5LKAA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
301
structure length
301
Chain Sequence
b'SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Engineering a de novo transport tunnel.
doi rcsb
source organism Sphingobium japonicum
molecule tags Hydrolase
total genus 115
structure length 301
sequence length 301
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lkaA00
1DX4A 4P92A 3STWA 1JU4A 2DHCA 2YXPX 2G5TA 3FOBA 1HL7A 1EXWA 2WHPB 2JGIA 5JZ9A 2PSFA 2XMZA 1BU8A 2QOEA 1B6GA 2PM8A 5H3HA 5BWCA 3MVEA 4WCVA 4KACA 5EHNA 4H0CA 3G7NA 1XZIA 1DU4A 3IVMA 2ZSIA 5A71A 4PSUA 2I3ZA 2ZYSA 3O9VA 3CN7A 3HLKA 4HXEB 2XQKA 2I03A 5JARA 5LP1A 2GYUA 3F8SA 5AM5A 2ZJ7A 3HACA 5AM2A 4MWSA 1GPNA 4BCCA 4UBOA 1N5MA 5JIBA 4FDMA 2J4FA 2VAVA 2X5XA 2RIPA 4G1FA 1FFAA 2HA5A 4Q3KA 3ILSA 2BGNA 1THTA 1AUOA 5HF6A 1MNAA 4N8SA 2G4LA 2GBIA 3WYNA 5HF5A 1ZD2P 4FLFA 3SK0A 5KBYA 1F6WA 5KREA 2QM0A 3QPCA 1EI9A 2RHTA 2PSHA 3WWOA 4C01A 3WK7A 1K63A 1EX9A 1NU6A 4PF1A 4WFKA 4QLOA 4G9EA 1KU0A 3WKEA 1EHYA 4H7JA 2WFMA 3LCRA 2C0PA 2FX5A 3M83A 2HRQA 1TQHA 1SOMA 5FXMA 4LIPD 5CXXA 1SFRA 1EB8A 1XKLA 3KOOA 2XB6A 4U2EA 3KD2A 3V9AA 1Y37A 2ZYIA 1G42A 1ZD3A 1XQYA 3Q8WA 4PSCA 5EHXA 1P0PA 3IA2A 4TGLA 2XUFA 3S8YA 1P0QA 4HVTA 2AJBA 1R9NA 3WJ2A 4EZIA 4JEIA 4NMWA 5K3FA 5F4ZA 4BCBA 5D7BA 4G5XA 4DMCA 3ESAA 4L9AA 1R88A 4Y2RA 3C8DA 2XUKA 3D7RA 3I28A 4QDTA 1MU0A 3DYIA 5AI4A 2QUAA 2QJWA 2PU5A 1ZOIA 3DCNA 2QVBA 2CJPA 3WK9A 4X85A 3WKBA 4QZVA 1W75A 5AKKA 1BE0A 1IZ7A 3IUQA 5JALA 4UBIA 2OCKA 1PV1A 1OILA 5AI0A 4AX4A 2HA6A 3UUFA 4I19A 2DQZA 5DNWA 2Y2VA 4O08A 3KWFA 3D2BA 3I6MA 4XVCA 1C4XA 4W1SA 1NU8A 3DKRA 3GFFA 4X90A 1XRNA 3PUHA 5CT5A 4KEAA 2PSJA 3YASA 2HU8A 4NS4A 1LPPA 2OCGA 5A7FA 4ZRDA 5DLPA 3LP5A 3O4IA 5HK8A 3ZI7A 2QR5A 4BRSA 4CG3A 3CCBA 4B9EA 1YB7A 4Y2QA 1T2NA 4QDUA 1J1IA 4ZV7A 4J3JA 3ZLTA 2OGSA 3STVA 1QIJA 4UHFA 4W1PA 1DQZA 1G66A 2WU3A 2FJPA 3AIOA 4ITVA 5DTJA 4G4IA 1LPOA 4BC0A 3E4DA 4JUIA 3ESDA 3STYA 3W04A 1P0IA 4Q34A 1E3QA 5HQ3A 1WPRA 2AJDA 3A2LA 5I9IA 3DYVA 1B41A 2WFLB 1LPBB 4Y2PA 2X76A 3PF8A 2XMBA 4BAUA 4KE8A 2ZYHA 3FNBA 3A2NA 3VDXA 3H0CA 3VKFA 4X94A 1ZGCA 2XUIA 1GZ7A 1Q0ZA 4YX9A 1XRLA 3ESCA 3QH4A 4WY8A 3DS8A 5DJ5A 2FUKA 5K3DA 1L7AA 3GROA 4M0FA 4MWTA 4CIAA 2GYWA 3FLBA 3AZQA 3LLCA 1AC5A 3FYTA 3O95A 1CRLA 3U1TA 5LZ2A 1JJIA 2CMFA 2WLSA 1K5PA 1FFEA 3PICA 3DKKA 1QFMA 1QIGA 3H2HA 4L0CA 4BZZA 3A6ZA 2GBCA 5FP0A 4DNPA 4B0OA 2GZSA 3HRHA 2AJLI 3FLAA 4MEAA 4UHBA 1EVEA 3CN9A 5AK4A 4E15A 5JANA 3AFIA 3MUOA 3G0BA 4FLMA 2XDWA 1ACJA 3B5EA 3W9BA 4DNOA 3VXKA 4LXHA 1DWOA 2WILA 5JAOA 1D07A 1G4HA 3KXPA 2VJAA 3E0XA 1EDEA 2XQJA 5ALKA 2QS9A 3RARA 2R11A 1K8QA 2O7VA 2G5PA 2K2QB 3H17A 4QNNA 1R3DA 2WIKA 1YAHA 1T4MA 4BBZA 2D5LA 3WJ1A 4MXDA 3VJMA 3SC2A 3C5WP 3LIIA 4K6GA 4DGQA 2QKYA 2EDAA 2WJ3A 4IO0A 4FBLA 1J07A 1IMJA 5AKEA 1CUJA 4E14A 4WJLA 1ORVA 2IIVA 1UK7A 3M82A 1E8DA 4XWGA 1FSSA 1MT3A 2XMSA 5ALOA 3HYSA 3V1KA 2WIFA 2VEOA 1F0NA 2BUAA 2YYSA 3KWJA 2NW6A 4I4CA 1HDEA 2XUJA 1QIDA 2GBFA 4W1RA 2JGLA 3B12A 4DLNA 1XZGA 2VJBA 2XLCA 1CUVA 4OUKX 4GECA 4ETWA 1A8QA 1XLVA 5CXUA 3AUKA 2RI6A 1MAHA 4AXBA 3GA7A 4AB1A 3H2GA 5AO9A 5AI6A 3PI6A 5FPPA 5AM4A 4B0PA 1XLUA 1L7RA 3P2MA 4X71A 2CKMA 4H18A 4BRZA 4J0CA 5LKAA 3DOIA 4C4YA 5LZ4A 5EHQA 3HXKA 3N2ZB 4BB0A 5JYCA 2OGZA 4KRYA 4EBBA 4XX1A 1TCCA 2B20A 1EH5A 3I1IA 3WKAA 2O2IA 5HF9A 1WM1A 1Z68A 1KEZA 1TK3A 5AIAA 2OPHA 2WHPA 3HSSA 4I3FA 7YASA 5AKHA 3QMMA 3FLEA 4J0IA 3H1BA 1N1MA 2H1IA 4FFWA 3A2MA 1JT2A 1FFCA 2VT7A 3ANSA 4UPDA 4ZGBA 5FV4A 3QMVA 4UBKA 4XIIA 3HJUA 3V1LA 3QMWA 1CUAA 3FVTA 3STTA 3DDUA 4BDTA 2PUHA 2PKYX 3V1MA 2CEKA 3D2AA 3NGMA 4UFNA 5K3EA 4EY8A 2WHRA 3AZPA 3H2KA 5EIAA 3FBWA 1ODSA 3HC7A 4N5IX 1EK2A 2WUDA 2ES4A 4LXGA 4UHEA 3G02A 4H7KA 3GBSA 3A70A 4F21A 1CEXA 2I3DA 1LPMA 2WG2A 1N5RA 3B3QA 4GBGA 2WUEA 4OU4A 4KE9A 1EINA 1MNQA 4QLAA 1LPNA 3G0CA 3H19A 3C5VA 4N8EA 3AJAA 1WB5A 4L3WA 5FLKA 1UOQA 1CUXA 1H23A 5ALPA 3QVMA 2V9ZA 1U8EA 3TEJA 3LIPA 3I2IA 2JGKA 1DINA 5BV7A 1AMNA 5AICA 5C8ZA 1IVYA 3WL8A 3TGLA 2IITA 2XUAA 1USWA 4MEBA 4UFOA 2VATA 4IHAA 1XQXA 4DMKA 1CUEA 4BE9A 1N8SA 3G0DA 3WK6A 4FHZA 4F0JA 2VQ6A 3VVLA 3D2CA 4PNZA 5DNUA 2FJ0A 1BRTA 4HTAA 5HFNA 2PL5A 3Q0TA 5JATA 3DOHA 2PVSA 4UHDA 2Z3ZA 5C81A 1DTEA 3O4GA 5FUMA 4OPMA 1QTIA 1UKBA 2ZSHA 5DYTA 4ZI5A 5JD4A 1F8UA 1XZFA 3IB3A 2E3JA 1CUHA 5SYNA 3I2HA 2Z8XA 2RONA 5ALLA 4J03A 5DYYA 4FNGA 3CCCA 1XZMA 3ESBA 3FWHA 4LYDA 4HXGA 2H7YA 2JBWA 4HRYA 1XLWA 5EI5A 5HKAA 1XRRA 3W9UA 5ALFA 3QITA 4J7AA 4J0KA 1CUDA 5A7GA 5AKLA 3WZLA 1SCKA 5AHXA 5LYYA 2JGFA 1BCRA 1IUPA 2XQFA 4DSZA 3ZLUA 3W05A 5ALMA 1AQLA 4X6XA 1QONA 3VISA 1M33A 5T4HA 1NX9A 1QFSA 2HA0A 1XFDA 3K6KA 5AM0A 3SX4A 5AJHA 3F98A 3D0KA 5CBKA 3IURA 4ROTA 2OQVA 1QOZA 2AJ8A 5JASA 1CUCA 5CRIA 4CCYA 2HM7A 2HU7A 3R41A 2WJ4A 3CXUA 1ZGBA 2H7CA 3L1JA 3AINA 1UXOA 1VE6A 4LHEA 5FKJA 4BP9A 4G9GA 2GZRA 1MTZA 1MN6A 3ZV7A 4BCDA 4KAAA 5A2GA 1BN6A 2HHAA 4F5ZA 1CUZA 1XQVA 3FCYA 2OCLA 5BWBA 4FNMA 3N0TA 3O9MA 2W6CX 1J06A 1RWQA 3WWCA 5ALYA 3C8HA 1TRHA 3R3ZA 3OC0A 1QGED 4BVJA 4MYSA 1VKHA 1XZEA 5AOAA 3R40A 3BDVA 1UT6A 1R9MA 