5LLIA

Pvhl:elob:eloc in complex with vh298
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
104
structure length
102
Chain Sequence
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEGFTSQTARPQAPATVGLAFRADDTFEALIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent and selective chemical probe of hypoxic signalling downstream of HIF-alpha hydroxylation via VHL inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Transcription elongation factor B polypeptide 2
total genus 25
structure length 102
sequence length 104
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2016-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5lliA00
4MSMB 4AWJA 4NAWB 4EEWA 3NHEB 3BY4B 4MGYE 2NVUI 1D3ZA 3KUZA 2IY1B 2LUEA 1NDDA 2A4ZA 2ZVOA 3VAWA 4FADA 3ZUNA 3ZNHB 2KTFA 2NBVB 2KHWB 2KX0A 2MLBA 2KTRB 4W9CA 4KDIC 1Q0WB 2BPSA 3SD5A 4RM8A 3QARA 2DX5B 5E6NA 4EKUA 2BWFA 4DHZE 2O2VB 3KW5B 4NQKE 1NBFC 1PQSA 4W9FA 1WGRA 3RULA 2DZKA 1YX6B 2C5LC 2KVRA 2XEWA 4GIVA 4BFRA 4FHJA 3ML9A 3PTFC 3APFA 5DCNA 2N9EB 4FJYA 2AL6A 1YX5B 2JVCA 3L0WB 1X1MA 3L13A 4N9F4 3W1YA 1P0RA 3R66C 4K7WA 2PJHA 2KXJA 1WZ0A 4MELA 5CHWA 2MQJA 2FCNA 5C23A 3L16A 2UYZB 3A9KA 1YD8U 2AYOB 1WR6E 5DPSA 2FAZA 2UWQA 4K81A 1E8YA 2CS4A 3PZDA 1Z2MA 2KDIA 1U4AA 2ZEQA 4ICUA 3R7RA 3JW0X 1GUAB 1E7UA 5BO4B 3ZLZA 3ZIMA 5G55A 2DZIA 3ZRCA 2RGFA 4A3PA 5D7GA 2EMSA 2IBIB 1UGMA 3QC8B 1G6JA 2KFKB 4IM0A 2LVOA 4DDID 1RLFA 3A4RA 2L7RA 2KQ7A 3B1LX 2B3AA 2PPHA 3PT2B 2JRHA 4PYUA 4PS8A 5CTRC 2G4SA 1P3QU 5JH5C 1E7VA 3M95A 2WDTB 2LGYA 3UF8A 2KANA 1ZGUB 3L17A 1UBQA 2C7NB 4BKSA 2LXCA 4GMVA 2KJ6A 3ML8A 1TGZB 1I42A 2M0XA 1WXSA 4M8NA 3TCAA 4WAAA 3IG3A 3ZNZB 3PRMB 3SDLC 4EUTA 4P7IA 3IFWB 4LJPB 4JIOU 3B0AA 1E8ZA 3K9PB 2Y5BB 2BGFA 1UBIA 2L00B 3OJ3A 3APDA 2LJ5A 3V61A 1RAXA 1WF9A 2DYMA 2KDEB 2KFKA 4GOCA 3UQAA 3AU4A 4XZ4A 5DPTA 2K6DB 4G11A 3ZDTA 4FLHA 2CHXA 1V49A 1LM8B 1WGGA 2WYQA 4LDTB 2MSED 3WA0A 4AOFA 1WGDA 4B95A 3H6NA 2EKEC 2XK5B 5J17A 4HDOA 3P2BA 4WJPA 1E90A 2AWTA 3DBSA 1EF5A 3V6EB 4G0NB 2HJ8A 3A9JB 1H8CA 1WRDB 3VQIA 4IWQA 3A1QA 3UIOB 4BKGA 4K7SA 2KKCA 2L3ZA 5AEKB 4CYEA 1GC7A 1C1YB 3ECIA 1ZKHA 3QAQA 4ANXA 2IO3B 5GMVA 2BKRB 2L0TA 4NNJB 3SHQA 2KFJA 5IAAC 1KOTA 2MX2A 2DYOA 2JRIB 3AXCA 2WWZA 3Q3JA 3H7PB 1WJ6A 3LJ3A 4KVGB 2NCNA 3VTVA 2JUOA 3A9JA 3GOEA 5CX3A 5HKHA 3HHMA 4W9LA 4CO7A 4EZLA 1F9JA 4KZCA 3KUDB 4PS7A 3ZRFA 4JL9A 4ZRIA 4MGIE 4XC2A 2M1MA 4YL8A 3WIMA 1GG3A 3VUYA 1T0YA 3S2AA 5E6PA 1WX7A 3N30A 4WWPA 3DQVA 3VTWA 1EF1A 2HE7A 2O6VB 4FJZA 3U30A 4K7UA 3EECA 2GBKA 4RM9A 4AJYB 1I35A 2O6VD 3PHWB 2KDFB 2Z0EB 2KC2A 3QWZB 4IWOA 2J0JA 3M63B 5JZEB 4ANWA 1IPGA 4B6WA 4I6PA 4HPLB 2IZVB 2R2OA 2K8CA 2RR9A 4BBNC 4MGZE 4WQOB 1WXMA 1WX8A 2LGXA 3EC8A 1LXDA 3QK0A 2IO2B 1FXTB 2L8JA 4JQWC 4TKNA 3RZWC 2KLGA 1NI2A 2V1YA 3U7DA 3DBRI 2FCQA 3QX1A 2I1KA 2BF8B 4NPNA 3DOWA 3NOBA 3EFUA 2KZRA 4AUQC 4I6NB 2OOBB 3ZW3A 4FA6A 4NJ7A 1OQYA 3QQ8B 1P1AA 2ZJDA 3H9DA 5FR6A 1Q5WB 1XD3B 4GSWA 3UGBB 1V81A 3ZDMC 2ZPYA 2ZCBA 3QCAA 4HDQA 4HLEA 1TTNA 2PE9A 3QHTA 4KDLB 3I3TB 4MH0E 5TR5A 3DBHI 3W1SC 3VH3B 4KIKA 1CMXB 2K8BA 2LVQA 3KVFB 3DVGY 4GN1A 4ZRJA 1LFDA 2GBNA 2FCSA 1KM7A 4HWIB 2DZMA 5DPWA 1WJ4A 4HK2A 4FJVB 2XK5A 4CHKA 4K1RB 4NQLB 3EHVA 3Q3FA 1J8CA 2DAFA 3PREA 2JT4B 5KHQA 2A5UA 2DYBA 2D07B 1WXVA 2J0MA 2MCNB 4BBNF 2GBMA 4LJOB 1JRUA 3RZFA 4GDLB 4NAWA 3TIXA 2KK8A 2LGDA 3A9KB 2KWVB 3KUCB 3M62B 3OAWA 3WAPA 2HTHA 3H7PA 1YJ1A 3VHTC 4BKTA 1V6EA 4IM3A 3NS8A 1RFAA 1V5TA 3WALA 2LASA 1UZXB 3R7QA 2DAJA 1YIWA 2KD0A 1E8XA 4W9EA 2OJRA 4MDKE 4OVUA 1WFYA 3VXWA 2ZNVB 2KX3A 1EO6A 1OEYA 1V2YA 2DENB 4MJSB 4BOSC 5CHVC 4X57B 1XT9B 