5LLIA

Pvhl:elob:eloc in complex with vh298
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 25
structure length 102
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lliA00
4CHKA 1YQBA 2Z0EB 5KHOA 1WY8A 2MBQA 1VCBA 2LGYA 3TMPB 3M62B 3L54A 2GMIC 3WA0A 5DPRA 2GBMA 1WZ3A 2Y5BB 5JZEB 1WGDA 3U7DA 3PVLA 4KDIC 4ZDVA 1KOTA 1ZGUB 4GDKB 3IBEA 2CS4A 4KDLB 4MGZE 4W9EA 3PGEA 1D3ZA 3Q3JA 1JRUA 1YX6B 2NCNA 2BYEA 4GN1A 2KHWB 2MW5A 2J0MA 2KOXA 3ZRFA 3JVZX 2O6VD 1E8WA 1UELA 2DAFA 4HCNB 2CHXA 3A33B 3GZNI 3NHEB 3ZDMC 4ASWC 2RGFA 2I1JA 2O2VB 2V1YA 3P2BA 4JQWC 2V4LA 5DPTA 3WALA 4GDLA 4KSLC 4WJOA 1GG3A 2I1KA 4DHJD 3BINA 2KC2A 3V60A 1C1YB 2KFKB 1UD7A 2K8HA 4NJ7A 4DHJB 4F7ZA 1J8CA 1SE9A 2MP2A 1WGYA 3DVNU 2Z0DB 2RPQA 2KZRA 4JGHB 2KTRB 1TGZB 1RLFA 3PLUA 2NVUI 3TL5A 2DX5B 2PPHA 3KUDB 1LFDA 3A9JA 4W9FA 3A9KA 1SIFA 3JYUA 1L7YA 2GBJA 2M4NA 3I3TB 3LJ3A 4LJPB 3WAPA 2L0FA 4AWJA 4PS3A 1E8YA 2IBIB 2KDFB 1WE6A 4MM3A 3VH3B 4FJZA 2DZJA 1PQSA 3PRZA 3L0WB 3PHXB 1WFYA 3M63B 4BKGA 1L2NA 4G11A 1X1MA 3QK0A 2YVCA 3CSFA 3TCAA 3DOWA 2FIDA 3V6EB 5JHAA 1YJ1A 1P1AA 4WAAA 1WGRA 5AZGA 3MJWA 5E6NA 2REXA 4B6WA 2JZ3B 2N1VA 4PS7A 2G45B 4WJNA 3WAOA 5LXHA 3H6NA 4IWQA 2L76A 4IWPA 4DBGA 3QIJA 5D94A 1EF5A 2MBEA 3EC8A 4PS8A 4WWPA 4GGQA 2N9EB 2J7QB 3A9JB 3U8ZA 3A9KB 5DCNA 2WX0A 2K39A 2KC1A 2FUHB 3X0WA 2NBWB 5GMVA 4FA6A 4NQLB 5FR6A 2VRRB 3KUZA 2KJ6A 4GMVA 2ZVOA 3UF8A 1OQYA 4ZRKA 3W1YA 2MBHA 4HK2A 2CHWA 3WIMA 1LQBA 3L08A 2KJRA 3QWZB 2PE6B 3DVNV 4LCDE 4P7IA 4EEWA 2G4DB 2ZVNA 2PE9A 3PPAA 3VTUA 3PHWB 1WJUA 4K7WA 2J0JA 4NNJB 1GJZA 2C60A 2KKCA 3KYCD 1WM3A 4FHKA 3ML8A 4JLCA 3AI5A 3DBSA 4ANUA 3ECIA 2GOWA 2BF8B 2LGDA 3CMMB 3KYDD 4M0WB 3U30A 5CHFA 1V80A 2BWFA 3Q3FA 4GXBA 2WWZA 1NBFC 4HXDA 4E71A 1F9JA 3C0RB 4KZ0A 3ZIMA 1R4NI 3VHTC 1Q5WB 2MRPA 2NS5A 3KH0A 1K8RB 2L7RA 4MJSB 5KHQA 3IFWB 3B08A 3HHMA 4TUUA 4W9JA 3RULA 4CYEA 1I35A 4ANXA 1WR6E 3CSTA 2C9WB 1I42A 1WF9A 3NY5A 1H4RA 2KDBA 4AJYB 3L16A 2MBOA 4II2B 2FIFA 4BKSA 4MGKE 4K7SA 1M94A 4DHZB 4GB9A 4EZJA 2FAZA 5HKHA 4W9IA 1OTRB 3KW5B 2N4FA 3AU4A 4XZ4A 2LD9A 1AARA 3QARA 1WXAA 4FJYA 3M3JA 3TJPA 4PYUA 3HIZA 2KNBA 1TBEA 3H7SA 2EMTA 4A3PA 2QHOA 3QA8A 4MELA 1LXDA 3KVFB 3VAWA 1YX5B 2L00B 2BGFA 2G3QB 1R4MI 4FHJA 4BKSD 3QQ8B 5D2MB 4BBNC 2HTHA 4ZRJA 4GDLB 2L0TA 3RUIB 5CTRC 3SHQA 2MSED 2IO2B 2JPHA 2B3AA 3DQVA 4TKNA 4IM3A 4I6PA 4IW0A 2LVQA 3IG3A 3LDZE 4I6LB 4ANVA 3O65B 3ZNGC 2BYFA 4RMAA 3W1SC 3T9LA 2D2QA 2LJ5A 2MLBA 3PTFC 5L95C 2KVRA 2M1MA 2KQ7A 3QCAA 4GOCA 2IYDB 1TTNA 3B1LX 3QJZA 5D6JB 1KJTA 3DCGA 4AUQC 3N32A 3EFUA 1WXMA 4ICVA 4G3XB 4N9F4 5EDSA 3PSEB 2DHZA 4M8MA 5J18A 2AEHA 4NY0A 3S2AA 2GBRA 1WGGA 2LRUA 4X57B 5C1ZA 1WX7A 2MA9B 2RR9A 5LXIB 1WE7A 2XK5A 2KTFA 2ZPNA 4OVUA 4W9HA 3OJ4B 5CHWA 3V6CB 3L17A 2LI5A 4W9CA 3PRMB 1SGHA 4BOZB 3APCA 3JSVB 2IO0B 4KVGB 3SD5A 2NBUA 4FJVB 3VDZA 2D07B 4IC7B 3V62A 2A5UA 3VUYA 2NPTB 3VTWA 5G55A 3HM3A 1RAXA 1IP9A 2MX2A 1HE8A 3VFKA 2OOBB 1P0RA 2OJRA 2IY0B 4HPMB 1V6EA 4FLHA 1WXVA 4JIOU 5C23A 1UH6A 2IZVB 2KANA 2FCNA 4HDQA 3A4SC 4GSWA 2KD0A 1WXSA 4DDID 2KO3A 1E7VA 2KMCA 4XX5A 3RT3B 1XT9B 3AXCA 3KUCB 4B95A 3ZDTA 2KLCA 1Y8RC 3PRPB 1V86A 4M8NA 2WX1A 2BKFA 4MDKE 2KN5A 2XBBC 3MHSD 4GU2A 1CMXB 1LM8B 1ZKHA 2FCSA 4IWOA 2RSUA 3H7PA 4HJKA 1P9DU 2BYVE 1NI2A 3JSVA 1V81A 2JUOA 1V49A 3ZO5B 2BKRB 4FN2A 1E7UA 2KWVB 3VUWA 4WWOA 4NAWA 1P98A 1RFAA 2GBNA 3ZUNA 4A3OA 3ZLZA 3HM6X 1V9JA 2LXCA 2MP2B 2MWSB 2IY1B 4GDKA 4FBJB 3ZVVA 2ZPYA 1V2YA 1YD8U 2GBKA 3UGBB 1ISNA 2KXJA 1Q0WB 3A1QB 4EKUA 2JY6A 2KFJA 3TBLD 2AYOB 4G0NB 1EO6A 2C7NB 2FNJB 1UZXB 1KM7A 2DAJA 2KK8A 3T8MA 4BFRA 1WYWB 4MGIE 4PYZA 1J19A 2HD5B 2FCMA 2KDEB 3RZFA 4WWNA 3V61A 2KX0A 1WH3A 1FXTB 3ZTCA 4MSQB 4URKA 2JXXA 2Z59B 4B9KA 3ML9A 4AJWA 4E74A 4MH0E 4A20A 2UYZB 3VXWA 4IM2A 1A5RA 5BO4B 2O6VB 4RM9A 3A4RA 3OAWA 2XEWA 4NAWB 2DYOA 2N9PC 3QX1A 2FCQA 5JHBA 3VTVA 1WM2A 3ZW3A 3NZUA 1C3TA 4MGYE 2N7EA 2W9NA 2NBVB 1KLVA 2LASA 3EHVA 3OJ3A 4KZCA 1RRBA 3NZSA 1MG8A 2ZCCA 2M8SA 4TQ0A 2KQSA 3K9PB 2UWQA 3VQIA 5CX3A 2JF5A 3IVFA 1P3QU 1UBQA 2CU1A 2LVPA 3TIXA 1WJ6A 3D32A 4DXAB 2M17A 3DBLI 3H7PB 4WQOB 3ALBA 2C7MB 1IPGA 1GUAB 1S3SG 3RZWC 2AWTA 1EF1A 1QZEA 2LRWA 2HE7A 3SU8X 2JRIB 2KDIA 4YL8A 4OVVA 1GC6A 4KV2A 2D3GA 4HCPB 3BY4B 2LZ6A 4J6IA 4BBNF 1TZ1A 4HVBA 4ICUA 4WJQA 5TR5A 2EKEC 3W1SA 3QC8B 4EUTA 1WIAA 1G6JA 2CR5A 2R2OA 1E8ZA 1S1QB 2D11A 2M0XA 1WX8A 1WGHA 4HDOA 3R3MA 2JRHA 2KJHB 2IO1B 2LGXA 2ZJDA 3R7QA 1WR1A 1V5OA 3NOBA 4HWIB 3OLMD 4DK5A 3PZDA 1WRDB 2KWUB 3UQAA 4LJOB 5AZHA 2XK5B 4DDGD 1OGWA 3N3KB 4IG7B 5DPWA 3DBRI 2K8CA 3VUXA 2O6VA 3B0AA 3H9DA 3RYTA 2K6QA 2DYBA 3JW0X 3L13A 5J2RA 1WZ0A 2NPTA 2NR2A 2KFKA 2K1FA 2KWCA 2N1WA 2N9XA 3EECA 3PT2B 4TQ1A 2HJ8A 4TV3A 3X23A 3ZKJC 2L8JA 1WMHA 3DPDA 3RCZA 1Z5SB 3AULA 2ZZPB 5DPSA 4ZRIA 4AP4C 3DDCB 4GIVA 2WYQA 3PLVA 2BWES 3CF6E 4K7UA 2KX3A 1GC7A 4KIKA 1XD3B 1WX9A 2YLMA 3R66C 5LLIA 2BPSA 2CHZA 3ZNHB 5JH5C 2L3ZA 4IM0A 3ZNID 3ZTDA 2LXAA 5IAAC 1XQQA 2MBBB 2J0KA 5E6PA 2N7DA 2JT4B 4XC2A 4LDTB 3WANA 2LUEA 2G4SA 2MCNB 3M95A 3WAMA 2PJHA 1E90A 1UGMA 5D7GA 1UBIA 2ZNVB 3UINB 2K6DB 2MQJA 1YIWA 3UIOB 5L83A 3APDA 5CHVC 4II3B 1V5TA 4CO7A 1WMHB 5J17A 3SDLC 2LWPA 2IO3B 4BOSC 3IHPC 3RD2A 3DVGY 1Q1OA 3DVGX 4RM8A 1J0GA 3PREA 1U4AA 1OEYJ 1WJ4A 3A1QA 2DZIA 1WI0A 5AEKB 1BT0A 3MTNB 4BVUC 4NJ6A 2A4ZA 2JZZA 3HK0A 4W9DA 2RD0A 4DHZE 2R2QA 4JL9A 4EOYA 2PEAA 4LDTD 2DZMA 3QAQA 2ASQA 2DZKA 5G2NA 1EUVB 4ZYNA 2DYMA 4DWFA 2ZNVC 4G50A 3GOEA 4K81A 2O2VA 2ZCBA 3H1UA 4FULA 2V3SA 3QHTA 4W9LA 4W9GA 3PS6A 2AL6A 4EZKA 3APFA 1IYFA 4EZLA 4IUMB 1ZW7A 3VVWB 1OEYA 2DENB 2WDTB 2L05A 3ZRCA 3AU5A 2K25A 4MEMA 3NS8A 4AOFA 2AL3A 2JWZA 3K9OB 3ZNZB 2LVOA 3VH4B 2KTRA 4WJPA 2C5LC 4KIKB 1GNUA 3N30A 4W9KA 3ONSA 4NQKE 3ENEA 4KSKC 3R7RA 5E6OA 1NDDA 1E8XA 1Z2MA 3UQBA 2D10A 1VD2A 4F8CB 4BKTA 4FADA 5AZFA 4E3CA 4HPLB 4MSMB 2CKHB 4NPNA 2KLGA 1E5WA 2KMAA 3L10B 4EFOA 4F1SA 5IA7A 1T0YA 3DBHI 2C7HA 4ANWA 3PV1A 4HLEA 2EMSA 4K1RB 1H8CA 4I6NB 1WJNA 2K8BA 2ZEQA 2JVCA 3UIPB 4MJSA
chains in the Genus database with same CATH superfamily
2Z0EB 1VCBA 4ZRPA 3TMPB 3M62B 2GMIC 2Y5BB 1WGDA 3U7DA 3PVLA 4KDIC 2WXNA 4MGZE 3PGEA 1D3ZA 4GLSC 4S17A 4OVZA 3Q8FA 3U52E 1ZPSA 3A33B 3GZNI 3NHEB 4RF0A 4ASWC 4TSSA 4JQWC 3WALA 4KSLC 4WJOA 2KMMA 1ACCA 2KC2A 1C1YB 3N1XC 4DHJB 5C3JB 2MP2A 2RPQA 4JGHB 3BYYB 1AWDA 3H8HA 3TL5A 2PPHA 2V9HA 1SIFA 3I3TB 3LJ3A 1PGBA 3WAPA 2YEPF 2L0FA 4YTMB 1MI0A 2AQ3B 1N63A 2DZJA 1PQSA 2ONQA 3L0WB 3M63B 3AH7A 3RNEC 3PZ8A 2JWUA 3QK0A 2INPE 2WXHA 2JZ3B 2G45B 3H6NA 1P7FA 4DXFA 1UWXA 2J52A 1L5PA 1SE3A 2MBEA 3A9JB 3A9KB 3DBRB 1OQQA 3X0WA 3I5JC 5C2TB 3AE2B 3NRZA 4GMVA 3TEZA 1T3QA 2CHWA 3WIMA 1TKGA 2B76B 2PMVA 3QWZB 2PE6B 4LCDE 2WP9B 1JWAD 1SB3C 4EEWA 3VTUA 1WJUA 4NNJB 2C60A 1ET6A 4HRSA 2K22A 3BIID 5FK9C 4IDIA 3AI5A 5BYSA 5HI1A 4M0WB 2LGDA 3CMMB 3KYDD 5CHFA 1NBFC 1GAQB 4HXDA 1F9JA 4KZ0A 3ZIMA 4JE3B 1K52A 2NS5A 3Q8CA 1YOVB 2WXJA 3RULA 3NY5A 1M94A 2FAZA 5EE0A 3QARA 1QOBA 4FJYA 2QHOA 3VAWA 5HHDG 4P1CC 3DWGC 1ET9A 2BGFA 1R4MI 4FHJA 4BKSD 1RWSA 2JQRB 4LNKA 5GXGB 2QIEB 3RUIB 2JPHA 2B3AA 3NVYA 1F0ZA 3IG3A 3LDZE 3O65B 3DBLB 3T9LA 3P1MA 2IYDB 2GRIA 4ICVA 5J18A 2FUG1 1FNVA 1LO5D 3ABVB 5E6JA 1KRHA 