6YASA 1GKLA 3F67A 1GT6A 4X97A 1FJ2A 2WG1A 2XQGA 1H2XA 2AJCA 2J3DA 2ZYRA 2VAXA 2VJDA 4GWLA 4PSDA 5DTIA 2BJHA 3I1YA 4AQDA 4BVLA 1QLWA 3FSGA 2HRRA 1ZD4A 2CB9A 1DT5A 2DHEA 3RLIA 4KRXA 5JAUA 5AM3A 4JH0A 2HADA 4X91A 4FKBA 3WWDA 4DM7A 1DX6A 1CPYA 4EY5A 3IUMA 3K9BA 1UWCA 2RAUA 5CURA 1YS2X 4UHHA 4HZGA 4RNCA 2HFKA 3QZUA 1UKCA 4X93A 2O7RA 3KSRA 1ETHA 5FRDA 2VT6A 4B6GA 5A62A 2PBLA 2RHWA 3EIOA 5C8XA 3HZOA 4H7FA 4AO6A 1YCDA 1EDDA 2R8BA 3RK4A 4FOLA 3WKDA 1HKHA 4N8DA 5E4JA 1YA8A 1A8UA 5IKXA 5K3FB 4PQEA 4KE6A 4L72A 2HU5A 1AX9A 2WG0A 5K5EA 3L1IA 3C6YA 2WIJA 5AKXA 5ALZA 4EB0A 2V97A 3T52A 5A6VA 3AIMA 4U2GA 4X95A 3DLTA 5DYWA 3C87A 4G8CA 4G8DA 4RE5A 1CIJA 3D4LA 5DNVA 3I2GA 3WK8A 4GXNA 4X6UA 2PSEA 5CT6A 2PPLA 5ALGA 1SCIA 4U2BA 4X3CA 3AIKA 4B7ZA 4DSAA 2JGJA 2C5GA 1CLEA 2HA4A 5E4TA 1LBTA 3BL8A 4OD0A 4H7DA 4UFPA 3H2JA 4Y2VA 3C45A 3ICVA 4M0MA 5ALUA 5K3AA 5LLSA 2XT0A 4AMZA 4K6HA 3E3AA 4G4JA 1G5FA 4X00A 3SWWA 3V48A 3G8YA 3HABA 4QWMA 1BN7A 5C8VA 4YK7A 2J3QA 1GPKA 3MUNA 4GW3A 4OYLA 4BATA 2BCEA 4IQ4A 5AK5A 2WFZA 1MJ5A 3HEAA 1BEZA 1PJAA 2JGEA 1Q0RA 2LIPA 4Y2SA 3PE6A 1BEEA 1VZ2A 4EY4A 4Y2TA 4EY6A 1RYYA 1W4LA 2WQZA 3I2KA 5EGNA 4AZ3A 5HQ3B 5DWDA 1OCEA 2O2HA 4ZV9A 5CW2A 3EQ9A 1ZI9A 4PW0A 4Y9SA 4FFVA 4Y2JA 2W22A 4QE3A 2GBGA 3DJYA 3QYJA 5JD6A 4H7EA 5ALSA 4JNCA 5YASA 3WK5A 2DR0A 3TRDA 4C88A 3IUJA 1QIIA 3NWOA 1ZICA 2OAGA 5CT9A 2EEPA 2JIDA 4AZ0A 5AK6A 2HA2A 4TVKA 1O6GA 1DQYA 4Q05A 3BF7A 2QT9A 1TAHA 2VSQA 1H22A 5FOQA 1JMKC 5IH7A 3WA7A 5A7HA 2XI4A 1XZAA 3M81A 2B61A 4UUQA 4CIBA 2ACEA 3HI4A 1YS1X 1BCSA 5LZ7A 1ODTC 3ZWQA 2JEYA 1F0PA 1CFJA 5HKBA 2QTBA 1JI3A 1MX1A 4BAGA 1VLQA 4KE7A 1TIBA 2JGMA 3V1NA 4BP8A 5LIPA 3QPAA 2Y6UA 3EBLA 3PDCA 3L1HA 4YASA 4QWWA 1X2EA 2QJRA 1J2EA 5CMLA 3DEAA 1XROA 1BS9A 1O6FA 2PX6A 3D3NA 1EA5A 1ISPA 3G9XA 3IIIA 1WB6A 4AO7A 3WLAA 3FCXA 1CV2A 2ORYA 4TPKA 1HQDA 4AN0A 1Q83A 5CTAA 1ZIYA 4B83A 1W6RA 3W2TA 1Y7IA 1QIFA 3G9TA 2YASA 2XUPA 2WTNA 2WU4A 1LZKA 3GZJA 5AKZA 1YSCA 4W9RA 3BJMA 4D9JA 1QO9A 5AP9A 5ESRA 1S8OA 5D6OA 4H35A 5SYMA 3G0GA 5AOBA 1W1IA 4U2FA 1OXMA 4K2AA 2X8BA 3IDAA 1WHTA 4OB7A 4LYEA 3VJLA 4UBLA 3G9UA 5IVDA 1LPSA 2HA7A 3OOSA 3C6BA 3OM8A 3O4JA 3VVMA 2WSLA 1A7UA 1QIKA 5EFZA 1LPAB 5T4EA 4E11A 4HAIA 3AZOA 3EF3A 3H18A 1XZKA 1XRQA 5AK3A 5JAPA 5CH5A 1GXSA 3K2IA 1AKNA 2QRUA 2QXTA 2Q0XA 4P9NA 1VXRA 3OPMA 4WFIA 3GELA 2BGRA 3FYUC 2WHQA 4J0GA 1MX9A 5AH0A 5KWJA 1H2ZA 5ISMA 3QPDA 2UZ0A 5IVIA 2XMCA 4F60A 1JMYA 4MJ3A 5ALNA 3FYUB 1QIMA 4DMFA 1HLGA 2BUCA 3ANTA 4M0EA 1CUBA 4E46A 2QXUA 3DNMA 4KR0A 2BKLA 2PUJA 2Y6VA 3FSGD 4G8BA 2Z5GA 2ZJFA 4BVKA 5AKGA 1HBJA 1JJBA 2V98A 1C7JA 1MAAA 4A16A 4ARBA 2XUOA 4X92A 4OYYA 4KAJA 5EHZA 3O0DA 4JYPA 1YB6A 1XZBA 3WKCA 4B82A 3C70A 2WUGA 2EDCA 3DL7A 4J0HA 5AI9A 3ZLVA 1EDBA 2CZQA 3OURA 4GHWA 3ZPXA 1XRPA 2WUFA 5HCUA 4BAZA 4B80A 3WWEA 4JYMA 3KDAA 1YAJA 4Z49A 5EIHA 4QDOA 3H04A 3I6YA 4KYVA 1E89A 3RM3A 3H2IA 2DCMA 4Q3OA 2HIHA 3JYHA 1ZI8A 4OSEA 3GUUA 3R0VA 1CUSA 1IUOA 5ALTA 4ARAA 5I7UA 4N5HX 4YPVA 1TKRA 4FWBA 3QBJA 1UKAA 1E8NA 5ALEA 2XUDA 5HF8A 1UK9A 2OCIA 2ACKA 2HDWA 1AZWA 4MQLA 1UOPA 3O4HA 4MYDA 3C6XA 4LKOA 2WJ6A 2ECFA 1QO7A 1XZLA 1VA5A 1E66A 1XQWA 2WFLA 1GPLA 5T4FA 5K3CA 4CCWA 2OGTA 4PO3X 3DQZA 2ZVDA 5ALVA 1E5TA 2ONCA 5AOCA 4AN1A 2C58A 4P93A 5I8PA 3R3UA 3NOXA 4Y7DA 5JD5A 3T4UA 1FFDA 2Z8ZA 2Y1KA 5LKRA 4AMYA 5AKIA 4GEGA 5ALQA 1BROA 3OG9A 3S2ZA 3BIWA 4J0JA 3WL5A 1UK6A 1JJFA 4U2CA 5CH3A 3R3XA 4B81A 5IVKA 3QM1A 1GGVA 4BTLA 3BDIA 4C6HA 2VJCA 3WIOA 1LBSA 4IH4A 1UOOA 1H2YA 3E1GA 4QA9A 4KJXA 5LZ5A 5JZBA 1K6EA 1QTRA 4B84A 1ORWA 1WCYA 1U65A 2JF0A 5D3KA 4DNQA 2BAGA 1EK1A 1QE3A 5AI5A 4U2DA 3FVRA 1VA4A 1CUFA 4FLEA 4DYHA 3F9CA 4S0XA 2Z3WA 3PFBA 4W1QA 1R1DA 1YA4A 3W06A 4V2IA 3BF8A 4HRXA 2B4KA 5J3JA 2JEZA 2AXEA 1WOMA 4FTWA 1IUNA 4EHBA 1WPXA 3JWEA 2OAEA 3WZMA 1LNSA 4B85A 1ODCA 1TCAA 3UMJA 3BWXA 3X3HA 4Y2UA 5JZSA 4MQMA 1THGA 4GLBA 1QJ4A 2DFPA 4RE6A 1SC9A 4WY5A 5ALXA 3PUIA 1WB4A 2OG1A 1K4YA 4BZWA 1UZAA 2XUQA 1UK8A 4BTVA 3RKSA 4DIUA 2YH2A 1ZIXA 2G63A 4DNFA 2GYVA 1LZLA 4CCYB 4A23A 3BIXA 4W63A 3JW8A 4ZXFA 3IBTA 4CG1A 3F96A 4GDMA 2CBGA 2J4CA 4Y2YA 5JAHA 4G4GA 1MO2A 3AILA 1CUUA 1ZD5A 5ALHA 3DL4A 2RGUA 3OTQA 1ZJ5A 2DSNA 1WHSA 1SCQA 5AKYA 4HS9A 1AURA 3DD5A 1GQRA 1A8SA 1JFRA 4NVRA 2Y2UA 4CI9A 4C89A 2OLEA 1C7IA 5ALWA 4ZWNA 4RGYA 2C7BA 1A88A 3R3VA 2QUBA 2BFNA 1VE7A 1YR2A 4CFSA 2BUBA 1LLFA 5K3BA 1EB9A 1CR6A 5AM1A 1GKKA 3R3WA 1IZ8A 3ICWA 4BYMA 3WIBA 1CUWA 1I6WA 4X7BA 1W52X 1U2EA 1DT3A 1RP1A 2O2GA 3R3YA 1FFBA 1MX5A 2HL6A 1R50A 5C7YA 5ALIA 4OCZA 4PV7A 3M3DA 2XLBA 3H1AA 1HPLA 4Q82A 1CQWA 1GQSA 1U4NA 4QDZA 2WIGA 5ALRA 1YASA 3WA6A 3G0IA 3U0VA 3FAKA 2ZJ6A 2QZPA 4BDSA 5T4BA 3WL7A 1VJ5A 4XJVA 2P8SA 4WFJA 5HK9A 5CT8A 1QIEA 5CT4A 2HA3A 3IUNA 2WM2A 1R4ZA 5EIEA 2PSDA 2OQIA 5D3ZA 3LS2A 3NUZA 3WYDA 1LGYA 3C43A 1ACLA 3BXPA 1L7QA 1XRMA 2B9VA 2QMQA 3I6ZA 3I2JA 3WK4A 4Y2XA 2WIDA 2XMQA 2V96A 1Q84A 4FMPA 1ZJ4A 2OXEA 3PF9A 1VOTA 3G9ZA 4EA6A 3ED1A 5ALDA 4OU5A 1W76A 2D0DA 1JU3A 1CUYA 2PU7A 4X6YA 3PFCA 1DWQA 4UBNA 3WI7A 4CG2A 1XZHA 3EQ7A 2XUHA 3WMRA 3C6ZA 3FYUA 2XE4A 4UHCA 1VXOA 