4A3OA 4EOYA 4ANUA 3BINA 4M0WB 4MSQB 3PV1A 1IYFA 4IG7B 1L2NA 4B9KA 2JF5A 3PRZA 4F1SA 3N3KB 4HCPB 4TV3A 1OEYJ 4JLCA 4HPMB 4GU2A 2MWSB 3CSFA 4G3XB 5J2RA 1AARA 1UD7A 2YLMA 3APCA 3HIZA 4F8CB 1H4RA 1WGHA 2L0FA 3RD2A 2FIDA 3IVFA 3NY5A 1SGHA 2KOXA 3H7SA 1WI0A 2KMAA 2VRRB 1WE7A 4JGHB 1L7YA 2R2QA 3GZNI 2O6VA 4FHKA 2PE6B 3DVGX 2REXA 3VDZA 4DXAB 3DPDA 3TL5A 2AL3A 2LD9A 2WX0A 3AU5A 4XX5A 4EZKA 1WR1A 3N32A 4TQ1A 2XBBC 5CHFA 3ZNGC 1P9DU 1GJZA 1WXAA 2C60A 1WJUA 2LWPA 3TMPB 4DBGA 1IP9A 4KSLC 4FN2A 1J0GA 1S3SG 2N9PC 1R4NI 4EFOA 4M8MA 5AZFA 3TJPA 1Q1OA 3DBLI 4ZYNA 2MBBB 1QZEA 2CHWA 5AZGA 1A5RA 2C7MB 2GMIC 3RYTA 3PVLA 1WZ3A 1BT0A 3AULA 1RRBA 1LQBA 2M17A 4AJWA 3T9LA 3PSEB 3JSVB 4ANVA 2WX1A 3QIJA 3HM3A 4ICVA 3LDZE 2ZPNA 1P98A 4HJKA 2IO0B 3PS6A 3KYDD 3IBEA 4I6LB 3V62A 3ZVVA 1V86A 4IWPA 1R4MI 2NBWB 3A1QB 1V80A 2LZ6A 3ENEA 4WWNA 3QJZA 4MM3A 2K6QA 2L76A 5D2MB 3MTNB 5D6JB 1SE9A 2K39A 4W9DA 2KWCA 2KTRA 2Z59B 1SIFA 2MP2A 1WY8A 4FBJB 5L95C 3WAOA 1WYWB 3CF6E 5LXIB 1ZW7A 1WE6A 3DDCB 2C7HA 3CSTA 3AI5A 3R3MA 2O2VA 3PHXB 4KSKC 3O65B 4FULA 4MJSA 5DPRA 4GDKB 2ASQA 2LVPA 4GDLA 2J7QB 3RCZA 3V60A 3VVWB 4PS3A 4W9JA 2RD0A 4IM2A 4MEMA 1M94A 4W9KA 2LRUA 2DHZA 5LLIA 4WWOA 2CHZA 2ZCCA 5L83A 3V6CB 3RT3B 3IHPC 3HK0A 2N7DA 2GBRA 2IYDB 4KIKB 1YQBA 2ZVNA 5JHAA 3PGEA 4HVBA 2IO1B 2CR5A 4HXDA 2LRWA 3MJWA 2D10A 3B08A 4OVVA 4DHJB 3VUWA 3NZUA 2YVCA 3PLVA 2BYFA 3X23A 3X0WA 4DHJD 3U8ZA 3ALBA 4HCNB 1EUVB 3PPAA 1WIAA 1WMHA 2ZNVC 2M8SA 2L05A 3KH0A 4W9GA 1K8RB 2CU1A 3JYUA 4KV2A 4II3B 4EZJA 1KLVA 5AZHA 3L10B 3MHSD 4GDKA 1HE8A 3SU8X 1J19A 4TQ0A 2LXAA 3M3JA 2KN5A 3ZNID 1WX9A 3WANA 5E6OA 3UQBA 3ZTCA 1VD2A 5G2NA 1Z5SB 3ZTDA 5IA7A 3PRPB 2BWES 2DZJA 2CKHB 4A20A 2NR2A 4ZRKA 5EDSA 5JHBA 5C1ZA 2NBUA 1TZ1A 3JVZX 4BVUC 3DVNU 4GGQA 3JSVA 2N7EA 3HM6X 4IW0A 2FIFA 4URKA 4GXBA 1OGWA 1XQQA 2NPTA 4J6IA 1E5WA 5D94A 2MBEA 1Y8RC 1GC6A 4DWFA 3UINB 3WAMA 4AP4C 1WJNA 3VTUA 4ZDVA 4WJNA 3PLUA 3ZKJC 2J0KA 2C9WB 2JZ3B 2N1WA 3VFKA 2PEAA 1S1QB 2KMCA 2JPHA 2I1JA 4DDGD 2D11A 2BKFA 1OTRB 2EMTA 2G4DB 2MP2B 3A4SC 3W1SA 4RMAA 1KJTA 2V3SA 3VUXA 2JXXA 3K9OB 4IC7B 1VCBA 4NY0A 3H1UA 2N9XA 4LCDE 4WJOA 4E74A 2LI5A 4GB9A 1UELA 2HD5B 3KYCD 4ASWC 2NPTB 4DHZB 4F7ZA 1WM2A 2MW5A 1C3TA 2K25A 2G3QB 4DK5A 2GBJA 2KO3A 3CMMB 1V9JA 2MBOA 4TUUA 1GNUA 3DCGA 4WJQA 3TBLD 2KLCA 3C0RB 2QHOA 2RPQA 1TBEA 4MGKE 1WMHB 2BYVE 2MA9B 1WH3A 1WGYA 4W9IA 2MBHA 2D3GA 3QA8A 2IY0B 2V4LA 3OLMD 3UIPB 2FCMA 4NJ6A 1ISNA 2AEHA 2N4FA 2MBQA 1V5OA 5LXHA 4E3CA 1MG8A 1WM3A 2KJHB 2KDBA 4LDTD 2JZZA 2G45B 2RSUA 4W9HA 3T8MA 2K8HA 4BOZB 2D2QA 3ONSA 3L54A 3DVNV 2K1FA 2KQSA 5J18A 2JY6A 1E8WA 3ZO5B 4II2B 2Z0DB 2KJRA 2FUHB 3L08A 2BYEA 2KC1A 4E71A 4PYZA 2GOWA 2KWUB 4IUMB 3VH4B 2NS5A 2KNBA 3NZSA 2W9NA 2JWZA 2N1VA 4KZ0A 4BKSD 2M4NA 3A33B 3OJ4B 4G50A 3RUIB 2ZZPB 3D32A 2FNJB 1UH6A 5KHOA 2MRPA
chains in the Genus database with same CATH superfamily
2INNE 4NAWB 1D3ZA 3ZNHB 3GP7A 2NBVB 3DWMA 2DX5B 1I4PA 4EKUA 1MPEA 2O2VB 3KW5B 3RULA 1K53A 1YX6B 1B1ZA 2C5LC 2Y3AA 4GIVA 3V3XA 4KGSA 5DCNA 1VR9A 3W1YA 1KTKA 3L13A 2J52A 2PJHA 1XF5L 1N6ZA 4XE0A 2AYOB 1WR6E 2FAZA 3MC9A 2G9HD 1Z2MA 2WXGA 4ICUA 1E7UA 4RFBA 5BO4B 1VJKA 3ZLZA 5G55A 1HEZE 4A3PA 5D7GA 2EMSA 1FO4A 3EUB2 4JX1C 2KFKB 2N7JA 4IM0A 1RLFA 3B1LX 3FKYA 2PPHA 1QOAA 4YT0B 4KGTA 2G4SA 4ZRQA 1OQRA 2BBCA 5IP4D 3M95A 2LGYA 3Q6BA 4BKSA 1JMLA 3TSSA 1Y56A 2KJ6A 3ML8A 1TGZB 3TCAA 3PRMB 4EUTA 3AV8A 4NAMA 4LJPB 1UBIA 1RAXA 2KFKA 2E6XA 2JXTA 3AU4A 4XZ4A 3UQAA 1WWTA 5DPTA 4G11A 3DBRB 1AWDA 1LM8B 4AOFA 1UGJA 2LHDA 1E90A 3DBSA 2HJ8A 4GLSC 4K7SA 5EE0A 4CYEA 1V1PA 3ECIA 1ZKHA 1V1OA 4DXGA 4D2KA 2IO3B 