5LKAA

Crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26 at 1.3 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
301
structure length
301
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEAADLPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGWILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQLPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPAHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloalkane dehalogenase
publication title Engineering a de novo transport tunnel.
doi rcsb
source organism Sphingobium japonicum
molecule tags Hydrolase
total genus 115
structure length 301
sequence length 301
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lkaA00
4OYYA 2VA9A 4MEAA 2CJPA 3RKSA 1QO9A 2XQFA 3WLAA 1XZLA 2P8SA 5AP9A 1HDEA 4N8EA 3AUKA 4X6YA 1BROA 1CVLA 4BTLA 1EB8A 2OG1A 2XUGA 2B4KA 4QEKA 5K3EA 4Y2VA 3A70A 3IURA 2AXEA 1DQZA 4X6UA 5AI6A 4XVCA 5JZSA 1J2EA 1XQWA 4G8BA 5ALTA 5FRDA 2XE4A 5A6VA 4BAZA 3DEAA 2C0QA 5ALWA 1F8UA 2PPLA 1KEZA 3G9UA 2HADA 2V9ZA 3F9CA 3NGMA 2XUDA 3DJYA 4NS4A 4X94A 5IVKA 1T2NA 3AIOA 2VAVA 2OQIA 1GQRA 4ETWA 1XKLA 2AJBA 4LKOA 1XZJA 2WSLA 3G7NA 1CLEA 3FLEA 1G66A 2K2QB 4KE6A 3C5VA 3LS2A 1JMKC 1CUVA 4PSDA 4Y2PA 4BYMA 5EIHA 3C5WP 4B0PA 4JNCA 2HRQA 2WUGA 3C6YA 1AMNA 4H7EA 4OUKX 4JYPA 2DHEA 3D5EA 2XLBA 3ESCA 3HEAA 1YA8A 3JWEA 5FV4A 1FFCA 2B20A 1DX6A 5FXMA 1XQVA 1BN7A 5LZ9A 4FBLA 1YS1X 1XFDA 3C43A 1MO2A 2Z5GA 1Z68A 1XZHA 3DCNA 4J0JA 3H2HA 1OXMA 1XQXA 4DNOA 1E3QA 5JAPA 2EDAA 1UK8A 5HF6A 1ZIXA 1XLVA 1H2WA 3DQZA 4C87A 1AKNA 5C81A 2W22A 5EHZA 3MVEA 5FKJA 1ODTC 2UZ0A 2Z3WA 5KWIA 2CBGA 2J4FA 3NOXA 5ALKA 2QZPA 5JD6A 4LYDA 3D7RA 1TQHA 1XZFA 1Y7IA 3CN9A 3ZPXA 1Q84A 1EA5A 1H22A 4KEAA 3VJLA 2WJ4A 3H2GA 1AZWA 2W6CX 1PFQA 3SC2A 1TCAA 1XZCA 2G63A 2RAUA 3ICVA 2BUAA 1FFBA 2XB6A 4DMHA 1EINA 4BVJA 3I2HA 1XZAA 3HI4A 3O9VA 1Q0ZA 4BCCA 2QUAA 4UBOA 3IUQA 1MX9A 3GUUA 2PUJA 1LBSA 1CV2A 1QTIA 2HL6A 3I2FA 3PFBA 3I6YA 3SWWA 4X90A 3DDUA 2AJDA 4UPDA 5J3JA 2QJWA 1ACLA 2B9VA 1CPYA 4DMFA 5AM1A 4IHAA 4KE8A 1F0NA 2WIJA 1EVQA 4Y2YA 3IUNA 2OGZA 4KR0A 2BJHA 1BCSA 4H7FA 1CUWA 4EBBA 4PSCA 3STVA 4H0CA 4PO3X 5K5EA 4X97A 4J0IA 4AZ3A 4IQ4A 1GZ7A 4H18A 3D2CA 4I4CA 4DNFA 2LIPA 2HU7A 3RLIA 2XMCA 4M0MA 1CUFA 3IULA 2RI6A 3FLBA 5AO9A 4Y2SA 3WZLA 2ZJFA 1LPBB 3C6XA 1WM1A 3HC7A 4UBNA 2VQ6A 2OQVA 2HFJA 4P9NA 3FCXA 4KACA 5AI5A 2PSFA 1E8MA 2HHAA 2IX9A 2XQGA 1XRQA 2WTMA 2PM8A 5KBYA 5A71A 6YASA 2BGRA 1N5RA 1WOMA 3D2AA 2X76A 3M81A 4LHEA 3WL5A 4YPVA 2GBCA 1UK9A 1EI9A 3I2JA 3G0GA 4EY5A 1JI3A 1CRLA 1CUZA 4Y2QA 4G8CA 1ISPA 1IMJA 5FP0A 4DIUA 4LXHA 4HXFB 5DTIA 1NX9A 2DHCA 5ALNA 4ROTA 1CUHA 5FOQA 5FLKA 1AX9A 1UOQA 3HABA 1R4ZA 4H77A 2WQZA 2VEOA 3STTA 1GKLA 2C5GA 5HQ3B 2HU8A 5ALGA 1WCYA 5AIBA 3FLAA 5CT8A 5CURA 2QM0A 1GQSA 2WU3A 4V2IA 4W1PA 4BC0A 2JF0A 2B61A 4H7KA 1JT2A 1EDEA 3I6ZA 4QLOA 1WPRA 2PL5A 3CCCA 1EH5A 3KD2A 3OG9A 2G4LA 3LIPA 2ROQA 4G9EA 2XQKA 1ZJ5A 3FVRA 5K3FA 5LKAA 1CR6A 4B84A 5IVDA 2XUHA 3DKKA 1FFAA 3PDCA 2ORYA 4CCYA 3LIIA 1EDDA 2XUJA 5C8ZA 4GW3A 4B7ZA 1VKHA 2WG0A 5DWDA 4HZGA 1FFEA 4B9EA 2BUBA 3E4DA 3VKFA 3DLTA 2C4HA 2PSJA 4M0EA 3ZWQA 4FLMA 4Z49A 1OILA 1MNAA 3O4IA 4H7HA 3V1KA 1XRPA 3OPMA 1CUBA 1O6FA 4FLFA 5ALZA 2VTVA 3NUZA 2OCKA 2WFZA 1YAHA 2WG1A 1HLGA 2OCLA 1K5PA 4KAFA 5AKJA 2IITA 2HRRA 1JJBA 4XX1A 1WHTA 4BE9A 3IDAA 1LPMA 3WKAA 2GYWA 1DU4A 4EB0A 1DT3A 3FNBA 1MT3A 2XQIA 4UBMA 1ETHA 3WJ2A 3RM3A 1ZGCA 3LP5A 4U2EA 1USWA 2HA4A 4FWBA 1ZI8A 4B85A 2ONCA 1IZ8A 1SCIA 2VT6A 2BUCA 1JMYA 2Y1KA 3GBSA 5DTJA 4QDXA 5AI9A 5AKXA 1WB6A 2ZYSA 2OCIA 5JZBA 1R50A 4BAGA 4JUIA 1MU0A 3S8YA 5CBKA 3QM1A 1ZOIA 5ALMA 3C6ZA 3R3XA 2HIHA 2XMSA 2ZYHA 3VJKA 3K6KA 4GI1A 4LIPD 1U65A 4UHBA 4WY5A 1YASA 4BATA 1BEZA 4HVTA 3TJMA 3EF3A 2QT9A 3FVTA 4S0XA 2R11A 4GDMA 3QMMA 4U2BA 1A7UA 1W6RA 4ZWNA 3WK7A 2QR5A 4OU5A 2IIVA 4BVKA 1SFRA 4PF1A 4KRYA 3B5EA 3A2LA 4ZXFA 3FYUB 1DTEA 4HRYA 4GWLA 4Q05A 2V96A 3OC0A 1GGVA 1THGA 1EHYA 2HA0A 1XZGA 1H23A 2E3JA 2G5PA 2EEPA 2BGNA 4G4JA 4DGQA 3WWPA 4ZV9A 2CUTA 2CKMA 2RIPA 4ARBA 4QWMA 3LLCA 4BRSA 5JIBA 3L1JA 1AURA 1JU4A 1MNQA 5AOAA 4OD0A 3ESDA 1C7IA 1A8UA 1SOMA 4HXGA 1CUJA 4Y2TA 3BJRA 4EY8A 4KAAA 3EBLA 2ZSIA 5ALRA 5AICA 3BXPA 1QO7A 4K6KA 3TRDA 4Y2UA 2J3QA 5AM2A 3G9ZA 3QPDA 4Y2XA 3M3DA 4ZV7A 1TCCA 5E2IA 4DLNA 5AM3A 4DNQA 2XUFA 4B80A 3PUIA 4NZZA 4AN1A 3V48A 2PSEA 3CCBA 3A6ZA 1XRMA 2FJPA 2CEKA 3N2ZB 3WZMA 1R9NA 5ALJA 5ALSA 1FSSA 2ECFA 4X95A 2WIDA 3W2TA 2FJ0A 1WHSA 4U2GA 1MX5A 1ZJ4A 1P0IA 4L0CA 1AGYA 5HKAA 4BC1A 4INZA 5K3DA 3K9BA 1QZ3A 1BRTA 1Q83A 3WK5A 4C01A 3IB3A 4O08A 4UBIA 4C4YA 3G0IA 5LYYA 4BRZA 4UBLA 2XUAA 3F96A 2WJ6A 1FFDA 3PE6A 1SCKA 4H7JA 3DNMA 4J7AA 5SYMA 4CIAA 3PI6A 1IUNA 4OSEA 2OGTA 2QXUA 3B12A 1CUGA 5K3CA 4K5QA 5HF5A 1LPNA 1QIEA 2WKWA 3E3AA 5D3ZA 5E4JA 1CUYA 5AIAA 4F21A 4PW0A 1EK1A 1J1IA 2G5TA 2DSNA 3ESAA 4W1RA 3WIOA 5AKGA 3WMRA 2GZRA 4G8DA 1W1IA 4TGLA 3C70A 3I28A 3DS8A 5EGNA 2O2GA 1EB9A 4DSZA 5EHNA 2V97A 4W9RA 5JARA 4E11A 4FMPA 2GBFA 1UKBA 2XUPA 1TCBA 1ZD2P 2DQZA 4Q1VA 1F0PA 1QIMA 3FWHA 4QE3A 4DMKA 5I8PA 3FCYA 3D2BA 1SC9A 1G42A 2OAEA 4B83A 3W06A 5LZ7A 4TPKA 5JAHA 