5IVHA 2I78A 4FBMA 3D59A 3WL6A 4K5QA 4KAFA 2WTMA 1H2WA 1DWPA 2WKWA 2VTVA 4DTCA 4H77A 1XZDA 4P08A 1AGYA 4C4XA 4GI1A 4BE4A 4OB8A 2VF2A 1JKMA 4AO8A 5ALJA 1XKTA 5AI8A 3MGAA 1E8MA 5FPQA 3UUEA 2HFJA 3STUA 4ZREA 4A5SA 1P0MA 4IH9A 1PFQA 1MPXA 5AKJA 3BJRA 4RPCA 4WDQA 5E4YA 5CH8A 4Q1VA 1XZJA 2ROQA 4K6KA 1X2BA 2H7XA 4HXFB 1CQZA 4BC1A 4IH1A 3F97A 3TJMA 1XZCA 4B9AA 4J0DA 1CVLA 5BOVA 5HZGA 2XMGA 4QEKA 4WDRA 2XMDA 4EUSA 4C87A 4OB6A 4H7HA 5LZ9A 2H9YA 1UFOA 4Q3LA 2C0QA 1ZI6A 5HFAA 3D5EA 4LXIA 2DQYA 5LZ8A 2CUTA 3STXA 1TCBA 4UBMA 2C5FA 2XQIA 1CUIA 3WQHA 1CUGA 5E2IA 5AIBA 1QIHA 5JADA 4DMHA 1VZ3A 2C4HA 3EQ8A 1X70A 4EY7A 4C4ZA 1QZ3A 3I2FA 1Y7HA 4QDXA 3VJKA 2VA9A 2XMRA 3BE8A 1EVQA 3WWPA 2XUGA 4UBJA 4H7IA 4INZA 4NZZA 2IX9A 5KWIA 1KU6A 5FDFA 3IULA 2DHDA
chains in the Genus database with same CATH superfamily
5IXJA 3NVKI 1CETA 1JH8A 4N0PA 3BTVA 4P92A 4HX2A 2WD8A 5KYYB 3EPKA 4YJKA 4WZAA 2JK0A 2R7LA 4ZZIA 4IFEA 1XEWY 2HXYA 5J1SB 3MSXA 3DOEA 3NCHA 1T3GA 1Z39A 4J1QA 4LHSA 1XD2B 2VQFB 5EC8A 3S4YA 4EATA 5HJ5A 1T36B 2XYRA 1Z4QA 2IEBA 3P9CA 2FPXA 2WP8J 3GN1A 3EGDB 1XDDA 3KQVA 3NASA 3ZDQA 1EZ4A 3FMOB 1N6RA 1BU8A 2QOEA 1JIQA 1B6GA 2X42A 3LQ4A 4KMSA 4M1TA 5DTQA 1I2MA 3E5NA 2BYTA 3MVEA 1XPJA 1XCOA 3A6EA 1GNPA 4UNSA 4YRMA 5I9LA 3N5KA 3C39A 4MJXA 4EABA 2AXNA 2C0CA 4JNKA 2YWCA 4K9QA 3VTAA 1D5WA 4F8YA 5J58A 2QD3A 4C7VA 2F9FA 3EZYA 3B8EA 3IVMA 3KKNA 1SUCA 2ZSIA 4ZJZA 5HMLA 2J6CA 2HH9A 4YRIA 3EFEA 1ICEA 2NIPA 5E1DA 4AW9A 2PUGA 4IDOA 4PSUA 2I3ZA 1K8RA 3HLKA 3TI7A 1O95D 2XQKA 2ZIFA 1NN0A 3CJRA 2I03A 3VZBA 4NABA 2O1EA 2X14A 3HVIA 1GNSA 5AM5A 2ZJ7A 1ECLA 2C3MA 1NVTA 1PX2A 3HACA 1U2RA 1GCUA 4CM1A 1GR1A 3E58A 5AM2A 3ELDA 1GPNA 1I13A 4TQUS 2CXTA 3CNQS 5EMHA 1NVDA 1N5MA 4BCCA 5KJ6A 7ABPA 5JIBA 3WP1B 4B6EA 1NW9B 1GYPA 1W5BA 1Y9EA 3GBPA 4KG7A 2R65A 1I94B 2X5XA 2ODQA 4HEHA 3B78A 1HQCA 3IBCA 1UBHS 4G1FA 2X3YA 2C88A 2X1MA 1GA1A 1WUKS 3T06B 1YR1A 2ZPTX 3KQPA 5LLTA 1RZRD 3DVQX 1THTA 4I66A 2G9QA 5GPBA 1XDBA 3SR4A 1E96A 1REQA 2C5BA 2GBIA 1ISSA 4J9UE 4L3OA 3OQHA 1CR2A 2Q3JA 3WYNA 3ZDYB 1F12A 1PV2A 3WYBA 2VFAA 4GKJB 3LRTA 2C3PA 5I9MA 2RHTA 2PSHA 5BW5A 2WU8A 3O9ZA 4C01A 4NDAA 2B2NA 2CJYA 2NZJA 3GQBB 5FWYA 4C2TA 1NBOA 2CE2X 5DOZA 3G79A 3TW6A 1JLLB 1K63A 2WWFA 4FUTA 3ZYZA 4IO1A 4BU1A 2DYKA 1QYRA 5E8RA 4ZEMA 1NONA 3JATB 1UT8A 4YFYA 1ST2A 1SC1A 5LYJA 2DUWA 2N47A 5IMBA 4D44A 5JROA 1N5JA 3E7FA 4G9EA 2QBYA 2OV3A 1IAVA 5JMPA 4E30A 3K6SA 3RVLA 4A2CA 1IUKA 1PK7A 1TZJA 2LDXA 3WLLA 1OFTA 1OAOC 2XJ9A 3ZWBA 4D99A 1P0CA 4DR1B 2WFMA 4LZOA 1RM0A 1Z74A 2FX5A 3IC5A 2EVWX 1SOMA 1QRRA 4LIPD 4RJIA 1K1EA 2D5BA 4X8OA 2GHQA 1SFRA 1IFXA 1EB8A 3GLFA 1YF3A 5J4LA 2WMYA 3Q2IA 1PX0A 1SN7A 5IM5A 4LE1A 3RTDA 3ZDEA 3T34A 5LOVB 1LDMA 1DHRA 3I53A 5EJFA 1JLHA 1Y37A 2R5FA 5KHAA 5JJ5A 4OMDA 1WD7A 2XF8A 5DPMA 4OUDA 3DZFA 5JNRA 4FGJA 2ZSFA 4PYIA 2WIAA 2P9CA 3DBVO 1DWUA 2NYVA 3Q3VA 4LMRA 4NU6A 3SDSA 3TLXA 3I9JA 2VRNA 4EB6A 3Q8WA 4PSCA 3TGPA 1QQBA 1G3IA 1H0RA 4TKUB 1P0PA 1LJ8A 1IMOA 1K2VN 1J0CA 4AY4A 3L7JA 3JU3A 2H2GA 4K40A 3S8YA 2WC1A 1UBCA 1L8QA 4BE7B 2VTBB 2QE6A 3KSMA 1WVGA 3HVHA 3WJ2A 1W1WA 4HLQB 4F04A 1CY0A 3BIOA 3KJXA 1ZWKA 2RGXA 4LBZA 3KC2A 5M3BA 3HK2A 3WNVA 4LAFA 2JIOA 3WZ2A 4C6RA 4PG5A 1XTZA 2KSQA 2QLNA 4ONEA 3TKAA 4BCBA 2F55A 1H8HA 5KQMA 4NCNA 1Q1QA 5F1OA 3A7DA 3QQ5A 3ESAA 3I05A 4LGVA 1VG8A 4M38A 4NG4A 1P7ZA 3KUUA 4KOEC 5B58T 4M1WA 1J7JA 2AHRA 4DLKA 4QFBA 3AEUB 3I28A 3KAJA 2NXCA 3EDCA 2QUAA 2GPSA 1G19A 4O4LB 1EX1A 4XGIA 3U4CA 3KTAB 3F5DA 2QJWA 4BVBA 2X6TA 2FQ1A 2AQ8A 3P9YA 4IJWA 3JVIA 3BG5A 4ZI2A 3T99A 3MYRA 5HR5A 2QN3A 3U3OA 1R9GA 1V35A 3WKBA 5HZKA 2NG1A 1WSAA 2AK2A 3OQBA 3RKUA 3JAMA 3TW4A 2LW7A 4M1YA 1IZ7A 4JL6A 3HJFA 1JXAA 1RXCA 4O0MA 4YRQA 3GXBA 4IQGA 4O63O 1PV1A 1LI5A 1W4ZA 1WEHA 5L3RA 1QTNA 2HA6A 4QM6A 4JDUA 1TA0A 3BYZA 2PAFA 3DWGA 1VL6A 3KQOA 4I19A 4IX1A 4L4ZA 5HE9A 3PQ2A 3PXDA 1O6BA 2GEDA 4ZOQI 3SLGA 4CM6A 1MEOA 3UW3A 2DGDA 1FSFA 3D2BA 4UQPA 2NV0A 4I50F 1V11B 1PO7A 1DLJA 2PRJA 2ZZKA 3BCRA 4Q3CA 4YJ2A 3I6MA 3ZGOA 3IT3A 2JHPA 5LM3A 1SUAA 3I39X 2ZM6B 1MJFA 4AL4A 3DKRA 3GFFA 4RQUA 2P69A 2PX8A 4X90A 3S2FA 2C7OA 3MHTA 2ODBA 1FJGB 3R6DA 4KGZA 4KWCA 1EGAA 1WXGA 3WLEA 5IKMA 2HF9A 3LHSA 5FX2A 1NFFA 1YB4A 2PSJA 3ZE6A 2B4AA 4R2KA 2HU8A 1WKVA 1KC1A 1PL6A 2REQA 2X0FA 4EDFA 2OO3A 1XZQA 4ED9A 2DEUA 1K7SN 2ZUBA 1E6CA 1GNQA 5BWNA 3DEIA 1UANA 2IA5A 1SH7A 1BKSB 1CP2A 3UK1A 4CHTA 3K1AA 2YV4A 5EY5B 2NACA 1UZNA 3EEQA 1RWKA 3SM3A 4B7AA 4JLMA 4B9EA 5C7IO 4NDZA 1XE3A 1DB3A 4DA4A 2VH5R 3IB6A 1Y5MA 1VLVA 3IE2A 1T2NA 1IM2A 2JFGA 4ZOEA 1DI0A 4LRTB 4I36A 4QDUA 2FPIB 3EDYA 4QU0A 5DBEX 1J8FA 2C3YA 5CA0B 1EESA 1Z25A 5IK2A 3I01A 3R5KA 4J3JA 2GXQA 4BGVA 5I4BA 4JSRA 1NG9A 3PJEA 3PC4A 3QBDA 3E22B 1HETA 3ZLTA 1RXSA 1ZIOA 1OV4A 2DC1A 5CFLA 3ISVA 5GONF 4EO7A 1CQXA 1LXCA 2IF2A 2GXAA 4UHFA 3GT7A 3TQSA 4KDCA 4DQVA 4OX9B 1BCRB 2JNWA 2WU3A 4GMGA 4RY8A 3AIOA 5FTJA 4DADA 3NDIA 3CUKA 4FEYA 3KYCB 4G4IA 2XIJA 1SRQA 3PC2A 3G2HA 4BC0A 2M98A 1RPJA 3O2QB 3KWLA 5ERXA 5I45A 1I1NA 4BHTA 3ESDA 3STYA 1II0A 4YRDA 1OREA 1WZUA 2GCOA 4IMPA 3I9OA 4C6TA 2ZK7A 