2BKRB 3AE8B 3P42A 2WWZA 3DBLB 3LJ3A 2JUOA 3GOEA 5CX3A 2WXHA 4W9LA 2GI9A 4RCOA 1C9FA 1JRPA 4JL9A 4ZRIA 4MGIE 2M1MA 2JX5A 1WSPA 4A55A 1T0YA 2BW2A 3S2AA 3SR6A 3ZQ4A 3VTWA 2O6VB 3MP9A 1FNWA 3EECA 2O6VD 4N6EB 3PHWB 1F0ZA 3QWZB 4B6WA 1AN8A 2CU3A 4WQOB 1FXTB 1PGBA 5HHDG 3VRAB 3DBRI 3QX1A 1ACCA 1UUPA 4AUQC 3QQ8B 1NVID 1Q5WB 1I4GA 4ACFA 1XEEA 4HDQA 1DYQA 3QHTA 5TR5A 3W1SC 2WU5B 4KIKA 2K8BA 3HVZA 1LFDA 2N0SB 1KM7A 3EFCA 1WJ4A 2JSVX 4FJVB 2XK5A 3PREA 2G1EA 2GBMA 4LJOB 4GDLB 1MG4A 2LGDA 3KUCB 2HTHA 2NTSA 1V6EA 3OWEB 1HTOA 2LGSA 1V5TA 4LNKA 1I7HA 1UWXA 1YIWA 1PDXA 4W9EA 2OJRA 4OZCA 1QOFA 2DLBA 4M00A 4RH6A 3MJ5A 4HPPA 4A90A 2MJEA 3N1YC 4IG7B 1C4PA 4RF0A 3URYA 1Q10A 4MH8A 3RFZB 4JLCA 4IOIE 4MM3B 1SJHD 1AARA 1UD7A 3APCA 5D3DA 1H4RA 1WGHA 3RD2A 2FIDA 3IVFA 1ZUD2 3BZDB 1KH0A 3ZYYX 3GZNI 4FHKA 3DVGX 3VDZA 2LD9A 4EZKA 2KACA 4TQ1A 4ZHOA 1WXAA 4YSYB 4DBGA 4FN2A 5AZFA 1FRRA 1KFYB 2C7MB 3RYTA 3PVLA 1L0YB 2Q5WD 3QIJA 3HM3A 3LDZE 1ZXHA 1T0SC 5C2TB 2LZ6A 4NZLB 3QJZA 5D2MB 2KWCA 2WXNA 2KTRA 1SIFA 1FRDA 3WAOA 1WYWB 2WXOA 4YWGG 3PHXB 3O65B 4FULA 4MJSA 2EKIA 2J42A 3TUOA 4GDLA 3Q69A 1C77A 4WWOA 3ZJTA 2CHZA 2ZCCA 3IHPC 3HK0A 2IJ0A 4C80A 1YN4A 1YQBA 3PGEA 1BMLC 2CR5A 4HXDA 4JWSC 4ZRPA 1ZDVA 3PLVA 3X0WA 3AECB 3PO0A 1WMHA 2PLPA 1YJIA 1GPXA 2LGIA 4W9GA 1K8RB 4KV2A 3JYUA 1KLVA 1AYFA 3L10B 4TQ0A 3ZNID 3WANA 5E6OA 5G5HA 1VD2A 3ZTDA 1NYQA 2J53A 2GB1A 4A20A 5BMHA 1EU4A 1YMHE 3DVNU 3B2GA 3AE1B 3HM6X 4GXBA 2NPTA 2MBEA 1Y8RC 4CQNA 3WAMA 4QAYA 4ZDVA 3PLUA 3VFKA 5BYRA 2PEAA 1S1QB 2JPHA 1KLGD 2I1JA 4DDGD 2MP2B 1SE3A 2IGDA 3AEFB 1L0VB 4NY0A 2N9XA 1QKZA 2LUMA 1UELA 2HD5B 4ASWC 3HRDD 1WM2A 1C3TA 3E56A 1HZ5A 3Q3OC 2GBJA 3CMMB 1M4VA 3DHIC 4TUUA 2BTEA 3TBLD 2KLCA 2PTLA 2L1AA 1BXTA 3AE2B 1JQ4A 1WMHB 2BYVE 3AM9A 2MBHA 2D3GA 1NYRA 2IY0B 2V4LA 2FCMA 1ISNA 1TS2A 3Q8FA 3C8YA 2MBQA 2KJHB 4LDTD 2KDBA 4B0MA 2E3TA 2RSUA 4RF1A 2JZPA 3DVNV 1E8WA 1FMAD 4II2B 2KJRA 1TY0A 5FKAC 2KC1A 5I4DA 4YTPB 4IUMB 1AW7A 2W9NA 4BKSD 3A33B 4G50A 2JWUA 3D32A 5KHOA 2MRPA 1TYGB 1HXYD 1L4ZB 4AWJA 3BY4B 2NVUI 3KUZA 2A4ZA 1I4QA 3VAWA 3ZUNA 2KX0A 1F2RC 2KTRB 1Q0WB 3SD5A 2M19A 3QARA 1T5XD 2WHIA 4DHZE 4NQKE 1NBFC 4W9FA 2KVRA 2XEWA 3TEWA 1CZPA 4E3CA 2AL6A 4TMAB 2JVCA 1X1MA 4K7WA 2KXJA 5C3JB 3ETRA 2MQJA 2FCNA 5EE1A 3A9KA 5DPSA 2UWQA 1E8YA 2ZEQA 4K3BA 4RGTA 1GUAB 1FM0D 3ZIMA 2DZIA 1MFWA 4Q2JA 2RDGA 2IBIB 5BMIA 1UGMA 1RM6C 1G6JA 3MHZA 4DDID 3A4RA 2L7RA 2KQ7A 4XDCA 4PS8A 3TEZA 3AEAB 1E7VA 1MI0A 2WDTB 3MC8A 2KANA 1ZGUB 1ET6A 1UBQA 3LXFA 1GAQB 2LXCA 1KLUD 3AEGB 2GLSA 1I42A 2M0XA 1WXSA 2OEDA 3SDLC 4JIOU 2BGFA 2INCC 3APDA 2LJ5A 1T0RC 1N5XA 2D5GA 4MT5A 2K6DB 3ZDTA 4DQOC 4JWUC 1WGGA 2K3UA 2MSED 1WGDA 5J17A 2XK5B 1ROEA 3P2BA 1SBBB 3A9JB 1H8CA 1WRDB 4IWQA 3A1QA 4NJCA 4BKGA 2KKCA 2L3ZA 1C1YB 4HKZE 1XO3A 3RNEC 4LTUA 2MJDA 4PK1A 3SHQA 1KOTA 3Q3MC 4S17A 3Q3JA 2DYOA 3AXCA 2NCNA 3FILA 4CO7A 3I9V1 4KZCA 2QMTA 4RGOS 4RGNA 4XC2A 4C56C 4YL8A 1F77A 1YN3A 4JPSA 2V3PA 3OG5A 4WWPA 3DQVA 4FJZA 3U30A 2V9HA 4XWWA 2BVCA 1FD6A 4EE2A 1I35A 2KDFB 4LLGM 5JZEB 4ANWA 3KWLA 1LO5D 1K52A 2WXIA 2WXLA 3EC8A 3QK0A 4MACA 1NI2A 2KN4A 2V1YA 2KVZA 4IKGA 2EELA 2KWDA 3RNCC 4NPNA 3DOWA 4I6NB 2OOBB 4NJ7A 2PW9A 3U4EG 1V8CA 4GSWA 4RNAA 2ZPYA 3QCAA 1VRAB 1NEKB 3MFGA 2PE9A 4MH0E 3P4QB 2DWQA 4GN1A 2IPKD 4ZRJA 3AEEB 2WXPA 1YOVB 3KWVA 2GBNA 2FCSA 2DZMA 2VH1A 4K1RB 2V4IB 3Q3FA 2JT4B 1R7SA 2DYBA 2WDRB 2J0MA 1IGCA 2MCNB 1JRUA 4WQMA 2KK8A 3WAPA 3OAWA 3NS8A 2LFIA 2LASA 1UZXB 1L5PA 2DAJA 2RMMA 1E8XA 1WFYA 3VXWA 1ESFA 2HTME 4BOSC 5CHVC 3BVZA 3E9SA 1GB1A 2J4XA 1OFFA 4ZHPA 4EOYA 2WXJA 2BQQA 3T3NA 3DHGC 3BINA 4J3OD 4LNFA 1L2NA 