2ZW0A 4W9CA 3PRMB 1MFWA 3SD5A 2NBUA 4IC7B 3V62A 4HEA1 5G55A 1RAXA 1T0RC 2OJRA 2IY0B 5G5HA 1V6EA 1AW7A 1C4CA 2IZVB 1XLQA 3Q14C 3IAS1 1C78A 4DDID 1MPEA 1E9MA 2QJLA 4B95A 1GB1A 1FFUA 2XBBC 4FXCA 1ZKHA 2VH2A 2RSUA 5IO9A 1KTKA 1J7AA 4FN2A 1E7UA 3VUWA 1RFAA 2GBNA 2W3SA 3ZLZA 2MWSB 2IY1B 2PW9A 2N7JA 2ZPYA 2K0PA 2GBKA 1ZP0B 3O13A 3TBLD 1EO6A 2FNJB 1UZXB 1KM7A 3T8MA 2CU3A 4WWNA 4MSQB 4MM3B 2Z59B 4E74A 4OZCA 4MH0E 1YN4A 1SXTA 1A5RA 2PVGC 3A4RA 3OAWA 2N9PC 1B1ZA 2FCQA 2XNAC 2LASA 3EHVA 3OJ3A 1JQ4A 5FKAC 3R2IA 3VQIA 5CX3A 5JXVA 1UBQA 2CU1A 1XXGA 3H7PB 4WQOB 3ALBA 2C7MB 3FAHA 1IPGA 1QZEA 2INNE 2JYEA 2LZ6A 2W3RA 5TR5A 2Q5WD 4EUTA 1WIAA 2CR5A 3VRAB 1JWUD 1V5OA 1J7CA 1L6VA 2K9XA 2MHJA 1WRDB 2KWUB 2Y5PA 3GE3C 1IBXA 2XK5B 3ZYYX 3KQ4A 3MC0B 3N3KB 3DBRI 2K8CA 2O6VA 5J2RA 2KFKA 4TQ1A 3PT2B 1R7SA 4WIPA 2N9XA 2HJ8A 2LHEA 2G9HD 3X23A 2L8JA 3RCZA 3AULA 5DPSA 4ZRIA 4N59A 3DDCB 4GIVA 1L4ZB 1QOFA 4XE0A 5HG2A 2GB1A 2Y5CA 5IOIA 3PLVA 2BWES 3FKYA 2KX3A 1GC7A 1WX9A 2CHZA 4IM0A 2WXOA 2QEJC 1FNWA 4LDTB 3TEXA 2ACZB 3M95A 3WAMA 2PJHA 3B9JA 5D7GA 1UBIA 1QILA 1HZ6A 2K5PA 3SDLC 3RD2A 3DVGY 1Q1OA 3PREA 2DZIA 2WS3B 2MJDA 3MTNB 2A4ZA 3P4QB 1MG4A 2RD0A 2R2QA 4EOYA 2PEAA 1C4PA 2ASQA 1E6EB 1EUVB 4N58A 4US9A 4NJCA 2J42A 4ZYNA 4MH8A 3RPFC 3P42A 2O2VA 4FULA 1N61A 2V3SA 1FFVA 2BS2B 2QCZA 2AQ2B 3AEAB 4RGMA 1MJDA 3NS8A 5BMGA 3MC8A 3AECB 4DXGA 3IAM1 2KTRA 4WJPA 1XLPA 3P4SB 1GNUA 3N30A 3ONSA 3ENEA 1TT5B 3R2TA 4E3CA 1V1OA 1E5WA 4F1SA 5IA7A 1T0YA 3BWUD 4HLEA 5JHBA 1WY8A 2OJWA 3L54A 2MJ3A 3WA0A 3SFDB 1WZ3A 1KOTA 2BB6A 4JWSC 1ZGUB 5TSSA 1LGRA 3IBEA 2CS4A 4KDLB 5H92C 3VR8B 4L23A 1VRAB 2KHWB 3ZRFA 1E8WA 1UELA 2DAFA 1T6BX 3ZDMC 1NENB 4B0MA 1SE4A 2RGFA 3RNAC 5DPTA 4GDLA 2BTEA 4XDDA 1D4BA 2WXQA 4AQ7A 1UD7A 4F7ZA 1UWMA 1TKYA 2K3UA 2IGGA 3BVGA 3P63A 2Z0DB 2KZRA 4HPPA 1ENFA 2N9LA 2DX5B 4LK0M 3KUDB 1LFDA 1L7YA 3OWEB 1C79A 1WXQA 3AEEB 4AWJA 2BS3B 1KLUD 4PS3A 1STEA 2KDFB 1WE6A 3VH3B 4ITKA 4KGTA 4BKGA 3I57A 1L2NA 1X1MA 3RNGC 2YVCA 3CSFA 5JHAA 4WAAA 2REXA 4B6WA 2LHDA 4IKGA 3WAOA 1AN8A 5D94A 4GGQA 2N9EB 2BBCA 2J7QB 4C80A 2WX0A 2WNMA 4P1BC 2VH1A 2K39A 4ZHPA 1WYGA 5BYQA 4FA6A 4NQLB 5FR6A 2VRRB 3KUZA 1WRIA 2KJ6A 4ZRKA 1LQBA 1L0VB 2X38A 3L08A 3CIRB 1PGAA 2ZVNA 5H8YE 2PE9A 3PPAA 1FIQA 2J0JA 2KKCA 2PTLA 1WM3A 2WXRA 3AMZA 3ML8A 2IDYA 2MH7A 4ANUA 3Q3OC 3AEDB 1V80A 3BVMA 1TS4A 1TYGB 2WXGA 3C0RB 2V4IB 1Y56A 3B08A 1WR6E 3CSTA 2C9WB 1I42A 2FIFA 4BKSA 4AS1A 1DYQA 4DHZB 4EZJA 3AU4A 4XZ4A 2LD9A 1AARA 1WXAA 3P4RB 3AN1A 1ZDVA 3HIZA 1TBEA 3H7SA 2EMTA 1VJKA 4A3PA 1LXDA 1Q10A 2L00B 2RDBC 2EKIA 5D2MB 2MJEA 4ZRJA 2L0TA 2WXIA 1EU4A 3DQVA 4TKNA 4K3CA 2BYFA 3W1SC 2WHIA 2D2QA 2LJ5A 4L1BA 3QCAA 1I4GA 4OHJA 3DCGA 2D3CA 4AUQC 3N32A 1YNTE 4G3XB 5BMHA 4XWWA 2DHZA 1I4PA 2GBRA 4PK1A 5C1ZA 2MA9B 3LXFA 2BVCA 2ZPNA 4OVUA 1SGHA 4FJVB 1HZ5A 4A6QA 4HJGE 2NPTB 3VTWA 1V8CA 2WU5B 3VFKA 2OOBB 4HPMB 1FD6A 1PDXA 5C23A 1UH6A 1XCQL 2D5GA 2KD0A 1WXSA 2WGSA 2KMCA 1YMHE 3Q8BA 3DBHB 4M8NA 1V86A 3GB1A 2WX1A 2BKFA 2KN5A 2ICIA 1CMXB 2FCSA 4ACFA 1NI2A 3JSVA 1V81A 2KWDA 3ZO5B 4O1NA 1GPXA 4A3OA 1HA5A 4GDKA 2IPKD 3U7ZA 1YD8U 1R4NB 2KN4A 1JWSD 1ISNA 1E10A 3A1QB 4EKUA 2JY6A 4Q2JA 3AE3B 3R8BA 2DAJA 1WYWB 3IXSA 1J19A 2HD5B 1K51A 2FCMA 2KDEB 3RZFA 1FXTB 1CK1A 4URKA 2JXXA 4AJWA 2UYZB 3B2FA 2O6VB 2WXLA 1N6ZA 2Z8LA 2GI9A 1ZUD2 1WM2A 4ARIA 4HROA 1UNSA 4MGYE 2N7EA 2W9NA 2KQSA 3K9PB 3DHHC 1L0XB 3C19A 4IOIE 1I7HA 1WJ6A 1FNUA 3D32A 4YTPB 4DXAB 3ZJTA 2OEDA 1GUAB 1BUIC 2AWTA 1EF1A 4RGNA 2HE7A 3SU8X 1R4MB 1HXYD 3AEBB 1D5MC 4OVVA 4YL8A 4KV2A 3BY4B 4BBNF 2EKEC 1G6JA 1I4QA 4ZOHC 2D11A 2M0XA 2ON8A 3R3MA 2JRHA 2IO1B 2LGXA 2M56B 4BAXA 3R7QA 3AE5B 5BYRA 4DK5A 1DOIA 2SEBD 4ZYSA 5DPWA 1L6UA 3HUIA 3VUXA 4A8XC 1CQVA 1CZPA 3RYTA 1JRPA 3JW0X 3QJZA 1WZ0A 2N1WA 4TV3A 3ZKJC 1KLGD 2MEKA 5IP4D 3CF6E 2W55A 2JZPA 5LLIA 2L3ZA 1TY0A 1XF5L 3ZTDA 2LUMA 2MBBB 5E6PA 3WANA 2MCNB 1E90A 1EU3A 4BZAA 2ZNVB 3UINB 1YIWA 3APDA 2XN9C 4II3B 1V5TA 5J17A 1FXAA 4KKJA 1IGDA 1J0GA 1OEYJ 3AE4B 1WI0A 3MP9A 1N5WA 4JL9A 2DZMA 1XCTL 5G2NA 3MC9A 2ZNVC 4G50A 3GOEA 3H1UA 4W9GA 2ZW1A 2AL6A 4EZKA 2LGIA 1IYFA 1OEYA 3ZRCA 2WDTB 4MEMA 2AL3A 3VH4B 4QAYA 5I4DA 4W9KA 2NTTA 4NQKE 1Z2MA 1VD2A 4FADA 3TSSA 4MSMB 5FR3A 4M01A 1NYRA 1SJED 4EFOA 2C7HA 1H8CA 4I6NB 2ZEQA 3LB8C 3UIPB 2LMCA 4MT5A 1I4XA 4CHKA 5EE3A 2MBQA 1AYFA 3AV8A 5JZEB 1VZ6A 3N20C 3I9V1 4ZDVA 1UGJA 4UDUC 3Q3JA 1YX6B 1F2RC 1YQ4B 1YN5A 2O6VD 2KVZA 1MVKA 4HCNB 5AUKA 1N5XA 1PYWD 3NVVA 2I1JA 2O2VB 4XWTA 2DNFA 2V4LA 1L4DB 1GG3A 2I1KA 4DHJD 4RFBA 2KFKB 1J8CA 2K8HA 4NJ7A 1SE9A 1UF0A 3DVNU 4ARCA 3LYYA 2KTRB 1TGZB 2CJOA 1RLFA 3PLUA 3HRDD 3A9JA 1KH0A 3A9KA 3BVZA 3T3NA 2KACA 3JYUA 2GBJA 1HTOA 2FE8A 1JMLA 1HQRD 5EE9A 3AE6B 1E8YA 1QF6A 2IBIB 1VDVA 4FJZA 3NJTA 2AQ1B 3EFCA 4C7ZA 1WFYA 1DOYA 1SSNA 4K3BA 4A9AA 3E56A 1A70A 2HTME 4LTUA 3MJWA 4ZHOA 4NAMA 2N1VA 2WXKA 4WJNA 1I4HA 1TJEA 3N9YC 3QIJA 1EF5A 3SFEB 3EC8A 4PS8A 4WWPA 2KYWA 4M0WA 3U8ZA 5DCNA 2KC1A 2NBWB 2BW2A 3DHIC 2PVOD 4YXDB 2MBHA 4HK2A 3ZXRA 2E6XA 2IGHA 2KJRA 3DVNV 2TSSA 2G4DB 3DWMA 2QC8A 3PHWB 4K7WA 1EWYC 3KYCD 4FHKA 1V1PA 1TIFA 4JLCA 3DBSA 1QQRA 1OQRA 3I63C 4KGRA 2BWFA 3Q3FA 4GXBA 2WWZA 1T5XD 1NEKB 3AE8B 4US8A 2N0SB 3Q8AA 1K8RB 1ZE3D 3TEYA 3IFWB 4CYEA 4W9JA 1I35A 4ANXA 1WF9A 1H4RA 4AJYB 4K7SA 5HKHA 4RCOA 1C77A 3KW5B 2G1EA 3AE1B 4PYUA 2LJIA 2KNBA 2H88B 2QSDA 4MELA 3VRBB 1ZDXA 2PKOA 4BBNC 4KX6B 2HTHA 4GDLB 1IGCA 5CTRC 3SHQA 2IO2B 3Q3NC 4IM3A 4I6PA 2LVQA 2RDHA 3ZNGC 5HFYA 4WQMA 2MLBA 5L95C 2KVRA 2KQ7A 1TTNA 5D6JB 3N1YC 2BQQA 4N9F4 4M02A 1J7BA 3RNFC 4M8MA 2AEHA 4NY0A 1WGGA 5LXIB 4USAA 3OJ4B 3L17A 4KVGB 2IO0B 3URYA 2D07B 1ZXIA 3VUYA 3HM3A 1IP9A 1HE8A 2JXTA 1QOGA 4JIOU 2KANA 3N1ZC 2FCNA 4HDQA 3TUOA 4GSWA 2OHFA 2RMMA 3EA6A 3W2DA 1XT9B 3KUCB 3ZDTA 2V3PA 3RN9C 1FXIA 4WAFA 2D3BA 1JWBD 2I38A 4HJKA 1P9DU 1TS2A 2BYVE 2JUOA 1D6EC 1FCCC 1V49A 2BKRB 2LGSA 1HTQA 1P98A 1V9JA 4FBJB 5D3IB 3IT4B 1V2YA 2KXJA 4JX1C 3Q2AC 1Q0WB 2AYOB 4G0NB 3AM9A 3ZJVA 2C7NB 3ETRA 1F77A 4MGIE 4PYZA 4R3DA 3V61A 3FC4A 3ZTCA 2SAKA 2Y3AA 3C8YA 1L0YB 5BO4B 4XGAB 4RM9A 4MACA 2DBYA 2VZKD 3QX1A 1BXTA 3U4EG 1ROEA 1P7EA 3FILB 3NZUA 3ZW3A 1C3TA 3GP7A 2NBVB 4KZCA 1NVID 3NZSA 2M8SA 4TQ0A 1E0ZA 2UWQA 3IVFA 1P3QU 1XO3A 2LVPA 1F52A 4C00A 2QMTA 3SR6A 2M17A 3DBLI 3RZWC 4YSZB 2LRWA 2KQ4X 2JRIB 4RH6A 1GC6A 1QOAA 2CJNA 3AEFB 2D3GA 4HVBA 1SF0A 4ICUA 4WJQA 3W1SA 1E8ZA 1S1QB 4ZRQA 2WXFA 2KJHB 3HVZA 2ZJDA 1WR1A 3NOBA 1FRDA 2RPVA 3OLMD 1QKZA 1RM6C 4WH4A 1TS3A 3UQAA 1OGWA 1ZXHA 4IG7B 2DLBA 1EWCA 3J9CA 2K6QA 2DYBA 1SE2A 2NPTA 3EECA 1YQ3B 2KWCA 3AEGB 2LEKA 3KLSX 5EE1A 1WMHA 1Z5SB 4XDCA 2J4XA 4AP4C 2I2YA 1EM7A 2W82A 4YTNB 4KIKA 1XD3B 2YLMA 2BPSA 3ZXVA 2L52A 3ZNID 1XQQA 4RF1A 2N7DA 2JT4B 4XC2A 3BK2A 3PZ7A 2LUEA 4OZBA 1F1HA 1UGMA 3VR9B 2BT6A 2K6DB 3UIOB 1FEHA 4CO7A 1WMHB 2LWPA 2IO3B 4BOSC 2IJ0A 3IHPC 1B9RA 4RM8A 1U4AA 3A1QA 5AEKB 1XLOA 4NJ6A 2JZZA 4W9DA 2FBWB 3Q69A 4LDTD 3TEWA 2DZKA 1SEBD 4DWFA 1XLNA 2ZCBA 3QHTA 1FM0D 3PS6A 3APFA 4IUMB 1ZW7A 3VVWB 3EGRA 2DENB 2L05A 3DHGC 2K25A 3ZNZB 2LVOA 1YJIA 1OFFA 3W5VB 2L1AA 2D3AA 2W54A 3U2SC 3RNBC 2L83A 5E6OA 1NDDA 1E8XA 3UQBA 2D10A 4F8CB 1VZ7A 4EE2A 5AZFA 4HPLB 4NPNA 