2HBZA 1VYTA 2HLHA 2RKBA 2ZUWA 3GMIA 1R50A 4IP0A 2RKOA 3E7PA 2BM9A 1EAMA 1GEEA 1HRKA 5ERXA 1BMFD 1W88B 2G36A 2JGDA 3R09A 4JB0A 2P75A 4N54A 4NECA 5HS6A 6GPBA 1OT3A 1SCDA 5HQ3A 3WRVA 1E2MA 1P2BA 4OKIA 4UJ5A 3WA6A 2ACWA 1XD2B 3I28A 4Z4HA 4BX8A 3K8OE 5KQSA 1JWLA 4KIWA 1QE0A 1Z3IX 1Z0DA 4URHA 2WP0A 1QJCA 4PE5B 2PGNA 1I1HA 1RQNA 4LY3A 4EENA 3U17A 2C5GA 4A5OA 1RP7A 4UJ3A 1IXZA 2CLLB 2PSFA 2A8YA 2W00A 6REQA 2JHFA 2VDUE 2ASVA 4G8BA 4C3UA 4KIFA 2XUOA 2ODPA 2OEPA 2NXJA 2GJ9A 1KAQA 3BRQA 1O6GA 1BDHA 4BECA 2W0MA 2J6HA 3I4FA 2CZCA 3KZCA 2CHUA 3O1IC 1LBEA 4AUEA 4WINA 2QL5A 3CYFA 4DMRA 1ZGCA 3QQPA 1JTVA 5HCNA 3A9WA 1FCJA 4MDHA 3JWIA 4E4RA 4KIGA 2YJ4A 4C0HA 4LZPA 4LSZA 1Y1TA 3OWOA 2GNOA 1LCIA 4W8OA 1ABEA 1EP1B 1SQGA 3BK1A 1NQTA 2XQKA 5C5IA 4MV7A 4YRSA 4F4HA 1OXTA 1E9EA 1H93A 4LSMA 4BNWA 4P7GA 3R41A 1M5UA 4RTSA 3DVAA 3UWPA 1SULA 1G8SA 5AW5A 1GU0A 4HI0E 4EVRA 3KAKA 4M1ZA 1GNRA 4PN7A 4EUKA 2ZJZA 5C5CA 4LG1A 1PFKA 3B1YA 2PZJA 2ZYRA 3VR5D 4I9FA 1PFGA 2G6TA 3GT7A 3KTAB 3ND8A 2B5VA 3OM1A 1LX6A 4K05A 4WXRA 2PXCA 4ALJA 3UJDA 2AG8A 1WV1A 2NAPA 3QLUC 4HN4B 4B6PA 1W36B 4C0KA 3PJEA 3B3JA 2OB2A 3LYLA 4HR7A 2GZRA 3VR6A 4CMGA 4W9RA 2LIVA 2WSSA 1GQQA 3TBKA 1A9RA 3CJRA 5CLJA 5LKRA 2PSSA 3E3OA 3P8ZA 4LHXA 3WY9A 2P78A 4R1UA 1OFUA 5GONA 3TXYA 4M21A 4RVCA 3LDFA 4BFUA 3R3ZA 4PG4A 4UU8A 4F8JA 4QVIA 3QBDA 2QV0A 4ZIRA 1A7AA 1XZLA 4NZ9A 1HBJA 2XDQB 1KR5A 2ZJAA 3M81A 1OX6A 2PKQO 3QKIA 2JIZD 2QTMA 1LLQA 1IHUA 1NP6A 5I7HA 1SN7A 1EVKA 5I9TA 3EMKA 4GX1A 2OHJA 2A0KA 4ZGGA 3SOZA 4RM2A 2R4UA 1D6NA 4XDHA 4EI2A 2AQ8A 3QFRA 4RA9B 3S2EA 3VVBA 2X58A 4W5NA 1VLJA 4MYSA 4BLVA 4EECA 4DRXA 3T5GA 1TAUA 5JS6A 3LA8A 1NONA 3EW9A 1VHJA 2DECA 3GDOA 1F9AA 2AN1A 4V1CI 4AY6A 7ABPA 5M5BA 1JH8A 1A4IA 2UYHA 3TNFA 2ZWPA 1OZGA 3PGA1 3NHRA 4DOMA 3UMYA 1DWOA 4LXQA 4B3MB 5HZMA 1AQLA 2GZ1A 1T3GA 3I5YA 1AK1A 3OE1A 3R7FA 1J1UA 2F4NA 2QDXA 2R79A 2SECE 4Q7QA 5GM1A 4AFNA 2R4TA 3CLSC 1YR7A 8AT1A 4X5OA 3AYXB 2XYHA 4CHTA 2CLDX 2QVGA 4RIGA 4RTPA 4MVJA 3FM9A 4FIDA 5K2OA 3EIOA 3KVRA 3A4VA 5BSFA 3PIRA 5LSAA 4P9NA 2OP0A 3X1DA 4HADA 5BUQA 1ISRA 2B1RA 3GWGA 1YS6A 3OY7A 5AW6A 2H7XA 2PKWA 3SKXA 2TSYB 4R8RA 3UCXA 4JODA 4PAMA 3ZK7A 1V7CA 1QDEA 2FEPA 2J0UB 2X0KA 3C1AA 1X0XA 2UVQA 4DLAA 1JVBA 3LLCA 4MV3A 5E6SA 1H23A 3CX6A 3C4JA 2JNWA 3COPA 3UXHA 1W96A 3ZE6A 2JFPA 4DLRA 3OPYA 4TWZA 1PR1A 4RGVA 3SHQA 1OH6A 2VP2A 1NA5A 1WF6A 1AF4A 3HL4A 1BIFA 3IP9A 3N7UA 5ARDA 3T3MB 4W5RA 1N2SA 