3N20C 3PRZA 2WP9B 3Q8BA 3N3KB 1OEYJ 3Q8EA 5J2RA 2MWSB 3CSFA 1TT5B 1C76A 2YLMA 1CJEA 3DBHB 2WLBA 3NY5A 1XCTL 1E6EB 1WI0A 3H7SA 4JGHB 2QIEB 3RNFC 4RGMA 2O6VA 4P6VF 5BYSA 5JXVA 4XX5A 3AU5A 1R4NB 3N32A 3ZNGC 2C60A 3J9CA 1PFDA 1R4NI 3TJPA 3BYTB 4ZOHC 2PVOD 2Y5PA 1A5RA 3P4PB 1WZ3A 1BT0A 1RRBA 4YSZB 4ANVA 2DNFA 1JWMD 4ICVA 1P98A 3PS6A 3KYDD 1V80A 3ENEA 1FEHA 3ZGZA 5L95C 5HFYA 3CF6E 5LXIB 2ACZB 1WE6A 5T8IA 4N58A 3CSTA 4KSKC 5DPRA 3IXSA 4GDKB 2ASQA 1L0XB 2RD0A 4W9KA 1SF0A 2JU6X 1T0QC 3RNAC 3V6CB 3RT3B 1T3QA 4TSSA 1K50A 1MHHE 1QLBB 2GBRA 5AUKA 3AE4B 2NMQA 2LRWA 1JALA 1TKEA 1MHXA 2I38A 3P63A 4DHJB 3VUWA 3NZUA 2AQ2B 2BYFA 3AE5B 3NZ3A 4DHJD 3U8ZA 4XYCA 3SEBA 4HCNB 1UNSA 3GE3C 2M8SA 2L05A 3RNGC 1FNUA 1SE4A 4HROA 3MHSD 3AE3B 2QSDA 2W3SA 3BK2A 2N9KA 3ZTCA 1DOIA 2JYTA 1Z5SB 1OQQA 3PRPB 2BWES 5IN7A 2CKHB 2VZKD 1I4XA 2NBUA 2PKOA 3AE6B 4GGQA 2VZKB 4IW0A 3BWUD 4C7YA 2N9LA 1XQQA 4J6IA 5D94A 2QILA 3AN1A 5FR3A 1QF6A 1JROA 3HUIA 4C4VA 4WJNA 4US8A 1PYWD 1OTRB 3W1SA 3VUXA 4AS1A 4USAA 4E74A 1J7CA 2DBYA 2NPTB 4DHZB 1P7EA 3CIRB 2MW5A 2G3QB 4DK5A 2KO3A 1V9JA 5IO9A 2WNMA 3C0RB 4KX6B 3W5UB 2RPQA 1NENB 2KT7A 2MA9B 2L52A 1WGYA 1ENFA 2AEHA 1V5OA 1MG8A 1WM3A 5IOIA 1N60A 2JZZA 4W9HA 2PVGC 1FCLA 2D2QA 3L54A 1MVKA 2K1FA 1IGDA 1XLOA 1UF0A 3ZO5B 3ZJUA 2Z0DB 2IDYA 2FUHB 1ZDXA 2GOWA 2FE8A 3NZSA 2N1VA 3RUIB 1D5XC 1PUTA 1QOGA 2FNJB 1UH6A 3PZ8A 4BZAA 4MSMB 4M02A 4MGYE 1D4BA 2ZVOA 1BUIC 3VRBB 2MLBA 4KDIC 4RM8A 1J7BA 2BWFA 1YQ3B 1PQSA 1A70A 1WGRA 2DZKA 4BFRA 1XXGA 2CJNA 3PTFC 4FHJA 1I4RA 1SXTA 5FK9C 3U52E 2N9EB 4FJYA 3L0WB 2FUG1 1P0RA 3NS1A 1WZ0A 3P4SB 1DOXA 2M0AA 1L6UA 1QILA 5C23A 3DHHC 3L16A 1YD8U 1FCCC 1FPYA 3PZDA 4WWMA 1U4AA 3R7RA 3FAHA 1VLBA 2V0GA 1JW9D 1F2RI 3QC8B 4FXCA 2LVOA 3W5VB 2JYEA 2KMMA 4P1BC 3PT2B 1KF6B 5CTRC 1P3QU 1F1HA 3EA6A 3L17A 3SFEB 3Q3NC 3IT4B 2JQRB 3UI3A 2L83A 2ZW0A 4M8NA 3N1XC 2QEJC 3AH7A 4P7IA 3IFWB 3V05A 3B0AA 1E8ZA 2WXMA 1FIQA 3V61A 3HVDA 1WF9A 2CHXA 5G5GA 4LDTB 3H6NA 2EKEC 2AWTA 3P1MA 1EF5A 3V6EB 5H92C 3UIOB 1CK1A 3H8HA 2GRIA 3AEDB 1ZE3D 2VH2A 5BYQA 1SIJA 3AB5A 2K9XA 5GMVA 2K0PA 2KFJA 1MJDA 2WU2B 2MX2A 1WJ6A 4KVGB 2SAKA 5HKHA 3HHMA 1WXQA 3KUDB 1N5WA 4O1NA 2YEPB 4UDUC 2WS3B 3WIMA 2BS4B 3VUYA 3N1ZC 1WX7A 4OVZA 3N30A 1EF1A 4K3CA 2GBKA 2QJLA 3B9JA 4AJYB 1ZOYB 2Z0EB 2W54A 3M63B 3KQ4A 1JWAD 3T3OA 2R2OA 2K8CA 3ABVB 4MGZE 1XLQA 1WXMA 1WX8A 2L8JA 3RZWC 3IAM1 4ARCA 3RN9C 2X8XX 4DXFA 3NUHB 2BF8B 4LK0M 5HI1A 3NOBA 2KZRA 1OQYA 1P1AA 2ZJDA 4PT5A 1D5MC 3UGBB 1V81A 3CWIA 2ZCBA 4HLEA 3RI7C 1SEBD 1ET9A 4KDLB 3I3TB 3DBHI 1TIFA 3VH3B 1RYJA 1CMXB 3BVMA 5LNK1 4AQ7A 4WAFA 5DPWA 4HK2A 4NQLB 3EHVA 5KHQA 1TKYA 1WXVA 3NVYA 3RZFA 3TIXA 3M62B 1YJ1A 3VHTC 4A8XC 4IM3A 1RFAA 1JWBD 2BT6A 4MDKE 4OVUA 1TZOA 2KX3A 1OEYA 4BAXA 1V2YA 4X57B 2AQ1B 4A3OA 4M0WB 4MSQB 3PV1A 4B9KA 1IUEA 1R4MB 4HCPB 4TV3A 1E7PB 3LYYA 4HPMB 4GU2A 1K51A 4G3XB 4OHJA 3I63C 3HIZA 3NG0A 4F8CB 3GS2A 2RPVA 2L0FA 1SGHA 2KOXA 4KKJA 2KMAA 1WE7A 5BMGA 2MEKA 2R2QA 1V1PB 1ZP0B 4DXAB 3TL5A 2AL3A 2WX0A 1C4AA 1WR1A 1IBXB 3BYYB 2XBBC 2W3RA 1GJZA 2LWPA 4XWTA 1IP9A 1J0GA 2M56B 2D3CA 3VR9B 4M8MA 4HEA1 1Q1OA 4ZYNA 1GOZA 1QZEA 4WURA 1E0ZA 4HKQA 3Q2AC 2GMIC 3NJTA 2WDQB 1E10A 1LQBA 2M17A 3T9LA 1FNVA 2SEBD 2WX1A 2ZPNA 2IO0B 3ZVVA 3IBEA 4I6LB 1V86A 2B76B 3AE7B 3A1QB 4WWNA 2IGHA 2K6QA 5D6JB 3Q14C 1SE9A 4OZBA 1EWYC 1WY8A 2K22A 3EGRA 1ZW7A 1V97A 3DDCB 4C4VB 4ARIA 1N63A 3R3MA 2O2VA 1VZ7A 4OZAA 2J7QB 4L23A 2FBWB 4MEMA 3P4RB 1M94A 2LRUA 2DHZA 3RPFC 5LLIA 2LEKA 5D3IB 3I57A 4KIKB 2ZVNA 4HVBA 2IO1B 3MJWA 2D10A 3IT6B 1QQRA 3AMZA 3ALBA 4OW0A 3PPAA 1EM7A 1WIAA 3U7ZA 3MC0B 3KH0A 4GDKA 