2RHTA 3HJUA 4QLAA 4X92A 3KXPA 4N8DA 4WY8A 1XZIA 2OLEA 1VZ2A 1CEXA 2QJRA 4N5IX 3HYSA 1J06A 3G0BA 3JYHA 1E89A 5JZ9A 1Y7HA 1MJ5A 1ZD5A 5YASA 3R3YA 4CG2A 5AOBA 3O9MA 3WK9A 1T4MA 2WFMA 2HDWA 2WUDA 1UXOA 4Q34A 3EQ8A 2QVBA 3EQ7A 3WKEA 3I2IA 4J3JA 5C7YA 3STWA 4K6GA 1BCRA 3DL7A 4X91A 1X2EA 5ALEA 4G5XA 3VDXA 2QUBA 1MPXA 2JGJA 4TVKA 4GLBA 4QNNA 5BOVA 3CN7A 2XUOA 4G4IA 3FYTA 1C4XA 4YK7A 5T4FA 1MAAA 1WPXA 4KE7A 2QKYA 3WL6A 4MWTA 3PUHA 2H7XA 5C8XA 1EX9A 3AINA 2JGMA 1QIJA 1RWQA 1QIIA 4IH9A 3E1GA 1DX4A 2FUKA 1JU3A 4P08A 5LZ5A 3ZI7A 5CT5A 3O0DA 5LIPA 4P92A 5AK5A 3FSGA 1XRLA 3HACA 4AQDA 4BB0A 1QIGA 4ZI5A 5LZ8A 3W05A 4JH0A 4QDUA 3WKCA 3QMVA 1LNSA 1W75A 4BP9A 5DYTA 2AJLI 2EDCA 1M33A 4WJLA 5HK8A 3D0KA 5HCUA 2WLSA 4X85A 4WFKA 4NMWA 3STUA 3R3WA 3U0VA 3TGLA 1MN6A 5ALUA 5IVIA 3R3UA 2Y6UA 3GELA 4I3FA 4M0FA 5JANA 1B6GA 3AZOA 2WIKA 5D6OA 3AILA 5JAUA 3H18A 2BCEA 1O6GA 2DFPA 4U2DA 3OURA 5JALA 5A2GA 3I1YA 3O4HA 2I03A 5HQ3A 3V1MA 1F6WA 5HKBA 4A5SA 1GT6A 1MAHA 1HBJA 4P93A 1UKAA 4CG3A 2X5XA 2Z3ZA 4JYMA 2DHDA 2GBGA 5CMLA 3N0TA 3F97A 4G4GA 2HA5A 4JEIA 5KWJA 1CUUA 1VXOA 1CFJA 2DR0A 1JKMA 1UZAA 1CUCA 2XMRA 3DOIA 4ARAA 3AIKA 1R3DA 3H04A 4UHHA 4AMZA 2XMQA 4PNZA 3STYA 1QE3A 1AC5A 4RGYA 5A62A 4U2CA 1NU6A 2VATA 3WL8A 5CXXA 1UK6A 5ALVA 4RE5A 5ALDA 4Y7DA 1GPKA 3WYDA 2VSQA 3WQHA 3WIBA 1R9MA 4BVLA 5JATA 4BZWA 4Q3OA 3WK6A 2O7VA 1L7QA 2I3ZA 5DYYA 4AO6A 4DMCA 5D7BA 2O2HA 4OYLA 3GA7A 4C4ZA 1DQYA 2PSHA 2VJDA 1VOTA 2JIDA 2NW6A 5LP1A 4PSUA 2Y2VA 4AO8A 1N1MA 2YYSA 5EHXA 1XKTA 5E4TA 3AIMA 2XI4A 2J4CA 3BWXA 3DYVA 1UT6A 2D0DA 4OCZA 1Q0RA 1RP1A 3G02A 3G0DA 5SYNA 3Q8WA 4J0CA 2GYVA 5AJHA 2HU5A 1AQLA 4E46A 2PSDA 1DWPA 1QOZA 5K3AA 5EIEA 1LPPA 3ANTA 1CUSA 7YASA 5EFZA 1XZEA 4BAUA 4E14A 2WHRA 2ACKA 1UK7A 1K6EA 2WHPB 3ILSA 3G9TA 1ZIYA 4HAIA 3PF8A 2PVSA 2X8BA 3H1AA 3VISA 1XZKA 4Q3LA 1XRNA 5ALIA 3DD5A 1X70A 1D07A 4X00A 5ALOA 5DJ5A 4LXIA 4BCBA 3QMWA 3UMJA 2XUIA 1QTRA 4OB6A 2O2IA 5BV7A 4HS9A 4X71A 3L1HA 4OB8A 1BEEA 3R0VA 5IKXA 1LZKA 2BFNA 2CMFA 1FJ2A 3PICA 4MQMA 3AFIA 3MUOA 1QGED 2C7BA 5H3HA 2XUQA 5BWCA 4LXGA 1ZICA 3WWDA 4F5ZA 3FYUA 1QFSA 3ESBA 4K6HA 1VZ3A 4EZIA 4K2AA 4W1QA 5AK4A 3STXA 4D9JA 5LKRA 2GBIA 1U4NA 4G1FA 2Z8ZA 3DKRA 3WKBA 4MQLA 3C6BA 4OB7A 4UBJA 1QFMA 3O95A 2OGSA 3H2IA 4FOLA 1CUXA 1BU8A 4OPMA 1MX1A 3BIXA 1CUAA 2JEZA 1H2YA 3QBJA 3IA2A 5A7GA 2ZSHA 4AXBA 5ALLA 3JW8A 1CQZA 2JGKA 1E8NA 1PV1A 3DOHA 1UOPA 1DINA 1L7RA 2FX5A 4DNPA 1BS9A 1K8QA 5LZ4A 3WKDA 4Y2JA 3HRHA 5CT6A 4GECA 5JASA 1QJ4A 1VE7A 2WJ3A 5KREA 5JADA 4QDOA 4AB1A 1GXSA 1G4HA 2PU5A 2VT7A 1IUOA 4N8SA 4Q3KA 5DNVA 3H1BA 3W04A 2V98A 1VA5A 4EHBA 4MEBA 4UHDA 2WFLB 5DNWA 2RONA 4N5HX 2WILA 4E15A 2CZQA 3IBTA 2QOEA 4EY4A 5AI8A 3BL8A 5I7UA 1A88A 5AK6A 1A8QA 2VJBA 3I2GA 4WCVA 3AZQA 1GKKA 1OCEA 4X3CA 1EVEA 4RE6A 5CT9A 4PV7A 1U2EA 1CUEA 1LPAB 1R1DA 4LYEA 4Y9SA 4J0HA 4J03A 5AM5A 4QWWA 4J0GA 3QVMA 5ALYA 3PF9A 3AJAA 2O7RA 3H2JA 5AM0A 4ZGBA 5FDFA 4QZVA 5T4HA 4HRXA 4AO7A 3WA7A 3WK4A 3CXUA 4NVRA 2QS9A 3R3ZA 4KAJA 1H2ZA 1UWCA 1LZLA 3RARA 2QXTA 3B3QA 1BN6A 4BBZA 2ZJ6A 5LLSA 2AJ8A 3H19A 4B82A 3ZV7A 3IVMA 1DWOA 4B81A 5AK3A 2D5LA 1QIDA 4MWSA 4DYHA 5AKHA 3D59A 5HFNA 1AUOA 5JAOA 4AN0A 2Y2UA 1WB4A 3F98A 4J0DA 4UFOA 1K63A 4XWGA 5D3KA 3IUMA 1GPNA 3GZJA 4RPCA 1CQWA 3R40A 5AOCA 1QLWA 1TK3A 4BDTA 2XMZA 5FUMA 1VXRA 1XLWA 4UHCA 1THTA 4DSAA 1EK2A 4IH1A 3TEJA 5EIAA 2WG2A 4FHZA 3I6MA 5CH8A 2ZVDA 5AI4A 3KWJA 3GFFA 5A7FA 1XLUA 2ZJ7A 1HQDA 5ALFA 2XMDA 3C8DA 3PFCA 4IO0A 3FAKA 5ALQA 1P0PA 3ANSA 3WWCA 2C0PA 4F60A 2ZYIA 2ACEA 4ZRDA 5I9IA 3BF7A 3SK0A 1XQYA 1QIKA 2OAGA 1EDBA 5HF8A 4AMYA 4DTCA 1SCQA 3G0CA 3OM8A 3P2MA 2VJAA 1EXWA 4CCWA 5FPPA 4X7BA 5JYCA 1VJ5A 2RGUA 3E0XA 1LBTA 1QONA 4FNGA 4QDZA 2GZSA 4C88A 3OTQA 3RK4A 2GYUA 2OXEA 1N5MA 5HZGA 2XT0A 3W9BA 5DNUA 2WU4A 3R3VA 3AZPA 1VLQA 1XZMA 1ZGBA 1YAJA 1XZBA 4YX9A 4KRXA 5ALHA 3D3NA 1KU0A 4L72A 4BZZA 5T4EA 4J0KA 1W52X 4YASA 3WI7A 2PU7A 3WYNA 4EUSA 2VAXA 1P0QA 3FSGD 2OPHA 3DYIA 2H7CA 2ZYRA 4AZ0A 4BDSA 4GEGA 5CW2A 2JGEA 5IH7A 5IVHA 4C6HA 4WFIA 3SX4A 3Q0TA 4A16A 3H17A 5HF9A 1B41A 3G8YA 2RHWA 4CFSA 1Y37A 4FLEA 3A2MA 1W4LA 5AM4A 1S8OA 1UOOA 3KDAA 2DCMA 2JGFA 4ITVA 4EY6A 3MGAA 1DT5A 2YH2A 4B9AA 2DQYA 3WJ1A 5AH0A 4WDQA 2ES4A 5BWBA 2WUFA 4PQEA 5ESRA 1UKCA 1KU6A 3H2KA 5F4ZA 3VVMA 2VJCA 2XDWA 3F8SA 5CTAA 4F0JA 5DYWA 4L9AA 1CUDA 3D4LA 3VXKA 1ZI9A 4UFNA 4B6GA 5AKEA 4BP8A 4UBKA 3KWFA 5ALPA 2J3DA 5EHQA 3GROA 2R8BA 1E8DA 2OCGA 3KOOA 4ZREA 3T4UA 5AI0A 1HKHA 3M83A 3WL7A 4CG1A 2QRUA 3T52A 1DWQA 4BTVA 4FFVA 4HTAA 3M82A 3NWOA 4CI9A 3QITA 3HXKA 1HPLA 3FOBA 4H7DA 2PX6A 2PBLA 1LPSA 5AHXA 4Q82A 5JD5A 1LLFA 3QZUA 3HLKA 3O4GA 4U2FA 4QDTA 3ICWA 1YA4A 3BE8A 4BCDA 4OU4A 3F67A 2WIGA 2Q0XA 5JD4A 2XMBA 4FBMA 3V1NA 1L7AA 3ED1A 2YASA 3WK8A 5ALXA 3ZLVA 4UHFA 3BDVA 3DL4A 3H0CA 1VE6A 1XROA 2C5FA 4KYVA 4BE4A 5E4YA 1ODSA 2XLCA 3OOSA 1J07A 3QYJA 4B0OA 3W9UA 5K3FB 2C58A 2PUHA 5EI5A 3ZLTA 5DLPA 3I2KA 5CXUA 4X93A 1G5FA 1U8EA 4GHWA 1YS2X 1JJIA 4CCYB 2JEYA 4X6XA 4FKBA 1TRHA 4I19A 4MXDA 2QMQA 2WUEA 3C8HA 5ISMA 1ODCA 2H7YA 3WWOA 2HA3A 1RYYA 3K2IA 4KJXA 1HL7A 5AKIA 3O4JA 3FBWA 3FYUC 3X3HA 3KSRA 3BIWA 