1VZ8A 2KLGA 3L10B 2V3NA 4ANWA 3PV1A 2EMSA 3KWLA 1WJNA 2K8BA 1UUPA 2JVCA 1YQBA 5KHOA 2EELA 2LGYA 3EUB2 5DPRA 2GBMA 4KGSA 4RGTA 4GDKB 4W9EA 3BK1A 1JRUA 2NCNA 2BYEA 4GN1A 2MW5A 2J0MA 2KOXA 3JVZX 1JCKB 2CHXA 3E9SA 4C4VA 4OW0A 3GS2A 4HKQA 2V1YA 3P2BA 1C4AA 3BINA 3V60A 2WDRB 4L2YA 2M19A 1WGYA 1RFKA 1HEZE 2NVUI 1V1PB 1T0SC 4W9FA 4REZA 1NYQA 2M4NA 4B0EA 3RMKC 4LJPB 5LNK1 4C4VB 1SBBB 4MM3A 5BMIA 2RDGA 3PRZA 3PHXB 4KKIA 4G11A 1BMLC 3TCAA 3DOWA 2FIDA 3V6EB 2JX5A 2QILA 1YJ1A 1P1AA 2HJ1A 1WGRA 5AZGA 5E6NA 2NTSA 1N60A 4PS7A 5LXHA 2DWQA 4IWQA 1JALA 2L76A 4IWPA 2PIAA 4DBGA 1KFYB 1VR9A 2INDC 2KAJA 2FUHB 4RNAA 4DQOC 5GMVA 3AE7B 4P16A 1SJHD 3UF8A 2ZVOA 1OQYA 4P6VF 3W1YA 3MFGA 2JU6X 4P7IA 4YSXB 1I4RA 2BYTA 1GJZA 4JWUC 1N62A 1FMAD 2HDEA 3Q6BA 2PLPA 1QLBB 3ECIA 1PUTA 2BF8B 2GOWA 3U30A 4WWMA 4CQNA 1JWMD 4E71A 2JYTA 4OZAA 1R4NI 1ESFA 3VHTC 1Q5WB 3NG0A 2MRPA 3BZDB 3KH0A 1T0QC 2L7RA 4MJSB 5KHQA 1PGXA 3HHMA 4TUUA 2IGDA 1F2RI 2KDBA 4LNFA 3L16A 3P4PB 4LNOA 2MBOA 4II2B 4MGKE 4GB9A 4W9IA 4PT5A 1OTRB 2N4FA 3IT6B 2X8XX 3M3JA 3TJPA 1M4VA 4YT0B 4HKZE 4LNNA 3ZGZA 3RNCC 1KF6B 3QA8A 3KVFB 3Q3MC 1YX5B 5D3DA 1WGKA 1NI3A 2G3QB 3QQ8B 3Q8EA 1IUEA 1JROA 2WDVB 2MSED 3NVZA 3RI7C 4IW0A 3T3OA 4I6LB 4ANVA 4RMAA 1C76A 3PTFC 2M1MA 4LLGM 4GOCA 3B1LX 1KJTA 3EFUA 1WXMA 1MHXA 4N6EB 5EDSA 1DOXA 3PSEB 3S2AA 3W9CB 2WQYB 2LRUA 4X57B 1FRRA 1WX7A 2RR9A 4TMAB 1WE7A 2KDMA 2XK5A 2KTFA 4W9HA 5CHWA 3V6CB 2LI5A 4JPSA 2WDQB 3SEBA 3APCA 3JSVB 4BOZB 3VDZA 2A5UA 4YSYB 2MX2A 2N9KA 1P0RA 4FLHA 1WXVA 1D5XC 2L32A 2LFIA 4J3OD 3A4SC 1TZOA 2WU2B 3RFZB 3CWIA 2KO3A 1E7VA 4XX5A 3RT3B 3AXCA 3HVDA 1C9FA 2KLCA 1Y8RC 3PRPB 1ZOYB 4MDKE 4GU2A 3MHSD 4IWOA 1LM8B 2JSVX 3GE8C 3H7PA 1GOZA 2VZKB 4D2KA 2KWVB 5IN7A 3AB5A 4WWOA 4NAWA 3ZUNA 3HM6X 2LXCA 2MP2B 3L4PA 1YN3A 4M00A 3KWVA 4XYCA 3ZVVA 1E7PB 3UGBB 2KFJA 3NVWA 2KK8A 4BFRA 1TKEA 2J53A 1K50A 2KX0A 1WH3A 5T8IA 4B9KA 3ML9A 1IBXB 3NS1A 4A20A 3VXWA 4IM2A 3V05A 1MHHE 2XEWA 4NAWB 2DYOA 3NUHB 3VTVA 4H2AA 1KLVA 1RRBA 1FPYA 1MG8A 2ZCCA 2KT7A 2JF5A 1TY2A 3TIXA 1D5ZC 2AX5A 1S3SG 2BS4B 1FCLA 2KDIA 4HCPB 4J6IA 1TZ1A 4C56C 1CJEA 4A55A 3QC8B 2R2OA 5IKCM 1WX8A 1WGHA 4HDOA 1JW9D 3MJ5A 1WSPA 3B2GA 3MHZA 3ZQ4A 4HWIB 3PZDA 4LJOB 5AZHA 1V97A 4DDGD 4WURA 5MPOA 3B0AA 3H9DA 3L13A 5L83A 2NR2A 1PFDA 2K1FA 3ZJUA 5G5GA 3WCQA 3DPDA 2ZZPB 3FILA 1SIJA 2WYQA 2WLBA 2GLSA 2R61A 4K7UA 4A90A 3AE9B 1VLBA 3R66C 3ZNHB 5JH5C 3W5UB 2LXAA 2UU7A 2WXPA 4NZLB 5IAAC 3GZNB 2J0KA 3NZ3A 2BB5A 2G4SA 2M0AA 2WXMA 3UI3A 1QT9A 5AUIA 2MQJA 1RYJA 3BYTB 1DGJA 5CHVC 1XEEA 4RGOS 2INCC 3DVGX 2YEPB 1YJJA 4S0RA 1WJ4A 1BT0A 4BVUC 3HK0A 1TS5A 2NMQA 3V3XA 4DHZE 3OG5A 1K53A 3QAQA 4YWGG 2DYMA 4K81A 4W9LA 4C7YA 4EZLA 3AU5A 4AOFA 3K9OB 2JWZA 4LNIA 1WWTA 2C5LC 3PO0A 4KIKB 1GB4A 2E3TA 4KSKC 3R7RA 2QDFA 4BKTA 1FO4A 2CKHB 2H89B 2KMAA 3DBHI 4K1RB 4MJSA 2V0GA
chains in the Genus database with same CATH topology
4CHKA 1YQBA 2Z0EB 5KHOA 1WY8A 2MBQA 1VCBA 2LGYA 3TMPB 3M62B 3L54A 2GMIC 3WA0A 5DPRA 2GBMA 1WZ3A 2Y5BB 5JZEB 1WGDA 3U7DA 3PVLA 4KDIC 4ZDVA 1KOTA 1ZGUB 4GDKB 3IBEA 2CS4A 4KDLB 4MGZE 4W9EA 3PGEA 1D3ZA 3Q3JA 1JRUA 1YX6B 2NCNA 2BYEA 4GN1A 2KHWB 2MW5A 2J0MA 2KOXA 3ZRFA 3JVZX 2O6VD 1E8WA 1UELA 2DAFA 4HCNB 2CHXA 3A33B 3GZNI 3NHEB 3ZDMC 4ASWC 2RGFA 2I1JA 2O2VB 2V1YA 3P2BA 4JQWC 2V4LA 5DPTA 3WALA 4GDLA 4KSLC 4WJOA 1GG3A 2I1KA 4DHJD 3BINA 2KC2A 3V60A 1C1YB 2KFKB 1UD7A 2K8HA 4NJ7A 4DHJB 4F7ZA 1J8CA 1SE9A 2MP2A 1WGYA 3DVNU 2Z0DB 2RPQA 2KZRA 4JGHB 2KTRB 1TGZB 1RLFA 3PLUA 2NVUI 3TL5A 2DX5B 2PPHA 3KUDB 1LFDA 3A9JA 4W9FA 3A9KA 1SIFA 3JYUA 1L7YA 2GBJA 2M4NA 3I3TB 3LJ3A 4LJPB 3WAPA 2L0FA 4AWJA 4PS3A 1E8YA 2IBIB 2KDFB 1WE6A 4MM3A 3VH3B 4FJZA 2DZJA 1PQSA 3PRZA 3L0WB 3PHXB 1WFYA 3M63B 4BKGA 1L2NA 4G11A 1X1MA 3QK0A 2YVCA 3CSFA 3TCAA 3DOWA 2FIDA 3V6EB 5JHAA 1YJ1A 1P1AA 4WAAA 1WGRA 5AZGA 3MJWA 5E6NA 2REXA 4B6WA 2JZ3B 2N1VA 4PS7A 2G45B 4WJNA 3WAOA 5LXHA 3H6NA 4IWQA 2L76A 4IWPA 4DBGA 3QIJA 5D94A 1EF5A 2MBEA 3EC8A 4PS8A 4WWPA 4GGQA 2N9EB 2J7QB 3A9JB 3U8ZA 3A9KB 5DCNA 2WX0A 2K39A 2KC1A 2FUHB 3X0WA 2NBWB 5GMVA 4FA6A 4NQLB 5FR6A 2VRRB 3KUZA 2KJ6A 4GMVA 2ZVOA 3UF8A 1OQYA 4ZRKA 3W1YA 2MBHA 4HK2A 2CHWA 3WIMA 1LQBA 3L08A 2KJRA 3QWZB 2PE6B 3DVNV 4LCDE 4P7IA 4EEWA 2G4DB 2ZVNA 2PE9A 3PPAA 3VTUA 3PHWB 1WJUA 4K7WA 2J0JA 4NNJB 1GJZA 2C60A 2KKCA 3KYCD 1WM3A 4FHKA 3ML8A 4JLCA 3AI5A 3DBSA 4ANUA 3ECIA 2GOWA 2BF8B 2LGDA 3CMMB 3KYDD 4M0WB 3U30A 5CHFA 1V80A 2BWFA 3Q3FA 4GXBA 2WWZA 1NBFC 4HXDA 4E71A 1F9JA 3C0RB 4KZ0A 3ZIMA 1R4NI 3VHTC 1Q5WB 2MRPA 2NS5A 3KH0A 1K8RB 2L7RA 4MJSB 5KHQA 3IFWB 3B08A 3HHMA 4TUUA 4W9JA 3RULA 4CYEA 1I35A 4ANXA 1WR6E 3CSTA 2C9WB 1I42A 1WF9A 3NY5A 1H4RA 2KDBA 4AJYB 3L16A 2MBOA 4II2B 2FIFA 4BKSA 4MGKE 4K7SA 1M94A 4DHZB 4GB9A 4EZJA 2FAZA 5HKHA 4W9IA 1OTRB 3KW5B 2N4FA 3AU4A 4XZ4A 2LD9A 1AARA 3QARA 1WXAA 4FJYA 3M3JA 3TJPA 4PYUA 3HIZA 2KNBA 1TBEA 3H7SA 2EMTA 4A3PA 2QHOA 3QA8A 4MELA 1LXDA 3KVFB 3VAWA 1YX5B 2L00B 2BGFA 2G3QB 1R4MI 4FHJA 4BKSD 3QQ8B 5D2MB 4BBNC 2HTHA 4ZRJA 4GDLB 2L0TA 3RUIB 5CTRC 3SHQA 2MSED 2IO2B 2JPHA 2B3AA 3DQVA 4TKNA 4IM3A 4I6PA 4IW0A 2LVQA 3IG3A 3LDZE 4I6LB 4ANVA 3O65B 3ZNGC 2BYFA 4RMAA 3W1SC 3T9LA 2D2QA 2LJ5A 2MLBA 3PTFC 5L95C 2KVRA 2M1MA 2KQ7A 3QCAA 4GOCA 2IYDB 1TTNA 3B1LX 3QJZA 5D6JB 1KJTA 3DCGA 4AUQC 3N32A 3EFUA 1WXMA 4ICVA 4G3XB 4N9F4 5EDSA 3PSEB 2DHZA 4M8MA 5J18A 2AEHA 4NY0A 3S2AA 2GBRA 1WGGA 2LRUA 4X57B 5C1ZA 1WX7A 2MA9B 2RR9A 5LXIB 1WE7A 2XK5A 2KTFA 2ZPNA 4OVUA 4W9HA 3OJ4B 5CHWA 3V6CB 3L17A 2LI5A 4W9CA 3PRMB 1SGHA 4BOZB 3APCA 3JSVB 2IO0B 4KVGB 3SD5A 2NBUA 4FJVB 3VDZA 2D07B 4IC7B 3V62A 2A5UA 3VUYA 2NPTB 3VTWA 5G55A 3HM3A 1RAXA 1IP9A 2MX2A 1HE8A 3VFKA 2OOBB 1P0RA 2OJRA 2IY0B 4HPMB 1V6EA 4FLHA 1WXVA 4JIOU 5C23A 1UH6A 2IZVB 2KANA 2FCNA 4HDQA 3A4SC 4GSWA 2KD0A 1WXSA 4DDID 2KO3A 1E7VA 2KMCA 4XX5A 3RT3B 1XT9B 3AXCA 3KUCB 4B95A 3ZDTA 2KLCA 1Y8RC 3PRPB 1V86A 4M8NA 2WX1A 2BKFA 4MDKE 2KN5A 2XBBC 3MHSD 4GU2A 1CMXB 1LM8B 1ZKHA 2FCSA 4IWOA 2RSUA 3H7PA 4HJKA 1P9DU 2BYVE 1NI2A 3JSVA 1V81A 2JUOA 1V49A 3ZO5B 2BKRB 4FN2A 1E7UA 2KWVB 3VUWA 4WWOA 4NAWA 1P98A 1RFAA 2GBNA 3ZUNA 4A3OA 3ZLZA 3HM6X 1V9JA 2LXCA 2MP2B 2MWSB 2IY1B 4GDKA 4FBJB 3ZVVA 2ZPYA 1V2YA 1YD8U 2GBKA 3UGBB 1ISNA 2KXJA 1Q0WB 3A1QB 4EKUA 2JY6A 2KFJA 3TBLD 2AYOB 4G0NB 1EO6A 2C7NB 2FNJB 1UZXB 1KM7A 2DAJA 2KK8A 3T8MA 4BFRA 1WYWB 4MGIE 4PYZA 1J19A 2HD5B 2FCMA 2KDEB 3RZFA 4WWNA 3V61A 2KX0A 1WH3A 1FXTB 3ZTCA 4MSQB 4URKA 2JXXA 2Z59B 4B9KA 3ML9A 4AJWA 4E74A 4MH0E 4A20A 2UYZB 3VXWA 4IM2A 1A5RA 5BO4B 2O6VB 4RM9A 3A4RA 3OAWA 2XEWA 4NAWB 2DYOA 2N9PC 3QX1A 2FCQA 5JHBA 3VTVA 1WM2A 3ZW3A 3NZUA 1C3TA 4MGYE 2N7EA 2W9NA 2NBVB 1KLVA 2LASA 3EHVA 3OJ3A 4KZCA 1RRBA 3NZSA 1MG8A 2ZCCA 2M8SA 4TQ0A 2KQSA 3K9PB 2UWQA 3VQIA 5CX3A 2JF5A 3IVFA 1P3QU 1UBQA 2CU1A 2LVPA 3TIXA 1WJ6A 3D32A 4DXAB 2M17A 3DBLI 3H7PB 4WQOB 3ALBA 2C7MB 1IPGA 1GUAB 1S3SG 3RZWC 2AWTA 1EF1A 1QZEA 2LRWA 2HE7A 3SU8X 2JRIB 2KDIA 4YL8A 4OVVA 1GC6A 4KV2A 2D3GA 4HCPB 3BY4B 2LZ6A 4J6IA 4BBNF 1TZ1A 4HVBA 4ICUA 4WJQA 5TR5A 2EKEC 3W1SA 3QC8B 4EUTA 1WIAA 1G6JA 2CR5A 2R2OA 1E8ZA 1S1QB 2D11A 2M0XA 1WX8A 1WGHA 4HDOA 3R3MA 2JRHA 2KJHB 2IO1B 2LGXA 2ZJDA 3R7QA 1WR1A 1V5OA 3NOBA 