1C78A 1HE8A 3SU8X 2LXAA 3M3JA 1TY2A 3UQBA 2DZJA 5JHBA 2NR2A 4ZRKA 5C1ZA 4H2AA 3R8BA 1TZ1A 4URKA 1E5WA 1GC6A 5EE3A 1FFUA 4DWFA 1ZXIA 4AP4C 4B0EA 1WJNA 3ZKJC 2C9WB 2JZ3B 2N1WA 1YN5A 2D11A 2EMTA 1KJTA 2V3SA 4IC7B 2LI5A 5IKCM 4GB9A 1FXAA 2AX5A 3DWGC 2K25A 5MPOA 1GNUA 3DCGA 4A6QA 1L4DB 2QHOA 4IDIA 1FFVA 1WH3A 3BK1A 3QA8A 2MJ3A 4P16A 1RWSA 2N4FA 5LXHA 1DGJA 2QCZA 2D3BA 2G45B 3T8MA 1VDVA 3ONSA 2XN9C 2W82A 2MH7A 4PYZA 2WXQA 3VH4B 2KNBA 2JWZA 1CQVA 4KZ0A 3OJ4B 3I5JC 2Z8LA 2ZZPB 3GE8C 4EEWA 3NHEB 1J7AA 2IY1B 2LUEA 1NDDA 4FADA 2KTFA 2KHWB 4W9CA 1B9RA 1F52A 2BPSA 3BIID 3ZXVA 5E6NA 2XNAC 3AE9B 2OJWA 3ML9A 4N59A 3APFA 1YX5B 4JE3B 4N9F4 3R66C 4L1BA 4MELA 5CHWA 1IBXA 2WGSA 2UYZB 4K81A 2BB5A 2CS4A 2KDIA 3GB1A 3JW0X 4YSXB 3ZRCA 2RGFA 2QC8A 2INPE 2R61A 1LGRA 3RMKC 2B3AA 4ITKA 2QDFA 2JRHA 4PYUA 5JH5C 1L6VA 3UF8A 4XDDA 2C7NB 1N61A 4GMVA 5EE9A 3L4PA 4WAAA 1P7FA 3IG3A 3ZNZB 2HDEA 3AEBB 2KDMA 3NRZA 3K9PB 2Y5BB 2L00B 3OJ3A 2V3NA 2DYMA 2KDEB 4GOCA 4FLHA 1V49A 2WYQA 2ON8A 3ZJVA 3WA0A 4B95A 4HDOA 4S0RA 4YXDB 4WJPA 4G0NB 3FILB 3VQIA 1DOYA 2BB6A 2CJOA 2KYWA 5AEKB 1GC7A 3QAQA 4ANXA 2L0TA 4NNJB 2WXFA 5IAAC 4C7ZA 2JRIB 3B2FA 3H7PB 3VTVA 3A9JA 4R3DA 2D3AA 4EZLA 1F9JA 1STEA 3PZ7A 4PS7A 3ZRFA 4P1CC 1D5ZC 2TSSA 1GG3A 5E6PA 1YJJA 1WYGA 2HE7A 1HQRD 4K7UA 4RM9A 1QOBA 2BS2B 2KC2A 4IWOA 2J0JA 1IPGA 1QT9A 2BS3B 4I6PA 5H8YE 4HPLB 2IZVB 2W55A 2RR9A 4BBNC 1SJED 2WXKA 2LGXA 4TKNA 1LXDA 4JQWC 2IO2B 2KLGA 4HJGE 3U7DA 2FCQA 2HJ1A 2I1KA 5GXGB 3Q8CA 5HG2A 3EFUA 3ZW3A 4FA6A 3H9DA 5FR6A 2LJIA 1XD3B 3ZDMC 4KKIA 2WXRA 2ICIA 3BVGA 1KRHA 1TTNA 2WQYB 3ZXRA 2RDHA 3N9YC 2H88B 2INDC 2LVQA 3KVFB 3DVGY 4US9A 2X38A 4ZYSA 2ZW1A 4HWIB 1JCKB 4CHKA 1E9MA 4LNIA 1J8CA 2DAFA 3RNBC 3KLSX 1HZ6A 2A5UA 2D07B 4BBNF 4NAWA 3A9KB 3R2TA 2KWVB 4BKTA 1TS4A 3H7PA 3WALA 3R7QA 2KD0A 1N62A 2ZNVB 4M0WA 3U2SC 4YTMB 1EO6A 4MJSB 2DENB 1XT9B 3C19A 4ANUA 1YNTE 1IYFA 2JF5A 4F1SA 1JWUD 2OHFA 2IGGA 2LHEA 1XLPA 1YQ4B 3NVVA 3GZNB 1D6EC 2ONQA 2VRRB 1L7YA 2PE6B 2REXA 1EWCA 3DPDA 4YTNB 5CHFA 1P9DU 1WJUA 2Y5CA 3TMPB 4REZA 4KSLC 1S3SG 2N9PC 4EFOA 2UU7A 3DBLI 2MBBB 2CHWA 5AZGA 1XLNA 3AULA 4C00A 4AJWA 3PSEB 3JSVB 3LB8C 1HA5A 1SSNA 4HRSA 4HJKA 2K5PA 3V62A 4IWPA 1R4MI 2NBWB 3R2IA 4MM3A 2RDBC 2L76A 2YEPF 3MTNB 2K39A 4W9DA 4LNNA 2Z59B 2MP2A 3IAS1 4FBJB 3W2DA 2NTTA 1SB3C 2KQ4X 2C7HA 3AI5A 2WDVB 1C79A 3RCZA 2LVPA 3O13A 1UWMA 3V60A 4PS3A 4W9JA 2PIAA 4IM2A 3VVWB 4LNOA 1JWSD 4KGRA 5L83A 4A9AA 1I4HA 2N7DA 2IYDB 5JHAA 1WGKA 3B08A 4OVVA 2YVCA 5E6JA 1EU3A 1XCQL 3X23A 1WRIA 1HTQA 1EUVB 1GB4A 2ZNVC 1VZ8A 1NI3A 2CU1A 4EZJA 4II3B 1T6BX 5AZHA 1J19A 4XGAB 3NVZA 2KN5A 1WX9A 5G2NA 5TSSA 5IA7A 5EDSA 2H89B 1FXIA 2L32A 3NVWA 3JVZX 4BVUC 1C4CA 3JSVA 4WIPA 2N7EA 2FIFA 1OGWA 3FC4A 1VZ6A 3UINB 3VTUA 2LMCA 2J0KA 3WCQA 2KMCA 2BKFA 2G4DB 2BYTA 3VR8B 3A4SC 4RMAA 2JXXA 2KAJA 3K9OB 1VCBA 3SFDB 3H1UA 4LCDE 4WJOA 3KYCD 4F7ZA 2AQ3B 5AUIA 1RFKA 2MBOA 4WJQA 1TKGA 1TBEA 4MGKE 4W9IA 1TJEA 4M01A 3OLMD 3UIPB 4NJ6A 1PGXA 4WH4A 3TEXA 1PGAA 4BOZB 3Q8AA 2K8HA 1TS5A 2KQSA 5J18A 2JY6A 1TS3A 3L08A 4L2YA 2BYEA 4E71A 2KWUB 2NS5A 2MHJA 1SE2A 3TEYA 2M4NA 2I2YA 1ZPSA 3W9CB 2PMVA
chains in the Genus database with same CATH topology