2W37A 3CWCA 4FMDF 1QYDA 4FEGA 4AMBA 4JT8A 1AUOA 4MWCA 3QX3A 1PNVA 1S7CA 3LK6A 1AH2A 3KUDA 2PRZA 5HQJA 1IZZA 1JDBC 1QH8A 1BXRB 4B2IA 1TYDE 5F5LA 4KLZA 2CE2X 1GL6A 3TCKA 2EZ4A 3Q3EA 4EW6A 3FZYA 3IHKA 2YCLA 3IC5A 1J70A 4Q7JB 2I4RA 1MU0A 1AOXA 5E6RB 2DHRA 1Q0ZA 2R96A 4YRNA 4IIJF 3PK0A 1Y3DE 4MS4A 5JSUA 1KJWA 1WB5A 4QYTA 3TR5A 5KIAA 5LU8A 5HQTA 3KSMA 3TOCA 5FORA 2C7VA 2BGNA 3SHWA 4ZO7A 5AHRA 4IILA 1U8XX 3I2GA 2J85A 1UMCB 2Z9CA 4N8EA 5KDOA 2WIAA 3IT3A 1IEQA 3GFBA 2RH8A 1JNXX 3B1VA 1C1DA 3PXAA 4ZAXA 1XI2A 2IKSA 3CSDA 3HXLA 2WHXA 1DMRA 1RT9A 3O1LA 2QRMA 2PX0A 5L3VA 1CRZA 4C07A 1YCHA 2QTNA 2JEZA 3RSSA 1CUBA 2WVJA 2PZ8A 2XMRA 3BB4A 1IU9A 1FMFA 3B6MA 4MA0A 4MR7B 1NOJA 1TC2A 4RLQA 2JBWA 1JHPA 4MYRA 5AD1A 1YB1A 2XV1A 1DG9A 1G41A 3LKVA 4RIHA 1ORRA 1BJTA 1NKTA 2YHAA 3DPSA 5JD5A 3BDVA 2HRBA 1T9BA 4G5YA 4C4RA 3GLGE 1Z13A 3KCQA 3PENA 4GR9A 1SVOA 1OBCA 5IBQA 1R0WA 1JIIA 1LS1A 1B42A 3O8CA 1BHSA 1JKJA 3UA3A 2YYSA 2OGUA 2ORVA 4IZOA 2R11A 3A32A 4OY3A 1QYRA 5AM5A 1QV9A 4NH0A 3F6CA 1N9KA 3SQDA 3B6EA 4DV2B 2BM0A 2QXUA 4RF4A 1FDSA 2H3HA 3KYIB 4X1OA 1BXGA 1DJNA 4LJSA 1I8TA 1PK8A 4NULA 3TTTA 4JC4A 1GUAA 4KL8S 1I36A 1LFAA 4XSHA 5DCLA 1VIYA 1BCRB 4R3WA 4RETA 5FTMA 1ESMA 1OYOA 1Y89A 4BQFA 5HJ5A 3FHOA 3CVXA 2VTBA 1PVDA 1SM4A 1X0VA 1FNNA 3FIJA 3EZYA 2GN8A 3ZWMA 2IYYA 4LXIA 1KDYA 4PYLA 5JALA 4L5IA 3JTMA 5A9TA 2C83A 2RHCA 1I10A 3SMVA 4C01A 1E1RD 2QAGB 4TQUS 1YMUA 1O57A 1IPHA 3HYSA 1IZ7A 1XKLA 2VVTA 3BFVA 4FR0A 5TVKA 3UFXB 2H31A 4C6TB 2EKPA 3FTNA 4KXLA 4NMMA 4C0JA 1GZDA 3GA0A 4MLZA 3I1YA 5JDCC 4YREA 5LJLA 5HP4A 3ZTYA 1GZVA 2FPOA 2JH9A 3MMNA 2ZUEA 3FNQA 1FRFS 3UUEA 2G40A 1W5EA 1B8NA 3VNQA 2FE4A 2XE6A 2ZREA 4YJ2B 5KTTA 1WZNA 1EK6A 3MQ2A 3VTZA 1TU4A 1Z7BA 5JC1A 4X6LA 4DA9A 3ER8A 2R6HA 4AICA 2O07A 3H8VA 2XOXA 1QGAA 3D4NA 3GGGA 4BNJA 1BO6A 4EGCB 4OQNA 4CT4B 3OM0A 3BMCA 1GJRA 1XMVA 2JJ2D 1NXXA 4OU4A 1M8FA 1O0SA 3LY7A 4J3NA 1IPEA 5E3IA 2D2IA 1DADA 2V7UA 3RHZA 3MRXA 3QOYA 3EVDA 1UFOA 3LDUA 4OQEA 1J8QA 3O0DA 4AKTA 1U2DA 1X74A 1U2TA 1YZFA 2GCOA 5DRYA 3T94A 3WK8A 4G4SO 4PM4A 1BYIA 3VC7A 2ZI6A 5IXSA 2VLIA 3A05A 5BW5A 1Y1QA 2VQSA 5EOVA 2HIMA 3QHPA 2H1HA 4JUDX 3X1ZA 1NQAO 2YMLA 3HB4X 4MV0A 2GPAA 3RYFB 3NDBB 2G8NA 4R1SA 3AR5A 4IIUA 2VJBA 3T1NA 4E4TA 1SG0A 4DMGA 4L95C 1M67A 3BEOA 3DOHA 5AK3A 2OAGA 2JLQA 3GDFA 4H7EA 1UQUA 3ZIAA 2DUWA 1E4YA 3VI4B 5C7LO 3UPUA 5JQWA 5KHLB 3PYXA 4W1RA 2G9ZA 3AETA 3CLVA 3CNHA 1YR3A 1O89A 5NLLA 3IUEA 4PWZA 