4HWIB 3OLMD 4DK5A 3PZDA 1WRDB 2KWUB 3UQAA 4LJOB 5AZHA 2XK5B 4DDGD 1OGWA 3N3KB 4IG7B 5DPWA 3DBRI 2K8CA 3VUXA 2O6VA 3B0AA 3H9DA 3RYTA 2K6QA 2DYBA 3JW0X 3L13A 5J2RA 1WZ0A 2NPTA 2NR2A 2KFKA 2K1FA 2KWCA 2N1WA 2N9XA 3EECA 3PT2B 4TQ1A 2HJ8A 4TV3A 3X23A 3ZKJC 2L8JA 1WMHA 3DPDA 3RCZA 1Z5SB 3AULA 2ZZPB 5DPSA 4ZRIA 4AP4C 3DDCB 4GIVA 2WYQA 3PLVA 2BWES 3CF6E 4K7UA 2KX3A 1GC7A 4KIKA 1XD3B 1WX9A 2YLMA 3R66C 5LLIA 2BPSA 2CHZA 3ZNHB 5JH5C 2L3ZA 4IM0A 3ZNID 3ZTDA 2LXAA 5IAAC 1XQQA 2MBBB 2J0KA 5E6PA 2N7DA 2JT4B 4XC2A 4LDTB 3WANA 2LUEA 2G4SA 2MCNB 3M95A 3WAMA 2PJHA 1E90A 1UGMA 5D7GA 1UBIA 2ZNVB 3UINB 2K6DB 2MQJA 1YIWA 3UIOB 5L83A 3APDA 5CHVC 4II3B 1V5TA 4CO7A 1WMHB 5J17A 3SDLC 2LWPA 2IO3B 4BOSC 3IHPC 3RD2A 3DVGY 1Q1OA 3DVGX 4RM8A 1J0GA 3PREA 1U4AA 1OEYJ 1WJ4A 3A1QA 2DZIA 1WI0A 5AEKB 1BT0A 3MTNB 4BVUC 4NJ6A 2A4ZA 2JZZA 3HK0A 4W9DA 2RD0A 4DHZE 2R2QA 4JL9A 4EOYA 2PEAA 4LDTD 2DZMA 3QAQA 2ASQA 2DZKA 5G2NA 1EUVB 4ZYNA 2DYMA 4DWFA 2ZNVC 4G50A 3GOEA 4K81A 2O2VA 2ZCBA 3H1UA 4FULA 2V3SA 3QHTA 4W9LA 4W9GA 3PS6A 2AL6A 4EZKA 3APFA 1IYFA 4EZLA 4IUMB 1ZW7A 3VVWB 1OEYA 2DENB 2WDTB 2L05A 3ZRCA 3AU5A 2K25A 4MEMA 3NS8A 4AOFA 2AL3A 2JWZA 3K9OB 3ZNZB 2LVOA 3VH4B 2KTRA 4WJPA 2C5LC 4KIKB 1GNUA 3N30A 4W9KA 3ONSA 4NQKE 3ENEA 4KSKC 3R7RA 5E6OA 1NDDA 1E8XA 1Z2MA 3UQBA 2D10A 1VD2A 4F8CB 4BKTA 4FADA 5AZFA 4E3CA 4HPLB 4MSMB 2CKHB 4NPNA 2KLGA 1E5WA 2KMAA 3L10B 4EFOA 4F1SA 5IA7A 1T0YA 3DBHI 2C7HA 4ANWA 3PV1A 4HLEA 2EMSA 4K1RB 1H8CA 4I6NB 1WJNA 2K8BA 2ZEQA 2JVCA 3UIPB 4MJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHK A;  1YQB A;  2Z0E B;  5KHO A;  1WY8 A;  2MBQ A;  1VCB A;  2LGY A;  3TMP B;  3M62 B;  3L54 A;  2GMI C;  3WA0 A;  5DPR A;  2GBM A;  1WZ3 A;  2Y5B B;  5JZE B;  1WGD A;  3U7D A;  3PVL A;  4KDI C;  4ZDV A;  1KOT A;  1ZGU B;  4GDK B;  3IBE A;  2CS4 A;  4KDL B;  4MGZ E;  4W9E A;  3PGE A;  1D3Z A;  3Q3J A;  1JRU A;  1YX6 B;  2NCN A;  2BYE A;  4GN1 A;  2KHW B;  2MW5 A;  2J0M A;  2KOX A;  3ZRF A;  3JVZ X;  2O6V D;  1E8W A;  1UEL A;  2DAF A;  4HCN B;  2CHX A;  3A33 B;  3GZN I;  3NHE B;  3ZDM C;  4ASW C;  2RGF A;  2I1J A;  2O2V B;  2V1Y A;  3P2B A;  4JQW C;  2V4L A;  5DPT A;  3WAL A;  4GDL A;  4KSL C;  4WJO A;  1GG3 A;  2I1K A;  4DHJ D;  3BIN A;  2KC2 A;  3V60 A;  1C1Y B;  2KFK B;  1UD7 A;  2K8H A;  4NJ7 A;  4DHJ B;  4F7Z A;  1J8C A;  1SE9 A;  2MP2 A;  1WGY A;  3DVN U;  2Z0D B;  2RPQ A;  2KZR A;  4JGH B;  2KTR B;  1TGZ B;  1RLF A;  3PLU A;  2NVU I;  3TL5 A;  2DX5 B;  2PPH A;  3KUD B;  1LFD A;  3A9J A;  4W9F A;  3A9K A;  1SIF A;  3JYU A;  1L7Y A;  2GBJ A;  2M4N A;  3I3T B;  3LJ3 A;  4LJP B;  3WAP A;  2L0F A;  4AWJ A;  4PS3 A;  1E8Y A;  2IBI B;  2KDF B;  1WE6 A;  4MM3 A;  3VH3 B;  4FJZ A;  2DZJ A;  1PQS A;  3PRZ A;  3L0W B;  3PHX B;  1WFY A;  3M63 B;  4BKG A;  1L2N A;  4G11 A;  1X1M A;  3QK0 A;  2YVC A;  3CSF A;  3TCA A;  3DOW A;  2FID A;  3V6E B;  5JHA A;  1YJ1 A;  1P1A A;  4WAA A;  1WGR A;  5AZG A;  3MJW A;  5E6N A;  2REX A;  4B6W A;  2JZ3 B;  2N1V A;  4PS7 A;  2G45 B;  4WJN A;  3WAO A;  5LXH A;  3H6N A;  4IWQ A;  2L76 A;  4IWP A;  4DBG A;  3QIJ A;  5D94 A;  1EF5 A;  2MBE A;  3EC8 A;  4PS8 A;  4WWP A;  4GGQ A;  2N9E B;  2J7Q B;  3A9J B;  3U8Z A;  3A9K B;  5DCN A;  2WX0 A;  2K39 A;  2KC1 A;  2FUH B;  3X0W A;  2NBW B;  5GMV A;  4FA6 A;  4NQL B;  5FR6 A;  2VRR B;  3KUZ A;  2KJ6 A;  4GMV A;  2ZVO A;  3UF8 A;  1OQY A;  4ZRK A;  3W1Y A;  2MBH A;  4HK2 A;  2CHW A;  3WIM A;  1LQB A;  3L08 A;  2KJR A;  3QWZ B;  2PE6 B;  3DVN V;  4LCD E;  4P7I A;  4EEW A;  2G4D B;  2ZVN A;  2PE9 A;  3PPA A;  3VTU A;  3PHW B;  1WJU A;  4K7W A;  2J0J A;  4NNJ B;  1GJZ A;  2C60 A;  2KKC A;  3KYC D;  1WM3 A;  4FHK A;  3ML8 A;  4JLC A;  3AI5 A;  3DBS A;  4ANU A;  3ECI A;  2GOW A;  2BF8 B;  2LGD A;  3CMM B;  3KYD D;  4M0W B;  3U30 A;  5CHF A;  1V80 A;  2BWF A;  3Q3F A;  4GXB A;  2WWZ A;  1NBF C;  4HXD A;  4E71 A;  1F9J A;  3C0R B;  4KZ0 A;  3ZIM A;  1R4N I;  3VHT C;  1Q5W B;  2MRP A;  2NS5 A;  3KH0 A;  1K8R B;  2L7R A;  4MJS B;  5KHQ A;  3IFW B;  3B08 A;  3HHM A;  4TUU A;  4W9J A;  3RUL A;  4CYE A;  1I35 A;  4ANX A;  1WR6 E;  3CST A;  2C9W B;  1I42 A;  1WF9 A;  3NY5 A;  1H4R A;  2KDB A;  4AJY B;  3L16 A;  2MBO A;  4II2 B;  2FIF A;  4BKS A;  4MGK E;  4K7S A;  1M94 A;  4DHZ B;  4GB9 A;  4EZJ A;  2FAZ A;  5HKH A;  4W9I A;  1OTR B;  3KW5 B;  2N4F A;  3AU4 A;  4XZ4 A;  2LD9 A;  1AAR A;  3QAR A;  1WXA A;  4FJY A;  3M3J A;  3TJP A;  4PYU A;  3HIZ A;  2KNB A;  1TBE A;  3H7S A;  2EMT A;  4A3P A;  2QHO A;  3QA8 A;  4MEL A;  1LXD A;  3KVF B;  3VAW A;  1YX5 B;  2L00 B;  2BGF A;  2G3Q B;  1R4M I;  4FHJ A;  4BKS D;  3QQ8 B;  5D2M B;  4BBN C;  2HTH A;  4ZRJ A;  4GDL B;  2L0T A;  3RUI B;  5CTR C;  3SHQ A;  2MSE D;  2IO2 B;  2JPH A;  2B3A A;  3DQV A;  4TKN A;  4IM3 A;  4I6P A;  4IW0 A;  2LVQ A;  3IG3 A;  3LDZ E;  4I6L B;  4ANV A;  3O65 B;  3ZNG C;  2BYF A;  4RMA A;  3W1S C;  3T9L A;  2D2Q A;  2LJ5 A;  2MLB A;  3PTF C;  5L95 C;  2KVR A;  2M1M A;  2KQ7 A;  3QCA A;  4GOC A;  2IYD B;  1TTN A;  3B1L X;  3QJZ A;  5D6J B;  1KJT A;  3DCG A;  4AUQ C;  3N32 A;  3EFU A;  1WXM A;  4ICV A;  4G3X B;  4N9F 4;  5EDS A;  3PSE B;  2DHZ A;  4M8M A;  5J18 A;  2AEH A;  4NY0 A;  3S2A A;  2GBR A;  1WGG A;  2LRU A;  4X57 B;  5C1Z A;  1WX7 A;  2MA9 B;  2RR9 A;  5LXI B;  1WE7 A;  2XK5 A;  2KTF A;  2ZPN A;  4OVU A;  4W9H A;  3OJ4 B;  5CHW A;  3V6C B;  3L17 A;  2LI5 A;  4W9C A;  3PRM B;  1SGH A;  4BOZ B;  3APC A;  3JSV B;  2IO0 B;  4KVG B;  3SD5 A;  2NBU A;  4FJV B;  3VDZ A;  2D07 B;  4IC7 B;  3V62 A;  2A5U A;  3VUY A;  2NPT B;  3VTW A;  5G55 A;  3HM3 A;  1RAX A;  1IP9 A;  2MX2 A;  1HE8 A;  3VFK A;  2OOB B;  1P0R A;  2OJR A;  2IY0 B;  4HPM B;  1V6E A;  4FLH A;  1WXV A;  4JIO U;  5C23 A;  1UH6 A;  2IZV B;  2KAN A;  2FCN A;  4HDQ A;  3A4S C;  4GSW A;  2KD0 A;  1WXS A;  4DDI D;  2KO3 A;  1E7V A;  2KMC A;  4XX5 A;  3RT3 B;  1XT9 B;  3AXC A;  3KUC B;  4B95 A;  3ZDT A;  2KLC A;  1Y8R C;  3PRP B;  1V86 A;  4M8N A;  2WX1 A;  2BKF A;  4MDK E;  2KN5 A;  2XBB C;  3MHS D;  4GU2 A;  1CMX B;  1LM8 B;  1ZKH A;  2FCS A;  4IWO A;  2RSU A;  3H7P A;  4HJK A;  1P9D U;  2BYV E;  1NI2 A;  3JSV A;  1V81 A;  2JUO A;  1V49 A;  3ZO5 B;  2BKR B;  4FN2 A;  1E7U A;  2KWV B;  3VUW A;  4WWO A;  4NAW A;  1P98 A;  1RFA A;  2GBN A;  3ZUN A;  4A3O A;  3ZLZ A;  3HM6 X;  1V9J A;  2LXC A;  2MP2 B;  2MWS B;  2IY1 B;  4GDK A;  4FBJ B;  3ZVV A;  2ZPY A;  1V2Y A;  1YD8 U;  2GBK A;  3UGB B;  1ISN A;  2KXJ A;  1Q0W B;  3A1Q B;  4EKU A;  2JY6 A;  2KFJ A;  3TBL D;  2AYO B;  4G0N B;  1EO6 A;  2C7N B;  2FNJ B;  1UZX B;  1KM7 A;  2DAJ A;  2KK8 A;  3T8M A;  4BFR A;  1WYW B;  4MGI E;  4PYZ A;  1J19 A;  2HD5 B;  2FCM A;  2KDE B;  3RZF A;  4WWN A;  3V61 A;  2KX0 A;  1WH3 A;  1FXT B;  3ZTC A;  4MSQ B;  4URK A;  2JXX A;  2Z59 B;  4B9K A;  3ML9 A;  4AJW A;  4E74 A;  4MH0 E;  4A20 A;  2UYZ B;  3VXW A;  4IM2 A;  1A5R A;  5BO4 B;  2O6V B;  4RM9 A;  3A4R A;  3OAW A;  2XEW A;  4NAW B;  2DYO A;  2N9P C;  3QX1 A;  2FCQ A;  5JHB A;  3VTV A;  1WM2 A;  3ZW3 A;  3NZU A;  1C3T A;  4MGY E;  2N7E A;  2W9N A;  2NBV B;  1KLV