3UUFA 2VF2A 1JJFA 4GBGA 2XMGA 2I78A 2Y6VA 4MJ3A 1QIFA 3HSSA 3A2NA 4XIIA 1ZD4A 4EY7A 1MTZA 3C45A 2WHPA 4GXNA 2Z8XA 5CH5A 3L1IA 2H9YA 2XQJA 4Y2RA 5AKLA 1JFRA 3G9XA 1TAHA 4W1SA 5C8VA 1IUPA 1ORVA 2HA7A 2WIFA 1CUIA 4G9GA 5FPQA 3IIIA 2BKLA 3BF8A 1K4YA 1TIBA 4UHEA 5HFAA 1QIHA 5AKYA 1R88A 2HFKA 1YB6A 1IZ7A 1YB7A 1A8SA 3R41A 3LCRA 3C87A 2JBWA 1TKRA 3EQ9A 4MYDA 2I3DA 5AKZA 1YSCA 3HZOA 1E66A 2HA6A 3MUNA 4C89A 3QPCA 5CT4A 2YXPX 1IVYA 1GPLA 1H2XA 1P0MA 4C4XA 1CIJA 5A7HA 4UFPA 5CRIA 4RNCA 3BDIA 4AX4A 1YR2A 3U1TA 2H1IA 2WHQA 4FNMA 1X2BA 4FDMA 2CB9A 4IH4A 5AKKA 4QA9A 1LGYA 1XZDA 3I1IA 4DM7A 2WM2A 1ZD3A 4WFJA 4H35A 2XUKA 3V9AA 1NU8A 4H7IA 3VJMA 3IUJA 2AJCA 5K3BA 4KE9A 2QTBA 3WA6A 1BE0A 1N8SA 1YCDA 2HA2A 1LPOA 3EIOA 3VVLA 2JGLA 3YASA 5T4BA 4FTWA 3QPAA 4EA6A 5HK9A 2BAGA 3UUEA 4HXEB 4FFWA 5CH3A 3S2ZA 4UUQA 4L3WA 3V1LA 4A23A 4XJVA 1ZI6A 1PJAA 1I6WA 2WFLA 1WB5A 4MYSA 2JGIA 1ORWA 1VA4A 2HM7A 2PKYX 3ZLUA 1UFOA 1W76A 3QH4A 1ACJA 5LZ2A 1E5TA 2WTNA 1XRRA 3BJMA 3WWEA 4CIBA 4W63A 4WDRA 1C7JA
chains in the Genus database with same CATH superfamily
1E0SA 3H7AA 5A2QA 5B7NA 3M70A 1CLUA 3JAKA 3KB1A 3LKZA 4MEAA 2CDNA 2JL1A 5KX5B 4NCBA 1U7TA 1OBFO 4II3A 3DE4X 2NZXA 2AF4C 3WLAA 3NT5A 3EFBA 2CNLA 1BQ4A 5AP9A 4Q7KA 2GVZC 5CVUA 2G6TA 1RHJA 1FQWA 4IDGA 5L45A 3AI1A 5B4VA 4IHJB 2RBGA 3EWNA 4X6YA 2RG7A 4XUDA 1QANA 3QVGB 1PR5A 4W7HA 1G64A 2VS1A 2IYSA 3CR8A 3L8YA 2WPDA 4BTLA 3RS0A 1EB8A 2P0EA 1ENPA 3U4DA 4UHKA 1ONNA 1GOTA 1Y34E 2HMYB 1H4TA 1N6NA 2WSMA 3PXAA 4HGNA 4P38A 1TZ2A 3VZRA 4AULA 1YF3A 5K3EA 1I7QB 3ZY2A 2B99A 4Z8YA 4UM5A 4AURA 4TWRA 2AXEA 1EUDB 4X6UA 3GOQA 3KXIA 1SRRA 2RH8A 5KU7A 2NP7A 1UZUA 2P3OA 4P3KA 1NV9A 4WCFB 2CHFA 3NAQA 3KYIB 2OB2A 4G8BA 4M9ZA 5ALTA 2XOKA 3NPMA 3GEPA 3UK6A 3HKDB 4W7SA 1D2AA 2AYZA 1U90A 5FRDA 1RQPA 3JAWA 3EG9A 1KS2A 2XE4A 1CR0A 2O59A 1U31A 2DBZA 5JJIA 4HLQB 3F6PA 3LBHA 5IPFA 1RLUA 3DE0X 3ECAA 3CH7A 1P7WA 1WA5A 3GPBA 4MWEA 1GL3A 4Y1FA 3K5PA 4HTFA 1RACA 1X0VA 3FIUA 5CYOA 4ARVA 2YS7A 5EJ4A 3U7IA 1KQOA 5EN4A 3NGMA 4TXHA 4KSBA 2HO4A 5KPJA 2XUDA 4GYJA 3P9PA 4ZQGA 3TTUA 4NS4A 2BFAA 2C78A 3X2EA 3AIOA 2JI4A 1PGNA 4MQEA 4YY3B 2OQIA 1ZUNB 4A10A 3OFSA 4ALJA 2EZ8A 2OUKA 4L2IA 2GAFA 5EIBD 1WDMA 3WLPA 4NFYA 5TF4A 4E1BA 5BWNA 2UXCB 1XKLA 3GJTA 4G0YA 1I30A 3DTYA 4I1IA 5CG2A 2RARA 3RVJA 1Z2OX 3OUZA 3L6EA 1YDEA 2APJA 4UEKA 4JXZA 1H69A 1XZJA 3AUUA 5CA1A 1UP4A 1SRQA 2GCPA 4EGSA 4HWKA 1S1CA 2HQOA 5C31A 2XVMA 4REQA 1MORA 2BY4A 3F6EX 3IQEA 4M8IA 2GTIA 3VNAA 3QLVC 4TV8F 1V43A 5KC8A 3L0OA 4N6OA 1YVUA 2V3WA 3AI2A 3G23A 1BMQA 1JMKC 2WDZA 4RVHA 4W9NC 5A03A 4Z3OA 1CUVA 1ZKMA 3G2NA 4KXVA 5CCXA 4NJMB 5BSKA 4N0EA 2YC4C 4L5CA 1HMPA 2DPHA 4KPYA 2WB4A 4GD3Q 4RPLA 5AVOA 3H84A 1SCJA 1ZW6A 1DBQA 3MYRA 4LV6A 4IOMA 1V5WA 1Y5NA 2HRQA 2OYRA 2Y0EA 4RPKA 1S7CA 3W4IA 2OL4A 4H7EA 2DZDA 3GAAA 3JCZA 4MS1B 2WSYB 4RD4A 4WOCA 3UFXB 5DGCA 3P4UA 1EUCA 2IQIA 4QJ3A 4O4JA 3CBGA 1I94B 3SHWA 1TTHA 2LW7A 2QSUA 4RNDB 1CZLA 1RAIA 3MSXA 3ESCA 3HEAA 2ZVJA 5ILGA 3UJCA 3E7DA 3F5SA 1QCZA 3F73A 1RAHA 2PZMA 3NPAA 4IS3A 5K0FA 1AU9A 2ZIAA 3CV3A 4HKTA 4UCQA 4ND3A 1UKVY 2FPUA 5D5PA 1FFCA 3P9RA 4ZCSA 9LDBA 1DX6A 3LXXA 4XLTA 4H27A 5DBEX 1C0EA 1T2DA 2B98A 2OZEA 3MTEA 5LA6A 1JEYA 3IEUA 5LZ9A 3PD7A 2JA2A 3VJRA 4UQLA 5F5LA 3LQYA 2YXDA 2YC2C 3SJBA 1W88A 3EPRA 2E21A 3C43A 2OBBA 3K6JA 4WXHA 2QX6A 2DSTA 1JALA 3KPVA 1RKVA 2P67A 3AF5A 4LS3A 4MPTA 4GVXA 1A9YA 3L0YA 3QKIA 2GEVA 1G41A 2BBSA 4QJIA 3E48A 4O4LF 1ZAYA 1SXJD 4PTLA 1BWQA 3H2ZA 4Y0VA 5DN9A 2JK0A 2CJYA 1NWCA 5JAPA 3WNVA 2NO5A 2XKAA 3NNNA 5H16A 1G21E 3CUTA 3S5UA 4MYUA 4ZT5A 1J8YF 1NVUQ 4QHYA 1ZIXA 1CEQA 1T3GA 5ELLA 5HF6A 1BDJA 4KQ6A 4K0KB 2ZS8A 3GLHB 1JA9A 1KO4A 4NFSA 4XD7A 4B79A 1BHQ1 4CVNA 1JMVA 4EG0A 5C81A 1UFQA 1VPDA 3RKRA 2W22A 2NU7B 4WTOA 2R84A 1YI1A 2B7LA 5K6AC 5LUBA 2O3JA 5FKJA 821PA 1IXRC 3G1WA 4FFBA 4YCBA 1M0WA 4EQ6B 1GKYA 1YB1A 2CBGA 4RH0A 4R16A 3SJUA 4S35A 3IEMA 1VP3A 3FHTA 4LNUB 1EWRA 5JD6A 3NTOA 4LYDA 4TUYA 4X8MA 3W1EA 3IDSA 1J0CA 5AD1A 2P9FA 2J30A 2LP4Y 4UARA 1XPJA 1AY0A 3CUSA 2IU4A 4MS4B 1KRWA 1BA2A 5HR5A 1XP5A 4NMMA 2QN7A 2DUMA 4H59A 5CU7A 3HCBA 5AW9A 5L40A 3IAM6 1Y7IA 4QGBA 3ZPXA 4TMVA 2X1VA 3DDHA 1PDOA 3HCNA 4CCAA 5TMDA 5FI5A 3E7XA 1KYZA 4YJ3F 3FNHA 1DADA 1TRKA 5P21A 3OEHD 1QPZA 5JTUA 1MMFB 1SD2A 3SM9A 5JAZA 2VBGA 4EITA 3M2PA 4URZR 3MXOA 1P2UA 3GMTA 2YQ4A 4BFVA 2VNKA 1U9CA 1EP1B 3H16A 2VUIB 2QTTA 3VR5H 2O2SA 1XV5A 1TO1E 2QG9A 2BWJA 2GAOA 2XADA 2WR8A 4Y67A 4G85A 1DBRA 2SECE 2QPTA 4XR4A 3HCWA 2HB6A 3F3YA 4HY3A 4MJ7A 4IVRA 1FMLA 3ZC3A 2OBMA 2WDPA 3B7GA 1EE1A 3I01A 4IEFB 2G08A 4QICA 3CINA 4FE7A 3LU1A 4BB6A 2Q21A 1EAYA 2D5BA 2OVBA 4A0RA 5KYYA 4II7A 1NPTO 2G25A 1RRMA 4FJ0A 1EX1A 2P9CA 1NC3A 5TXGA 3VKUA 4BNUA 1N5KA 3SFTA 4BMVA 1J70A 4UBOA 4CN8A 3LLSA 1U2DC 1FTQA 2AUMA 2FX2A 3ANLA 2AQIA 4W7IA 2PUJA 1LBSA 5DK6A 4R31A 3ZN2A 1B26A 3A4IA 2F8LA 2QTHA 1JFVA 2HL6A 1JNXX 1US8B 1Q5PA 3I2FA 3K0HA 4LZLA 4R9UC 3T0IA 1ZQ9A 3QPWA 4X90A 1H2RS 2KBFA 5BY2A 5G0UA 3IYLW 5KQSA 1UBMS 2AJDA 1KQ3A 3T7AA 2X2PA 4BMPB 3PNQA 2R87A 5CVDA 4BZQA 2BI8A 1ACLA 4NEHB 1UH5A 2DQ4A 4DL9A 1ZGAA 5F7XA 1XNGA 1F6BA 1DPGA 