5IJWA 1O94D 2W6PA 4JLNA 1A9YA 2PBFA 1HNWB 1L5RA 3JWHA 3KDSE 4MUIA 3AZPA 4YR9A 3OX3A 5U4XA 3LXRA 1Z6ZA 2EKBA 4GLFA 5ESWA 1GGFA 1IE3A 2OILA 3GA7A 3OETA 2AG5A 2DFPA 3BMNA 1JWBB 1ZK1A 3JQ7A 5E95A 4OBXA 2VL7A 3SEQA 2Q5IA 3O4GA 2WWYA 2OYCA 4WY5A 3TLJA 4DL9A 1ISMA 1U9IC 2QQGA 2GCPA 3I2JA 3TFQA 1GV1A 4CKZA 5TMBA 5KS2A 2RE8A 1E1QD 2A59A 2HKIA 1QLWA 2IUUA 3KSUA 1W581 4ER5A 4H3HB 2IIVA 2CL0X 2IIQA 3ZGZA 4ZYUA 4HGPA 2FWNA 2ZSJA 1RHKA 2BFDA 3OQ6A 2MSEB 4WY8A 1JG3A 2YC2C 3MMZA 2CVPA 5M34A 3E61A 3Q7QA 4L6IA 4AX8A 3PVSA 3GPBA 3TZKA 4E6PA 3OCXA 4ZOEA 1P1RA 3KIPA 4S1PA 2NU9A 5H3HA 1GAWA 1BW9B 4FEYA 3GDGA 4HQKA 4CM1A 3H97A 2V3VA 3VJRA 2E0IA 4HB3A 4JLPA 2RGYA 2A5LA 2J0QA 2QG4A 5B64A 5IK2A 4A8JA 3IPXA 1XA4A 3DHYA 5D3KA 5LQSA 1HETA 1HURA 3DVSX 4UDOA 1JUDA 2HSEA 3VVLA 4BNDB 1OX4A 1P4JA 1RHQA 3BCSA 3LWZA 4AG6A 5HHTA 2B25A 1ZR2A 5BQ3A 3DAPA 3UM9A 1RMTA 5LZ8A 1OFHA 1SZPA 2HDOA 3R0ZA 5EHGA 3IMGA 4IXNA 1JMVA 3R0JA 4TMZA 3S1SA 3DBVO 2IEIA 1UBSB 3TVDA 5HJ7A 1GGJA 1QH1B 3IRVA 5KC9A 1NRJB 1XTSA 1TK9A 2V8OA 5AMXA 3HU2A 4GP6A 4NU6A 4O2RA 4CDGA 1LTHR 1YIAA 3LYUA 1K6XA 3PRJA 3WGMA 1UMDB 3GFQA 5CTAA 2A14A 1BJKA 2ETVA 4DSTA 5IASA 3B3AA 3RYFA 1KA9H 1S3FA 3G2HA 4NAHA 3QUAA 1N3YA 1O9HA 1KYZA 4H35A 2OK8A 3HJUA 4ZDWA 2FCAA 3JQBA 3JQPA 4GLJA 3O90A 2BRUC 1NUUA 2GBLC 3FFTA 4DZZA 1KETA 3AHCA 1ZGGA 2JA1A 2XZPA 4LVNA 1K08A 3I8OA 5CLLA 4YNBA 1JLHA 2BZ0A 1JQKA 4OK6A 3L7IA 3MRTA 2B7BA 2V5AA 3PRKE 3FR8A 3AUSA 3KZVA 3GK3A 3JQDA 4TTIA 4AROA 2QB5A 1KBOA 1A9QA 1NQOA 1TLTA 1UPAA 2VWQA 3L5KA 4IJ6A 4IX1A 5AWFC 2F8TA 1JEQB 1N2ZA 4HZUA 4GKVA 2JLSA 3JWPA 1M8JA 2OBYA 3AR6A 5H68A 4ZT5A 3CGGA 5DN9A 3RF6A 3G9XA 4D0RA 3FVQA 1YBHA 4D4JA 3KLOA 1GV0A 1Z0FA 3GJ6A 4H0NA 2IV3A 5KVAA 1AGPA 3O95A 1S5PA 2RGXA 2IXFA 2VZ0A 4KQCA 5FPKA 1G55A 2VHYA 3Q7RA 1K92A 2Q07A 2FV8A 2IUTA 1WZCA 3H16A 3H1TA 3QXHA 4RL4A 4RVHA 2HLPA 5LUBA 5LP6B 1U4SA 4QGAA 5G40A 5BURA 4B3SB 2Q3MA 1W36D 3B48A 3D8BA 4GP7A 3MUNA 1FQKA 5KX5A 1QONA 2QSYA 1CFJA 3P9YA 5LXTA 2EG5A 5IAAA 2NTNA 4NBLA 2VK1A 2IYNA 4ZARA 2UUBB 3VNRA 1A9OA 1W93A 1Y9AA 4EHHA 3STVA 1R6VA 2B4AA 3L4JA 1G20E 1V48A 2XJ4A 4KWCA 4FFPA 4CIAA 2DPGA 3MTEA 4H7HA 3WKAA 1W1IA 5A6SB 1UBFA 2IEBA 1DVRA 2VCEA 1W8DA 2OCKA 3L9XA 3GB9A 3THSA 3NC4A 4TTTS 2OCLA 3T1HB 3RRBA 4IH9A 3JCZA 3E3LA 4JLAA 2YZ7A 1ZIDA 2WFLB 2CJYA 1P0CA 1JHYA 16PKA 2HD4A 3A8TA 3CLRC 1S8AA 3EVNA 4HT3B 4JI2B 2G7MC 4NVRA 5A02A 3AYZB 5ALMA 5L3SA 3NATA 3KKKA 4R2MA 4DQUA 