A;  2LAS A;  3EHV A;  3OJ3 A;  4KZC A;  1RRB A;  3NZS A;  1MG8 A;  2ZCC A;  2M8S A;  4TQ0 A;  2KQS A;  3K9P B;  2UWQ A;  3VQI A;  5CX3 A;  2JF5 A;  3IVF A;  1P3Q U;  1UBQ A;  2CU1 A;  2LVP A;  3TIX A;  1WJ6 A;  3D32 A;  4DXA B;  2M17 A;  3DBL I;  3H7P B;  4WQO B;  3ALB A;  2C7M B;  1IPG A;  1GUA B;  1S3S G;  3RZW C;  2AWT A;  1EF1 A;  1QZE A;  2LRW A;  2HE7 A;  3SU8 X;  2JRI B;  2KDI A;  4YL8 A;  4OVV A;  1GC6 A;  4KV2 A;  2D3G A;  4HCP B;  3BY4 B;  2LZ6 A;  4J6I A;  4BBN F;  1TZ1 A;  4HVB A;  4ICU A;  4WJQ A;  5TR5 A;  2EKE C;  3W1S A;  3QC8 B;  4EUT A;  1WIA A;  1G6J A;  2CR5 A;  2R2O A;  1E8Z A;  1S1Q B;  2D11 A;  2M0X A;  1WX8 A;  1WGH A;  4HDO A;  3R3M A;  2JRH A;  2KJH B;  2IO1 B;  2LGX A;  2ZJD A;  3R7Q A;  1WR1 A;  1V5O A;  3NOB A;  4HWI B;  3OLM D;  4DK5 A;  3PZD A;  1WRD B;  2KWU B;  3UQA A;  4LJO B;  5AZH A;  2XK5 B;  4DDG D;  1OGW A;  3N3K B;  4IG7 B;  5DPW A;  3DBR I;  2K8C A;  3VUX A;  2O6V A;  3B0A A;  3H9D A;  3RYT A;  2K6Q A;  2DYB A;  3JW0 X;  3L13 A;  5J2R A;  1WZ0 A;  2NPT A;  2NR2 A;  2KFK A;  2K1F A;  2KWC A;  2N1W A;  2N9X A;  3EEC A;  3PT2 B;  4TQ1 A;  2HJ8 A;  4TV3 A;  3X23 A;  3ZKJ C;  2L8J A;  1WMH A;  3DPD A;  3RCZ A;  1Z5S B;  3AUL A;  2ZZP B;  5DPS A;  4ZRI A;  4AP4 C;  3DDC B;  4GIV A;  2WYQ A;  3PLV A;  2BWE S;  3CF6 E;  4K7U A;  2KX3 A;  1GC7 A;  4KIK A;  1XD3 B;  1WX9 A;  2YLM A;  3R66 C;  5LLI A;  2BPS A;  2CHZ A;  3ZNH B;  5JH5 C;  2L3Z A;  4IM0 A;  3ZNI D;  3ZTD A;  2LXA A;  5IAA C;  1XQQ A;  2MBB B;  2J0K A;  5E6P A;  2N7D A;  2JT4 B;  4XC2 A;  4LDT B;  3WAN A;  2LUE A;  2G4S A;  2MCN B;  3M95 A;  3WAM A;  2PJH A;  1E90 A;  1UGM A;  5D7G A;  1UBI A;  2ZNV B;  3UIN B;  2K6D B;  2MQJ A;  1YIW A;  3UIO B;  5L83 A;  3APD A;  5CHV C;  4II3 B;  1V5T A;  4CO7 A;  1WMH B;  5J17 A;  3SDL C;  2LWP A;  2IO3 B;  4BOS C;  3IHP C;  3RD2 A;  3DVG Y;  1Q1O A;  3DVG X;  4RM8 A;  1J0G A;  3PRE A;  1U4A A;  1OEY J;  1WJ4 A;  3A1Q A;  2DZI A;  1WI0 A;  5AEK B;  1BT0 A;  3MTN B;  4BVU C;  4NJ6 A;  2A4Z A;  2JZZ A;  3HK0 A;  4W9D A;  2RD0 A;  4DHZ E;  2R2Q A;  4JL9 A;  4EOY A;  2PEA A;  4LDT D;  2DZM A;  3QAQ A;  2ASQ A;  2DZK A;  5G2N A;  1EUV B;  4ZYN A;  2DYM A;  4DWF A;  2ZNV C;  4G50 A;  3GOE A;  4K81 A;  2O2V A;  2ZCB A;  3H1U A;  4FUL A;  2V3S A;  3QHT A;  4W9L A;  4W9G A;  3PS6 A;  2AL6 A;  4EZK A;  3APF A;  1IYF A;  4EZL A;  4IUM B;  1ZW7 A;  3VVW B;  1OEY A;  2DEN B;  2WDT B;  2L05 A;  3ZRC A;  3AU5 A;  2K25 A;  4MEM A;  3NS8 A;  4AOF A;  2AL3 A;  2JWZ A;  3K9O B;  3ZNZ B;  2LVO A;  3VH4 B;  2KTR A;  4WJP A;  2C5L C;  4KIK B;  1GNU A;  3N30 A;  4W9K A;  3ONS A;  4NQK E;  3ENE A;  4KSK C;  3R7R A;  5E6O A;  1NDD A;  1E8X A;  1Z2M A;  3UQB A;  2D10 A;  1VD2 A;  4F8C B;  4BKT A;  4FAD A;  5AZF A;  4E3C A;  4HPL B;  4MSM B;  2CKH B;  4NPN A;  2KLG A;  1E5W A;  2KMA A;  3L10 B;  4EFO A;  4F1S A;  5IA7 A;  1T0Y A;  3DBH I;  2C7H A;  4ANW A;  3PV1 A;  4HLE A;  2EMS A;  4K1R B;  1H8C A;  4I6N B;  1WJN A;  2K8B A;  2ZEQ A;  2JVC A;  3UIP B;  4MJS A; 
#chains in the Genus database with same CATH topology
 2Z0E B;  1VCB A;  4ZRP A;  3TMP B;  3M62 B;  2GMI C;  2Y5B B;  1WGD A;  3U7D A;  3PVL A;  4KDI C;  2WXN A;  4MGZ E;  3PGE A;  1D3Z A;  4GLS C;  4S17 A;  4OVZ A;  3Q8F A;  3U52 E;  1ZPS A;  3A33 B;  3GZN I;  3NHE B;  4RF0 A;  4ASW C;  4TSS A;  4JQW C;  3WAL A;  4KSL C;  4WJO A;  2KMM A;  1ACC A;  2KC2 A;  1C1Y B;  3N1X C;  4DHJ B;  5C3J B;  2MP2 A;  2RPQ A;  4JGH B;  3BYY B;  1AWD A;  3H8H A;  3TL5 A;  2PPH A;  2V9H A;  1SIF A;  3I3T B;  3LJ3 A;  1PGB A;  3WAP A;  2YEP F;  2L0F A;  4YTM B;  1MI0 A;  2AQ3 B;  1N63 A;  2DZJ A;  1PQS A;  2ONQ A;  3L0W B;  3M63 B;  3AH7 A;  3RNE C;  3PZ8 A;  2JWU A;  3QK0 A;  2INP E;  2WXH A;  2JZ3 B;  2G45 B;  3H6N A;  1P7F A;  4DXF A;  1UWX A;  2J52 A;  1L5P A;  1SE3 A;  2MBE A;  3A9J B;  3A9K B;  3DBR B;  1OQQ A;  3X0W A;  3I5J C;  5C2T B;  3AE2 B;  3NRZ A;  4GMV A;  3TEZ A;  1T3Q A;  2CHW A;  3WIM A;  1TKG A;  2B76 B;  2PMV A;  3QWZ B;  2PE6 B;  4LCD E;  2WP9 B;  1JWA D;  1SB3 C;  4EEW A;  3VTU A;  1WJU A;  4NNJ B;  2C60 A;  1ET6 A;  4HRS A;  2K22 A;  3BII D;  5FK9 C;  4IDI A;  3AI5 A;  5BYS A;  5HI1 A;  4M0W B;  2LGD A;  3CMM B;  3KYD D;  5CHF A;  1NBF C;  1GAQ B;  4HXD A;  1F9J A;  4KZ0 A;  3ZIM A;  4JE3 B;  1K52 A;  2NS5 A;  3Q8C A;  1YOV B;  2WXJ A;  3RUL A;  3NY5 A;  1M94 A;  2FAZ A;  5EE0 A;  3QAR A;  1QOB A;  4FJY A;  2QHO A;  3VAW A;  5HHD G;  4P1C C;  3DWG C;  1ET9 A;  2BGF A;  1R4M I;  4FHJ A;  4BKS D;  1RWS A;  2JQR B;  4LNK A;  5GXG B;  2QIE B;  3RUI B;  2JPH A;  2B3A A;  3NVY A;  1F0Z A;  3IG3 A;  3LDZ E;  3O65 B;  3DBL B;  3T9L A;  3P1M A;  2IYD B;  2GRI A;  4ICV A;  5J18 A;  2FUG 1;  1FNV A;  1LO5 D;  3ABV B;  5E6J A;  1KRH A;  2ZW0 A;  4W9C A;  3PRM B;  1MFW A;  3SD5 A;  2NBU A;  4IC7 B;  3V62 A;  4HEA 1;  5G55 A;  1RAX A;  1T0R C;  2OJR A;  2IY0 B;  5G5H A;  1V6E A;  1AW7 A;  1C4C A;  2IZV B;  1XLQ A;  3Q14 C;  3IAS 1;  1C78 A;  4DDI D;  1MPE A;  1E9M A;  2QJL A;  4B95 A;  1GB1 A;  1FFU A;  2XBB C;  4FXC A;  1ZKH A;  2VH2 A;  2RSU A;  5IO9 A;  1KTK A;  1J7A A;  4FN2 A;  1E7U A;  3VUW A;  1RFA A;  2GBN A;  2W3S A;  3ZLZ A;  2MWS B;  2IY1 B;  2PW9 A;  2N7J A;  2ZPY A;  2K0P A;  2GBK A;  1ZP0 B;  3O13 A;  3TBL D;  1EO6 A;  2FNJ B;  1UZX B;  1KM7 A;  3T8M A;  2CU3 A;  4WWN A;  4MSQ B;  4MM3 B;  2Z59 B;  4E74 A;  4OZC A;  4MH0 E;  1YN4 A;  1SXT A;  1A5R A;  2PVG C;  3A4R A;  3OAW A;  2N9P C;  1B1Z A;  2FCQ A;  2XNA C;  2LAS A;  3EHV A;  3OJ3 A;  1JQ4 A;  5FKA C;  3R2I A;  3VQI A;  5CX3 A;  5JXV A;  1UBQ A;  2CU1 A;  1XXG A;  3H7P B;  4WQO B;  3ALB A;  2C7M B;  3FAH A;  1IPG A;  1QZE A;  2INN E;  2JYE A;  2LZ6 A;  2W3R A;  5TR5 A;  2Q5W D;  4EUT A;  1WIA A;  2CR5 A;  3VRA B;  1JWU D;  1V5O A;  1J7C A;  1L6V A;  2K9X A;  2MHJ A;  1WRD B;  2KWU B;  2Y5P A;  3GE3 C;  1IBX A;  2XK5 B;  3ZYY X;  3KQ4 A;  3MC0 B;  3N3K B;  3DBR I;  2K8C A;  2O6V A;  5J2R A;  2KFK A;  4TQ1 A;  3PT2 B;  1R7S A;  4WIP A;  2N9X A;  2HJ8 A;  2LHE A;  2G9H D;  3X23 A;  2L8J A;  3RCZ A;  3AUL A;  5DPS A;  4ZRI A;  4N59 A;  3DDC B;  4GIV A;  1L4Z B;  1QOF A;  4XE0 A;  5HG2 A;  2GB1 A;  2Y5C A;  5IOI A;  3PLV A;  2BWE S;  3FKY A;  2KX3 A;  1GC7 A;  1WX9 A;  2CHZ A;  4IM0 A;  2WXO A;  2QEJ C;  1FNW A;  4LDT B;  3TEX A;  2ACZ B;  3M95 A;  3WAM A;  2PJH A;  3B9J A;  5D7G A;  1UBI A;  1QIL A;  1HZ6 A;  2K5P A;  3SDL C;  3RD2 A;  3DVG Y;  1Q1O A;  3PRE A;  2DZI A;  2WS3 B;  2MJD A;  3MTN B;  2A4Z A;  3P4Q B;  1MG4 A;  2RD0 A;  2R2Q A;  4EOY A;  2PEA A;  1C4P A;  2ASQ A;  1E6E B;  1EUV B;  4N58 A;  4US9 A;  4NJC A;  2J42 A;  4ZYN A;  4MH8 A;  3RPF C;  3P42 A;  2O2V A;  4FUL A;  1N61 A;  2V3S A;  1FFV A;  2BS2 B;  2QCZ A;  2AQ2 B;  3AEA B;  4RGM A;  1MJD A;  3NS8 A;  5BMG A;  3MC8 A;  3AEC B;  4DXG A;  3IAM 1;  2KTR A;  4WJP A;  1XLP A;  3P4S B;  1GNU A;  3N30 A;  3ONS A;  3ENE A;  1TT5 B;  3R2T A;  4E3C A;  1V1O A;  1E5W A;  4F1S A;  5IA7 A;  1T0Y A;  3BWU D;  4HLE A;  5JHB A;  1WY8 A;  2OJW A;  3L54 A;  2MJ3 A;  