4AAYA 4D97A 2PH7A 2O19A 1UIRA 1VCHA 2XTZA 3PC7A 3I9LA 3R9XB 1V8ZA 2X0KA 3UMRA 4IHAA 4KE8A 4F7WA 1F0NA 4XPIB 2C20A 2WIJA 2Y9MB 1RFLA 3RS3A 3FUUA 3WGTA 2FQYA 2OGZA 2PCLA 4B5LA 1R7RA 1ZJWA 1YS9A 4NMXB 4HUJA 1AT1A 2PJZA 1LK5A 2BJHA 1BCSA 1SK8A 2D4AA 1KNQA 3CG0A 1CUWA 2PX0A 5EJIA 4WEQA 1EXDA 1T8UA 1C9DB 2VBIA 1FW8A 5B5SA 4G0NA 1DBWA 1UXJA 5G0TA 5K5EA 3U4CA 1RE1A 3B13B 3N2EA 2WYWA 1A2BA 3SYMA 4AZ3A 1TADA 4IQ4A 1KI6B 3TGWA 3TX6A 4H18A 1GFWA 1NVFA 2QTFA 3FROA 3MJVA 4I4CA 1YBMA 4YQEA 4ZOLF 3T3MB 3X2SA 2HJWA 3UWKA 4X20A 4DCGA 4YR9A 2J3HA 3LQRA 2FGKA 1JXMA 5D6NA 3RLIA 1K6XA 2HEIA 4BNXA 1JQLB 2INGX 2Q07A 4C6TB 4MV9A 1QAQA 1V8OA 2RI6A 4AP6A 2BP7A 4Y2SA 1VI6A 3JYNA 1GQOA 5FT9A 1T29A 2J48A 4FBGA 1H05A 2FSVA 1GKUB 2Q2OA 4O33A 1BMTA 1SURA 1WM1A 2O4CA 2Y4NA 4NOMA 3ILYA 2VQ6A 3C3WA 1HETA 3NTQA 2FP3A 1CVRA 4UBNA 5I4IA 5JPDA 3QVLA 2YZMA 2JEOA 1Z2CA 4DLSA 2CT8A 1PO7A 1HM5A 2P0YA 2GXAA 4JIGA 2NO9A 3GGJA 1AXRA 5EE5B 4MI9A 5I9MA 4EPYA 5FA6A 4D56A 5I8WA 3O8BA 3GWZA 3MXTA 2PSFA 4LJLA 4D46A 1AV6A 5BN5A 3IERA 3TZCA 3THYB 4DLLA 5D5QA 1YDHA 3T7SA 2FZLA 4KQ9A 1O89A 4TS1A 3L8HA 4Z4CA 2E37A 1JZQA 2HPZA 2OYSA 4OJKA 1N4DA 1WOMA 4FW8A 4M21A 2XGJA 2JGNA 5KNCA 2FN9A 1D8TA 5KYUA 3W3ZB 4NE2A 4B76A 1JSXA 3WL5A 3WNDA 3DZHA 3IPLA 3E58A 1R5BA 1QP4A 5J4HA 1XD9A 2A0KA 4AJ4A 4PCAA 4TVOA 1UK9A 4IIGA 1N6OA 5K09A 3E22A 2QN1A 2CF6A 2J1LA 4WZAB 5HGXA 3OLVA 1G17A 5CNKA 4Z0HO 4DIUA 4YRGA 1RZRD 4U5XA 3IR7A 4LYAA 3RU7A 1M5RA 4RWEA 4DZZA 3C74A 2QORA 3I5MA 4DDWA 5WRFA 4ZGWA 2IEDA 5ITZB 3CPSA 1QYRA 5DSTA 4BKUA 1HOXA 4OSPA 3UAXA 1FVHA 1GN9A 2JFBA 5TGTA 3DV9A 2ICAA 3C4QA 1GZ4A 5C32A 3SPXA 1YKSA 2VKQA 3TINA 4GRAA 3SEFA 3HJTA 4RTKA 3K71B 2DQKA 2FP4B 3QSYA 1E5QA 3O31A 3JR7A 1B6TA 4KMMA 2REQB 3A32A 4F2HA 3KNZA 4ZCTA 1W1WA 3LCUA 3LDAA 2V7XA 1SCNE 3EDMA 2IK8A 2QM8A 4ZTUB 4TZ0A 1U7WA 2AZDA 4M7WA 4FDUA 5AIBA 1LW7A 3CH6A 4JR2A 5AW3A 3RRBA 3ILHA 4UE2A 4DXAA 1XSEA 2W42A 5CT8A 4TM8A 1ZX1A 3J7TA 3ONDA 2ZB8A 3G82C 3OZIA 1YCGA 1YDFA 4ZQHA 4N01A 5HKOA 3T9EA 3K20A 1XWIA 1YR6A 4KXFB 1S8AA 3RPEA 4DDUA 5F21A 3VPAA 4K9RA 1JT2A 4Y30A 5IBQA 4FYMA 2Q6KA 3MSCA 3QF7A 1HF3A 2DQSA 3I6ZA 1GPJA 1IYZA 4JJIA 3RGWS 1B6RA 3DT9A 3QBVA 3UAOA 5CD1A 3EA4A 4BVAA 4I5EA 5KOJB 1KVTA 3JQEA 1U5BB 2FXVA 1E0KA 3TZEA 1EH5A 4X5OA 2FSGA 2QLTA 4X45A 4GM0A 1CE8B 4DIFA 5AVTA 1K3TA 1EJ6A 2EP5A 3IP6A 4YLEA 1FUEA 2H1VA 4UXHA 1LA2A 4M3NA 1U0LA 2REXB 1MA3A 2FWPA 2OFPA 2G4LA 4BKOA 2Q1SA 4KR9A 2ROQA 5F78A 3VH2A 3G8DA 4E70A 4Q4HB 2OB1A 3OBIA 4R2IA 3LGXA 3GHHA 1AN9A 3FVRA 2R2GA 4K7JA 1NN1A 2NSLA 3JATA 5GZ6A 4K28A 1FNMA 4TN1A 4B84A 2A5JA 4EJSB 3D3WB 3U7FB 1Z4PX 1WF3A 4NABA 4UULA 1HNXB 1HXHA 1KNXA 2WVJA 4NCNA 4WGGA 2DLNA 1GVHA 2XUHA 3OLQA 4EZEA 2F9MA 4PFSA 5TX7A 1ND5A 5JMTA 5HKKA 1FFAA 1T6XA 2RHLA 4IF6A 4RLSA 2ZRGA 4PVCA 3LY8A 1PVOA 1J42A 2ORYA 1C0KA 2PZBA 4JKOA 4CRWB 4JCCA 3OT5A 1FUYB 1IBSA 5A4DA 3TSCA 5KTPA 1T3SA 1NI4B 3O47A 5B37A 3TSZA 4CMKA 1ZOLA 1XMQB 1E79D 4FWIB 4QUEA 2O0LA 2CLCX 2BUBA 1DLIA 4INAA 3UMFA 3HJBA 3BMXA 3ZDXB 2D2FA 3AM5A 4TKVA 3ZZ0A 1DO2A 2C4HA 4LQDA 3BUSA 4FLMA 4JOSA 1W30A 5DRYA 1UJ6A 2YJGA 1H4SA 1C2YA 5DNYB 1MNAA 5U4XA 3D4IA 2H1OA 1I3CA 4YT4A 1ZCZA 3O94A 3OOEA 1BXRA 4KU4A 4Q37A 3VNSA 3ORYA 2DKNA 3PWTA 1IDN1 1L3CA 2Q49A 3OPMA 2XB8A 4MCIA 3E03A 4QQNA 3HH8A 1VYHA 4ZC8A 3OQIB 3RSLA 3ZE1B 2FAXA 4GZLA 4HC4A 4P36A 4R2KA 1J24A 3A28A 4HG2A 2JH8A 3GZTB 3O75A 4YCNA 3MINB 5A6SB 2W8BA 4MUNA 1YAHA 2WG1A 5FBWB 2OCLA 4KAFA 4L7VA 1LTKA 3I53A 3C7AA 1NFRA 2IITA 4K9QA 4MW4A 1MH9A 1RRGA 1NMEA 4HUQA 4M0KA 3TR0A 5THXA 1SXGA 1XZ8A 3IDAA 3WKAA 2FEKA 2W2LD 2PDAA 3EZNA 2RE8A 2GYWA 1M76A 4QT0A 1K98A 1DU4A 1M8GA 3BC1A 1CYDA 3CLUC 3QJGA 2CL0X 4RA9A 4MTLA 3CRZA 5IDVA 1SVUA 3OHMA 4JB2A 5H68A 3WGJA 4N3AA 3RM3A 1ES9A 1T8RA 2V4MA 4FIDA 4M1QA 3EN0A 3AGQA 4V0LA 1EWKA 1Q22A 5GQSA 3TAUA 3TLBA 1E58A 5JPCA 3LY5A 3RS4A 1RWKA 1V8FA 3ORHA 1PV4A 1II9A 3FPEA 4L02A 2G1AA 4CQMD 1DO8A 1Q0SA 1LU9A 4R51A 2ZVQX 4XWAA 3J80A 2FVXA 4BNKA 5JEEA 2MDTA 3F7OA 1HFJA 1IZ8A 4DCOA 2EW8A 2YMLA 2IYOA 1RHKA 3NT2A 1LQUA 2P5UA 4BNDB 2QI9C 1ARZA 3DFFA 3E9ZA 3GZ4A 1X80A 4CMAA 3I58A 4I9HA 4LRXA 4QDXA 5DMHA 4QELA 3FBGA 1WB6A 3GJZA 4IJVA 2P6PA 3ZWMA 1Q3KA 2FH5B 5EJ6A 4UMVA 3AVOA 3S8YA 3EXHB 4YMVA 3QM1A 1CRPA 2DY1A 1V16B 1L4YA 2ZE6A 3HN7A 1IK4A 1FU8A 3PDIA 1SCUB 3RRYA 5ALMA 2CLMB 4OHMA 1P2DA 3C6ZA 3DOFA 3PLNA 5H9VA 2HIHA 4GZ6A 2Q7OE 3E82A 2ZYHA 3PQ3A 4FXPA 1L5OA 1F4LA 1RYFA 1C3XA 5IANA 3AWIA 3V46A 5HUHA 3UQZA 4HMPA 5JBNA 1RS0A 5JRZA 3GXOA 3ROFA 1H9BA 1E5XA 2VI5A 4UHBA 1DRKA 2DPMA 4O0LA 4AICA 3T99A 2PKQO 3CF0A 4ZYVA 4DKXA 4AKHA 3T5DA 1PJRA 1D2MA 4QXQA 3ZGYA 4QBHA 4KO3S 1RAEA 4NP6A 4S0XA 5DGDA 2RHGB 3VPHA 3GI1A 3QOYA 5CGQB 1QQBA 1W6RA 2BH2A 3G0HA 3AL0C 3SKXA 4OU5A 4BVKA 1QV6A 2Z09A 1SFRA 1P9RA 2ODAA 1JP7A 2QQFA 3BMCB 4QU8A 2IHNA 1UR5A 2HBYA 3HDVA 4PF1A 4ZU3A 4A6XA 2X9NA 1V8BA 3DFZA 4CTKA 4WINA 1VQ1A 3I62A 2R4TA 3OQBA 5MN6A 2DMRA 5B7GA 4IAOA 2F4NA 4KRYA 3NBFA 4J16C 3DBVO 3KB6A 1DAKA 1Q6ZA 1ZA2A 3PFKA 2X0JA 3EUEA 3WRXA 4B5KA 1DTEA 2CY0A 3IP7A 1OWPA 1Z08A 3BIOA 3LT0A 4PLYA 5EGSA 1ODFA 2R7LA 3AFHA 4F4FA 1MO5A 3PD0A 3QEOA 1A98A 3C3MA 