3DLTA 3R6LA 4J90A 3UUFA 3DBHB 3MZ0A 1QX4A 4O4HA 1J21A 4Q3DA 4IJMA 5FB3A 3KAJA 3JALA 3MTQA 5CCEA 3NJ4A 4LRYA 3BD6A 2WWWA 4QLOA 1NU8A 3UGQA 1RJ9A 1FNSA 4L6CA 2D0DA 3DO8A 4G0OA 1DBWA 1SHUX 1E3TA 1YL7A 1Z6XA 2E3JA 2WYHA 4R81A 4HGZA 3ZE2B 5FOQA 1B6GA 1M2JA 5DPMA 1XALA 1TGVA 2IZ6A 3K0HA 2M32A 1KY3A 3BBLA 4ZOLA 3RPEA 4L73A 5AVWA 5DWVA 3AM5A 4J9UE 4H6PA 2PCJA 1U65A 1AC5A 1S2GA 2Q45A 2P6UA 4PLHA 4UTNA 3MAAC 3DZHA 2EJCA 3QG5A 1X7WB 1R6XA 3L6UA 3G82C 3Q3IA 4L7QA 4QFMA 3ZU3A 4KK4A 4QUBA 2JG3A 1UZMA 4ZCTA 5I7SA 1NAHA 1BRMA 1NPDA 1HLGA 4UDYX 1P73A 4IQFA 3WHIA 4GM0A 3ZKWB 4PN3A 5BVHB 2J08A 1A76A 1T4BA 2Q9AA 3BJMA 2WUGA 1MP0A 2XMPA 4WNIA 2X0IA 3CLKA 1IXSB 2NOAA 1K7EB 3DBLA 1N5MA 4FOOA 1NW8A 1CV2A 1K5GA 1LDGA 2PO5A 2BFEB 4JBXA 3D5TA 1SCUA 4OLAA 5LOVA 3PX2A 4IRXA 5IAEA 2Z1NA 1ZO8A 3DFZA 3L0OA 1Z06A 2BFBA 3LCUA 4LZAA 5CTJA 5M2QA 2OHGA 3CR8A 1P44A 8ABPA 4JJ6A 3IQDB 2CDCA 1CNEA 3KB8A 2E4ZA 4KIJA 4RM3A 1G5IA 2O2XA 3TAHA 3ZPXA 3V2HA 4FQ8A 1PNTA 1AUVA 2R6R1 3JZFA 3NFYA 4KE7A 2HYDA 2O1WA 5C7OO 2HZ7A 4DB2A 1B3RA 3FKJA 4PNPA 3B70A 1GIAA 2VK2A 3I01A 3AI7A 5EIFA 3ZDQA 1E6WA 4ARAA 4ZYVA 2R7NA 4QA9A 1JU4A 2CXSA 2C7GA 1Q16A 1ZEMA 1E3QA 2F9MA 3AU9A 5AQEA 5T8KC 4BOYA 1A1SA 4ZTBA 3U3KA 1FX0A 3HDQA 5A3JA 2N3ZA 1U8EA 2RI6A 1XCLA 4DIMA 2B69A 4ALMA 3AVYA 5MN6A 4PFSA 4YRJA 1OLUB 2CXUA 4Z7JA 3SI7A 3UMJA 2FLKA 2OV8A 1X77A 3TYXA 4DSZA 1EA5A 3A6DA 1KZYC 4G0QA 3OKPA 4OLJA 2E89A 4EB3A 3FZGA 3TCXB 5EHZA 3PSHA 1OXSC 1QHNA 3GT4A 1Y7IA 4Q1DA 1FYVA 2X2EA 4E12A 3DZFA 3HKEB 5CX1B 4N0DA 3IQZA 1UCFA 4RENA 1V9CA 1UT6A 3HP7A 1F2DA 2A58A 4XIYA 1MABB 2H1RA 1JZQA 4Q15A 1JSCA 2WHEA 5NULA 2I4IA 5G4LA 3BF8A 4DJJA 3KJNA 3ER6A 2WYUA 4HDMB 5KB3A 3K1JA 4L3VA 1PYGA 2NP7A 1TM5E 4JJEA 4C22A 1RD4A 2JLUA 1DAOA 3E81A 1KOJA 3F67A 3KPJA 2C1XA 2UKDA 1SC9A 4L9AA 4RWEA 2IPXA 3J7TA 3WMWA 1GU7A 1GZ3A 3AQ4A 4IZ6A 3ZJVA 1LDEA 2WUEA 2OM2A 3CT6A 1MQAA 3HHPA 2ZUCA 1CUHA 3GFOA 4Z9BA 3LUFA 4PYNA 4F4CA 3OJ0A 3GJ4A 2WZBA 3ZQ6A 3ETHA 4J7AA 3KZMA 5J4KA 1H0KA 5IDYA 3L8EA 3SU8A 2GYUA 3OPXA 4S1NA 1QRDA 1DAKA 2JDID 5I9NA 4M8KA 4HQFA 3HDVA 3NWJA 4ODIA 2DWPA 2I4OA 2Y9PB 1JJAA 4OO3A 3X43A 5LU9A 3EPJA 3LBNA 4LKRA 1UJBA 3KYCA 1QZZA 4BASA 2I55A 4C87A 2CLKB 1E0KA 3W6OA 5LQDA 3UB4A 1JG4A 4E08A 4RD0A 9MHTA 4D92A 2O3RA 1NWHA 4US0R 4WN9B 1LW7A 2XF2A 4KCGA 1Y3HA 1YZGA 4KLCA 2R8ZA 3AG6A 4CNQA 1S8OA 1NGSA 1C7JA 1GHTA 3KQYA 2MYUA 2WJAA 4G9EA 5CFOA 3FJYA 5DI3B 2WT4A 3WMFA 1T1IA 3MJRA 