3WA0 A;  3SFD B;  1WZ3 A;  1KOT A;  2BB6 A;  4JWS C;  1ZGU B;  5TSS A;  1LGR A;  3IBE A;  2CS4 A;  4KDL B;  5H92 C;  3VR8 B;  4L23 A;  1VRA B;  2KHW B;  3ZRF A;  1E8W A;  1UEL A;  2DAF A;  1T6B X;  3ZDM C;  1NEN B;  4B0M A;  1SE4 A;  2RGF A;  3RNA C;  5DPT A;  4GDL A;  2BTE A;  4XDD A;  1D4B A;  2WXQ A;  4AQ7 A;  1UD7 A;  4F7Z A;  1UWM A;  1TKY A;  2K3U A;  2IGG A;  3BVG A;  3P63 A;  2Z0D B;  2KZR A;  4HPP A;  1ENF A;  2N9L A;  2DX5 B;  4LK0 M;  3KUD B;  1LFD A;  1L7Y A;  3OWE B;  1C79 A;  1WXQ A;  3AEE B;  4AWJ A;  2BS3 B;  1KLU D;  4PS3 A;  1STE A;  2KDF B;  1WE6 A;  3VH3 B;  4ITK A;  4KGT A;  4BKG A;  3I57 A;  1L2N A;  1X1M A;  3RNG C;  2YVC A;  3CSF A;  5JHA A;  4WAA A;  2REX A;  4B6W A;  2LHD A;  4IKG A;  3WAO A;  1AN8 A;  5D94 A;  4GGQ A;  2N9E B;  2BBC A;  2J7Q B;  4C80 A;  2WX0 A;  2WNM A;  4P1B C;  2VH1 A;  2K39 A;  4ZHP A;  1WYG A;  5BYQ A;  4FA6 A;  4NQL B;  5FR6 A;  2VRR B;  3KUZ A;  1WRI A;  2KJ6 A;  4ZRK A;  1LQB A;  1L0V B;  2X38 A;  3L08 A;  3CIR B;  1PGA A;  2ZVN A;  5H8Y E;  2PE9 A;  3PPA A;  1FIQ A;  2J0J A;  2KKC A;  2PTL A;  1WM3 A;  2WXR A;  3AMZ A;  3ML8 A;  2IDY A;  2MH7 A;  4ANU A;  3Q3O C;  3AED B;  1V80 A;  3BVM A;  1TS4 A;  1TYG B;  2WXG A;  3C0R B;  2V4I B;  1Y56 A;  3B08 A;  1WR6 E;  3CST A;  2C9W B;  1I42 A;  2FIF A;  4BKS A;  4AS1 A;  1DYQ A;  4DHZ B;  4EZJ A;  3AU4 A;  4XZ4 A;  2LD9 A;  1AAR A;  1WXA A;  3P4R B;  3AN1 A;  1ZDV A;  3HIZ A;  1TBE A;  3H7S A;  2EMT A;  1VJK A;  4A3P A;  1LXD A;  1Q10 A;  2L00 B;  2RDB C;  2EKI A;  5D2M B;  2MJE A;  4ZRJ A;  2L0T A;  2WXI A;  1EU4 A;  3DQV A;  4TKN A;  4K3C A;  2BYF A;  3W1S C;  2WHI A;  2D2Q A;  2LJ5 A;  4L1B A;  3QCA A;  1I4G A;  4OHJ A;  3DCG A;  2D3C A;  4AUQ C;  3N32 A;  1YNT E;  4G3X B;  5BMH A;  4XWW A;  2DHZ A;  1I4P A;  2GBR A;  4PK1 A;  5C1Z A;  2MA9 B;  3LXF A;  2BVC A;  2ZPN A;  4OVU A;  1SGH A;  4FJV B;  1HZ5 A;  4A6Q A;  4HJG E;  2NPT B;  3VTW A;  1V8C A;  2WU5 B;  3VFK A;  2OOB B;  4HPM B;  1FD6 A;  1PDX A;  5C23 A;  1UH6 A;  1XCQ L;  2D5G A;  2KD0 A;  1WXS A;  2WGS A;  2KMC A;  1YMH E;  3Q8B A;  3DBH B;  4M8N A;  1V86 A;  3GB1 A;  2WX1 A;  2BKF A;  2KN5 A;  2ICI A;  1CMX B;  2FCS A;  4ACF A;  1NI2 A;  3JSV A;  1V81 A;  2KWD A;  3ZO5 B;  4O1N A;  1GPX A;  4A3O A;  1HA5 A;  4GDK A;  2IPK D;  3U7Z A;  1YD8 U;  1R4N B;  2KN4 A;  1JWS D;  1ISN A;  1E10 A;  3A1Q B;  4EKU A;  2JY6 A;  4Q2J A;  3AE3 B;  3R8B A;  2DAJ A;  1WYW B;  3IXS A;  1J19 A;  2HD5 B;  1K51 A;  2FCM A;  2KDE B;  3RZF A;  1FXT B;  1CK1 A;  4URK A;  2JXX A;  4AJW A;  2UYZ B;  3B2F A;  2O6V B;  2WXL A;  1N6Z A;  2Z8L A;  2GI9 A;  1ZUD 2;  1WM2 A;  4ARI A;  4HRO A;  1UNS A;  4MGY E;  2N7E A;  2W9N A;  2KQS A;  3K9P B;  3DHH C;  1L0X B;  3C19 A;  4IOI E;  1I7H A;  1WJ6 A;  1FNU A;  3D32 A;  4YTP B;  4DXA B;  3ZJT A;  2OED A;  1GUA B;  1BUI C;  2AWT A;  1EF1 A;  4RGN A;  2HE7 A;  3SU8 X;  1R4M B;  1HXY D;  3AEB B;  1D5M C;  4OVV A;  4YL8 A;  4KV2 A;  3BY4 B;  4BBN F;  2EKE C;  1G6J A;  1I4Q A;  4ZOH C;  2D11 A;  2M0X A;  2ON8 A;  3R3M A;  2JRH A;  2IO1 B;  2LGX A;  2M56 B;  4BAX A;  3R7Q A;  3AE5 B;  5BYR A;  4DK5 A;  1DOI A;  2SEB D;  4ZYS A;  5DPW A;  1L6U A;  3HUI A;  3VUX A;  4A8X C;  1CQV A;  1CZP A;  3RYT A;  1JRP A;  3JW0 X;  3QJZ A;  1WZ0 A;  2N1W A;  4TV3 A;  3ZKJ C;  1KLG D;  2MEK A;  5IP4 D;  3CF6 E;  2W55 A;  2JZP A;  5LLI A;  2L3Z A;  1TY0 A;  1XF5 L;  3ZTD A;  2LUM A;  2MBB B;  5E6P A;  3WAN A;  2MCN B;  1E90 A;  1EU3 A;  4BZA A;  2ZNV B;  3UIN B;  1YIW A;  3APD A;  2XN9 C;  4II3 B;  1V5T A;  5J17 A;  1FXA A;  4KKJ A;  1IGD A;  1J0G A;  1OEY J;  3AE4 B;  1WI0 A;  3MP9 A;  1N5W A;  4JL9 A;  2DZM A;  1XCT L;  5G2N A;  3MC9 A;  2ZNV C;  4G50 A;  3GOE A;  3H1U A;  4W9G A;  2ZW1 A;  2AL6 A;  4EZK A;  2LGI A;  1IYF A;  1OEY A;  3ZRC A;  2WDT B;  4MEM A;  2AL3 A;  3VH4 B;  4QAY A;  5I4D A;  4W9K A;  2NTT A;  4NQK E;  1Z2M A;  1VD2 A;  4FAD A;  3TSS A;  4MSM B;  5FR3 A;  4M01 A;  1NYR A;  1SJE D;  4EFO A;  2C7H A;  1H8C A;  4I6N B;  2ZEQ A;  3LB8 C;  3UIP B;  2LMC A;  4MT5 A;  1I4X A;  4CHK A;  5EE3 A;  2MBQ A;  1AYF A;  3AV8 A;  5JZE B;  1VZ6 A;  3N20 C;  3I9V 1;  4ZDV A;  1UGJ A;  4UDU C;  3Q3J A;  1YX6 B;  1F2R C;  1YQ4 B;  1YN5 A;  2O6V D;  2KVZ A;  1MVK A;  4HCN B;  5AUK A;  1N5X A;  1PYW D;  3NVV A;  2I1J A;  2O2V B;  4XWT A;  2DNF A;  2V4L A;  1L4D B;  1GG3 A;  2I1K A;  4DHJ D;  4RFB A;  2KFK B;  1J8C A;  2K8H A;  4NJ7 A;  1SE9 A;  1UF0 A;  3DVN U;  4ARC A;  3LYY A;  2KTR B;  1TGZ B;  2CJO A;  1RLF A;  3PLU A;  3HRD D;  3A9J A;  1KH0 A;  3A9K A;  3BVZ A;  3T3N A;  2KAC A;  3JYU A;  2GBJ A;  1HTO A;  2FE8 A;  1JML A;  1HQR D;  5EE9 A;  3AE6 B;  1E8Y A;  1QF6 A;  2IBI B;  1VDV A;  4FJZ A;  3NJT A;  2AQ1 B;  3EFC A;  4C7Z A;  1WFY A;  1DOY A;  1SSN A;  4K3B A;  4A9A A;  3E56 A;  1A70 A;  2HTM E;  4LTU A;  3MJW A;  4ZHO A;  4NAM A;  2N1V A;  2WXK A;  4WJN A;  1I4H A;  1TJE A;  3N9Y C;  3QIJ A;  1EF5 A;  3SFE B;  3EC8 A;  4PS8 A;  4WWP A;  2KYW A;  4M0W A;  3U8Z A;  5DCN A;  2KC1 A;  2NBW B;  2BW2 A;  3DHI C;  2PVO D;  4YXD B;  2MBH A;  4HK2 A;  3ZXR A;  2E6X A;  2IGH A;  2KJR A;  3DVN V;  2TSS A;  2G4D B;  3DWM A;  2QC8 A;  3PHW B;  4K7W A;  1EWY C;  3KYC D;  4FHK A;  1V1P A;  1TIF A;  4JLC A;  3DBS A;  1QQR A;  1OQR A;  3I63 C;  4KGR A;  2BWF A;  3Q3F A;  4GXB A;  2WWZ A;  1T5X D;  1NEK B;  3AE8 B;  4US8 A;  2N0S B;  3Q8A A;  1K8R B;  1ZE3 D;  3TEY A;  3IFW B;  4CYE A;  4W9J A;  1I35 A;  4ANX A;  1WF9 A;  1H4R A;  4AJY B;  4K7S A;  5HKH A;  4RCO A;  1C77 A;  3KW5 B;  2G1E A;  3AE1 B;  4PYU A;  2LJI A;  2KNB A;  2H88 B;  2QSD A;  4MEL A;  3VRB B;  1ZDX A;  2PKO A;  4BBN C;  4KX6 B;  2HTH A;  4GDL B;  1IGC A;  5CTR C;  3SHQ A;  2IO2 B;  3Q3N C;  4IM3 A;  4I6P A;  2LVQ A;  2RDH A;  3ZNG C;  5HFY A;  4WQM A;  2MLB A;  5L95 C;  2KVR A;  2KQ7 A;  1TTN A;  5D6J B;  3N1Y C;  2BQQ A;  4N9F 4;  4M02 A;  1J7B A;  3RNF C;  4M8M A;  2AEH A;  4NY0 A;  1WGG A;  5LXI B;  4USA A;  3OJ4 B;  3L17 A;  4KVG B;  2IO0 B;  3URY A;  2D07 B;  1ZXI A;  3VUY A;  3HM3 A;  1IP9 A;  1HE8 A;  2JXT A;  1QOG A;  4JIO U;  2KAN A;  3N1Z C;  2FCN A;  4HDQ A;  3TUO A;  4GSW A;  2OHF A;  2RMM A;  3EA6 A;  3W2D A;  1XT9 B;  3KUC B;  3ZDT A;  2V3P A;  3RN9 C;  1FXI A;  4WAF A;  2D3B A;  1JWB D;  2I38 A;  4HJK A;  1P9D U;  1TS2 A;  2BYV E;  2JUO A;  1D6E C;  1FCC C;  1V49 A;  2BKR B;  2LGS A;  1HTQ A;  1P98 A;  1V9J A;  4FBJ B;  5D3I B;  3IT4 B;  1V2Y A;  2KXJ A;  4JX1 C;  3Q2A C;  1Q0W B;  2AYO B;  4G0N B;  3AM9 A;  3ZJV A;  2C7N B;  3ETR A;  1F77 A;  4MGI E;  4PYZ A;  4R3D A;  3V61 A;  3FC4 A;  3ZTC A;  2SAK A;  2Y3A A;  3C8Y A;  1L0Y B;  5BO4 B;  4XGA B;  4RM9 A;  4MAC A;  2DBY A;  2VZK D;  3QX1 A;  1BXT A;  3U4E G;  1ROE A;  1P7E A;  3FIL B;  3NZU A;  3ZW3 A;  1C3T A;  3GP7 A;  2NBV B;  4KZC A;  1NVI D;  3NZS A;  2M8S A;  4TQ0 A;  1E0Z A;  2UWQ A;  3IVF A;  1P3Q U;  1XO3 A;  2LVP A;  1F52 A;  4C00 A;  2QMT A;  3SR6 A;  2M17 A;  3DBL I;  3RZW C;  4YSZ B;  2LRW A;  2KQ4 X;  2JRI B;  4RH6 A;  1GC6 A;  1QOA A;  2CJN