4OHVA 2M2IA 2NVUB 4D8YA 1KRXA 3VNBA 3B3AA 4RTNA 2ATIA 4KN6A 2GTPA 2O3TA 4PQRA 3BMQA 3BRSA 4V2UA 3HKEB 2H54A 3OUTA 1HY3A 3JQCA 1E1RA 2E3JA 1RU3A 2GCNA 5EKTA 3D1LA 3U4IA 2RGRA 3OE7D 3B82A 4HEA6 3RJTA 2BGNA 3SJZA 3K4HA 3N8HA 2PMFA 4KQ1A 2BSQA 3P71T 4J75A 1CG6A 2EQ5A 3UHPA 1RCUA 2PZKA 1NXOA 1WCV1 5ES3A 1Y0BA 3X2FA 2FMUA 4IJ6A 2B1QA 2GLXA 2QLBA 2RIPA 4WXYB 3JQFA 5HRCA 5HBGA 2HDOA 4M1TA 4EG4A 1W2HA 3DVRX 1RC0A 3LLCA 3FSEA 3V2GA 3VTFA 2I2AA 2AB0A 4QJ5A 4BRSA 4EVQA 4NKRA 2YY7A 5CAEA 1NUQA 1N9GA 1MNQA 4D74A 4OD0A 1EZZA 3K0KA 2GZHA 2HIGA 3E1KA 5JCOA 3DE6X 1C7IA 5DV9A 4B73A 3WLSA 1P3DA 4C6RA 4R8LA 4RIGA 5ALRA 1W4BA 1ZSYA 2KB0A 5D1HA 5F2KA 4KREA 4K6KA 2I33A 1X6VA 1Z35A 4HV4A 2FFHA 3JPYA 3UZUA 2AG6A 4Y2UA 5K6RA 1D1SA 3QPDA 4TMKA 4DR3B 4REOA 3GDWA 1MHPA 2GN1A 1SBCA 1TCCA 2O8BA 1I7NA 2IYQA 1Y8RA 3DEKA 4RF2A 5DBIA 4Z4HA 2QGNA 1HT1E 3TF5A 1GN8A 1E99A 1T26A 1BHSA 4DAOA 3D4PA 1XPRA 4B80A 1BE1A 1Y6JA 2QE7D 2VK8A 1UBCA 3BH6A 3C8MA 1N4AA 2O6HA 4B3HA 3CLRC 3SD7A 4QIHA 4RULA 2WK1A 2PT7A 5L6MB 1RZ3A 2C03A 1YRYE 2CD9A 2IYEA 4IFIA 4KI7A 4MSUA 4RF4A 3VZQA 5K0GA 3ISTA 5E2AA 3T3PB 4I8DA 1JS1X 5KEIA 4Y6PA 4YH1A 5CLFA 1DBSA 1IONA 3DM5A 4LNAA 4NZZA 4ZCRA 1LRLA 5LD2B 2V9PA 1C9YA 5T41A 1XEXB 1NBME 4IRXA 3IALA 1G3IA 4FCCA 1FNSA 2I7VA 3QJYA 3GLFE 1XRMA 2FJPA 3W79A 1E9DA 1QYXA 3ZK9A 2C4NA 2RBEA 3V55A 1ADYA 2PMDA 4J0QA 3FUXA 4KWEA 5ALSA 1Y48E 3JZAA 3QFFA 1QQTA 3IV9A 3QKUA 4NEGA 4KPFC 4DAEA 1EM6A 4QO7A 3AM4A 2FJ0A 2VYVA 1WSWA 1FTSA 2CJFA 1UF9A 2Z1DA 4NMLA 3K3PA 2BTEA 3EWIA 1IQRA 1BDHA 2UVDA 3T3GA 2XDQB 1AGYA 2DULA 1NJ2A 4X60A 5FBLB 3VFDA 3ZNQA 4AWAA 3G2MA 3N9IA 5CFQA 5A3VA 4INZA 1YFLA 2B9EA 4R2WA 2H92A 2OAP1 1GTL1 4C6SA 4F96A 1QFXA 1DGQA 4U0KA 1KOLA 3ETEA 3G2LA 3U3DA 4DPMA 1BRTA 4DCVA 1X7XB 1X9HA 2Q3MA 4LRSB 4P5EA 4YFVA 3T5PA 2JVIA 5CLJA 2PD3A 3C97A 4C01A 3R6TA 4PBSA 2HYDA 3K5WA 1OFUA 1YZVA 1HG1A 2ZWAA 3CA8A 3DVLA 4P5DA 4UAVA 5AW5A 3RRFA 2R5NA 1EJBA 5IT5A 1AMUA 3OIDA 1IPEA 2P3LA 2GVNA 3G0IA 3L9XA 5NULA 5CDUA 4OI0A 1YT5A 1Z6QA 1FX0A 1PF7E 4DQVA 2ADOA 5HJEA 2QN9A 1K86A 2I6QA 2ZUWA 3QU9A 4HNGA 1T9GS 1E2MA 4PLVA 2FZEA 5DGTA 2P2YA 3PE6A 5HTKA 1SCKA 3R7SA 3UTDA 3ZHXA 3DNMA 4JSRA 4UEJA 1CWUA 4LYYA 2G83A 3RJMA 4DN6A 4YT2A 4UTNA 1B7GO 1FP2A 4CG0A 5SYMA 4UM8B 2HXSA 1SUEA 4BXOA 4I4NA 5BN1A 2Q3HA 5C2JB 3EWSA 1Y1TA 1D6SA 3PXDA 2C54A 4OOEA 1DAGA 4LJAA 3KCNA 4OSEA 3KKMA 1V4BA 3DWIA 1RC1A 3R5JA 4Q5IA 5A4MS 5J1SB 2QXUA 4JXXA 3CSSA 3CG4A 4BNMA 4HB0A 4JLSA 4G0UA 4OJQA 3HDJA 1EFCA 3N7AA 4K5QA 3WLLA 5E6RB 5D3ZA 3O1LA 1U2RA 1QVVA 2OENG 1DG3A 2EZTA 3SE0A 1CUYA 3IQIX 4GMXA 4IUCS 1MVNA 4WZBB 1OU0A 2ZT7A 4EEKA 4RD1A 3Q2OA 4F21A 4R71A 3P9XA 1EK1A 4NXNB 5F3RA 2DPXA 3RGGA 4V0SA 2DX7A 1Q19A 2OV4A 3QBTA 5DHSA 4CI0B 1JR6A 3H5LA 4TLBA 4RFSB 4UQPA 3GNQA 1EM8A 3R20A 4TTIA 4GMDA 2O8EA 3TIVA 5ENZA 4RIEA 1KOFA 5CDTA 2MTBA 1OZHA 1Z75A 1Z34A 4DIOA 1RMQA 1QNLA 4MUXA 4BP1A 4BNHA 1G20E 1JPVA 5CFMA 3F90A 1ZD1A 1IRIA 1HDOA 3DZIA 1T9DA 2OD7A 4RHEA 2QTRA 3RJZA 5HCIA 3AKCA 1UL1X 1VIVA 3PWSA 5DM0A 3ENKA 4PPFA 1DS6A 3W3AD 1XMXA 1P2FA 2BZSA 3PC2A 4R5HA 4R7ZA 1CQJA 2XAUA 3VU8A 3E4CA 4DARA 3TTSA 5EGNA 1GV1A 2X5NA 4PPQA 4W5NA 4B09A 2B7BA 2JIOA 2O2GA 2J08A 5AUOB 3BJZA 1VIYA 2CLFB 5JFTA 5M7EA 2IELA 2VHXA 2V97A 1YA6A 4W9RA 4C1NA 2VDWA 3JTMA 1JDBC 1GYQA 2H85A 2PWYA 3PQFA 4JOCA 4M8SA 1E5LA 1OHHD 1GGKA 2C1EA 2WOOA 1FFXA 2XUPA 1KHTA 5DNCA 4B31A 1TCBA 2DQZA 4AM8A 2IUEA 3AEQA 3EE6A 4JS0A 1FDRA 1NURA 4RMGA 5EERA 2RD2A 1J56A 3GJ3A 4PLHA 4N47A 3WQQA 1F0PA 1XL1A 3HO8A 3SU8A 2QN3A 4ATNA 1M34E 4RHYA 5CEFA 1UQTA 1GAWA 4FN5A 2IZ1A 1K2WA 2WWXA 3MK31 4IDFA 1QRDA 4ZO6A 4PN3A 4DSOA 4PRZA 5BSWA 2XCUA 4OKNA 4G67A 1A50B 4QE3A 2NP6A 1PG0A 4RTPA 3BBPA 2IWHA 1N0VC 1H8HD 3WLOA 5I8PA 4DA4A 1NUHA 1LF0A 1YGYA 3FYCA 5JS1A 3UJ6A 1TM5E 2NYAA 2JVKA 3L7OA 2X0EA 4A8JC 1A9OA 1KZYC 5JPIA 5GIPE 4LHVA 2VG8A 3L4SO 3FZQA 2C9OA 3NYQA 4NL4H 3SBDA 4PPYA 4X8HA 4LCEA 4OQFA 2VHYA 5TS2A 1S2DA 2Q46A 3WGGA 2RHTA 2ZBRA 1XJQA 4X92A 1JPNA 1XZIA 1VZ2A 1PBNA 4LY9A 4PAWA 4EG5A 3OCWA 3L7DA 2Y1LA 3OFVA 5LM3A 1XTPA 3PUYA 4XJXA 8GPBA 1J06A 4GI3A 1SXJA 3WIDA 2FQXA 1E89A 5JSQA 2K7FA 2UZ3A 1Y7HA 1MJ5A 2A58A 1SVMA 1W2GA 3A9TA 4L16A 4ZHQB 1K8XB 3TSWA 5IABA 1IH8A 3R3YA 5I6DA 3MS4A 1RT9A 4LF7B 2QVGA 3FVQA 3LVQE 4R8KA 5DXJA 2FUEA 3WJ7A 2ZJAA 4L7QA 2PXXA 3E84A 5ULLA 3K9WA 3C3YA 3ETJA 4RAOA 4RX1A 3CB4A 3CNBA 4ZRMA 5L6LB 2Z83A 2R3SA 4R41A 3A1NA 4UJ3A 2CLDX 3PLRA 2QVBA 3COJA 1DFIA 1WOYA 4TTVA 3VHRA 3QY9A 4P4SA 1VIDA 4PU0A 1IOZA 3D81A 2X6QA 3CF6R 1BCRA 2YYYA 3DXXA 2FN4A 2E87A 4YAEA 4DSNA 4TTRA 2I3AA 1KAGA 3G2IA 3MJRA 3V2HA 4F3RA 3T1VA 1DOAA 2W7TA 2QUBA 3I30X 3N0XA 4EARA 3QBDA 3I32A 4RENA 4ZVPA 2A0YA 1HNNA 5A04A 1OU4A 4EG6A 3V6MA 5IKPA 2C4VA 4E5UA 2PLWA 2AMLA 5A1JA 4GLBA 4QNNA 2CCJA 1RXIA 1SHKA 2JGRA 3CZCA 5BOVA 1WXFA 5IARA 4KGVA 3WRYC 4YP6A 3HU2A 3MTGA 4WVLA 2RK6A 3K5HA 4HAVA 2CSUA 2YNMC 1JFFA 3GHYA 4LZAA 4G63A 4Y1EA 1W47A 3DG9A 3KTFA 5EMMA 1NY6A 4TT8A 4KR6A 1JN0A 3I9FA 3JXEA 1HDGO 1KTVA 1L4FA 3O7WA 3PTZA 2FR1A 4YAWA 1C4XA 1Z82A 1Z36A 4MUGA 3B1XA 3AETB 4F2PA 3OX2A 1KYQA 3UXEA 4Y6QA 4YMGA 5IMSA 4DA6A 4G0MA 1BTOA 