4WKBA 5ALLA 3R77A 1CG6A 3SE7A 1BE0A 2AOWA 3FXAA 4R1TA 3BF7A 3OZTA 2O6LA 2Q5HA 3QSGA 4N6OA 4RULA 2ZI5A 1IBMB 1SUCA 4TMYA 3OZGA 5A0TA 2GK4A 1TD1A 1Z45A 2VRCA 4RH1A 5JCPA 2QTBA 3Q1KA 4DAEA 3TW4A 1UFVA 1GL9B 4J0GA 1YJ8A 4U7DA 5LR6A 1GVHA 5ALYA 1XFAA 4Z7OB 1JN0A 1NXOA 3MSCA 2Z6QA 2H54A 1F6DA 1Y7LA 2DWOA 1QHXA 3NV7A 1DKQA 3PJDA 5EERA 4BZZA 2NTVA 3GHYA 3U3DA 2F3PA 4X8MA 5LWHA 2A9QA 2D0IA 4FZVA 1YQDA 5AVTA 3DZJA 1KOFA 3MJ4A 3C74A 4OXIA 1G9XA 3ZIUA 2FYTA 4RTRA 1CJTC 1XZKA 3Q10A 3WK9A 4ES6A 1ZM3A 3L8YA 4Y1EA 1PQ4A 4WCVA 5BSMA 2X8JA 2XGOA 1RHMA 3QLEA 3IP8A 1XUOA 1NBMD 3BE8A 5LBIA 5TR9A 4OX9Y 4QYSA 2XMDA 1BOFA 3ICOA 1N1EA 2IU0A 4EB8A 2WU4A 3ESQA 3M4YA 4L0QA 4LXYA 5A9SA 3BAFA 4ZICA 3H0EA 1ZIPA 1R8JA 2VYQA 1DUIA 2OSBA 4CL0A 3FNFA 4L22A 2VUHB 5TARA 3HVHA 4D74A 1CD5A 5KX5F 3OECA 4IZIA 3KYBA 5JI3E 3GRKA 1K2WA 3IMEA 2WW8A 2WHYA 4HFJA 4BWGA 3LAWA 5KEIA 5AI0A 1DOZA 4HWSA 1JBQA 3SBEA 3A04A 1P1FA 4A5SA 4IG9A 2FJPA 1VCMA 4ESOA 1U90A 1YJBA 2XYGA 4XRGA 1Q57A 5JU6A 2EGUA 3W2IA 1R15A 5BN1A 3AUTA 1JFSA 1E9SA 2Q3DA 5KWIA 3AIIA 2WWXA 3NNDA 3NT4A 3WDKA 3AY7A 4A0RA 1VJ0A 1GTSA 2ID9A 3UB3A 2FFBA 4DTCA 5EEHA 2PGXA 3EQ7A 3G7NA 3O3OB 2H65A 1OUMA 3H11A 4WDRA 3ZC3A 4DVGA 2BBSA 2EYQA 2AJDA 1QG4A 4JOQA 4K86A 1H3FA 4LTMA 3W9BA 5A4JA 4OQMA 4EF4A 1AKYA 1TNDA 2X4IA 3V4ZA 5A5FA 2PUFA 2FY8A 1E2UA 1GRRA 3A6JA 3CLTD 4FFDA 3FUVA 4ZKEA 4REQB 3LG2A 2ESRA 4M7WA 3TFWA 1DTWA 4Z0TA 4C7BA 1Y98A 4WK6A 3NDJA 3TI9A 4YUYA 2OCIA 2NPOA 1U6KA 2BM8A 1D1QA 1ZLXA 2DX7A 3AETB 2Y8EA 1E58A 2WU1A 4JYPA 4RIIA 4P81A 2QGFA 4UZSA 3BGDA 1E9RA 3BTSA 4JVOA 1T0BA 2YV5A 3R9IA 2L42A 1QZUA 3CUYA 1FFHA 2WQZA 3MNFA 3PC7A 3OQNA 3O8QA 2REBA 5EIAA 4MRVA 3ZJ5A 3NC1C 5HR5A 5JLJA 1RJFA 3RV3A 4RTNA 2H5IA 1XROA 1TO1E 2IS2A 1W4AA 4RACA 2YFQA 2QP3A 3OPQA 4HNSA 1XTPA 1XYVA 4D9MA 4KO3S 4M0MA 4GX5A 4BC1A 2EX4A 4B45A 3LSTA 4UCWA 1T35A 2OBMA 4PRKA 3BM5A 1KYWA 2OHHA 3FF4A 3NKVA 3IT2A 4FQ5A 3NJ8A 1DV2A 4AYTA 2WYWA 4V1CA 5JS1A 1O9GA 4EGQA 4KXVA 1B23P 4G0PA 4B32A 3O4FA 2P6MA 3HB7A 3IUMA 5I5EA 2OCDA 3DZKA 1HE2A 3KE8A 4O33A 1QUEA 1K86A 1W2WB 2DT8A 2ZFUA 4KYTA 4G8JA 3AI1A 4M1WA 4B4KA 4BRWA 1U9ZA 1E2KA 4BVLA 1JLKA 4X91A 4Z0PA 4CIYA 1K66A 3C48A 3MSXA 3P5SA 4HBGA 5K2MA 4D0GA 2GPYA 4MDFA 3TSOA 5FIUA 1RXSA 4ZMRA 4QU5A 2E1RA 3K70C 4Y6PA 3DLIA 3NR2A 2QRGA 4QFCA 5AXDA 1PR3A 3GX1A 5BV1A 4H0FA 2O59A 3NBUA 4N0PA 4FOPA 1G9TA 2WE7A 1XTJA 1ZJ5A 4Q4DA 1XFDA 4UHFA 4JVMA 1THTA 4K6KA 3H9QA 2A1TR 1E59A 