4MSMB 4AWJA 4NAWB 4EEWA 3NHEB 3BY4B 4MGYE 2NVUI 1D3ZA 3KUZA 2IY1B 2LUEA 1NDDA 2A4ZA 2ZVOA 3VAWA 4FADA 3ZUNA 3ZNHB 2KTFA 2NBVB 2KHWB 2KX0A 2MLBA 2KTRB 4W9CA 4KDIC 1Q0WB 2BPSA 3SD5A 4RM8A 3QARA 2DX5B 5E6NA 4EKUA 2BWFA 4DHZE 2O2VB 3KW5B 4NQKE 1NBFC 1PQSA 4W9FA 1WGRA 3RULA 2DZKA 1YX6B 2C5LC 2KVRA 2XEWA 4GIVA 4BFRA 4FHJA 3ML9A 3PTFC 3APFA 5DCNA 2N9EB 4FJYA 2AL6A 1YX5B 2JVCA 3L0WB 1X1MA 3L13A 4N9F4 3W1YA 1P0RA 3R66C 4K7WA 2PJHA 2KXJA 1WZ0A 4MELA 5CHWA 2MQJA 2FCNA 5C23A 3L16A 2UYZB 3A9KA 1YD8U 2AYOB 1WR6E 5DPSA 2FAZA 2UWQA 4K81A 1E8YA 2CS4A 3PZDA 1Z2MA 2KDIA 1U4AA 2ZEQA 4ICUA 3R7RA 3JW0X 1GUAB 1E7UA 5BO4B 3ZLZA 3ZIMA 5G55A 2DZIA 3ZRCA 2RGFA 4A3PA 5D7GA 2EMSA 2IBIB 1UGMA 3QC8B 1G6JA 2KFKB 4IM0A 2LVOA 4DDID 1RLFA 3A4RA 2L7RA 2KQ7A 3B1LX 2B3AA 2PPHA 3PT2B 2JRHA 4PYUA 4PS8A 5CTRC 2G4SA 1P3QU 5JH5C 1E7VA 3M95A 2WDTB 2LGYA 3UF8A 2KANA 1ZGUB 3L17A 1UBQA 2C7NB 4BKSA 2LXCA 4GMVA 2KJ6A 3ML8A 1TGZB 1I42A 2M0XA 1WXSA 4M8NA 3TCAA 4WAAA 3IG3A 3ZNZB 3PRMB 3SDLC 4EUTA 4P7IA 3IFWB 4LJPB 4JIOU 3B0AA 1E8ZA 3K9PB 2Y5BB 2BGFA 1UBIA 2L00B 3OJ3A 3APDA 2LJ5A 3V61A 1RAXA 1WF9A 2DYMA 2KDEB 2KFKA 4GOCA 3UQAA 3AU4A 4XZ4A 5DPTA 2K6DB 4G11A 3ZDTA 4FLHA 2CHXA 1V49A 1LM8B 1WGGA 2WYQA 4LDTB 2MSED 3WA0A 4AOFA 1WGDA 4B95A 3H6NA 2EKEC 2XK5B 5J17A 4HDOA 3P2BA 4WJPA 1E90A 2AWTA 3DBSA 1EF5A 3V6EB 4G0NB 2HJ8A 3A9JB 1H8CA 1WRDB 3VQIA 4IWQA 3A1QA 3UIOB 4BKGA 4K7SA 2KKCA 2L3ZA 5AEKB 4CYEA 1GC7A 1C1YB 3ECIA 1ZKHA 3QAQA 4ANXA 2IO3B 5GMVA 2BKRB 2L0TA 4NNJB 3SHQA 2KFJA 5IAAC 1KOTA 2MX2A 2DYOA 2JRIB 3AXCA 2WWZA 3Q3JA 3H7PB 1WJ6A 3LJ3A 4KVGB 2NCNA 3VTVA 2JUOA 3A9JA 3GOEA 5CX3A 5HKHA 3HHMA 4W9LA 4CO7A 4EZLA 1F9JA 4KZCA 3KUDB 4PS7A 3ZRFA 4JL9A 4ZRIA 4MGIE 4XC2A 2M1MA 4YL8A 3WIMA 1GG3A 3VUYA 1T0YA 3S2AA 5E6PA 1WX7A 3N30A 4WWPA 3DQVA 3VTWA 1EF1A 2HE7A 2O6VB 4FJZA 3U30A 4K7UA 3EECA 2GBKA 4RM9A 4AJYB 1I35A 2O6VD 3PHWB 2KDFB 2Z0EB 2KC2A 3QWZB 4IWOA 2J0JA 3M63B 5JZEB 4ANWA 1IPGA 4B6WA 4I6PA 4HPLB 2IZVB 2R2OA 2K8CA 2RR9A 4BBNC 4MGZE 4WQOB 1WXMA 1WX8A 2LGXA 3EC8A 1LXDA 3QK0A 2IO2B 1FXTB 2L8JA 4JQWC 4TKNA 3RZWC 2KLGA 1NI2A 2V1YA 3U7DA 3DBRI 2FCQA 3QX1A 2I1KA 2BF8B 4NPNA 3DOWA 3NOBA 3EFUA 2KZRA 4AUQC 4I6NB 2OOBB 3ZW3A 4FA6A 4NJ7A 1OQYA 3QQ8B 1P1AA 2ZJDA 3H9DA 5FR6A 1Q5WB 1XD3B 4GSWA 3UGBB 1V81A 3ZDMC 2ZPYA 2ZCBA 3QCAA 4HDQA 4HLEA 1TTNA 2PE9A 3QHTA 4KDLB 3I3TB 4MH0E 5TR5A 3DBHI 3W1SC 3VH3B 4KIKA 1CMXB 2K8BA 2LVQA 3KVFB 3DVGY 4GN1A 4ZRJA 1LFDA 2GBNA 2FCSA 1KM7A 4HWIB 2DZMA 5DPWA 1WJ4A 4HK2A 4FJVB 2XK5A 4CHKA 4K1RB 4NQLB 3EHVA 3Q3FA 1J8CA 2DAFA 3PREA 2JT4B 5KHQA 2A5UA 2DYBA 2D07B 1WXVA 2J0MA 2MCNB 4BBNF 2GBMA 4LJOB 1JRUA 3RZFA 4GDLB 4NAWA 3TIXA 2KK8A 2LGDA 3A9KB 2KWVB 3KUCB 3M62B 3OAWA 3WAPA 2HTHA 3H7PA 1YJ1A 3VHTC 4BKTA 1V6EA 4IM3A 3NS8A 1RFAA 1V5TA 3WALA 2LASA 1UZXB 3R7QA 2DAJA 1YIWA 2KD0A 1E8XA 4W9EA 2OJRA 4MDKE 4OVUA 1WFYA 3VXWA 2ZNVB 2KX3A 1EO6A 1OEYA 1V2YA 2DENB 4MJSB 4BOSC 5CHVC 4X57B 1XT9B 4A3OA 4EOYA 4ANUA 3BINA 4M0WB 4MSQB 3PV1A 1IYFA 4IG7B 1L2NA 4B9KA 2JF5A 3PRZA 4F1SA 3N3KB 4HCPB 4TV3A 1OEYJ 4JLCA 4HPMB 4GU2A 2MWSB 3CSFA 4G3XB 5J2RA 1AARA 1UD7A 2YLMA 3APCA 3HIZA 4F8CB 1H4RA 1WGHA 2L0FA 3RD2A 2FIDA 3IVFA 3NY5A 1SGHA 2KOXA 3H7SA 1WI0A 2KMAA 2VRRB 1WE7A 4JGHB 1L7YA 2R2QA 3GZNI 2O6VA 4FHKA 2PE6B 3DVGX 2REXA 3VDZA 4DXAB 3DPDA 3TL5A 2AL3A 2LD9A 2WX0A 3AU5A 4XX5A 4EZKA 1WR1A 3N32A 4TQ1A 2XBBC 5CHFA 3ZNGC 1P9DU 1GJZA 1WXAA 2C60A 1WJUA 2LWPA 3TMPB 4DBGA 1IP9A 4KSLC 4FN2A 1J0GA 1S3SG 2N9PC 1R4NI 4EFOA 4M8MA 5AZFA 3TJPA 1Q1OA 3DBLI 4ZYNA 2MBBB 1QZEA 2CHWA 5AZGA 1A5RA 2C7MB 2GMIC 3RYTA 3PVLA 1WZ3A 1BT0A 3AULA 1RRBA 1LQBA 2M17A 4AJWA 3T9LA 3PSEB 3JSVB 4ANVA 2WX1A 3QIJA 3HM3A 4ICVA 3LDZE 2ZPNA 1P98A 4HJKA 2IO0B 3PS6A 3KYDD 3IBEA 4I6LB 3V62A 3ZVVA 1V86A 4IWPA 1R4MI 2NBWB 3A1QB 1V80A 2LZ6A 3ENEA 4WWNA 3QJZA 4MM3A 2K6QA 2L76A 5D2MB 3MTNB 5D6JB 1SE9A 2K39A 4W9DA 2KWCA 2KTRA 2Z59B 1SIFA 2MP2A 1WY8A 4FBJB 5L95C 3WAOA 1WYWB 3CF6E 5LXIB 1ZW7A 1WE6A 3DDCB 2C7HA 3CSTA 3AI5A 3R3MA 2O2VA 3PHXB 4KSKC 3O65B 4FULA 4MJSA 5DPRA 4GDKB 2ASQA 2LVPA 4GDLA 