A;  3AEF B;  2D3G A;  4HVB A;  1SF0 A;  4ICU A;  4WJQ A;  3W1S A;  1E8Z A;  1S1Q B;  4ZRQ A;  2WXF A;  2KJH B;  3HVZ A;  2ZJD A;  1WR1 A;  3NOB A;  1FRD A;  2RPV A;  3OLM D;  1QKZ A;  1RM6 C;  4WH4 A;  1TS3 A;  3UQA A;  1OGW A;  1ZXH A;  4IG7 B;  2DLB A;  1EWC A;  3J9C A;  2K6Q A;  2DYB A;  1SE2 A;  2NPT A;  3EEC A;  1YQ3 B;  2KWC A;  3AEG B;  2LEK A;  3KLS X;  5EE1 A;  1WMH A;  1Z5S B;  4XDC A;  2J4X A;  4AP4 C;  2I2Y A;  1EM7 A;  2W82 A;  4YTN B;  4KIK A;  1XD3 B;  2YLM A;  2BPS A;  3ZXV A;  2L52 A;  3ZNI D;  1XQQ A;  4RF1 A;  2N7D A;  2JT4 B;  4XC2 A;  3BK2 A;  3PZ7 A;  2LUE A;  4OZB A;  1F1H A;  1UGM A;  3VR9 B;  2BT6 A;  2K6D B;  3UIO B;  1FEH A;  4CO7 A;  1WMH B;  2LWP A;  2IO3 B;  4BOS C;  2IJ0 A;  3IHP C;  1B9R A;  4RM8 A;  1U4A A;  3A1Q A;  5AEK B;  1XLO A;  4NJ6 A;  2JZZ A;  4W9D A;  2FBW B;  3Q69 A;  4LDT D;  3TEW A;  2DZK A;  1SEB D;  4DWF A;  1XLN A;  2ZCB A;  3QHT A;  1FM0 D;  3PS6 A;  3APF A;  4IUM B;  1ZW7 A;  3VVW B;  3EGR A;  2DEN B;  2L05 A;  3DHG C;  2K25 A;  3ZNZ B;  2LVO A;  1YJI A;  1OFF A;  3W5V B;  2L1A A;  2D3A A;  2W54 A;  3U2S C;  3RNB C;  2L83 A;  5E6O A;  1NDD A;  1E8X A;  3UQB A;  2D10 A;  4F8C B;  1VZ7 A;  4EE2 A;  5AZF A;  4HPL B;  4NPN A;  1VZ8 A;  2KLG A;  3L10 B;  2V3N A;  4ANW A;  3PV1 A;  2EMS A;  3KWL A;  1WJN A;  2K8B A;  1UUP A;  2JVC A;  1YQB A;  5KHO A;  2EEL A;  2LGY A;  3EUB 2;  5DPR A;  2GBM A;  4KGS A;  4RGT A;  4GDK B;  4W9E A;  3BK1 A;  1JRU A;  2NCN A;  2BYE A;  4GN1 A;  2MW5 A;  2J0M A;  2KOX A;  3JVZ X;  1JCK B;  2CHX A;  3E9S A;  4C4V A;  4OW0 A;  3GS2 A;  4HKQ A;  2V1Y A;  3P2B A;  1C4A A;  3BIN A;  3V60 A;  2WDR B;  4L2Y A;  2M19 A;  1WGY A;  1RFK A;  1HEZ E;  2NVU I;  1V1P B;  1T0S C;  4W9F A;  4REZ A;  1NYQ A;  2M4N A;  4B0E A;  3RMK C;  4LJP B;  5LNK 1;  4C4V B;  1SBB B;  4MM3 A;  5BMI A;  2RDG A;  3PRZ A;  3PHX B;  4KKI A;  4G11 A;  1BML C;  3TCA A;  3DOW A;  2FID A;  3V6E B;  2JX5 A;  2QIL A;  1YJ1 A;  1P1A A;  2HJ1 A;  1WGR A;  5AZG A;  5E6N A;  2NTS A;  1N60 A;  4PS7 A;  5LXH A;  2DWQ A;  4IWQ A;  1JAL A;  2L76 A;  4IWP A;  2PIA A;  4DBG A;  1KFY B;  1VR9 A;  2IND C;  2KAJ A;  2FUH B;  4RNA A;  4DQO C;  5GMV A;  3AE7 B;  4P16 A;  1SJH D;  3UF8 A;  2ZVO A;  1OQY A;  4P6V F;  3W1Y A;  3MFG A;  2JU6 X;  4P7I A;  4YSX B;  1I4R A;  2BYT A;  1GJZ A;  4JWU C;  1N62 A;  1FMA D;  2HDE A;  3Q6B A;  2PLP A;  1QLB B;  3ECI A;  1PUT A;  2BF8 B;  2GOW A;  3U30 A;  4WWM A;  4CQN A;  1JWM D;  4E71 A;  2JYT A;  4OZA A;  1R4N I;  1ESF A;  3VHT C;  1Q5W B;  3NG0 A;  2MRP A;  3BZD B;  3KH0 A;  1T0Q C;  2L7R A;  4MJS B;  5KHQ A;  1PGX A;  3HHM A;  4TUU A;  2IGD A;  1F2R I;  2KDB A;  4LNF A;  3L16 A;  3P4P B;  4LNO A;  2MBO A;  4II2 B;  4MGK E;  4GB9 A;  4W9I A;  4PT5 A;  1OTR B;  2N4F A;  3IT6 B;  2X8X X;  3M3J A;  3TJP A;  1M4V A;  4YT0 B;  4HKZ E;  4LNN A;  3ZGZ A;  3RNC C;  1KF6 B;  3QA8 A;  3KVF B;  3Q3M C;  1YX5 B;  5D3D A;  1WGK A;  1NI3 A;  2G3Q B;  3QQ8 B;  3Q8E A;  1IUE A;  1JRO A;  2WDV B;  2MSE D;  3NVZ A;  3RI7 C;  4IW0 A;  3T3O A;  4I6L B;  4ANV A;  4RMA A;  1C76 A;  3PTF C;  2M1M A;  4LLG M;  4GOC A;  3B1L X;  1KJT A;  3EFU A;  1WXM A;  1MHX A;  4N6E B;  5EDS A;  1DOX A;  3PSE B;  3S2A A;  3W9C B;  2WQY B;  2LRU A;  4X57 B;  1FRR A;  1WX7 A;  2RR9 A;  4TMA B;  1WE7 A;  2KDM A;  2XK5 A;  2KTF A;  4W9H A;  5CHW A;  3V6C B;  2LI5 A;  4JPS A;  2WDQ B;  3SEB A;  3APC A;  3JSV B;  4BOZ B;  3VDZ A;  2A5U A;  4YSY B;  2MX2 A;  2N9K A;  1P0R A;  4FLH A;  1WXV A;  1D5X C;  2L32 A;  2LFI A;  4J3O D;  3A4S C;  1TZO A;  2WU2 B;  3RFZ B;  3CWI A;  2KO3 A;  1E7V A;  4XX5 A;  3RT3 B;  3AXC A;  3HVD A;  1C9F A;  2KLC A;  1Y8R C;  3PRP B;  1ZOY B;  4MDK E;  4GU2 A;  3MHS D;  4IWO A;  1LM8 B;  2JSV X;  3GE8 C;  3H7P A;  1GOZ A;  2VZK B;  4D2K A;  2KWV B;  5IN7 A;  3AB5 A;  4WWO A;  4NAW A;  3ZUN A;  3HM6 X;  2LXC A;  2MP2 B;  3L4P A;  1YN3 A;  4M00 A;  3KWV A;  4XYC A;  3ZVV A;  1E7P B;  3UGB B;  2KFJ A;  3NVW A;  2KK8 A;  4BFR A;  1TKE A;  2J53 A;  1K50 A;  2KX0 A;  1WH3 A;  5T8I A;  4B9K A;  3ML9 A;  1IBX B;  3NS1 A;  4A20 A;  3VXW A;  4IM2 A;  3V05 A;  1MHH E;  2XEW A;  4NAW B;  2DYO A;  3NUH B;  3VTV A;  4H2A A;  1KLV A;  1RRB A;  1FPY A;  1MG8 A;  2ZCC A;  2KT7 A;  2JF5 A;  1TY2 A;  3TIX A;  1D5Z C;  2AX5 A;  1S3S G;  2BS4 B;  1FCL A;  2KDI A;  4HCP B;  4J6I A;  1TZ1 A;  4C56 C;  1CJE A;  4A55 A;  3QC8 B;  2R2O A;  5IKC M;  1WX8 A;  1WGH A;  4HDO A;  1JW9 D;  3MJ5 A;  1WSP A;  3B2G A;  3MHZ A;  3ZQ4 A;  4HWI B;  3PZD A;  4LJO B;  5AZH A;  1V97 A;  4DDG D;  4WUR A;  5MPO A;  3B0A A;  3H9D A;  3L13 A;  5L83 A;  2NR2 A;  1PFD A;  2K1F A;  3ZJU A;  5G5G A;  3WCQ A;  3DPD A;  2ZZP B;  3FIL A;  1SIJ A;  2WYQ A;  2WLB A;  2GLS A;  2R61 A;  4K7U A;  4A90 A;  3AE9 B;  1VLB A;  3R66 C;  3ZNH B;  5JH5 C;  3W5U B;  2LXA A;  2UU7 A;  2WXP A;  4NZL B;  5IAA C;  3GZN B;  2J0K A;  3NZ3 A;  2BB5 A;  2G4S A;  2M0A A;  2WXM A;  3UI3 A;  1QT9 A;  5AUI A;  2MQJ A;  1RYJ A;  3BYT B;  1DGJ A;  5CHV C;  1XEE A;  4RGO S;  2INC C;  3DVG X;  2YEP B;  1YJJ A;  4S0R A;  1WJ4 A;  1BT0 A;  4BVU C;  3HK0 A;  1TS5 A;  2NMQ A;  3V3X A;  4DHZ E;  3OG5 A;  1K53 A;  3QAQ A;  4YWG G;  2DYM A;  4K81 A;  4W9L A;  4C7Y A;  4EZL A;  3AU5 A;  4AOF A;  3K9O B;  2JWZ A;  4LNI A;  1WWT A;  2C5L C;  3PO0 A;  4KIK B;  1GB4 A;  2E3T A;  4KSK C;  3R7R A;  2QDF A;  4BKT A;  1FO4 A;  2CKH B;  2H89 B;  2KMA A;  3DBH I;  4K1R B;  4MJS A;  2V0G A; 
#chains in the Genus database with same CATH homology
 4CHK A;  1YQB A;  2Z0E B;  5KHO A;  1WY8 A;  2MBQ A;  1VCB A;  2LGY A;  3TMP B;  3M62 B;  3L54 A;  2GMI C;  3WA0 A;  5DPR A;  2GBM A;  1WZ3 A;  2Y5B B;  5JZE B;  1WGD A;  3U7D A;  3PVL A;  4KDI C;  4ZDV A;  1KOT A;  1ZGU B;  4GDK B;  3IBE A;  2CS4 A;  4KDL B;  4MGZ E;  4W9E A;  3PGE A;  1D3Z A;  3Q3J A;  1JRU A;  1YX6 B;  2NCN A;  2BYE A;  4GN1 A;  2KHW B;  2MW5 A;  2J0M A;  2KOX A;  3ZRF A;  3JVZ X;  2O6V D;  1E8W A;  1UEL A;  2DAF A;  4HCN B;  2CHX A;  3A33 B;  3GZN I;  3NHE B;  3ZDM C;  4ASW C;  2RGF A;  2I1J A;  2O2V B;  2V1Y A;  3P2B A;  4JQW C;  2V4L A;  5DPT A;  3WAL A;  4GDL A;  4KSL C;  4WJO A;  1GG3 A;  2I1K A;  4DHJ D;  3BIN A;  2KC2 A;  3V60 A;  1C1Y B;  2KFK B;  1UD7 A;  2K8H A;  4NJ7 A;  4DHJ B;  4F7Z A;  1J8C A;  1SE9 A;  2MP2 A;  1WGY A;  3DVN U;  2Z0D B;  2RPQ A;  2KZR A;  4JGH B;  2KTR B;  1TGZ B;  1RLF A;  3PLU A;  2NVU I;  3TL5 A;  2DX5 B;  2PPH A;  3KUD B;  1LFD A;  3A9J A;  4W9F A;  3A9K A;  1SIF A;  3JYU A;  1L7Y A;  2GBJ A;  2M4N A;  3I3T B;  3LJ3 A;  4LJP B;  3WAP A;  2L0F A;  4AWJ A;  4PS3 A;  1E8Y A;  2IBI B;  2KDF B;  1WE6 A;  4MM3 A;  3VH3 B;  4FJZ A;  2DZJ A;  1PQS A;  3PRZ A;  3L0W B;  3PHX B;  1WFY A;  3M63 B;  4BKG A;  1L2N A;  4G11 A;  1X1M A;  3QK0 A;  2YVC A;  3CSF A;  3TCA A;  3DOW A;  2FID A;  3V6E B;  5JHA A;  1YJ1 A;  1P1A A;  4WAA A;  1WGR A;  5AZG A;  3MJW A;  5E6N A;  2REX A;  4B6W A;  2JZ3 B;  2N1V A;  4PS7 A;  2G45 B;  4WJN A;  3WAO A;  5LXH A;  3H6N A;  4IWQ A;  2L76 A;  4IWP A;  4DBG A;  3QIJ A;  5D94 A;  