3Q72A 1T24A 1HOTA 3B9BA 1LK7A 2L0XA 1TYCA 1ZJYA 2R8RA 4D4JA 2HF8A 3LF1A 2A94A 3MJEA 4B3TB 3Q6MA 1T1EA 1GVHA 2G1UA 3IFSA 3DZ8A 1I5OA 5A9TA 1Q7BA 2PRKA 4LF6B 3T1OA 5I9IA 1PT8A 3IAM6 3RG2A 2HY7A 2WFLB 4Y2PA 3A37A 3OLZA 3ZCRA 2P3OA 4MS4A 2ZANA 1M0TA 2PGXA 3K2QA 3PF8A 1U0NA 3T7JA 1OLOA 2F59A 3ROMA 3PCXA 1ZGAA 4B43A 4IIXA 2RC5A 3N3BC 4R8KA 2G07A 4IDPA 2Q5HA 2QX7A 3H0CA 3EF0A 1ZGCA 2XUIA 1KEPA 1RC0A 2A7XA 3DXFA 5TRTA 4YGYA 4OBXA 3KOZA 4TTSA 4WN3A 1CS4C 2IU3A 3NIWA 1MLDA 3ZW7A 4CR7A 1J8VA 2Z56A 1OB5A 1HT1E 3DLAA 1WDKA 1H2RS 2XVXA 4PQRA 4M9RA 4G0PA 4PHFA 5FI1B 3UJ3X 2AUMA 2XDYA 3WMWA 1XMOB 2J1LA 1L5NA 1BXGB 4RLHA 1W36D 4LF5B 2Z1DA 3CO5A 3UMSA 2AI1A 1KMQA 2LDBA 3DNPA 3AZQA 3LPNA 2IZ0A 3WGMA 4DANA 3O95A 1JU9A 5A1JA 4GOLD 2QE7D 1YJXA 4KXLA 3DLBA 3E35A 2JZNA 4OHRA 3KP1A 5ECDA 3U1TA 4F84A 5IASA 1XD8A 4B2YA 2YWHA 4TLEA 1RABA 4PHHA 3DE4X 3OFSA 3U49A 4EUFA 2TSYB 4ZTZB 2R1TB 3FX2A 3URKA 1K5PA 1RADA 4ER5A 3PEVA 3PICA 1JPUA 1KSHA 2C4KA 2W2OA 3KKEA 1XVVA 3Q1LA 3PQ3A 4NDNE 5EZYB 4B3FX 2R4QA 1M2VA 3L8EA 4GKVA 3V8EA 2FWIA 1HDRA 4S0ZA 1QIGA 4HPJB 5L3SA 3TCNA 4BZZA 2PXCA 2XUZA 1I3OA 3FHCB 5EP1A 1DOZA 2O0LA 4MPDA 2DVMA 2HDHA 3AUTA 2QAIA 3DE5X 3LBYA 4IYRA 5C4GB 4E0BA 1ZR4A 2EKDA 1F0YA 4R7TA 2GBCA 2GCEA 2ZI9A 3B85A 3LWNA 5BSEA 4JVLA 4KVAA 3HRHA 3E3LA 3FLAA 3ASZA 3OP4A 5CYGA 1NF9A 1YKGA 3AUJB 3CN9A 3Q7IA 2CFSA 4M1ZA 4LDAA 1ODJA 1VI5A 4II2A 1AE1A 4E15A 3MMNA 3SAJA 5BVGB 5KTPA 1LSOA 4MDEA 3QWAA 4DIKA 4RIEA 1D6SA 1KI2A 2OZLB 2HBYA 5CG2A 3LT4A 2OK8A 2VDNB 3S6JA 1V1MA 1Z82A 2XDWA 2ZRMA 4EPWA 4YYZA 5HPYB 3DPIA 1R66A 3L6UA 2GMWA 5BN4A 1WCWA 4YRPA 2OP1A 3VXKA 4D81A 4JYAB 1JA0A 3DZIA 5EQDA 4CMEA 4KAXA 4E5VA 1N2BA 2WJGA 2XE8A 2ZIZA 3SQNA 4BP1A 3V8QA 1IOZA 5IYZF 2H1SA 5LWQA 3H42B 2HQSA 1DIGA 2WTUA 4JXJA 3VGJA 3F6CA 1JWAB 5EKTA 4YRFA 3HZRA 5JS2A 2Z58A 3FUXA 4DHWA 1QP8A 5I4CA 2VJAA 4MW9A 3WL3A 1AO0A 1JJ7A 1RKVA 5CX1B 4C7JA 1EDEA 4F71A 4UARA 3S2SA 3L79A 4JLWA 2RBEA 1TYEB 2ORIA 4R8VA 1DKMA 1VLJA 5ALKA 5JBIA 1W0JA 2FTKE 2IPNA 2PBZA 2Z3VA 3GRAA 3I6IA 2YJNA 3IOMA 3QJYA 3QUSA 4G5FA 1VKZA 1Q6ZA 1A9XA 3QVTA 3IOCA 2R9VA 3H1GA 3SBDA 2OM2A 2K2QB 5KMGB 1IBMB 2O8BB 1X94A 2PR7A 3S2UA 1DE0A 1M5RA 1T4CB 2XVAA 4L27A 4LXQA 2PS0A 3PE3A 2FXVA 5TARA 2D5LA 3NQ41 4GKKB 3RRFA 1EP2B 2EZTA 4U4AA 4AP5A 4RK7A 4LE0A 5CGZA 4OIMA 4DLLA 3NEYA 4QAQA 7REQB 4LOKA 3RT1A 3DZGA 2O7SA 1LSUA 3RW9A 4LBWA 4K6GA 4RJ2A 3K53A 2JLUA 1MIOB 1JILA 2EDAA 2Y1LA 4YMLA 4IO0A 4P7BA 4UEOA 3AF1A 3TIIA 3FI0A 1FFHA 3R5JA 3FMGA 4LJYA 1Y3DE 4RZ3A 5AKEA 4NV3A 2F4NA 5BNFA 5C7LO 7ADHA 3GP5A 1Y3CE 5JMOA 1AKVA 1Q19A 4OVKA 2FZCA 1V1JA 1UK7A 1ZBDA 2IIVA 1KJ9A 2OCXA 4NFYA 5BP7A 4EECA 2Y71A 1YMVA 1GU7A 1E8DA 1M75A 2XMSA 4RVOA 3DJFA 4R3UC 1CQIA 1E7QA 2IGBA 2NV2B 2WIFA 1CY7A 4YT8A 5JNUA 1P5JA 4CNQA 2VKTA 1KVTA 1W2GA 3ND9A 2NW6A 2ZRFA 2XUJA 2I4NA 4RMJA 3WB1A 2XSZA 2B35A 1KMHB 2XCUA 3JD0A 1H4TA 3NNDA 4JENA 3Q6IA 1S1CA 2OSBA 2IS2A 5F7ZA 5CDUA 2C31A 3BZUA 2OHXA 1RAHA 5GOZA 4P84A 1IHYA 4INPA 1NVVR 1R10A 1JQEA 3OETA 4G63A 4MQFB 1BXRB 4XIJA 3AU8A 4V03A 4YCAA 5E6RB 4OUKX 5KKAA 4GX1A 4UOQA 5CB4A 1SHZA 1YZNA 4X65B 1ZWLA 2C57A 2Y1CA 4BNTA 1YD7A 4ETWA 1U6KA 4WNCA 3P9RA 5D5PA 2D4AA 3L8YA 1XDZA 4Z5XA 3GJ7A 3UCEA 2NZVG 3AR6A 4DW8A 3HN6A 1HSOA 2J0UA 1UPBA 1WWKA 3U31A 3WV4A 3UMBA 1D2CA 2GAFA 4RSMA 2ZCJA 1U0BB 4DM4A 3LA6A 3CWCA 1UH5A 1G8SA 3HCPA 3RC9A 2CDAA 2LZ0A 2ZAGA 2B8JA 4O2AB 4RF5A 5KOYA 1RLTA 1F0KA 1ZQ9A 1JG7A 1G8KA 3MTGA 5IG2A 4BLPA 1HYGA 4V0MA 2ZW9A 5AO9A 3PI6A 5FPPA 3TPFA 4GT1A 2OVBA 3M3HA 1QAMA 2AGVA 1E63A 2BKAA 4HGRA 5FWNA 2RGYA 3HNPA 3RAEC 4B0PA 1XLUA 1L7RA 1KAOA 4J4BA 3P2MA 1QYWA 3SIRA 5EIFA 3AC0A 4QREA 2CKMA 1PJ3A 1YMUA 1L7MA 3HGMA 1FSZA 1GFWA 3HJGA 4G23A 5AWFC 2WVJA 5HILA 5JG7A 2HWKA 1B6TA 4EGCB 1THMA 2PV0A 1KKUA 3MOSA 3QVLA 4J0CA 3D4BA 4N3AA 1LC0A 3RU7A 3ZZTA 1ZSYA 1KNQA 2UUPA 2LVBA 3D6AA 4L4UA 1JIVA 2BGWA 2J9RA 1E2QA 4AS3A 5L4SA 1U2SA 1WXIA 3PYMA 2BFEA 4HDKB 1PSWA 2DY1A 2G9RA 1E9FA 3HXKA 4EITA 3N2ZB 1CDDA 4BKQA 3PEYA 4Z1MA 3M6IA 3OQIA 1JDBB 4X41A 4RNDB 3CKLA 4M6WA 4BQIA 3WR5A 4F9TA 3UNXA 3A4IA 3IPRA 2I91A 5K0TA 4B3BA 1LI4A 4XX1A 1ZK1A 4IS2A 2O52A 1FUIA 3LYUA 3NR2A 5JOQA 2B7LA 2Q5FA 3DL0A 3ZDDA 2F9LA 3CONA 2R5WA 3OAAA 3TB6A 1HR0B 1QPZA 1KRWA 3I1IA 3QF4B 3GNQA 1RWXA 1E5QA 5HF9A 3WKAA 1TK3A 5GJVC 1U3VA 5B6IA 2WHPA 2C8VA 1IQRA 4I0WB 1IZ9A 4M76B 1ZPDA 1B2RA 3ROEA 5L51A 1WA5A 4PZUA 1WUIS 3H0EA 3MT8A 4I3FA 5AKHA 4AI6A 1CQJA 5BQOA 4G0OA 3IAS1 4D9KA 1PL7A 4J0IA 3FM9A 4TSKA 3PYXA 2H1IA 4HMQA 3VH1A 1W29A 1VHWA 1OI4A 3A2MA 1UPAA 1Z5NA 2NTEA 3IA7A 1FFCA 4DLSA 4HVCA 1KYQA 2J3EA 4LJRA 5TMEA 2XODA 1Y9JA 1SURA 3HO8A 4U9UA 4YAIA 2REOA 2JAOA 3UJDA 4ZFNA 2QORA 4IFIA 4YC7A 3TCKA 5FHRA 3EH1A 4ZGBA 1E3SA 2DCUA 1M2HA 2EFHB 4BVHA 1UBOS 1M6HA 1QE0A 3FB4A 4QPJC 2SHKA 3CRQA 1OHHD 4IDFA 5JTTA 3V1MA 2BLNA 2CEKA 1EYZA 1RQ2A 2HZBA 3D2AA 5FOXA 3H1TA 5KAPA 5CB0A 2GQ0A 2W0MA 1AIPA 2BMFA 4AZ3B 3L2OB 4Z1OA 4TXLA 3MJ4A 2PNFA 4UFNA 3PRJA 1FTWA 1N2CE 1RCUA 2UZ4A 2B7BA 3R77A 1M8GA 1OIVA 2D5CA 1VP9A 4R0VA 1JHUA 3HDYA 821PA 3O8CA 3W5UA 1H93A 4N5IX 1T3LA 1R5JA 1RLOA 