1IOVA 5C7OO 2CZGA 4DV6B 4F8EA 2ZR0A 4UC0A 4ILEA 4FKZA 3WL6A 2OFOA 3D6AA 1FMTA 3KYJB 4MWTA 3SZRA 4DM4A 3NEPX 4EFLA 3E3OA 3SJ7A 5C8XA 1QF7A 3FTNA 4FW9A 2C9ZA 1I0ZA 3CLSC 5DX0A 3TPZA 1Z63A 1X1DA 5CFPA 1JQAA 2EZ4A 2JPDA 1RQRA 3K0FA 3U81A 1VL1A 4EYGA 1IULA 1B8NA 1PFYA 1CDEA 1JU3A 2V6MA 3H5NA 2BLLA 3JRWA 4PC7A 5LZ5A 1K5HA 3RTAA 4AYWA 1D3AA 4ERXA 3DHWC 4H2DA 1O8BA 1Z4NA 1NI5A 2IOYA 5LIPA 1NGSA 1YI8A 4K86A 5EZQA 4DXHA 3LHFA 3QG5A 5GGXA 1DQSA 3HACA 3EPJA 2IZ7A 1EPUA 3HG7A 2XITA 4XYMA 1T9BA 3MWDA 1ZJ6A 5BUZA 4K9PA 1KK3A 2ZR9A 1P5FA 4JENA 1SGWA 1Q20A 3MD0A 3RHTA 2ID9A 3QMVA 3K1AB 1LNSA 2P40A 4R9RA 1OV4A 4H0NA 3QKRB 3MJFA 4U2KA 1REQB 3FN4A 2C1XA 2AEEA 3MS7A 4ZO9A 4C0JA 3ZTTA 3K7EA 5LJLA 5KMGA 4MUYA 1YS7A 3ADBA 1SHZA 4PRYA 4G0XA 3LKVA 4B40A 5IM4F 5HK8A 4X84A 5KZMB 4KQKA 2BJWA 1G7TA 1DEKA 3FHCB 4E33A 2DECA 3TI9A 2KW5A 3OKCA 4L4RA 3U0VA 4WI1A 3BQMB 2O0MA 3ZKAA 1IZ0A 2GF9A 2Q4RA 2XCQA 3OCXA 3JASB 4YJHB 4UNIA 5SYAA 3BYZA 2GN0A 2ZXFA 1DEXA 1N2CE 4M0FA 4MRRA 5JANA 1B8UA 4GM4A 5L95A 1BWRA 1Y8QA 2WIKA 2LCIA 3NJ4A 4KTTE 4Q4JA 3T38A 2QRVA 4MRMA 2ZDHA 1G21B 4AFNA 2VPXA 4IY1A 5IVKA 3B1KA 5K0JA 1M6HA 5IKOA 2I99A 3ECSA 1J5XA 1EIWA 4PQFA 1Y8AA 2CVZA 2BCEA 1ZVQA 1ZO8A 4U2DA 5MN4A 3OURA 4LJ6A 3D0RA 5JALA 3H0KA 2FHSA 3LVBA 4Z0PA 5A2GA 4LC0A 4FZJA 2IBMA 3FNRA 2I03A 1YBAA 5ED0A 3EMDA 4NLLA 2OPBA 1F6WA 5HKBA 4A5SA 3B20A 3D6VA 3WNQA 1Z2EA 3K09C 4YYEA 5TQ2B 4P93A 3I37X 3FFBA 1XYYA 1UKAA 1DIBA 3ICCA 3LOQA 3MJCA 3DEFA 4MKGA 4CG3A 4YUAA 1EP2B 3P19A 4MW1A 2YV4A 2GBGA 2WWFA 1SKAA 4Q4AA 3EUWA 3RIXA 5CUQA 5JDCC 1IB0A 3IDFA 1CJKC 1E7YA 4BWYA 2OHXA 2HA5A 4B4WA 1LBEA 5UKDA 3EXFA 2C2MA 4OREX 1SC3A 5KWJA 3F6BX 3GK3A 3BD7A 2VF4X 1BAPA 1JEDA 1M2JA 2GZMA 3E5RA 1JKMA 3Q6IA 5EYPB 5K0BA 2XCTB 4Z0NA 1I2MA 4DIBA 2HXYA 4U6QA 3WV4A 4OF4A 2OV1A 2P6NA 3PIIA 4X24A 5F1KA 7MDHA 3CSDA 4MHOA 4CLOB 1CUCA 1EE9A 2ZKIA 2WF8A 1TF7A 5K0ZA 3DOIA 1MGOA 5BPHA 4JV5B 1F51E 1W44A 3AIKA 1VJDA 5KOHB 3MWEA 1QHHB 1R3DA 2WINI 3WIVA 4C4RA 3IMFA 4CMCA 4JJGA 4UHHA 4D02A 4AMZA 3NQ41 3RFUA 2YWDA 3FOFC 3A36A 1EFLA 2OP0A 4RV5A 3S70A 4RMHA 2I55A 2UDPA 2WV7A 4CIXA 4ZMSA 2LV8A 2HTFA 3UOAB 5A62A 1MABA 1ZD8A 2AIRA 2G06A 3BTSA 5C8YF 4G81A 2HJVA 2RHDA 4UU1A 2Z6VA 3WL8A 1GA4A 3VNQA 5C80A 1LWNA 1XXHE 2CCGA 4KV9A 5ALVA 4YRMA 4I08A 2CNBA 3P96A 2ZB2A 3AYZB 3C3EA 5AVJA 5J23A 1GUBA 5DWVA 2Q3FA 4MR8B 9ATCA 3WWZA 4BLTA 3C85A 1ZHOA 3LUAA 3EAGA 1ZSVA 1RLMA 4ZJUA 1GD1O 1XTBA 2YZ7A 1B4DA 3C7CB 4MWZA 4X7MA 4RK4A 5ILQA 3WIBA 5AVYA 1WETA 1OA1A 4B3XA 3RW9A 3JWHA 3LUPA 2P2SA 3NBXX 5DW3A 4QFBA 3GN2A 2O7VA 3R0IA 4Q0MA 2XNHA 5DDIP 3DEZA 5DYYA 4DMCA 3B1WA 2GZ3A 4IIEA 5D7BA 4JJ6A 5IWAB 4Z54A 4DT1A 1XZNA 2YIMA 5CDFE 3ZJYA 2ZRNA 4NWIA 4C4ZA 1DQYA 1A2OA 3NX4A 4FYHA 4DLVA 5E9QA 5AW6A 3L93A 3H11B 4WN9A 4AJKA 1FYFA 3G8BA 3VC1A 1UBHS 1JILA 1GR1A 3S44A 1R4MB 2FPIB 2OZKA 5LP1A 1LQTA 5F98A 5EQDA 1QK4A 1W581 1Y6QA 1W8IA 4V1CI 3HVRA 5DHQA 4DV7B 2PQ2A 2VSXA 1N1MA 3PNMA 1XEWY 2YYSA 3ZK7A 1JRLA 3DULA 4ITRC 3FTCA 3M1IA 1XKTA 3QPUA 2BTQB 2E4UA 4OATA 2OO5A 3TLKA 1H1TA 3TKLA 3AY6A 3TIGA 2R6GA 3FR7A 3OZWA 4KDFA 2HCFA 1LKZA 3PV0A 4NV3A 1IJEA 3A9RA 3IIEA 1HEIA 1UT6A 5ARBA 1N77A 2GJ8A 3SDBA 1NF8A 4LZJA 3TE6A 1USUA 2B1JA 3ICOA 1QZZA 3G0DA 3LAWA 1Z2AA 4J4BA 4RH3A 1HKUA 4LSZA 5GM2A 3K8ZA 5SYNA 5AJHA 4ZK2A 1AQLA 5KQLA 3I45A 5CX1B 3OP4A 4PE5B 5KJEA 3FMPB 2BC9A 2PSDA 4I55F 1G55A 4U5QA 2BDUA 1PHPA 5EIEA 1KMNA 2G17A 2ZSKA 3KT6A 3RU3A 1ONBA 1USKA 2FMXA 2I1VB 1LPPA 2FEOA 3AHEA 2MYPA 4R0NA 5H80A 3UO8B 3DUFB 1CC1S 1CUSA 2ZRHA 1TVCA 4DZRA 3ZCQA 3FZNA 5EFZA 1C7ZA 1XZEA 2XNKA 4A2WA 4BAUA 2C84A 4C05A 4P54A 4YRSA 1LDMA 1N9ZA 1WS6A 2QENA 2TSYB 1SKYB 2H2FA 2ZYVX 3NNSA 4RADA 2H11A 5EXXA 3IHTA 1V3QE 1QKIA 2Y66A 3R6GA 3NS7A 4EKYA 2C94A 2FF7A 5LP6B 1OJ7A 5T3UA 4TZKA 1ZVVA 4HAIA 3USZA 1ZG3A 2IIPA 2C5EA 4N0MA 1T5HX 2PVSA 3P0EA 4LMBA 2ZE5A 1C7FA 1KORA 3ER8A 1IY0A 2BPOA 2GPSA 5B57C 4QC2A 1XZKA 1KPHA 1V37A 4JUFA 4Q3LA 1I9GA 1U1EA 2IYAA 2OMEA 5H3CA 5BT9A 2II6A 1YO6A 4C43A 5ALOA 2AFIA 2QSJA 3UMJA 1DRVA 3ZH9B 3W8NA 5JYEA 2VK2A 3BJIC 2PUWA 4RXTA 3ISJA 4HYQA 4C5BA 4GPAA 5TVKA 3TN7A 4DA8A 2GEKA 2WAXA 4Z2AA 4DA9A 2CYAA 2CVPA 1OAOA 1LD3A 2WYVA 3FFWA 4NENA 5BV7A 4INJA 3B53X 1CD5A 3BXGA 4ZCLA 2CLSA 2MSKA 2O54A 4F4HA 1BEEA 1HLDA 3GPCA 1Y98A 3V00A 5BMVA 5IKXA 2VYND 3CF2A 1FJ2A 2P4SA 4PZEA 3D8BA 1W29A 4S24A 2Q1YA 2ZS9A 3LBNA 3PICA 4MW9A 1PNRA 4O3MA 2F8TA 5LXTA 1WKBA 3QE0A 2PJUA 2X9LA 2W43A 1LI4A 4BFSA 1QGED 1V1RA 1YZNA 2A78A 2H1WA 2QYTA 3GWGA 4IUDS 3EZXA 4MPRA 5H3HA 4UTXA 4C4TA 1XVAA 3FM9A 5BWCA 1O95D 1WQ3A 2IXFA 2KSQA 3B52X 4F8JA 3FYUA 2J4DA 5BR7A 2SCUA 1R5OA 2NMVA 4CUKA 2V0NA 5JV5A 1RIIA 3ZHVA 3QI2A 2IZ5A 4WCFC 4X64B 4BO8A 5JSYA 5HILA 1GTMA 2AFRA 2ATXA 2CLHB 1YQTA 5I5EA 3DKRA 3O8RA 4MQLA 3GD7A 2EQBA 1O77A 3C6BA 3ZNNA 1J2TA 1X1RA 1JA1A 2PBRA 2ASEA 2OGSA 2QROA 4S1VA 3V4OA 3WX0A 1KP3A 1WL8A 3H5RA 4FFNA 3JZIA 2JARA 1Q57A 1Z4OA 1JX6A 4NQZA 3IQFA 9MHTA 3W8DA 4OPMA 1XLTC 1TLLA 1MX1A 3EC2A 1VYTA 3IMEA 1XDSA 4LDAA 1NVDA 5DIFA 5A7GA 2FPMA 3B1JA 1E2BA 3G8AA 3NKVA 2CK3D 1LS6A 4WLOA 1UMDB 2RGDA 1K9SA 2D7CA 3D3KA 3PDJA 3OOYA 3OMLA 1OD6A 5DOVA 