4K81B 1QRUA 5C9ZA 4XJVA 2AC7A 4O4JA 1YE3A 4HOYA 2R48A 4IVRA 1BXRA 4WESB 1PL6A 1UZAA 2D1RA 4R0NA 2O6HA 5HF5A 2H1OA 2HYIC 1QIDA 1JSLA 4QPNA 4TTRA 4W8HA 1LWNA 2C31A 4HH4A 4PQRA 1PL7A 2QZJA 4XI9A 3K4HA 3P2EA 4IGAA 4DRYA 4B17A 3LF1A 1TTHA 4PGMA 5C7IO 3KUKA 6LDHA 221PA 1TRHA 3NP7A 4PZEA 4D9KA 3BK2A 2O52A 3T7RA 4C4XA 4NCNA 1WB6A 1H2RS 1P9OA 3KJGA 5EHQA 3A3YA 2A88A 3T3PB 4G1CA 1F8FA 4F1KA 3HWRA 1S01A 2XUDA 1N0UA 4HDOB 4FGZA 4CDNA 1JYSA 4JH0A 5F1YA 4XGIA 3ICQB 3PFGA 4B9EA 1U2PA 4WJLA 1SMKA 3DEJA 4HAYA 2GD0A 2J09A 5EUQB 1E9BA 2WK1A 2VJLA 5EMKA 3VAYA 5BMOA 4IDBA 2O19A 2J30A 5DYIA 3URKA 5ILGA 1W34A 1WVMA 2EZUA 4RFSA 3G23A 1V4BA 1ISJA 1KI8A 4FVTA 3JD1A 4K7JA 4AUMA 1ZW6A 3UJNA 2OXFA 3BMXA 3OMWA 3AINA 1VGRA 1QB8A 3DHVA 4ZO8A 4MUYA 4EHAA 5K99A 1RCFA 2ODTX 4LYGA 2AS0A 3B9RA 3RODA 4CFYA 4D6XA 1S1MA 1ZUWA 4X66B 3EHDA 2WT9A 3CXUA 4RORA 1U2GA 3JZAA 3AJDA 1P1JA 1WAMA 3JARA 3QJ5A 3AU8A 1EE9A 2HHLA 1MOZA 1E5LA 3TSWA 1CJKC 4EZEA 4FCCA 4IZHA 3WHPA 2AMLA 4XOUA 2HJSA 4K9KA 1A9ZA 4L9WA 3K6KA 4UVIA 5D3QA 2UUPA 5KU1A 2P9JA 2ZB7A 1Y8RB 4GBGA 1LB1B 3Q3JB 3H4IA 5KTRA 1I6MA 5T41A 2OP1A 4IDFA 3H9EO 3G2KA 2R25B 3IHWA 4HVAA 4P4SA 2JLWA 1ZOIA 1ZVKA 2A2ZA 1OH8A 2YRFA 2ANCA 2I65A 4UPEA 3OT5A 4BMSA 4Z4GA 1G16A 4FCVA 2HRZA 1Q91A 4QU8A 5ITSA 1SXJE 3W3AD 1WZUA 3E22A 1US8B 3H75A 4XYGA 2F17A 4RD6A 4LHWA 3DL7A 1SCAA 3PF8A 4QPJC 4RD3A 5KI6A 3P4XA 3L0ZA 4OJKA 2IPMA 1H9AA 3R9KA 2V59A 2BL4A 1JU9A 1ADFA 3A6LA 4I3GA 2M6SA 2VJNA 4BO0A 4CF7A 5JFOA 3HLYA 4EYQA 3IIKA 3OMXA 1L7VC 1I7NA 2AXEA 3NOVA 4MOWA 5F76A 4A0FA 5JSHA 3V33A 4GOMD 3DMNA 4P7FA 3RSOA 2W6MA 4LKOA 4QNNA 1RKQA 2VYFA 4PIVA 2Y1OA 3DS8A 4CI9A 3Q7EA 1M7HA 2J46A 5WRFA 5F7XA 4LF6B 3L5OA 3TQCA 4R8LA 4BMVA 1O96B 1LI5A 3NT2A 3OLCX 1L5KA 5T4HA 5D7BA 1I2MA 2F3QA 4GEGA 1X7YB 4YS6A 1ILEA 4JKYA 3AEYA 5B6IA 3W5DA 1EFVA 1UC8A 3EWNA 1F4PA 2WJGA 1E3DA 1VL8A 3OZWA 3CX8A 4P4LA 4TROA 2YC4C 4RMGA 2NV6A 2GT1A 3AUUA 3OMLA 5G1OA 4AWBA 3P2KA 3ENQA 1T4GA 1GQFA 4G97A 3OP4A 2J3EA 4CETA 4CV1A 1O77A 1VZ2A 1X7WA 3MYRA 4GPTA 4C43A 1MQSA 3U5TA 1A3CA 1QBGA 1NP7A 1MCZA 1ODJA 3F5FA 1P19A 2UAGA 3DDZX 4EY5A 1FNDA 2CV2A 4M36A 3UJ9A 2QX8A 2OLEA 3IBTA 1PSZA 1R0YA 2ZCUA 4OMCA 4P93A 2OXTA 3CN7A 3KEQA 5KUTA 1IDN1 2BKAA 3ENVA 4N7MA 2PCLA 5IUNC 4C4OA 4IIFA 4RS3A 4ZPXA 1V0JA 4R5MA 1TVEA 3RS2A 3QF4B 4ER6A 4MUFA 3UAGA 3HVUA 1Q74A 5CXQA 1G5PA 1DXYA 1R0KA 3T0IA 4XVRA 4DQXA 5EE5B 1YF3A 1T6ZA 1U1IA 3L7BA 1YRWA 5AM1A 1KARA 