5JSYA 1NJ2A 4G2NA 2C2ZA 1IYZA 3ULKA 3O82A 1NUHA 3A70A 3OUUA 1CEXA 3L4EA 4MVJD 4F4UA 3R24A 2I3DA 3MAAC 3MJCA 4WN9A 1YV9A 4R1PA 1GAQA 4PXYA 1PR6A 3MGCA 5B4VA 1VMKA 3NBAA 2XKJE 5JAZA 4EF6A 4A15A 2QXYA 3KSAC 2W6ZA 2YXBA 1T5LA 1OBVA 2QSJA 5A5DA 1JTVA 4KPUB 4EYOA 2NO7A 4PTZA 3D0OA 4CTOA 1QFZA 4ZYXA 5LYJF 4PHCA 3EVEA 4K81B 4DA6A 4GRAA 4TYYA 5IP5A 4MVYA 3VPAA 1EINA 5H1YA 3JPWA 2DFNA 2QN2A 2G1AA 1J0XO 2EHDA 3SNHA 1K8XB 4JBNA 1Z0FA 1YU9A 3WHIA 4F2DA 4HBGA 2GJSA 3EVTA 1N7JA 4WNIA 5IC6A 2PT5A 3FTNA 1F14A 3VYVA 1JG1A 1ADJA 1DAPA 1G98A 3ND6A 2P0EA 3ZZUA 5DWVA 3OTIA 5BOSB 3C5VA 4UEQA 4N8EA 5LMZA 2HO5A 3KVRA 3TQOA 1EXNA 4ENQA 4FFBA 1W85B 4YRBA 1M54A 1WB5A 2V6IA 4L3WA 2JIMA 5L4LA 3O47A 1HEUA 5BPFA 5KTMA 1UOQA 5EMKA 2DLNA 1ONNA 5EZQA 2IZ6A 3K09A 1QG4A 3EA5A 5SZJA 2V9ZA 3L0YA 3Q11A 2VDRB 4PGMA 4TLDA 2ZVJA 3G49A 2BM1A 3O73A 1SZJG 1EAMA 1Q7CA 3GGOA 2HT6A 3PD0A 4GR4A 3TEJA 3LBIA 3MSCA 2O8NA 3G7SA 3MWJA 2P1DA 3I2IA 2JGKA 4DCNA 5K1ZA 4BLVA 4EFDA 2XEXA 2VRCA 3V3TA 3GLVA 2NPIA 3IQHX 4DREA 2PGJA 4UTRA 3WL8A 1PHPA 3TGLA 3DDHA 5EXPA 4Y2HA 1KS2A 1KXZA 3RUCA 3ZWCA 2Q1TA 4BASA 4Y6RA 3R9XB 4WVLA 2AN5A 4FS3A 2JLQA 1ZIPA 4RF2A 1QC5B 2EJVA 4DMKA 1OB2A 2GAJA 3K9HA 1S7CA 4PLCA 4EKGA 2F1HA 2Q6TA 3HDVA 3HM2A 4V0KA 1D9XA 2A1TR 2WF5A 3FTQA 3HJAA 1E60A 4G5OA 3VNSA 3N5CA 3DVLA 4EIWA 3OCUA 1EBUA 1G21A 4L3VA 2QP4A 5IJ9A 4GOJA 1CYEA 4FINA 3WK6A 3K15A 2VH1A 4L74A 2HI0A 4LHVA 5THQA 2ZI7A 2VQ6A 3VVLA 2AZXA 3D2CA 3AEZA 4HUJA 2HRDA 2YFQA 7AT1A 2GN1A 5JNSA 3GJSA 5ICCA 4EKNB 3WMGA 2BF4A 4ITUA 2EOAA 4HDCA 1BRTA 1UMCB 2X9NA 3LBFA 4TMFA 3SZOA 3UKJA 4MAFA 3B9QA 4OFBA 4V0OA 1C81A 1XAIA 4QOFA 2QNBA 2V6BA 1KJYA 2CY0A 3OU7A 2X8WA 3TK1A 3UIEA 3TRHA 3ZKAA 4LMPA 3EEFA 3M70A 2FP3A 2JCGA 5JJCA 4DRZA 1BMDA 2ZM5A 2O1WA 3DOHA 5JATA 2B4TO 1DBPA 4ZA2A 3FH0A 3KDPA 3LPMA 4ZXPA 4XTCS 3H1EA 1QHYA 2BWJA 3Q9UA 1L4BA 1G17A 1A50B 3O4GA 4J43A 3FZYA 3HYTA 4LK3A 3AY3A 1I0IA 4NAVA 4KYTA 4KSYA 3MWFA 2CNBA 1ORRA 1L3IA 2FHPA 3R5FA 4AIRA 4NMLA 1YDFA 4PXSA 1A9ZA 2ZSHA 1F17A 1SCDA 4CIVA 5JD4A 3I5AA 1IE3A 1YVPA 4YCJA 3BILA 4B3HA 2RHLA 2GEJA 1XEWX 5EWMA 5JDIA 4LDRA 2HHCA 2V0CA 1FU8A 2FJUA 1FYEA 4MQBA 2X4IA 1E1KA 2ZYGA 4J03A 4ENPA 4OQXA 1SWWA 5DYYA 3UJNA 4JQOA 2X40A 4Q1EA 1P62B 4JSTA 4WPGA 5JNWA 2V7EA 3WBBA 2VYCA 3K0SA 3GPCA 4QC2A 2DUUA 4XDHA 4EA7A 4R8MA 3RRNA 3PPIA 5A02A 2BGIA 4Q19A 1XZMA 2CVFA 3ESBA 1N34B 1B15A 4Y0AA 4G4SP 4PIPA 3REGA 3WNBA 2NMVA 1XLWA 2LKCA 3ZGXA 3LXXA 4MMXB 3HB7A 2WMOB 4MR8A 4YI5A 4BQRA 4JQCA 2PCJA 1OY1A 3IL2A 5AQEA 2BGLA 1QV9A 2WAMA 4YLGA 1S2GA 2QQ0A 2G76A 3H84A 3AWIA 1CF4A 1CUDA 1NR5A 3N7UA 1HSZA 3OOEA 1BQ4A 1G6HA 3T5GA 1ZNZA 1KPGA 1P80A 1J42A 4HH0A 1M1YA 1SCKA 5AHXA 3S7ZA 2JGFA 3VR4A 4CNBA 3D0RA 5J2TB 1OU0A 1Z6AA 4MYUA 4WVFA 3VO9A 2JPDA 1EE9A 2J3JA 3OEEA 5DB4A 1JDPA 1Y1KE 3I1FA 3HYLA 3FVVA 4KQJA 4PANA 3CUTA 3LZCA 1AQLA 2C77A 4MLPA 4X6XA 3QTLA 2XTAA 3C5CA 2A86A 2WWHA 5FPSA 4A8JB 3NTXA 1B8UA 1XFDA 2XB4A 4YUXA 5CYPA 5AJHA 2PLAA 2GERA 3HNRA 3D0KA 5EKXA 4ACAA 1NNEA 1U6JA 3OOJA 1BHSA 2G17A 3IURA 3TLCA 1RYMA 1ODKA 3L0PA 4L2IA 1FSGA 1QP4A 3HMKA 3K4QA 3MS7A 1VYUA 5CA1F 1DAMA 2QY9A 3ZIUA 3Q8MA 3VR4H 2GD0A 1NR7A 2WUVA 3QXGA 4NAUA 1AUQA 4K05A 1JRLA 3SJ7A 2CHUA 3PKIA 3N8IA 2HM7A 4FW8A 5HUJA 4D56A 3FR8A 1PBNA 1H2AS 1QKJA 3FZGA 5FORA 1NW6A 5C46F 3JRNA 4HVLA 4LGYA 2XGJA 4Z9FA 4UJ3A 4J76A 2JIPA 4H1VA 1NPTO 2GSDA 4IEIA 4RDIA 1OH8A 2G3YA 2GVNA 4G1UC 1A1SA 13PKA 4K6MA 5FKJA 4BNMA 3BK1A 4H6WA 2GZRA 2VNKA 4LYAA 1VB5A 3RF6A 2GSWA 5DK4A 3K6RA 4NBRA 1XO1A 3FPGA 2ILTA 2AF4C 2IBMA 4J8PA 3SICE 3GJTA 3ENVA 3H86A 4CN8A 1YNSA 4I5IA 4PQFA 2VSXA 1JA1A 1ZINA 1P60A 1E6UA 2WSYB 3AR3A 1XPUA 5IPFA 3IKMB 1NDUA 2W2NA 4AG6A 4BPRA 4ARZA 1AGPA 1RKQA 3FCYA 3U13A 1SGWA 4FNMA 3Q1KA 1PLJA 3DMTC 3O9MA 2R8ZA 4OA5A 1RWQA 3W1VA 4GOMD 4B8WA 3L4BA 3SEFA 5ALYA 4OIFA 1NXTA 4IW3B 2P8JA 4FGUA 4DLRA 4OL0A 2A5YB 1TRHA 4FMDF 2FW1A 1R0SA 2HQBA 3UMYA 2QGNA 3H9EO 3L02A 5FPYA 3DEKA 4G1BA 4BVJA 4DR6B 4D8VA 2HRBA 2AEJA 4MYSA 4P6VF 1TT5A 2FLKA 1RRKA 1SBIA 2DF8A 3RNLA 3R40A 4LDJA 1K4MA 1CD5A 2ZJYA 4QULA 2ID7A 2I9PA 5BQ5A 4C5AA 3K32A 4JEHA 5C8YF 3SE7A 3QE3A 5DGDA 1P5RA 1FJ2A 2B1QA 2V45A 2JKZA 4CG0A 2ZS7A 2LV8A 1H2XA 5CVCA 2VAWA 3HB5X 4QEDA 1M8KA 1R27A 5I7EA 2J3DA 4K28A 1VP3A 5C1IA 4NZMA 2D54A 2QZZA 3EFHA 3PDIA 2VAXA 2VDPB 2OG2A 4TWAA 4Z51A 5IKPA 2O5EA 1MQ9A 1YMQA 3ANLA 4K8RB 4KK4A 5CB8A 1N8TA 2GM9A 4UDOA 2BJHA 4GPTA 4XTRA 3PA6A 4ZQBA 2OZPA 2WIBA 2ZJBA 5E2AA 4N41A 2YVKA 1QLWA 3FSGA 5TB5A 1KR2A 1ZVJA 4M1MA 1TF7A 2HRRA 2DECA 5D3QA 5FUVA 2CB9A 1S8AA 2DHEA 3HFSA 2B0JA 3L84A 4LY9A 1NR1A 1M8FA 4Q1BA 4H08A 5CXQA 2XNKA 2HIGA 4DQDA 2VXCA 2DJIA 1COWA 1RYZA 1QM5A 4KN8A 5AJUA 3TTUA 1DRKA 1JL3A 3MMPA 1JDUA 3FPEA 3KTOA 3B53X 4MW2A 2I54A 2A1IA 4FNOA 3FETA 1ZOOA 2ZYAA 1LLQA 1YI8A 1CRQA 3EIWA 3QFRA 1UJ4A 4ZDWA 1AKMA 3WWDA 2DWPA 4DM7A 3ZZ1A 3T1YB 1CPYA 4L8GA 2Z2YA 3KIPA 1GTZA 4RTOA 2D5AA 3FPFA 1XSEA 3K9BA 1X74A 1R18A 1SUBA 2UVPB 2R8EA 5ICFA 1JDVA 1LQ2A 4MI1A 1BMTA 2CL6X 4R3WA 3ZWYA 5HSGA 2GBPA 3ZY4A 4L02A 4AF6A 4C0AC 3PITA 1I3LA 3D7SA 1NXWA 1QZZA 2A0XA 3GUYA 5KJEA 