1K7XB 2JGKA 2XY4A 3EZ2A 2P2LA 3MFYA 1PV1A 4W6ZA 2VDQB 3LGAA 5DP1A 4H1WA 3KXLA 1PR3A 3AF1A 4I50A 1TC2A 3I05A 2Z57A 1JWLA 1P9WA 2DBYA 2ZJ5A 4PINA 2H16A 1WP4A 4GXRA 1ZNXA 3LQQA 1E6CA 1K8QA 2YJ6A 3FPKA 3UY4A 1E63A 3HBMA 3WKDA 1KDPA 5JFOA 1WEHA 1VHJA 1M2OB 4HZUB 3KJIA 3MGBA 1VE7A 4G01B 3KSDO 5IYZA 4WNAB 3WSVA 2R1TB 3MTQA 1GXSA 2NSHA 4F86A 5JECA 1EU1A 4G1EB 1B16A 1IZZA 4Q47A 4LJSA 3DZKA 2OZVA 1W46A 2P9EA 2A1TR 4HH4A 3GYBA 1I4OA 1B8PA 4Q3KA 3H1BA 1DJOA 3DM9B 4WASA 1TA4A 3LUDA 3O4FA 2ZBEA 4ES6A 3BWBA 2I6UA 2IEZA 2XF8A 3A3PA 4OXXA 4UHDA 4ZOBA 3J81k 3AVXA 3L7YA 2RONA 1RJEA 4N3CA 1X8LA 2WILA 2CWWA 1N0HA 3OA0A 2NV2B 3ANYB 2NU8B 1MJGA 1SN7A 4TKLA 3ZIAD 2NIPA 3C48A 5AI8A 1E1DA 3WXBA 3H87A 1RW4A 3HJAA 4LF4B 3LZCA 4J07A 3K6SA 4ARIA 3BKXA 4DUGD 5EUMA 2I6XA 1V3TA 4ML3A 2L42A 3P9YA 4KXQA 2AKYA 4URFA 1ZK4A 4UMDA 1XRSB 1QVRA 2HCJB 2ZTMA 3BMNA 1OCEA 1U99A 3MJSA 4X1YB 3V8NA 4BLPA 3CO0S 3JYPA 2X42A 5CT9A 4FGLA 1Q16A 3CONA 4BFZA 4PV7A 1U2EA 2BRUA 5FTLA 2ID7A 4LYEA 1MC8A 4J0HA 1WZUA 2AEMA 4P7KA 1DIRA 4J03A 1TUBA 4IJMA 2W93A 4CQJA 1P72A 3NTUA 7AT1A 4QWWA 3SYTA 3U6KA 3CIFA 4J0GA 1A5BB 1T2UA 2AVNA 3QVMA 4FX2A 1JDUA 1NQUA 1Y1QA 2CUZA 3PF9A 3HS3A 4M0PA 2O7RA 3H2JA 4Q01A 1JKXA 2ZWVA 2YRXA 2Q5JA 2I1QA 2R1VA 4A82A 1JKIA 1KS9A 1XCGB 2EC5A 2I29A 2R97A 2XVYA 3CFYA 3KEOA 4RVSA 3TIXB 4AO7A 2VJNA 1DQNA 2F48A 3B85A 3RRNA 1A5SB 1IC6A 5BSRA 3B9QA 1GYRA 3EARA 4KAJA 1DQRA 1GNRA 3OLZA 1ZLYA 1DEHA 3KQWA 4EABA 5LYJA 2JKYA 1LZLA 1I36A 3C6KA 2QXTA 3DFKA 1FS4A 1NDUA 4BL5A 1HURA 2RHOA 4A26A 3GYGA 3N87A 3VNUA 1UBOS 1XR3A 3WYCA 1E9VA 1NVGA 1G291 5D86A 2M32A 1TQ8A 3CE9A 3P4YA 4MV8A 1JSZA 3TRHA 3TXAA 1VMKA 1RPJA 2Q6OA 5E7IA 2ZXEA 3CGGA 4PZ0A 3WJAA 1DHTA 3ZU6A 5IF3A 5BSTA 2ZBQA 2QP3A 4R84A 1FNCA 2EIXA 1QIDA 2DPGA 1HYHA 3MQ4A 4PAMA 5AKHA 4J49A 1RR6A 3QTTA 1U80A 2VRWA 3CLVA 5HFNA 3ZI0A 2DTXA 2IEIA 1GDHA 3PA8A 1GAJA 4BB5A 5JAOA 5KTNA 1P2BA 1KE1A 1FUUA 4N54A 2OGWA 1GZ5A 3LOUA 1PQPA 4XX0A 3T3NA 2CL6X 3IUMA 4XSVA 1A71A 5I9NA 3X0DA 2QTAA 1GPNA 2ARKA 3NHRA 1E9BA 4YP9A 1E4OA 3KD3A 5L4LA 1Z0FA 3SIWA 4ZD6A 4AT1A 2CYCA 2X2OA 1KI3A 1QLWA 1TK3A 5EPUA 4B3DA 1CJBA 2FFRA 3L4EA 3HL0A 4XYLA 4WHMA 3HGMA 4N6GA 3MLBA 4JQSA 3ZY5A 3U61B 4OHWA 4HNTA 3RG2A 3GF4A 4OYHA 1JAZA 1JHOA 5TPWA 3PEWA 5F7ZA 5CB4B 3CRMA 4V1CA 2R751 5EE1A 2JBAB 5D01A 3E18A 4C2AA 4UHCA 3H75A 1DRJA 2QYSA 4EW3A 1Z4KA 4IH1A 3TG2A 4UNNA 1NG9A 1D7AA 2DR3A 4B2YA 5EIAA 2RAFA 1OH6A 4RSRA 5TR9A 4DMRA 2V03A 1WF6A 2Y68A 3GEDA 2X5KO 1E18A 1R3UA 2J7PD 2D2XA 2G9UA 4MJXA 3ZZMA 3L4JA 3MF4A 4UOQA 3CR3C 4HADA 3IP1A 3CZ4A 2XTJA 3PGKA 4GOKA 2XIQA 2V3VA 1KAQA 3GFFA 2A7XA 4BS9A 1V8DA 4KPUA 1BE6A 2QLNA 2GF2A 1BHO1 1SUBA 5ENDA 1RPNA 4EGQA 3GPIA 3ENNA 5B1IA 2G6BA 1ZFNA 1JPUA 2QPOA 3TTYA 4RL6A 1UXGA 3WV5A 1A5TA 5BURA 1VG9B 4PLFA 1I1HA 5MN5A 3BK1A 4IO0A 2Y1GA 5I48A 1KVRA 2JVJA 3W77A 1P0PA 1EFPB 3GAZA 4TN5A 3L6CA 5KWSA 3HY4A 2JK1A 4E0BA 1N6LA 3OCVA 3WLMA 2ACEA 4ZRDA 4OP2A 2CV1A 4YCMA 2O1SA 1QRAA 3BF7A 3ELYA 2XCIA 4GMHA 2GFIA 5J4KA 3OQOA 5K8LA 1R4NA 1SNYA 4WBNF 4FKMA 3QXXA 1YZUA 3CNLA 4R83A 3G2KA 4CFYA 4M0UA 1ZN9A 1PDWA 2G76A 5KNBA 1UDWA 2YWEA 4G25A 5HF8A 3EJ6A 4ZDWA 1YQEA 3KBBA 3A26A 1QPGA 1XA0A 2LXNA 2CW5A 1NJSA 1FC0A 1P1RA 1SCQA 1DAIA 2BE9A 1QB7A 1KMHB 2IL1A 3W3AA 1R8QA 3A04A 5B3JA 3NBKA 3QLVA 4PRKA 1P81A 5IAEA 3OM8A 5IT4A 2V7GA 4MVJD 3EFOB 4W9NA 4XUCA 5HJ2A 2WKSA 1TGYA 4KXXA 4DYDA 3MUFA 1AUVA 5F51A 5KQGA 1ESEA 3ROPA 1EXWA 4A0FA 4CCWA 4C0KA 5KYGA 1Z2PX 1CJMA 2VVTA 1G9XA 1VJ5A 2W90A 1HRDA 1LBTA 2F2TA 3KUUA 3ROGA 4C88A 1QLHA 5K4HA 1DKRA 1IEVA 2GYUA 3QYFA 4FN4A 1R0WA 1I24A 2FE1A 5HZGA 2O50A 1PU2A 3U3JA 1J49A 4JJZA 3JVVA 1ZMXA 3MFQA 3S8EA 4MA5A 3LYAA 2KYRA 2UVPA 3FETA 4FGZA 5L3VA 1I4DD 3AZPA 3U7QB 1W9MA 4F56A 1VLLA 1H8HA 4R98A 4OGGA 1EUQA 2PZFA 2VP5A 3JZDA 3P0JA 5AK0A 2ANBA 2ZT5A 4LE0A 1SKBA 2WMNB 4CT0A 3CNHA 1FYEA 3MCAA 4HP8A 1RVDA 1L4EA 1QVWA 1T1IA 1SVIA 1FW6A 5JMPA 4NU6A 4YBZA 2V8BA 2IS6A 2LTAA 3U6BA 1KU0A 4Q00A 2RHJA 1FDIA 2IY7A 3R74A 1A9XA 3P1JA 3MJHA 4E2WA 2IGBA 1CQIB 1BFUA 3GAFA 1HDRA 3QYAA 4FOSA 2Q5HA 4C7JA 5HZKA 5K8CA 4G1VA 3L84A 1TEXA 2EKDA 4NBKA 4B7CA 4AY5A 2A9KA 2D7JA 3MRXA 2JIPA 1JHXA 1W52X 1OF1A 4YASA 2BHLA 2PU7A 3WI7A 4EUSA 3UXHA 3GRYA 3ODPA 1P0QA 3FSGD 1Q74A 4ICIA 1KZHA 4ENQA 3O90A 4JDPA 3TLJA 2O8DA 4KVGA 4DHWA 1AJEA 2J87A 2WWRA 2ZI9A 3TNYA 3OC6A 1TGVA 2BEJA 2ZYRA 2NVBA 3ASZA 4HB2A 4JJ4A 5FULA 3T7IA 1OUMA 3ZU5A 1RAFA 4ALKA 2JGEA 2QE6A 3FMVA 4MV3A 4RZQA 3ER9A 4NULA 4UNRA 4IIJA 2FPGA 2XXAA 1E2DA 2CC2A 4MUFA 3KAPA 4AUKA 4TX1A 4ZIRB 5ICCA 5K6AA 4RSGA 4HDSA 4LPKA 2O3UA 1OI7A 2PWPA 1ZH6A 4ND2A 3C98A 1ZVMA 4I5FA 4DDTA 1V48A 4BMXA 4PQYA 3A4LA 1B41A 3G8YA 3JQGA 5JS2A 4G2NA 4LF5B 2O2CA 1K6MA 1S89A 3OQMA 4QGGA 4CQLB 3CNOA 1P3JA 2R6CA 4KWTA 1W4LA 4OI2A 4WESB 4OA5A 3FCAA 2H4WA 1NSYA 8ADHA 1KR5A 4CM9A 4G09A 1RRKA 1YV9A 3AUFA 3ZJVA 4JL8A 4LF9B 2R6JA 2Q5IA 2ZCUA 4O3FA 4BQFA 4NESA 1QUEA 4MYTA 5FORA 3ZHQA 1A3CA 3FDZB 2CFRA 1NMSA 1P7YA 2YYAA 1QB8A 4E5YA 4MLCA 2C3MA 3O74A 2XTNA 3RR2A 5IBRA 4MR9B 4HSEA 5J2UA 1K68A 4EJSC 1G20B 3K72B 4HFJA 3F47A 3FMGA 3DFUA 1FBNA 3TLXA 3PFFA 4JHXA 4JY7A 3TJZA 