4EG0A 5B1EA 2ZAYA 4A1FA 1EG2A 1QGYA 3EEIA 3L7LA 1NT4A 2BFWA 4OI4A 4F60A 2YVAA 3A7EA 4OMDA 3SR4A 1SUSA 3JQ6A 3SEZA 4ARIA 2ZJ7A 2WJWA 3A3NA 4EA8A 3ZJYA 4E2XA 5IAGA 4LSGA 3IE0A 3WHLA 2FDXA 1EM8A 2UYOA 2ZTLA 2EWMA 4L16A 4OLHA 1I4TD 3H13A 3R5JA 5K3BA 4OHBA 4Z8YA 2XODA 1OZAA 1ACJA 1NJ6A 3G6KA 4YWJA 2WU3A 3SK0A 5C18A 1M6EX 4PO3X 2PZMA 1WD5A 4NJOA 1DE0A 4GVPA 2OO7A 2H1FA 4WPGA 3F4LA 1OASA 2CJFA 2AMVA 1U0SY 2VPWA 4TRRA 2BDUA 1NNLA 1QNFA 3QUSA 3E9YA 3Q7IA 3PXUA 4YYEA 5ICSA 4M0FA 4HL6A 4Y30A 3W9YA 1NBWB 5J5CA 1E20A 4YN3A 5JWOA 4N40A 2EBHX 3WMXA 4M7OA 3BQ9A 3QELB 1TIKA 1W75A 2EBFX 2WD9A 1QGOA 4GOKA 2JZCA 3E2MA 3TM5A 2R6ZA 1VIVA 1T9KA 4PBTA 4DWWA 4CKEA 4EFNA 4JIMA 1MABA 2YINC 3G88A 4M60A 1NIJA 2XB2A 1JXAA 3VMMA 2JLYA 1RXEA 3P45A 3WR5A 1T8UA 3WYDA 5I9LA 3FFBA 1WMSA 3WIVA 1BEUB 2VYVD 2ZYVX 3DDNA 3BHIA 3PKJA 3DMGA 3S29A 3M4XA 2FK7A 3AVWA 3KOXA 4G24A 2PZBA 1X80B 3RIMA 2ARKA 5FR2A 3OT4A 2HO4A 4Q21A 2CK3D 2BMAA 5F73A 1B8PA 1L9KA 1VTKA 2NTEA 3PZBA 1E5TA 2QLMA 1MQ9A 4G0XA 3E5NA 4BLUA 2GZDA 5BVGA 3VC3A 3QVXA 1Q3HA 1JYEA 1GSAA 2O8NA 5ES4B 3BSSA 3SAJA 1BMFA 4D8WA 1F51E 1YRBA 3PGLA 1ECLA 2FPXA 4F85A 3WHKA 2WFMA 4PXAA 3MS7A 4CUKA 5BYKA 3FBGA 2QN7A 3WB1A 1I7QB 4D41A 1XEAA 1HFEL 2OO3A 4J0HA 2WAAA 4LF7B 5CIWA 4ZQFA 4RZUA 3E4CA 1J5XA 1U80A 5C32A 2RH5A 1VSBA 4QYXA 1N2CA 1T8WA 2J7PD 4W7IA 3HYNA 1QU2A 1SUFA 4O4IA 2QN6A 2O8BB 2FPIB 3EGEA 4KWTA 1PZNA 4O5OA 5F52A 5F7ZA 4BN0A 1PD0A 3WGQA 1RKUA 3ECAA 2ZAOA 4KK3A 4OA8A 2Z98A 3U4GA 4MAFA 2XT0A 3NOXA 3GUZA 2QLBA 5CIQA 3D1VA 4NY1A 4FMDB 3ZIAD 4COKA 2IHBA 1V4VA 2HBRA 2I6XA 1CR4A 1UXOA 4R1LA 2YASA 2DR3A 3ZXYA 1CUGA 2J3LA 1QPBA 2EL9A 2PR2A 4XR4A 3LNCA 2RHLA 3PEFA 4ALNA 2B0CA 4UEOA 1NUAA 1EEHA 2DTEA 4XPIB 2QWXA 2R8YA 3L07A 3KZ1E 4PYMA 3C3KA 1N0VC 2XX3A 3ROQA 2PH7A 2PUHA 1L8LA 3SHFA 3ZCSA 3WYNA 4TSRA 1D9ZA 2FMUA 4HO1X 1XRJA 3U40A 4JUIA 2GYYA 4H6VA 1TZBA 3G0HA 4U7HA 1JFFB 1N0IA 2ONZA 4G1VA 1PT9A 4Q1FA 5GY7A 4DZTA 1U2QA 1WCYA 3A4LA 3JRNA 3HADA 1Y8ZA 2O1SA 3OX2A 3VR5A 3REQA 2RHOA 5F2NA 3O8DA 3BJIC 2CNLA 3REGA 4M9CA 3WWOA 2DT5A 3I39X 1Z28A 3DB2A 3QPVA 1CTQA 1E8MA 4H16A 5AOAA 1II8A 3T5CA 1TIBA 2WB4A 2NW6A 1MB9A 3QE2A 2AIRA 4V38A 5DF1A 5KQRA 3IV9A 4NYMR 1JHUA 1V43A 3USCS 3NONA 4UTVA 2EBWA 5LDHA 5IT0A 3OQVA 1LTKA 1SC3A 3RM3A 1KSGA 5FDFA 3OTWA 3S2UA 4TKVB 1KYYA 1X1CA 1K0FA 3I52A 4KWEA 3E9RA 4O2AA 5EZSA 4DA8A 3HNPA 3DLHA 1XD2A 4S1TA 1NW6A 5FA8A 2E5LB 4OYHA 3UMRA 1KAHA 2ODWA 2A9KA 