2J7QB 3RCZA 3V60A 3VVWB 4PS3A 4W9JA 2RD0A 4IM2A 4MEMA 1M94A 4W9KA 2LRUA 2DHZA 5LLIA 4WWOA 2CHZA 2ZCCA 5L83A 3V6CB 3RT3B 3IHPC 3HK0A 2N7DA 2GBRA 2IYDB 4KIKB 1YQBA 2ZVNA 5JHAA 3PGEA 4HVBA 2IO1B 2CR5A 4HXDA 2LRWA 3MJWA 2D10A 3B08A 4OVVA 4DHJB 3VUWA 3NZUA 2YVCA 3PLVA 2BYFA 3X23A 3X0WA 4DHJD 3U8ZA 3ALBA 4HCNB 1EUVB 3PPAA 1WIAA 1WMHA 2ZNVC 2M8SA 2L05A 3KH0A 4W9GA 1K8RB 2CU1A 3JYUA 4KV2A 4II3B 4EZJA 1KLVA 5AZHA 3L10B 3MHSD 4GDKA 1HE8A 3SU8X 1J19A 4TQ0A 2LXAA 3M3JA 2KN5A 3ZNID 1WX9A 3WANA 5E6OA 3UQBA 3ZTCA 1VD2A 5G2NA 1Z5SB 3ZTDA 5IA7A 3PRPB 2BWES 2DZJA 2CKHB 4A20A 2NR2A 4ZRKA 5EDSA 5JHBA 5C1ZA 2NBUA 1TZ1A 3JVZX 4BVUC 3DVNU 4GGQA 3JSVA 2N7EA 3HM6X 4IW0A 2FIFA 4URKA 4GXBA 1OGWA 1XQQA 2NPTA 4J6IA 1E5WA 5D94A 2MBEA 1Y8RC 1GC6A 4DWFA 3UINB 3WAMA 4AP4C 1WJNA 3VTUA 4ZDVA 4WJNA 3PLUA 3ZKJC 2J0KA 2C9WB 2JZ3B 2N1WA 3VFKA 2PEAA 1S1QB 2KMCA 2JPHA 2I1JA 4DDGD 2D11A 2BKFA 1OTRB 2EMTA 2G4DB 2MP2B 3A4SC 3W1SA 4RMAA 1KJTA 2V3SA 3VUXA 2JXXA 3K9OB 4IC7B 1VCBA 4NY0A 3H1UA 2N9XA 4LCDE 4WJOA 4E74A 2LI5A 4GB9A 1UELA 2HD5B 3KYCD 4ASWC 2NPTB 4DHZB 4F7ZA 1WM2A 2MW5A 1C3TA 2K25A 2G3QB 4DK5A 2GBJA 2KO3A 3CMMB 1V9JA 2MBOA 4TUUA 1GNUA 3DCGA 4WJQA 3TBLD 2KLCA 3C0RB 2QHOA 2RPQA 1TBEA 4MGKE 1WMHB 2BYVE 2MA9B 1WH3A 1WGYA 4W9IA 2MBHA 2D3GA 3QA8A 2IY0B 2V4LA 3OLMD 3UIPB 2FCMA 4NJ6A 1ISNA 2AEHA 2N4FA 2MBQA 1V5OA 5LXHA 4E3CA 1MG8A 1WM3A 2KJHB 2KDBA 4LDTD 2JZZA 2G45B 2RSUA 4W9HA 3T8MA 2K8HA 4BOZB 2D2QA 3ONSA 3L54A 3DVNV 2K1FA 2KQSA 5J18A 2JY6A 1E8WA 3ZO5B 4II2B 2Z0DB 2KJRA 2FUHB 3L08A 2BYEA 2KC1A 4E71A 4PYZA 2GOWA 2KWUB 4IUMB 3VH4B 2NS5A 2KNBA 3NZSA 2W9NA 2JWZA 2N1VA 4KZ0A 4BKSD 2M4NA 3A33B 3OJ4B 4G50A 3RUIB 2ZZPB 3D32A 2FNJB 1UH6A 5KHOA 2MRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSM B;  4AWJ A;  4NAW B;  4EEW A;  3NHE B;  3BY4 B;  4MGY E;  2NVU I;  1D3Z A;  3KUZ A;  2IY1 B;  2LUE A;  1NDD A;  2A4Z A;  2ZVO A;  3VAW A;  4FAD A;  3ZUN A;  3ZNH B;  2KTF A;  2NBV B;  2KHW B;  2KX0 A;  2MLB A;  2KTR B;  4W9C A;  4KDI C;  1Q0W B;  2BPS A;  3SD5 A;  4RM8 A;  3QAR A;  2DX5 B;  5E6N A;  4EKU A;  2BWF A;  4DHZ E;  2O2V B;  3KW5 B;  4NQK E;  1NBF C;  1PQS A;  4W9F A;  1WGR A;  3RUL A;  2DZK A;  1YX6 B;  2C5L C;  2KVR A;  2XEW A;  4GIV A;  4BFR A;  4FHJ A;  3ML9 A;  3PTF C;  3APF A;  5DCN A;  2N9E B;  4FJY A;  2AL6 A;  1YX5 B;  2JVC A;  3L0W B;  1X1M A;  3L13 A;  4N9F 4;  3W1Y A;  1P0R A;  3R66 C;  4K7W A;  2PJH A;  2KXJ A;  1WZ0 A;  4MEL A;  5CHW A;  2MQJ A;  2FCN A;  5C23 A;  3L16 A;  2UYZ B;  3A9K A;  1YD8 U;  2AYO B;  1WR6 E;  5DPS A;  2FAZ A;  2UWQ A;  4K81 A;  1E8Y A;  2CS4 A;  3PZD A;  1Z2M A;  2KDI A;  1U4A A;  2ZEQ A;  4ICU A;  3R7R A;  3JW0 X;  1GUA B;  1E7U A;  5BO4 B;  3ZLZ A;  3ZIM A;  5G55 A;  2DZI A;  3ZRC A;  2RGF A;  4A3P A;  5D7G A;  2EMS A;  2IBI B;  1UGM A;  3QC8 B;  1G6J A;  2KFK B;  4IM0 A;  2LVO A;  4DDI D;  1RLF A;  3A4R A;  2L7R A;  2KQ7 A;  3B1L X;  2B3A A;  2PPH A;  3PT2 B;  2JRH A;  4PYU A;  4PS8 A;  5CTR C;  2G4S A;  1P3Q U;  5JH5 C;  1E7V A;  3M95 A;  2WDT B;  2LGY A;  3UF8 A;  2KAN A;  1ZGU B;  3L17 A;  1UBQ A;  2C7N B;  4BKS A;  2LXC A;  4GMV A;  2KJ6 A;  3ML8 A;  1TGZ B;  1I42 A;  2M0X A;  1WXS A;  4M8N A;  3TCA A;  4WAA A;  3IG3 A;  3ZNZ B;  3PRM B;  3SDL C;  4EUT A;  4P7I A;  3IFW B;  4LJP B;  4JIO U;  3B0A A;  1E8Z A;  3K9P B;  2Y5B B;  2BGF A;  1UBI A;  2L00 B;  3OJ3 A;  3APD A;  2LJ5 A;  3V61 A;  1RAX A;  1WF9 A;  2DYM A;  2KDE B;  2KFK A;  4GOC A;  3UQA A;  3AU4 A;  4XZ4 A;  5DPT A;  2K6D B;  4G11 A;  3ZDT A;  4FLH A;  2CHX A;  1V49 A;  1LM8 B;  1WGG A;  2WYQ A;  4LDT B;  