4EX6A 1GFZA 2XBMA 4QPJC 4B1FA 4F9FA 3QVOA 5BWBA 4XB1A 2F17A 1HYQA 4LFBB 4PQEA 3B8EA 3PGLA 1W5SA 1LDEA 5ESRA 1U0EA 1ZESA 4KSCA 1IQ0A 2PPVA 2OBXA 4G84A 5F4ZA 3VVMA 1JVBA 4EPVA 1MW8X 4HNVA 2FFAA 3RADC 3ZNOA 1TQ2A 2G72A 3SS7X 3P9IA 5L3QA 1DDGA 2XDWA 1GM5A 2C9BA 2XEXA 1S4QA 4Y9DA 3GUCA 2AXPA 4D3SA 4F0JA 4M1YA 2D3TA 2PWZA 2O2ZA 2OUIA 3JTEA 1P2GA 1ZM9A 1VMDA 2DFTA 3L5KA 5AWFC 7ABPA 1VJ1A 3N8KA 3GGDA 1GR0A 3Q72A 1RCFA 3MTBA 3Q7EA 4H15A 4RY8A 2BR5A 5AKEA 3GLGA 4AKTA 3REGA 4UBKA 4AJHA 1FZTA 3OT1B 4K05A 1RZUA 2JI8A 1MRNA 4KX5A 5L7TA 1M34B 4UTOA 2BKUA 2H2GA 4MUMA 4DJ5X 1T5DX 1VGRA 1IJBA 2DP4E 2J3DA 1D1TA 2OLJA 4KIFA 5EHQA 3IJ5A 2IKSA 1SK9A 4G36A 4ZO7A 5BSGA 1E7RA 1M6WA 3I5AA 3AFNA 3BAZA 3NONA 1E8DA 2GCGA 3BZUA 4GR4A 1RYMA 3NV9A 2H4FA 3O5AA 1YE5A 2B21A 1SMKA 4ZREA 5FJIA 2UVQA 1ESMA 3AQIA 2D0IA 3U16A 1ADJA 4QBIA 1JDJA 3HK2A 5AI0A 2JFFA 2ZTLA 4RLHA 1HKHA 3H1GA 2QUJA 3FRHA 4UCFA 4B71A 3HDHA 2VPQA 3HYNA 2M98A 2FPWA 3L01A 2QRUA 2I34A 1FRNA 3M6WA 3UAGA 1ZNWA 4E3ZA 3GZNA 4QSHA 5FWXA 4UDXX 1QP0A 2QVLA 2NUPB 3D8SA 3PNBA 1SKQA 3CURA 3CX8A 5F1OA 3ADOA 1E3SA 3OLYA 2X19A 3S55A 2JD0A 4M1ZA 1G4AE 1J5EB 4NJEB 1HPLA 4JP5A 3NH9A 2QT1A 1M9NA 3P0RA 1QC5B 1BD4A 3NDIA 4HNAB 1H4QA 2HBQA 2C3OA 2PZAA 4MVCA 2AMFA 1RI4A 1TJ5A 2PBLA 4Z2YA 1LPSA 4QBKA 4M88A 5AHXA 3TZBA 3MMNA 4CGYA 1Y6GA 1ZL0A 2IU0A 1CRQA 2ONZA 2XWPA 1LLFA 1LNZA 4UTPA 4CIYA 5J4YA 1LI5A 5CA0A 1CS0A 2GO1A 1P74A 3ICWA 2BYTA 1IXYA 3M49A 4GPEA 2F1JA 3F67A 3F6YA 3GIDA 3IHWA 4GS5A 4UVGA 1YIOA 2D5CA 2PYDA 3G88A 3DF9A 1RNLA 3H6HA 3QU5A 1A8PA 2VWGA 3V1NA 4BO0A 5GVSA 1QQAA 4OHXA 3A4VA 2Q2QA 5LP6F 3KKLA 4JQOA 3ED1A 3VO1A 4C2UA 4BECA 1EP3B 2GHTA 2E2WA 4JBXA 5GJVC 2H2DA 4GQBA 3EXHC 3B9BA 1S3SA 3BDVA 1GGNA 3DL4A 2I6GA 1XNHA 3TG8A 4TXJA 5JE8A 2ILTA 3G8CA 2DUUA 3U13A 3KC2A 3SF0A 1RKBA 4BUJA 1S8FA 2WF6A 2YOHA 4Y9TA 3G2PA 2QPLA 3HADA 3SBXA 4ND8A 2D8AA 4URYR 3T41A 4MITA 4LMPA 3B6ZA 1OBOA 3DMDA 2PUHA 5FB3A 3A9CA 1KYYA 5DLPA 1Z7YA 2FEXA 2QAGB 3AHCA 4H4EA 3SP1A 4OTZA 3RFVA 4E4TA 2JFHA 3KSBC 1NW4A 3FNGA 4WV3A 4ZXPA 4IJ5A 4NZOA 2XNDA 4CCYB 2JEYA 4TOIA 3NXKA 4X6XA 4Q4CA 1ONPA 3UH0A 3WQRA 3VC2A 2AQ8A 3EH1A 4DMMA 4YJ2F 5LDDC 3FRIA 1QYWA 2HWXA 1E2FA 4IRMA 5TDHA 3HY3A 1XMVA 2FCRA 4BKQA 3F3MA 4LOKA 5GM1A 1I7PA 4HNQA 2FYTA 4C7KA 1R8JA 3BM5A 2PH3A 2J9YB 4DS3A 1VL6A 3BA6A 3DMYA 2DG2A 5CLGA 3NETA 5AKIA 5EVJA 4OBXA 3IRVA 3M6XA 4YIKA 4CLXA 1CS4C 3X3HA 4P0QB 4V0RA 3KSRA 4DV4B 2I7CA 2WIBA 3JYOA 3C3XA 4EMBA 1WLYA 2W5UA 2CLEB 1GZVA 3SR0A 2C57A 1TJ4A 1UXIA 1YHZA 2C2KA 2R68A 4DG5A 2JFOA 1JJFA 3TLMA 4B46A 1I4TD 1DJPA 1XMSA 2A1UA 2PY6A 2H0QA 2QLFA 2XSZA 4LBYA 5FOVA 1DPFA 1A72A 3K8QA 1NLMA 2RGNA 1WZCA 3CUKA 1QIFA 3W7BA 4CW7A 1RYZA 4JKYA 4XIIA 2A9RA 3KYCB 4EGAA 3DYBA 2AN9A 3ZY3A 4BP3A 5IH3A 5KJFA 1ZD4A 2FXIA 1MZVA 2IYVA 2JCBA 3EA0A 3I4FA 1IN6A 2FGJA 3AEXA 4HN4B 3E9CA 3E15A 4QTXA 4TTTS 5ERYA 1UDBA 4GXNA 3PP8A 4RKQA 4RACA 2H5JA 3O8OB 1WHTB 1Z9BA 2LKDA 3JARB 4HGYA 3U3RA 3N8IA 5JY6A 5K8IA 3TZ6A 4I9GA 5KNCH 1N2CB 5TB5A 2ZDQA 3PJFA 1BOOA 2JANA 3A1TA 1XD2B 2MR6A 2R0QC 2AI3A 2ZB4A 3GLQA 1TAHA 2I6SA 1QLJA 1IEQA 1ORVA 1QOPB 2E85A 2VZLA 2NZVG 3BB3A 3CNNA 3MOSA 2AR9A 3I83A 4RGVA 4LTDA 4UD2A 1I01A 4DADA 3GDOA 5BORA 4G9GA 2QZ4A 4LISA 3W5CA 3LF2A 3M5CA 1OC2A 1B00A 2O2DA 3GH3A 1P60A 3V2UA 5ESWA 4RTSA 2JKZA 3SI7A 4HMQA 4O2BB 4L85A 3TK1A 6PFKA 1TIBA 2ZSBA 3KB2A 3Q3EA 3EASA 5M04A 2IDZA 3VYSB 2P4EA 3O83A 4J7UA 1L4HA 2P5SA 3CCFA 4I0WB 5JNWA 1RBQA 1AKTA 4F5DA 2AOTA 1C9MA 1XJCA 1WDLA 3A1EA 3WRVA 2BELA 3R41A 4O29A 4CR6A 3LCRA 4AKIA 2B1GA 1DC5A 3HYCA 4WFQA 4FUTA 3OMXA 3T8YA 5IFLA 2C5LA 2R2AA 2VCEA 3OLCX 4M9RA 1DXHA 1UBSB 4N5MA 2QN2A 4L8WB 4OHFA 2HLDA 1AG9A 1OWLA 2FUG6 1E66A 3HZOA 4I4IA 3TVYA 4D98A 2Y67A 1X38A 1U1CA 2IHUA 3L2OB 4C89A 4CCSA 1TUEA 4BX0A 5LD2C 1HZZC 3IVCA 4L1KA 3G5UA 3FX2A 2JCVA 1Y3AA 1VP9A 4MVJI 1IVYA 2YYZA 1PFGA 1P0MA 2VYFA 4FYPA 4WMLA 1WZEA 2JGDA 5TQ0A 4C4XA 2VDKB 4RKRA 1NNEA 1IUKA 4ZAFA 2L69A 3FJOA 4YWHA 1TD1A 1J7JA 5E6SB 1EBFA 1PUJA 1AQUA 3O8QA 1HC7A 1YR2A 1EXNA 4J8PA 5FUWA 1G3QA 2CD7A 4P84A 3HRKA 3D3QA 3WGHA 1DG9A 5E4FA 5ILOA 1IG0A 1YL5A 3Q15C 5JI2E 2H63A 4PYIA 5GY7A 8OHMA 1LUAA 3HJCA 5GZ1A 1G0NA 4AG3A 4QA9A 1XZDA 4Z7OB 5FI0B 5U4QA 4B2IA 3UJNA 3OM0A 2HLPA 1XXHB 4H35A 1Z0AA 1TMGE 4ZCQA 2XUKA 4Y1GA 1G5HA 5IMBA 3T7DA 3TAXA 4FGKA 2Q1UA 4H7IA 4JU9A 4PGGA 4RBNA 3WQSB 3O4VA 4YRCA 2O8NA 3WAKA 1W36C 1QR6A 3IUJA 1I1QB 1XNJA 3D7MA 1K7YA 4JELA 3G5AA 4AJEA 4E2XA 5M5BA 5CNIA 1F5SA 5J2TF 5HDQA 1BE0A 1QJCA 4L5IA 1C0LA 1H8EA 2HA2A 2YVUA 3MN1A 1SZCA 1LPOA 2ZBGA 3C6QA 5FOSA 4XLZA 1R00A 4TS3A 1ADGA 1BSVA 4HEQA 1ST2A 4J3NA 5THKA 2AJTA 2J31A 3QFHA 2UZ4A 2BAGA 3FPLA 1LJLA 4FFWA 4QFCA 3HCOA 3NAGA 4MDHA 1VHDA 4P81A 2V9CA 1CZUA 2P6MA 3S2ZA 1WIWA 3RBXA 1VJRA 4XJVA 3SQXA 2YUTA 3UOGA 3NHBA 1WD5A 5BW8A 2AMVA 3B60A 5ICGA 1PJAA 2VXCA 5BOSA 4QGSA 1R27A 1X77A 2WFLA 5COBA 3LGSA 4X8LA 5E6UA 5F1YA 2NSDA 2NZJA 3FKSD 1YZGA 3KE8A 4XKJA 4ZOEA 1INLA 2ISCA 2JGIA 3EVNA 4CHGA 3FA2A 4HWOA 3DLHA 2D13A 1PLKA 1MA0A 1M1XB 4KUGA 3RC7A 4AY6A 1L8OA 2GB4A 4TLLB 3FYHA 2CJWB 2BN4A 3Q87B 3ZNPA 2WKPA 5DFAA 3UKDA 5LZ2A 1E5TA 1V8PA 3FBTA