1DQRA 1LXCA 4D5GA 2MMGA 1UKYA 2DMRA 3AKYA 1HGXA 3W5BA 3AFIA 4C78A 1W49A 4GI1A 4UAUA 4MDEA 1XZQA 3ROKA 2BCJQ 1AKVA 1P8AA 1XK7A 2HOQA 3H86A 3HZHA 1VG8A 3LHDA 2C4VA 3MJCA 2NAFA 1MH1A 1BFDA 2HK7A 3FOBA 4QUGA 1TMKA 2B8EA 2DFNA 2W93A 3O83A 1ZGHA 2C03A 2I8AA 3Q8XB 3QX9A 3SZ3A 2PUAA 2O0JA 2FZVA 2AL7A 1NDUA 4N7RA 4RKWA 4BDSA 3H17A 3O1JC 3L1UA 1Q95A 1RLOA 4KBFA 2MINB 4JASB 1PR9A 2FEMA 3RDPA 2ZYTX 3NXSA 2XMBA 4FJ1A 4TWJA 5AI6A 1Y1RA 2BH2A 3QOXA 4FBMA 3AUAA 4TLCA 4YPVA 5K45A 3FPGA 2FAXA 3PYMA 3T1OA 1EUQA 4JVNA 4NYIQ 3W5SA 3RROA 1XBTA 1WPGA 4CMEC 4KDEA 3NUQA 5DLPA 4MQFB 5BWMA 4ID3A 4RK7A 1ZH8A 5F2KA 2IDKA 3GAZA 4EI7A 1TM2A 2NXWA 3D43A 3LT2A 3RS3A 3UXYA 1BX3A 1ZCAA 1LJLA 3DVRX 1KEKA 1RRPA 2Q9BA 4ESEA 4ETWA 1IVYA 2HK8A 3U4DA 4JKIA 2CKDA 1GNTA 2ZI7A 4ENTA 5ELMA 3RHFA 3V6LA 4JQSA 5EAIA 4CKWA 1A8SA 2O2CA 2GPWA 2BFBB 1M6YA 3OD1A 4Z3KA 1L7NA 5AKZA 3N2GB 1UFQA 5IULC 3MTBA 1L5QA 2GJSA 3EQ9A 1PV1A 3ICVA 3C87A 5LJIA 5DBGA 1A4RA 5JWRA 2AZTA 2QUIA 4A2WA 4W8GA 1S02A 4LVOA 2ZRHA 1QK3A 2JJMA 4WNCA 2WY2D 3AW8A 4BFCA 1QKJA 2OO5A 1TQ6A 4NFYA 5DSZA 1AB5A 2QZ4A 3S2ZA 3PX3A 3CIOA 4MW2A 1Q19A 5MDHA 2E4WA 3EIXA 3DFFA 5KOYA 3WJ1A 1CUZA 5JECA 4ZVLA 3ZHSA 5JRZA 1WMBA 2X76A 1IXRC 3QPCA 3GPDG 3OBIA 4RPKA 4HH1A 2XD4A 4MSUA 2W8ZA 3S2FA 4DGQA 2VQFB 5FA5A 1T2NA 2JJ1A 4EHIA 2YN2A 1RW4A 2ZRDA 4Q7KA 5IAJA 4ARVA 5E6RA 1XHEA 1LK5A 1HT1E 4ANFA 4EGFA 2G1KA 1Z4NA 3VAZA 2AUTA 4XRRA 1FW8A 2IVFA 3CX4A 3T7TA 1KOGA 3Q6NA 1XVAA 3NLLA 1YONA 1VLZA 1E3WB 2ZU0C 5JJKA 3TZBA 3WMRA 1YR9A 4GIBA 3D81A 2C77A 3EFBA 3GH1A 3JZDA 5H4HA 3WGYA 1SIOA 4DCVA 1YQUA 1XE3A 3RC1A 3G0BA 3LOQA 4H4CA 1XTKA 2ZRQA 1WXFA 5EKUA 3WXBA 4I5DA 3S2YA 2NPIA 2H57A 4A15A 3DR3A 5HDQA 4F97A 3NANA 1AQJA 4MGYR 2ZS7A 1KH3A 1ZNWA 3W2GA 2V03A 3AY0A 1ZWKA 4JUCA 1HUQA 3HJHA 4OGKA 5CGZA 5GV7A 3H42B 4IX9A 5L3QA 1MJHA 1V2HE 3AO0B 4NF2A 4BWFB 2B9VA 1JJFA 1CUXA 3GNSA 3GRYA 5HIAA 2H92A 1QP0A 5CVUA 2EW8A 4TUYA 2BBOA 3T3OA 3GJ3A 4U2GA 1NM5C 3CVJA 2YN4A 4QOJA 3WSVA 1GOTA 3UH1A 2ZXEA 4DIDA 5AVXA 3U19A 1K7FB 3A70A 1NQXA 1RXCA 4JDPA 1F0PA 1XQ9A 4BMCA 1DU4A 2L0XA 1ZBDA 4ZXFA 1GYPA 4U8HA 4YR7A 2XKAA 2F3TA 3H3FA 4XSVA 5E7IA 4D8VA 3OZBA 2WF9A 4Q1BA 4IJVA 5ALGA 1ODLA 1T2UA 2LTAA 2RI1A 4MUNA 1XMIA 5JCJD 1JQLB 4RC9A 1SOAA 3B51X 5BP7A 2CHGA 2BRUA 2EP7A 2AK3A 3F5QA 2J87A 2JAQA 3RAGA 3ADOA 1PJ4A 1IQRA 3QLTA 4Z5XA 1QQ6A 3JRWA 5BT9A 5BUSA 4MQBA 2HMWA 1SXJC 1VJ5A 4G2TA 4ROTA 5DWDA 1XMSA 1YZQA 2F3UA 3QI2A 4DTIA