3VR5D 4PX2A 2FUNB 4MB6A 3NP9A 2H1WA 3B2EA 4BVGA 2TYSB 5LJLA 4KR3A 1GAXA 3IUEA 2D0OB 3CX4A 1DXYA 1E1QA 1U8CB 2VT6A 2I4IA 4P3NA 3P9PA 2J45A 2F1OA 4CM8B 5IJ0A 2CDNA 3C7TA 5C8XA 4RXTA 4NNOA 4HRVA 1TYDE 2I4TA 4H7FA 1NQVA 3BZWA 1M7HA 1GFSA 5JS8A 2XTMA 5TPZD 1VG1A 3SFVA 3U6KA 3BAFA 2RJ3A 3VU0A 3PI7A 3DDZX 3LW7A 4WXMA 5EEGA 1TM4E 1B0PA 1KJ8A 2HRZA 1DC3A 4JYBA 4FOLA 3RK4A 3WRWA 4PLVA 1ZKDA 1YRQA 1UBNA 1YBVA 3BTOA 2PMWB 3EEYA 5K3FB 3PZRA 1YK1A 3BWEA 3RPEA 3T9AA 4DZTA 1ZH0A 1P81A 1UJBA 5J2UF 4I1PA 1EQUA 5K5EA 2MYTA 2PZ8A 4ZYUA 4U3JB 3AHIA 3OZEA 3HTXA 2IYUA 4RZUA 4J1NA 2YHIA 3AESA 3HU5A 3IHLA 2I6SA 5FCDA 3KQKA 2DLDA 1CRPA 5CB4F 1SHLA 1ZEMA 2ZUCA 4OHFA 1ZR2A 4EB0A 4ND2A 1BH6A 3B1YA 4YRGA 2PUBA 5A6VA 4B46A 2AYXA 1ONSA 2X23A 4KXMA 3QA3E 2TS1A 2AC2A 2EP5A 3NHAA 2EIHA 2NO5A 3DLTA 3P4YA 5DYWA 3ROKA 4URXR 1QAQA 2C1EA 3C87A 4LSGA 1L5HA 1SVUA 2FE1A 1WP4A 3MJTA 2WM3A 5A04A 4G8DA 1NAIA 4XD7D 4RE5A 3OT1B 1CIJA 1LK5A 3BFXA 4ND4A 1M3SA 5DNVA 3LT2A 3HWRA 2OXFA 3KOMA 3C85A 2Y66A 1TO6A 4LSWA 4GXNA 5B3JA 3DFUA 2BRUA 3UWKA 1BKDR 2RGGA 5TGZA 4EHJA 4DG9A 5IT0A 2NUAA 1K7XB 3PQ8A 3Q3GE 1KAEA 5FLXA 3VH2A 2QVCA 2NYRA 3GH1A 4FX2A 2EFDB 2VF8A 2FX2A 1GUDA 4U2BA 4NK5A 3AIKA 1BAPA 4WKOA 3IKVA 3KQYA 3MIZA 1D5CA 3E8XA 3IP3A 4XIYA 1SK9A 4JOCA 4OD0A 3IRVA 4Q4AA 3VOTA 2I8AA 2CD9A 3A6JA 4RHFA 3DA8A 4PNHA 4GGMX 4BKUA 3A6HA 5KWSA 3ZUGA 4LMAA 1X7WA 5PGMA 2RKWA 3M6VA 3QG1A 5CVJA 5FA5A 1UBFA 4GNRA 1RXVA 3O7WA 4M87A 3KJEA 2Y77A 3OWOA 4DM3A 5ALUA 4F1WA 1QZXA 4LF9B 3CLTD 1ISJA 3MTIA 4AJIA 3MJDA 3GG2A 5KKCA 5A1TA 2HC9A 2BH2A 2UVDA 2RGEA 4RV5A 2PT7A 1YHNA 1S8NA 4IXNA 3RRXA 3BL6A 4PC6A 3SEQA 1KZ6A 1EHIA 1QGAA 3TOVA 3JALA 5DKFA 2GI4A 2HQ1A 1PNTA 1T6ZA 4X00A 3TTSA 4QNRA 4D98A 3SWWA 2JLVA 3G8YA 4QWMA 5KTRA 3HSYA 3VPXA 1BN7A 1QGYA 2RAVA 4A2PA 2EG5A 1VIMA 3MNFA 3PPYA 3ZHZA 1AMNA 2CSXA 3MUNA 3ROPA 3W3AH 1JVSA 4MKGA 3ZE8A 4YJFB 4AJJA 5C1BA 1O95C 2H31A 3U16A 1CEQA 4Q1DA 4IQ4A 2GRAA 2QY6A 3P2IA 1N9GA 3BD7A 3FB1A 3W6PA 5I5EA 1U2GC 5DFAA 5ULLA 4NENA 1F2TB 2JA1A 1HEIA 1EVJA 3HEAA 3KT6A 4RPHA 1PJAA 5BYBA 3TSAA 2CLMB 1C7QA 1BMFD 1YXMA 1MGOA 5DTEA 4Y2SA 2XB9A 3PE6A 3J7TA 1KGSA 1TQ2A 1V3VA 3HBJA 4A3SA 1TJNA 3EVCA 4R7GA 4L7VA 2BFCB 3DHEA 4ZI7A 3THYB 1LJUA 3HKDB 4EY6A 1Z2AA 3MUEA 3NHWA 3C3BA 5ITZB 1RJWA 4H9GA 3BE5A 3SF8A 3UA3A 3V4VB 2WQZA 1GVNB 2YX1A 3AHEA 3QKRA 4F6RA 5H82A 1JEOA 3L7LA 5I7OA 2WKRA 4MR7A 1OCEA 3OZWA 2Y1EA 3F9RA 5H16A 1O4WA 1XTJA 3NO4A 4V0LA 1G18A 2ZI4A 1FP1D 1GUBA 5FOUA 2E85A 1V6SA 1ZI9A 4PLPA 4TL6A 1SUEA 1NBIA 4HYTA 2P27A 3P5BA 3KB6A 4RVHA 4Y2JA 2W22A 2AX3A 5K51A 3DJYA 4E70A 1T9HA 2VJPA 4H2DA 3GLGE 2WWYA 1H3NA 2PJZA 4BFCA 1A96A 2G83A 4R69A 2FMXA 5BYKA 5ALSA 4CKWB 1SIWA 2BFAA 3KK0A 4JNCA 2QT0A 1QOQB 4UUBA 2DR0A 3SBOA 4DUPA 1YVRA 3U7FB 1ZH2A 1PFYA 3BMNB 4NOJA 3KZNA 4OI4A 2HWYA 4P82A 1CJUC 4RD3A 4QDKA 3H8JA 4GPZA 2FV8A 4L4YA 3OE4A 1AKTA 3KAKA 3GT4A 1F1JA 1JVNA 1CR4A 4RKRA 1JEQB 4NEGA 5EIBC 3VH3A 2OBMA 3FTDA 3KOWA 3Q7EA 5AK6A 5DXFA 2HA2A 3A26A 2XTNA 1WDMA 3EGXB 3QVVA 3JAKB 4FFPA 3HUDA 3CUWA 2B5WA 2EFCB 4Q05A 3D6FA 4FK8A 2HTEA 3BF7A 1ABEA 3FPAA 3QTBA 3PHGA 4GBJA 4XIFA 1PQPA 3G9QA 5FOQA 2G88A 2ZE8A 4DJAA 2YCLA 4MPRA 4K9KA 1DAIA 3MWGA 2IDZA 2O07A 2PZKA 5IH7A 2ZBVA 3Q8XB 4ZALA 1DPGA 1M5UA 5GV8A 1IXYA 3UMMA 4Q1FA 2AFHB 2L69A 3NG1A 5ERGB 2PX5A 1LLCA 1T8SA 4UUQA 4KODA 1TUEA 1Y4AE 1SOUA 3I8OA 1SQ5A 3EDOA 1R5NA 4K86A 1SO8A 1CK4A 1X1TA 4H6VA 3QKIA 5E3IA 5HW0A 4QKQA 2CNWA 3B6ZA 1G64A 3MRTA 1E1LA 4YAEA 5K6AC 3FYHA 2DBQA 5DOVA 1U7UA 2DH6A 2YQ5A 5EVJA 1KYZA 1PZGA 5LZ7A 3ERCA 2BGKA 3IRUA 2ZXEA 3ZWQA 3RK1A 5B3KA 4RO0A 4XARA 1F0PA 1Z5PA 1CFJA 2YOHA 1KFBB 1W5FA 2XX3A 3ADOA 3GRFA 4GE3A 1AUXA 3WAJA 4DCMA 3C48A 2VHQA 3KLNA 2PA0A 4AY2A 3BREA 5KCMA 1YOVA 3LY5A 4P7JA 3KYJB 2XBMA 3KUKA 2N9UA 1U1EA 4O2RA 3C24A 2X5NA 3EGDA 3R7BA 4N7JA 2I6UA 4JUCA 4LV8B 4Q48A 5EN4A 4ZIRA 1NRJB 4V0QA 1SBYA 3AEXA 2Y6UA 3I5UA 4XD2A 4B3JA 3AQ4A 3FKJA 1WMEA 5AJTA 1TADA 3DTYA 3OVMA 3L1HA 4JELA 4YASA 1F38A 4YRLA 3ETLA 1NI3A 4I4TA 3IX7A 1Q91A 2E1PA 2FEKA 4NU5A 4OQ4A 4PYNA 5JE8A 3DB1A 1YCGA 1Z0AA 3I4CA 3TLGB 1CJMA 5IULC 1TUIA 1BS9A 1O6FA 1GGKA 3IXMA 2QAGA 3LM8A 3M4XA 3NKVA 3OA0A 3D3NA 3QPBA 4BNFA 5BURA 4V1CI 2FMTA 2D7DA 4QOSA 3ENKA 2XWQA 3M4NA 3WLAA 4ZYZA 1E94E 2GT1A 3P2EA 4EYQA 4AYWA 4O2BF 1QP7A 2EX0A 2ORYA 3BWMA 4KWEA 2CMKA 1D2AA 3E1SA 4XYBA 3N0RA 5AUQA 4XVRA 3OE5A 1Q83A 1CE8A 3WFIA 3FSJX 5CTAA 4I6GA 5AVKA 5BWOA 1JDJA 5LNK6 1ZIYA 1O58A 1PQ4A 4O4JB 1GL9B 3CPHA 3PIDA 1MB0A 1YB5A 3O5AA 3ITEA 4MPTA 4XSHA 2QD4A 2MR6A 3MJVA 3VDNB 2A84A 4IV0A 4E2XA 1QIFA 3NDPA 4QYXA 4KHZA 3W8DA 3DH0A 1UOEA 1V1RA 2WTNA 3PR2B 4UW9A 5F21A 4G5GA 4IQFA 1KO4A 3T94A 3HU1A 1LZKA 1HM5A 5FEUA 1ZN7A 2IZZA 3TRKA 2AF3C 2OB1A 4FXOA 1K92A 4B76A 4PEVA 3L7OA 3L7AA 4D3SA 3ILVA 1EFPA 5FYDA 5A0VA 1D1SA 2X0JA 3X44A 4D9JA 1BNCA 1H8HD 1QO9A 2QENA 5KU1A 1E3DA 1E3WA 1GAWA 4ZT7A 1G2OA 5B2ZA 2J5RA 4RJLA 5A5GA 1AGRA 3KQTA 2ADMA 4MVJE 4BO8A 2DR3A 3V9PA 4P0QB 4LFAB 1VHTA 1UBSB 3QBTA 5JD3A 2JIZA 2AR0A 4DFDA 2X8BA 1K75A 3IDAA 3KKZA 3VJLA 1ZGGA 4UBLA 1NGSA 4UNRA 3T5BA 5JBQA 4LJ7A 