1EF5 A;  2MBE A;  3EC8 A;  4PS8 A;  4WWP A;  4GGQ A;  2N9E B;  2J7Q B;  3A9J B;  3U8Z A;  3A9K B;  5DCN A;  2WX0 A;  2K39 A;  2KC1 A;  2FUH B;  3X0W A;  2NBW B;  5GMV A;  4FA6 A;  4NQL B;  5FR6 A;  2VRR B;  3KUZ A;  2KJ6 A;  4GMV A;  2ZVO A;  3UF8 A;  1OQY A;  4ZRK A;  3W1Y A;  2MBH A;  4HK2 A;  2CHW A;  3WIM A;  1LQB A;  3L08 A;  2KJR A;  3QWZ B;  2PE6 B;  3DVN V;  4LCD E;  4P7I A;  4EEW A;  2G4D B;  2ZVN A;  2PE9 A;  3PPA A;  3VTU A;  3PHW B;  1WJU A;  4K7W A;  2J0J A;  4NNJ B;  1GJZ A;  2C60 A;  2KKC A;  3KYC D;  1WM3 A;  4FHK A;  3ML8 A;  4JLC A;  3AI5 A;  3DBS A;  4ANU A;  3ECI A;  2GOW A;  2BF8 B;  2LGD A;  3CMM B;  3KYD D;  4M0W B;  3U30 A;  5CHF A;  1V80 A;  2BWF A;  3Q3F A;  4GXB A;  2WWZ A;  1NBF C;  4HXD A;  4E71 A;  1F9J A;  3C0R B;  4KZ0 A;  3ZIM A;  1R4N I;  3VHT C;  1Q5W B;  2MRP A;  2NS5 A;  3KH0 A;  1K8R B;  2L7R A;  4MJS B;  5KHQ A;  3IFW B;  3B08 A;  3HHM A;  4TUU A;  4W9J A;  3RUL A;  4CYE A;  1I35 A;  4ANX A;  1WR6 E;  3CST A;  2C9W B;  1I42 A;  1WF9 A;  3NY5 A;  1H4R A;  2KDB A;  4AJY B;  3L16 A;  2MBO A;  4II2 B;  2FIF A;  4BKS A;  4MGK E;  4K7S A;  1M94 A;  4DHZ B;  4GB9 A;  4EZJ A;  2FAZ A;  5HKH A;  4W9I A;  1OTR B;  3KW5 B;  2N4F A;  3AU4 A;  4XZ4 A;  2LD9 A;  1AAR A;  3QAR A;  1WXA A;  4FJY A;  3M3J A;  3TJP A;  4PYU A;  3HIZ A;  2KNB A;  1TBE A;  3H7S A;  2EMT A;  4A3P A;  2QHO A;  3QA8 A;  4MEL A;  1LXD A;  3KVF B;  3VAW A;  1YX5 B;  2L00 B;  2BGF A;  2G3Q B;  1R4M I;  4FHJ A;  4BKS D;  3QQ8 B;  5D2M B;  4BBN C;  2HTH A;  4ZRJ A;  4GDL B;  2L0T A;  3RUI B;  5CTR C;  3SHQ A;  2MSE D;  2IO2 B;  2JPH A;  2B3A A;  3DQV A;  4TKN A;  4IM3 A;  4I6P A;  4IW0 A;  2LVQ A;  3IG3 A;  3LDZ E;  4I6L B;  4ANV A;  3O65 B;  3ZNG C;  2BYF A;  4RMA A;  3W1S C;  3T9L A;  2D2Q A;  2LJ5 A;  2MLB A;  3PTF C;  5L95 C;  2KVR A;  2M1M A;  2KQ7 A;  3QCA A;  4GOC A;  2IYD B;  1TTN A;  3B1L X;  3QJZ A;  5D6J B;  1KJT A;  3DCG A;  4AUQ C;  3N32 A;  3EFU A;  1WXM A;  4ICV A;  4G3X B;  4N9F 4;  5EDS A;  3PSE B;  2DHZ A;  4M8M A;  5J18 A;  2AEH A;  4NY0 A;  3S2A A;  2GBR A;  1WGG A;  2LRU A;  4X57 B;  5C1Z A;  1WX7 A;  2MA9 B;  2RR9 A;  5LXI B;  1WE7 A;  2XK5 A;  2KTF A;  2ZPN A;  4OVU A;  4W9H A;  3OJ4 B;  5CHW A;  3V6C B;  3L17 A;  2LI5 A;  4W9C A;  3PRM B;  1SGH A;  4BOZ B;  3APC A;  3JSV B;  2IO0 B;  4KVG B;  3SD5 A;  2NBU A;  4FJV B;  3VDZ A;  2D07 B;  4IC7 B;  3V62 A;  2A5U A;  3VUY A;  2NPT B;  3VTW A;  5G55 A;  3HM3 A;  1RAX A;  1IP9 A;  2MX2 A;  1HE8 A;  3VFK A;  2OOB B;  1P0R A;  2OJR A;  2IY0 B;  4HPM B;  1V6E A;  4FLH A;  1WXV A;  4JIO U;  5C23 A;  1UH6 A;  2IZV B;  2KAN A;  2FCN A;  4HDQ A;  3A4S C;  4GSW A;  2KD0 A;  1WXS A;  4DDI D;  2KO3 A;  1E7V A;  2KMC A;  4XX5 A;  3RT3 B;  1XT9 B;  3AXC A;  3KUC B;  4B95 A;  3ZDT A;  2KLC A;  1Y8R C;  3PRP B;  1V86 A;  4M8N A;  2WX1 A;  2BKF A;  4MDK E;  2KN5 A;  2XBB C;  3MHS D;  4GU2 A;  1CMX B;  1LM8 B;  1ZKH A;  2FCS A;  4IWO A;  2RSU A;  3H7P A;  4HJK A;  1P9D U;  2BYV E;  1NI2 A;  3JSV A;  1V81 A;  2JUO A;  1V49 A;  3ZO5 B;  2BKR B;  4FN2 A;  1E7U A;  2KWV B;  3VUW A;  4WWO A;  4NAW A;  1P98 A;  1RFA A;  2GBN A;  3ZUN A;  4A3O A;  3ZLZ A;  3HM6 X;  1V9J A;  2LXC A;  2MP2 B;  2MWS B;  2IY1 B;  4GDK A;  4FBJ B;  3ZVV A;  2ZPY A;  1V2Y A;  1YD8 U;  2GBK A;  3UGB B;  1ISN A;  2KXJ A;  1Q0W B;  3A1Q B;  4EKU A;  2JY6 A;  2KFJ A;  3TBL D;  2AYO B;  4G0N B;  1EO6 A;  2C7N B;  2FNJ B;  1UZX B;  1KM7 A;  2DAJ A;  2KK8 A;  3T8M A;  4BFR A;  1WYW B;  4MGI E;  4PYZ A;  1J19 A;  2HD5 B;  2FCM A;  2KDE B;  3RZF A;  4WWN A;  3V61 A;  2KX0 A;  1WH3 A;  1FXT B;  3ZTC A;  4MSQ B;  4URK A;  2JXX A;  2Z59 B;  4B9K A;  3ML9 A;  4AJW A;  4E74 A;  4MH0 E;  4A20 A;  2UYZ B;  3VXW A;  4IM2 A;  1A5R A;  5BO4 B;  2O6V B;  4RM9 A;  3A4R A;  3OAW A;  2XEW A;  4NAW B;  2DYO A;  2N9P C;  3QX1 A;  2FCQ A;  5JHB A;  3VTV A;  1WM2 A;  3ZW3 A;  3NZU A;  1C3T A;  4MGY E;  2N7E A;  2W9N A;  2NBV B;  1KLV A;  2LAS A;  3EHV A;  3OJ3 A;  4KZC A;  1RRB A;  3NZS A;  1MG8 A;  2ZCC A;  2M8S A;  4TQ0 A;  2KQS A;  3K9P B;  2UWQ A;  3VQI A;  5CX3 A;  2JF5 A;  3IVF A;  1P3Q U;  1UBQ A;  2CU1 A;  2LVP A;  3TIX A;  1WJ6 A;  3D32 A;  4DXA B;  2M17 A;  3DBL I;  3H7P B;  4WQO B;  3ALB A;  2C7M B;  1IPG A;  1GUA B;  1S3S G;  3RZW C;  2AWT A;  1EF1 A;  1QZE A;  2LRW A;  2HE7 A;  3SU8 X;  2JRI B;  2KDI A;  4YL8 A;  4OVV A;  1GC6 A;  4KV2 A;  2D3G A;  4HCP B;  3BY4 B;  2LZ6 A;  4J6I A;  4BBN F;  1TZ1 A;  4HVB A;  4ICU A;  4WJQ A;  5TR5 A;  2EKE C;  3W1S A;  3QC8 B;  4EUT A;  1WIA A;  1G6J A;  2CR5 A;  2R2O A;  1E8Z A;  1S1Q B;  2D11 A;  2M0X A;  1WX8 A;  1WGH A;  4HDO A;  3R3M A;  2JRH A;  2KJH B;  2IO1 B;  2LGX A;  2ZJD A;  3R7Q A;  1WR1 A;  1V5O A;  3NOB A;  4HWI B;  3OLM D;  4DK5 A;  3PZD A;  1WRD B;  2KWU B;  3UQA A;  4LJO B;  5AZH A;  2XK5 B;  4DDG D;  1OGW A;  3N3K B;  4IG7 B;  5DPW A;  3DBR I;  2K8C A;  3VUX A;  2O6V A;  3B0A A;  3H9D A;  3RYT A;  2K6Q A;  2DYB A;  3JW0 X;  3L13 A;  5J2R A;  1WZ0 A;  2NPT A;  2NR2 A;  2KFK A;  2K1F A;  2KWC A;  2N1W A;  2N9X A;  3EEC A;  3PT2 B;  4TQ1 A;  2HJ8 A;  4TV3 A;  3X23 A;  3ZKJ C;  2L8J A;  1WMH A;  3DPD A;  3RCZ A;  1Z5S B;  3AUL A;  2ZZP B;  5DPS A;  4ZRI A;  4AP4 C;  3DDC B;  4GIV A;  2WYQ A;  3PLV A;  2BWE S;  3CF6 E;  4K7U A;  2KX3 A;  1GC7 A;  4KIK A;  1XD3 B;  1WX9 A;  2YLM A;  3R66 C;  5LLI A;  2BPS A;  2CHZ A;  3ZNH B;  5JH5 C;  2L3Z A;  4IM0 A;  3ZNI D;  3ZTD A;  2LXA A;  5IAA C;  1XQQ A;  2MBB B;  2J0K A;  5E6P A;  2N7D A;  2JT4 B;  4XC2 A;  4LDT B;  3WAN A;  2LUE A;  2G4S A;  2MCN B;  3M95 A;  3WAM A;  2PJH A;  1E90 A;  1UGM A;  5D7G A;  1UBI A;  2ZNV B;  3UIN B;  2K6D B;  2MQJ A;  1YIW A;  3UIO B;  5L83 A;  3APD A;  5CHV C;  4II3 B;  1V5T A;  4CO7 A;  1WMH B;  5J17 A;  3SDL C;  2LWP A;  2IO3 B;  4BOS C;  3IHP C;  3RD2 A;  3DVG Y;  1Q1O A;  3DVG X;  4RM8 A;  1J0G A;  3PRE A;  1U4A A;  1OEY J;  1WJ4 A;  3A1Q A;  2DZI A;  1WI0 A;  5AEK B;  1BT0 A;  3MTN B;  4BVU C;  4NJ6 A;  2A4Z A;  2JZZ A;  3HK0 A;  4W9D A;  2RD0 A;  4DHZ E;  2R2Q A;  4JL9 A;  4EOY A;  2PEA A;  4LDT D;  2DZM A;  3QAQ A;  2ASQ A;  2DZK A;  5G2N A;  1EUV B;  4ZYN A;  2DYM A;  4DWF A;  2ZNV C;  4G50 A;  3GOE A;  4K81 A;  2O2V A;  2ZCB A;  3H1U A;  4FUL A;  2V3S A;  3QHT A;  4W9L A;  4W9G A;  3PS6 A;  2AL6 A;  4EZK A;  3APF A;  1IYF A;  4EZL A;  4IUM B;  1ZW7 A;  3VVW B;  1OEY A;  2DEN B;  2WDT B;  2L05 A;  3ZRC A;  3AU5 A;  2K25 A;  4MEM A;  3NS8 A;  4AOF A;  2AL3 A;  2JWZ A;  3K9O B;  3ZNZ B;  2LVO A;  3VH4 B;  2KTR A;  4WJP A;  2C5L C;  4KIK B;  1GNU A;  3N30 A;  4W9K A;  3ONS A;  4NQK E;  3ENE A;  4KSK C;  3R7R A;  5E6O A;  1NDD A;  1E8X A;  1Z2M A;  3UQB A;  2D10 A;  1VD2 A;  4F8C B;  4BKT A;  4FAD A;  5AZF A;  4E3C A;  4HPL B;  4MSM B;  2CKH B;  4NPN A;  2KLG A;  1E5W A;  2KMA A;  3L10 B;  4EFO A;  4F1S A;  5IA7 A;  1T0Y A;  3DBH I;  2C7H A;  4ANW A;  3PV1 A;  4HLE A;  2EMS A;  4K1R B;  1H8C A;  4I6N B;  1WJN A;  2K8B A;  2ZEQ A;  2JVC A;  3UIP B;  4MJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...