1LPSA 2HA7A 3OIUA 2YRXA 5ICEA 1FTSA 4L7QA 1NBMA 4R3NA 3QXCA 1ZLXA 1KVRA 3QGMA 5HKOA 3JATA 4X8LA 4INJA 3P9QA 2WMNB 1K7YA 1YL5A 2WSLA 3M5PA 3IIMA 4Z3KA 1WKBA 2BBOA 1A7UA 5LPNA 1QIKA 3RVKA 4P3OA 1E1CA 1E32A 1SEPA 2DFVA 4AG3A 4GBED 1QHNA 2WB4A 3KOYA 3ZCUA 4AJLA 2P6NA 3OSZA 4DLXA 4YJGB 3EF3A 1ISIA 2QN9A 4CM4B 4ME6A 1SB8A 1XZKA 2R96A 3H18A 4C30A 3IAUA 4N6NA 1UKYA 4RLQA 3HJNA 1M6VA 1N2HA 1G7RA 4RWZA 4WK0B 1L5GB 2EKBA 2ST1A 1J1ZA 5SZKB 3RYCB 2CVHA 3UAOA 2VUHB 3E3MA 1NW7A 1G2IA 1WCXA 1LA2A 2A9QA 2E18A 3CIOA 4HZUB 2Q0XA 3O8LA 5HJ7A 4FOSA 2V7GA 2P2LA 4HNUA 2RB5A 3ZGZA 1ZOSA 4XVHA 4ZEWA 2IY8A 3GELA 2BGRA 4RS3A 5FH9A 2WHQA 4IX9A 1DEHA 3W79A 5KWJA 3D54D 4NYIQ 1RWBA 2IHJA 3OCJA 2JIQA 1CC1S 3DE0X 2IUYA 3THWA 1XR3A 1G8HA 2VTBA 3FRHA 4A8TA 3FWKA 5JJKA 3FUCA 4IL5A 1FQOA 3EWNA 1RI1A 3MF4A 4FW9A 1BW9B 4JKYA 3RH0A 1R16A 2NAPA 2P30A 1N9ZA 1KK0A 1PYGA 4OK3A 4UJ5A 5ALNA 3RFXA 1B7GO 3FYUB 3EH2A 3U56A 3H3XA 3TRJA 3Q7PA 1QIMA 1RHRA 4FN5A 3AERB 4JVNA 5JC1A 1VPTA 221PA 3QVUA 1E7RA 1YRLA 4K9OA 2Q5JA 3PL1A 5BSMA 4MCIA 2O23A 1Z47A 3KKQA 1I8TA 5BVHA 1EHCA 4O4LA 2A5DA 3A04A 4AM8A 2ZUSA 2BKLA 1CB0A 3C98A 3UK6A 5IK2D 4NOLA 2AEEA 2PYZA 5DNDA 2QROA 5BNWA 1B00A 5BRJA 1SIUA 1Q50A 4IKEA 3WLKX 3D64A 4R4JA 1TAUA 2ZJFA 3PX3A 2JBAA 2VWGA 5E7JA 4W9NA 1D09A 1K27A 3TPZA 4BVKA 2JRLA 2PZFA 2D1SA 2XYQA 1CXZA 1E6WA 1Y3BE 2VNJA 2EEZA 3HVJA 1U8YA 5CAEA 3GP8A 1JJBA 1E2KA 3SXJA 1NWCA 5D01A 1E9BA 4A16A 1MENA 2FGJA 4IXMA 2GEKA 1R4NB 1I51A 3G1UA 4U63A 3VR1A 3MJFA 4KQ6A 1CT9A 2VJMB 3C6QA 4GGOA 2V7VA 2ZB7A 2I1QA 2O2YA 4LFCB 4KAJA 3CSUA 4P5PA 4R1SA 5TDHA 2IK8A 5EHZA 2RHOA 4J0QA 3O0DA 2RG1A 5JSZB 1EGQA 1QK4A 1V5GA 1SD1A 1WMDA 3KUXA 5F5XA 4URYR 2YDYA 4JYPA 2WAOA 3GK3A 3X1YA 1XZBA 3QV1A 3TD6A 4WBNA 1U0JA 2Q1UA 1M1XB 5G0TA 3HPQA 1I0ZA 4MUXA 2JLYA 2QUJA 4G5YA 3FOZA 2EBUA 4RADA 2IZ7A 1YKSA 3O1LA 3UK0A 1RBQA 2GZ2A 5AI9A 5CDFA 1BGXT 3T7AA 2Q9UA 4PYLA 3L6RA 4RAQA 2LRHA 3R7WA 2VK8A 3O21A 3OURA 1FX0B 1D9ZA 4IDNA 4WOBA 1NXXA 1XP8A 4F3NA 4QXAA 3GUHA 3QE9Y 3OSUA 5ES3A 3ETCA 4MWCA 3VOSA 3QWFA 5LQRA 3KYBA 3CEAA 1YULA 4LI3X 1YAJA 4Z49A 1ECCA 1R8YA 2OENG 4M7PA 3R7AA 3HBNA 1T2CA 1IAQA 2AEFA 2DR2A 2X9QA 3MOGA 3RADC 3DGFC 2QX4A 3A3NA 4QARA 3Q41A 1YJ5A 2ZROA 1VJ1A 3E9ZA 4WKNA 5IBPA 5IAOA 3CLRC 5KZMB 3JYHA 1NVUQ 4HMPA 4LOJA 1DDGA 4YALA 1KYTA 2M2IA 2VJLA 3FJ1A 4G84A 3QPUA 4DSTA 5JHHB 3I04A 2R47A 5T64A 1EVYA 5L3VA 1X13A 4OQMA 4S24A 1WJGA 4QNMA 4XXHA 3F7NA 4KLCA 2QTNA 4JCOA 4M8IA 5KNDH 4FB5A 1R5BA 1TD1A 3RYHA 5F12A 3ORQA 3O03A 2ZREA 3I37X 1ZUD1 1OVMA 1DLIA 5HBGA 3RRMA 3TR0A 2V7WA 3FCOA 1C8BA 1Z5OA 1D0SA 1UMDB 4HQFA 4LRWA 4E94A 5BQ3A 2IS6A 2HWXA 3PX7A 2IHBA 5HIIA 3PFGA 3G1WA 2XUDA 1SM4A 4DDTA 2G08A 5HF8A 3QELA 8OHMA 2FG6C 1GSOA 1KS9A 2VBFA 3BD6A 5EHIA 1GGHA 2ACKA 2PD4A 3AYXB 3MWEB 4ODIA 4MQLA 2RGAA 2GUGA 2QUIA 1UOPA 4AJNA 1L4GA 4YP5A 4PZ0A 4YMSA 3ABOB 3ROZA 5CLGA 2BT4A 4MYDA 3STWA 4AF7A 2P2GA 1NM5A 3DP9A 3GRKA 4GMXA 2Q9BA 4I1IA 3JQ9C 4UZEA 2ECFA 4II3A 4Y2GA 4R1OA 3X1DA 4EEZA 2VT2A 5FJJA 2V7PA 4CIYA 4ZAGA 3BHNA 3BB4A 7GPBA 1NP7A 4PQYA 5AW4A 4HEA6 1O96A 1T0BA 2HNAA 2JVIA 2XEDA 3I6QA 3IJEB 2AW5A 3LAWA 4RHYA 3AEKA 5D5HA 1IL0A 1VA5A 8ADHA 2WFLA 1YDGA 1Z6XA 5T4FA 2Q7OE 2IS4A 4O02B 1QDUA 5EIOA 1KFEB 4AROA 1JB9A 1KBZA 1X7XB 1NSFA 1R8XA 2RB4A 4PO3X 3ZH9B 4J0EA 1PKEA 3NVMB 5LJIA 5HJEA 3VPHA 5KAMA 2RD2A 2SICE 4CDNA 3HFRA 5TF4A 1C5KA 5K6RA 3QFHA 4P3PA 2H08A 4YB8A 5I8PA 1AQ6A 1ZA1A 3INGA 1VKRA 5LD2C 3JQFA 2FPGB 1U2ZA 2ZS8A 5E0KB 3RSOA 4TL8A 4BKMA 1JYEA 4EPXA 2P2NA 3FUVA 2OV2A 2Y1KA 3RNOA 2FZGA 3JX9A 4AMYA 4D43A 2EYUA 1JHMA 1I5EA 1P7VA 3OZDA 5ALQA 4C3VA 4BX9A 1DV1A 2JIBA 2CLHB 2FUG1 2JD1A 5HJ2A 3A3OA 4UVHA 5AVVA 4QJ4A 4GP6A 4ZEXA 2BIFA 2V4MA 3OG9A 1NLMA 5BV2P 1OJ7A 1TEVA 3S2ZA 2GA9A 1R0BA 2IPAB 3B7PA 3ZXYA 1IC6A 3K0BA 4J0JA 1FDWA 1AQJA 4RA9A 4R83A 2Z6QA 2XMPA 2WJIA 1IWPB 4XYMA 2VUTA 1SCUB 3EXEB 3OIFA 3OJEA 3JTMA 4JUDX 4MUNA 3R3XA 4MGYR 1DVRA 1XDWA 2E4ZA 5IVKA 3C3EA 3QM1A 4DV1B 2B8WA 4BTLA 2FEXA 1DBWA 2D8MA 2IDMA 3UXHA 2VJCA 2ZR8A 1UM8A 3HXQA 2EBHX 4FOTA 2RGRA 2PKRA 4ETMA 2GB4A 4LW8A 4WA8A 1UOOA 1QYDA 2C2OA 2ZUFA 2EU8A 3RFFA 1Z6GA 1V9SA 4ETIA 3S81A 3R7FA 2ACVA 2ZSEA 4M0DA 4N9QA 5LZ5A 3HA7A 2QVGA 1IBRA 1VRWA 1YI0A 4LY3A 4NPAA 1CIPA 1D3AA 2VK4A 4I1YA 1D7OA 1QTRA 1UDXA 3DEJA 2GZDA 2HMYB 1U7TA 4A0QA 4RVNA 1D2HA 2PLRA 1V39A 3PFKA 1WSWA 4QOGA 5AR1A 2WHEA 1W8DA 2XSZD 3FMPB 1BVRA 2W6NA 3KL2A 3QHAA 2A2ZA 4OLHA 4ZZ3A 2Y92A 5JSHA 2BAGA 4NCKA 4YV1A 4PICA 2YIJA 4N40A 4P7GA 3GLHA 1PEYA 1IM5A 2KPOA 4NHEA 2CUKA 1DEOA 1X39A 2Q99A 3JYQA 5JFOA 1TGVA 3PHLA 4PFSA 1EFRA 4EUEA 4EFKA 2A3RA 2M6SA 1JAZA 2OLKA 1FRVA 3FVRA 1Q7GA 4OLFA 1CUFA 1EEXB 1VJCA 4Q0MA 1NDHA 3SMQA 4QQ8A 3L9XA 5CX1A 4MB2A 4DYHA 5J4YA 4QT4A 3PC7A 5B1YA 5LVAA 3B48A 2Y3IA 2J9GA 4UCQA 3G5AA 4MDYA 2BEUA 4W1QA 2HW8A 1V7QA 1PVDA 3ZC3A 4X8HA 5H83A 1DRUA 2H18A 4FGLA 4BO2A 3TZLA 2HCTA 1E99A 2FFBA 3GNTA 2ARKA 1CY6A 2G06A 3EOZA 2RC6A 4KITB 4QUIA 3VZPA 2PTGA 4UAUA 3EXIA 4IIDA 2X2EA 4V2IA 1R74A 4Z4EA 1FS5A 4KLAA 2B4KA 1ZY2A 1KO7A 5DM60 1A76A 5J3JA 4DLUA 1IATA 2IGTA 4V38A 2AXEA 2B7CA 3NDRA 3F6BX 1II8A 2IF0A 2PMDA 2QD1A 4D8YA 2QGZA 1PAUA 2GHRA 7REQA 5M29A 3CW2A 4RD1A 4LDPA 4RK0A 1VBNA 4MV6A 3WZMA 4DMMA 1MFZA 1ODCA 3GXOA 3A25A 1ND6A 2FR8A 3OMLA 5T67A 3K0FB 3UMCA 1L5LA 1T5HX 3UC5A 1GZSA 1G20B 2R8XA 2H17A 3OU6A 5DHUA 3L7YA 4OF4A 3ECSA 2WKPA 1U1FA 2J08A 2Z0MA 3C3KA 4JN6B 2VSFA 3ETJA 1U02A 4PZAA 5FAXA 5LN1A 4R05A 1L3CA 1VHDA 2C5LA 4Y2UA 4ZI7F 3TSOA 1ZVVA 4MDFA 4R1LA 4MQMA 5JSUA 1THGA 1HNWB 1YHZA 4IFBA 2IHYA 3DKVA 3DLPX 4YAUA 3NEJA 4GOKA 4EJSA 3K05A 4Z1MD 2ZI3A 1XWFA 2QL7A 2XUQA 1NZFA 3O2NA 3OX4A 1NYTA 3AG6A 3DTVA 2ZYUX 1KMHA 3AQIA 1WW3A 3COSA 3EBOA 4L5IA 4RK1A 5G02A 1IBSA 2YH2A 2QTRA 1QQ7A 2W0SA 5JCJA 3OAAD 1Y63A 2VHUA 2IH5A 2G63A 1BOOA 1SU7A 2FPOA 3K0CC 4IPTA 1KDYA 4NYMR 2CF6A 1CEEA 5E6RA 1A5ZA 1BXRA 1DQPA 1LZLA 1MPTA 1EFAA 2FW9A 4M37A 3KR0A 4C21A 4Z4FA 2I62A 3BIXA 4HLUC 4TMVA 1W19A 1A4XA 1P5HA 1R3UA 3JVEA 4W63A 4XWTA 3RI3A 3TZQA 4B09A 4Q3NA 4CIWA 3IP6A 1X3SA 1ZBQA 1G55A 2BN4A 1OUMA 2FFJA 2QIPA 3IBTA 3JQBC 4YCBA 4R1QA 3VFDA 3WSWA 4DT1A 2GN0A 4Y2YA 1KDRA 4O33A 3GRCA 1OU4A 3E15A 1E2IA 1MH9A 1Y8QA 2W2LA 5ALHA 5EJ7A 4M9UA 1E4EB 4MPPA 3G88A 2HIMA 2BKXA 4P4SB 1NZJA 2RGUA 2XBUA 4JUAA 3CQ9A 4MVCA 3SKVA 2VCEA 4IHQA 1NURA 3FN4A 1P19A 4S35A 4YAFA 4EHDA 3BCHA 1TTQB 5BSHA 1YR9A 4PIVA 1SCQA 2AT1A 3V2GA 3HWWA 3ROTA 3VOAA 4K9PA 5DHAA 3WLQA 4C0BA 1EP9A 2PRIA 4BGDA 1PTJC 1O2DA 3G8AA 3HVUA 3HA3A 3Q85A 5KOJA 4TKZA 1XVAA 4NP6A 2WOOA 4L85A 3J81k 2GF9A 1ZCBA 4QSMA 1BFUA 2YNMA 3S2YA 1HX7A 2IE8A 4FHEA 5DLYA 3F5MA 1VJRA 2Y2UA 3HDGA 3W8RA 4B3DA 4E4YA 1BIFA 2OLEA 4AZVA 4DV7B 4MYTA 5EOVA 2ZT8A 1C7IA 4FP9A 1HZZA 5ALWA 4KSBA 1BMQA 3QYPA 2XXAA 3M49A 1TT7A 3NNSA 3X2FA 1A88A 3V55A 5FFMA 4D4GA 2D06A 1VE7A 2DUNA 3P1JA 4KWHA 1YR2A 5F9HA 3E2IA 1Q0PA 1G8JA 3QX8A 4IS3A 1DXOA 3QF4A 4RLSA 1ZD8A 1DMRA 3C14C 1IN4A 1EB9A 3RTCA 1CR6A 3VR2A 2VQEB 1Y1PA 3R75A 4BXOB 4KCGA 5FOVA 3R3WA 1D2GA 1IZ8A 1U8TA 4R98A 4BYMA 1QHHB 2RK6A 3CSDA 3W9YA 3WIBA 4EARA 1ZJZA 3WV5A 1DDIA 3O8BA 3LUGA 3F73A 1P3JA 3LUJA 1Q0HA 3RSGA 1JHYA 1U2EA 3GJ6A 1W88B 5DMXA 1G3MA 1QV6A 2MYUA 1Q1ZA 1CNFA 3R3YA 2D1QA 1J21A 4AQYB 3OJWA 4N5DA 3NDJA 3C3YA 3T7RA 6REQA 1KIAA 1IOWA 3N07A 2R00A 3GUCA 3KZMA 1KP9A 4CL2A 3DMDA 5G0VA 3M3DA 1MJGM 3H1AA 1HPLA 3MM4A 1ESMA 2X77A 4IIEA 4JI1B 3M5WA 3TL6A 3GR6A 1M7GA 1QX4A 1DIHA 3OQPA 5J59A 4Q82A 2ONJA 1GRNA 3SMVA 5COAA 3DT6A 3M1LA 4B71A 4CM5A 4I2VA 4JLBA 5LMCA 2JJYA 3Q9SA 2IS1A 2CCKA 4UD6A 3LOQA 2YV5A 2CB0A 4YO8A 4BX3A 1RZVA 3AOEC 1PR5A 3MB8A 3D6JA 3ODPA 2VRCD 2YWXA 1P2BA 1P6UA 2G6TA 2OHOA 2QM3A 1RRVA 3L0DA 4MV7A 1R0LA 4BJ5A 1X7YA 3X2EA 4QEZA 4Y1FA 4WZAE 4Z0TA 1E1RA 2EFJA 3RUAA 3QX3A 1YE5A 5DDIP 4B4WA 4KFSA 2ZJ6A 4ZOCA 3OO1A 5LP6B 2Y9PB 1E9VA 3W8NA 1NW5A 4DQXA 5CLQA 4F3KA 5JVDF 1O7JA 1Z3CA 2A6PA 1P0FA 3GVPA 4KXFB 4PLWA 1GKUB 3V7UA 1P3DA 3WL7A 2GF2A 3A1SA 3KBOA 4AN4A 1R15A 1RQ7A 2OBNA 2WWWA 3LUKA 2BHSA 4Q1AA 3AJ8A 4XJVA 2P8SA 1VSQA 3VTFA 5A9SA 3JQ6A 3W5DA 2JFNA 1VIYA 3AKZA 1BXZA 2RKBA 1E7SA 1RWMA 1DAGA 3EWIA 4CMAA 3X1WA 3DDCA 4Z8XA 2VZ8A 1RKBA 1TKCA 1ZCFA 3QI7A 4CR8A 2BCGY 4YDQA 2A5LA 1HT0A 3TKYA 1C1YA 1ACLA 3N7AA 5KKNB 5FV7A 3C2QA 1FP2A 1E2DA 3BK2A 2V3VA 1U7XA 3IMGA 1A4UA 1H9AA 1XRMA 3ZK8A 1Y42X 4AMBA 3QSYA 1PDVA 3BHMA 3D7KA 2NUTA 5EJ5A 2Z4RA 3A2KA 4JUFA 3L3BA 2H9AA 3I2JA 2OBXA 2VWQA 1T5TA 3DOCA 4GQBA 4NFLA 3O3OB 4Y2XA 3TXAA 3WK4A 3IERA 4H3SA 4XYEA 1KOLA 1RYBA 1XAGA 2XMQA 3ZTTA 5TJHA 1FUYB 2V96A 4W5WA 1I5RA 5CVDA 4EFNA 4YRRA 1RHKA 3KKKA 3RFUA 5KYNA 5LOVF 3ZJUA 4EA6A 2Y0CA 1BDIA 1UDWA 1J5PA 1GQYA 1R0YA 3KT8A 3ED1A 1XMPA 3WLTA 3ZIAD 1D1PA 3CBGA 2JAUA 1PDOA 1LTHR 1U80A 1MRZA 4W8GA 3LYHA 3MT0A 4KR6A 5TSDA 1JU3A 1VJTA 3B6IA 1DIRA 3KPYA 1U1DA 2R0QC 4F3YA 3NHMA 1D4OA 3JARB 3EG9A 1GLGA 1JPVA 3LQKA 3SVZA 2XYGA 5H59A 3UUWA 1TJYA 3IJ5A 3WI7A 2GWHA 1XZHA 3WMRA 2V9PA 1ZU4A 2X58A 4A0GA 5I3ZA 2I33A 3IPCA 5DTMA 1N8NA 3D7LA 1ESZA 4JQYA 5LQUA 3I0NA 1V25A 3WY9A 2J5XA 2YRFA 2NU8A 2ODWA 3FPCA 1S3SA 5A6SA 1GPDG 2ZKLA 4GLJA 4GRDA 5A05A 2ZSUA 3X1MA 4K1XA 2W4MA 5JNVA 2VPTA 4RTJA 5IVHA 3GY0A 4XFJA 4WCFA 1HXHA 3E03A 5LB4A 4ZEVA 2ALJA 1VMAA 1FLNA 2QJTA 2VJNA 4O4LF 1N57A 3EPHA 3LK6A 3DVRX 1B0AA 3LK7A 3DKIA 4D0NA 1RNLA 2VTVA 3LX5A 3EGWA 5AVZA 4ML3A 4XI9A 2RAFA 2GD2A 3PFWO 3GLFE 1NVEA 2OZEA 3VR4D 1R4MB 1X8KA 4GI1A 1I7DA 1Y4SA 4OB8A 1H4SA 3TL3A 3DHYA 2VF2A 3OZUA 1BFDA 3GNLA 4AO8A 4J16A 3OEED 4BMZA 1L8OA 5ALJA 1RLUA 3CLVA 4TUYA 3VAYA 5BMOA 4QVKA 3MGAA 3L05A 5JYEA 5K8TA 3HB1A 3UUEA 3IMKA 3MWDB 5F7OA 2YW2A 3NOQA 1JWBB 4I9UA 1T25A 4XOIA 2NUPB 2V6FA 5TT0A 1DXHA 1UXGA 3E8SA 1MPXA 4HSEA 2PKEA 3ENZA 5IWCA 1QYIA 3P4UA 3UHPA 1C29B 1EFTA 1TYZA 2QQEA 4GF5A 3VZSA 5DZSA 2PRZA 1TF5A 1J4AA 1U0EA 5L3ZA 3BMQB 3LO5A 3ZNOA 4XDGA 5JS1A 2C9OA 2HQOA 3DHWC 4V02A 2LNDA 3NBMA 1UPFA 2Y1FA 1MBZA 1ZVKA 1XG5A 3TN7A 8LDHA 2ZJ1A 1B1CA 4ZAXA 2FLVA 1JHRA 2JJ1A 3M34A 4K6KA 4KQIA 2ZB8A 1CQZA 3DL2A 3LUHA 4PR0A 5A9RA 1XU7A 3F97A 4C5CA 2B69A 3C1AA 1IQPA 3OJFA 3TJMA 3QJGA 1XA3A 4UASA 5JI2E 2XXJA 3DM5A 2G71A 3R9IA 3T1QA 2G25A 5B1SA 1X6VA 1E9RA 1CVLA 2JVKA 2O6HA 3F7OA 3OD5A 3I62A 4E2FA 2R66A 3REOA 2A9RA 1JHDA 1EFCA 4P3KA