2MSE D;  3WA0 A;  4AOF A;  1WGD A;  4B95 A;  3H6N A;  2EKE C;  2XK5 B;  5J17 A;  4HDO A;  3P2B A;  4WJP A;  1E90 A;  2AWT A;  3DBS A;  1EF5 A;  3V6E B;  4G0N B;  2HJ8 A;  3A9J B;  1H8C A;  1WRD B;  3VQI A;  4IWQ A;  3A1Q A;  3UIO B;  4BKG A;  4K7S A;  2KKC A;  2L3Z A;  5AEK B;  4CYE A;  1GC7 A;  1C1Y B;  3ECI A;  1ZKH A;  3QAQ A;  4ANX A;  2IO3 B;  5GMV A;  2BKR B;  2L0T A;  4NNJ B;  3SHQ A;  2KFJ A;  5IAA C;  1KOT A;  2MX2 A;  2DYO A;  2JRI B;  3AXC A;  2WWZ A;  3Q3J A;  3H7P B;  1WJ6 A;  3LJ3 A;  4KVG B;  2NCN A;  3VTV A;  2JUO A;  3A9J A;  3GOE A;  5CX3 A;  5HKH A;  3HHM A;  4W9L A;  4CO7 A;  4EZL A;  1F9J A;  4KZC A;  3KUD B;  4PS7 A;  3ZRF A;  4JL9 A;  4ZRI A;  4MGI E;  4XC2 A;  2M1M A;  4YL8 A;  3WIM A;  1GG3 A;  3VUY A;  1T0Y A;  3S2A A;  5E6P A;  1WX7 A;  3N30 A;  4WWP A;  3DQV A;  3VTW A;  1EF1 A;  2HE7 A;  2O6V B;  4FJZ A;  3U30 A;  4K7U A;  3EEC A;  2GBK A;  4RM9 A;  4AJY B;  1I35 A;  2O6V D;  3PHW B;  2KDF B;  2Z0E B;  2KC2 A;  3QWZ B;  4IWO A;  2J0J A;  3M63 B;  5JZE B;  4ANW A;  1IPG A;  4B6W A;  4I6P A;  4HPL B;  2IZV B;  2R2O A;  2K8C A;  2RR9 A;  4BBN C;  4MGZ E;  4WQO B;  1WXM A;  1WX8 A;  2LGX A;  3EC8 A;  1LXD A;  3QK0 A;  2IO2 B;  1FXT B;  2L8J A;  4JQW C;  4TKN A;  3RZW C;  2KLG A;  1NI2 A;  2V1Y A;  3U7D A;  3DBR I;  2FCQ A;  3QX1 A;  2I1K A;  2BF8 B;  4NPN A;  3DOW A;  3NOB A;  3EFU A;  2KZR A;  4AUQ C;  4I6N B;  2OOB B;  3ZW3 A;  4FA6 A;  4NJ7 A;  1OQY A;  3QQ8 B;  1P1A A;  2ZJD A;  3H9D A;  5FR6 A;  1Q5W B;  1XD3 B;  4GSW A;  3UGB B;  1V81 A;  3ZDM C;  2ZPY A;  2ZCB A;  3QCA A;  4HDQ A;  4HLE A;  1TTN A;  2PE9 A;  3QHT A;  4KDL B;  3I3T B;  4MH0 E;  5TR5 A;  3DBH I;  3W1S C;  3VH3 B;  4KIK A;  1CMX B;  2K8B A;  2LVQ A;  3KVF B;  3DVG Y;  4GN1 A;  4ZRJ A;  1LFD A;  2GBN A;  2FCS A;  1KM7 A;  4HWI B;  2DZM A;  5DPW A;  1WJ4 A;  4HK2 A;  4FJV B;  2XK5 A;  4CHK A;  4K1R B;  4NQL B;  3EHV A;  3Q3F A;  1J8C A;  2DAF A;  3PRE A;  2JT4 B;  5KHQ A;  2A5U A;  2DYB A;  2D07 B;  1WXV A;  2J0M A;  2MCN B;  4BBN F;  2GBM A;  4LJO B;  1JRU A;  3RZF A;  4GDL B;  4NAW A;  3TIX A;  2KK8 A;  2LGD A;  3A9K B;  2KWV B;  3KUC B;  3M62 B;  3OAW A;  3WAP A;  2HTH A;  3H7P A;  1YJ1 A;  3VHT C;  4BKT A;  1V6E A;  4IM3 A;  3NS8 A;  1RFA A;  1V5T A;  3WAL A;  2LAS A;  1UZX B;  3R7Q A;  2DAJ A;  1YIW A;  2KD0 A;  1E8X A;  4W9E A;  2OJR A;  4MDK E;  4OVU A;  1WFY A;  3VXW A;  2ZNV B;  2KX3 A;  1EO6 A;  1OEY A;  1V2Y A;  2DEN B;  4MJS B;  4BOS C;  5CHV C;  4X57 B;  1XT9 B;  4A3O A;  4EOY A;  4ANU A;  3BIN A;  4M0W B;  4MSQ B;  3PV1 A;  1IYF A;  4IG7 B;  1L2N A;  4B9K A;  2JF5 A;  3PRZ A;  4F1S A;  3N3K B;  4HCP B;  4TV3 A;  1OEY J;  4JLC A;  4HPM B;  4GU2 A;  2MWS B;  3CSF A;  4G3X B;  5J2R A;  1AAR A;  1UD7 A;  2YLM A;  3APC A;  3HIZ A;  4F8C B;  1H4R A;  1WGH A;  2L0F A;  3RD2 A;  2FID A;  3IVF A;  3NY5 A;  1SGH A;  2KOX A;  3H7S A;  1WI0 A;  2KMA A;  2VRR B;  1WE7 A;  4JGH B;  1L7Y A;  2R2Q A;  3GZN I;  2O6V A;  4FHK A;  2PE6 B;  3DVG X;  2REX A;  3VDZ A;  4DXA B;  3DPD A;  3TL5 A;  2AL3 A;  2LD9 A;  2WX0 A;  3AU5 A;  4XX5 A;  4EZK A;  1WR1 A;  3N32 A;  4TQ1 A;  2XBB C;  5CHF A;  3ZNG C;  1P9D U;  1GJZ A;  1WXA A;  2C60 A;  1WJU A;  2LWP A;  3TMP B;  4DBG A;  1IP9 A;  4KSL C;  4FN2 A;  1J0G A;  1S3S G;  2N9P C;  1R4N I;  4EFO A;  4M8M A;  5AZF A;  3TJP A;  1Q1O A;  3DBL I;  4ZYN A;  2MBB B;  1QZE A;  2CHW A;  5AZG A;  1A5R A;  2C7M B;  2GMI C;  3RYT A;  3PVL A;  1WZ3 A;  1BT0 A;  3AUL A;  1RRB A;  1LQB A;  2M17 A;  4AJW A;  3T9L A;  3PSE B;  3JSV B;  4ANV A;  2WX1 A;  3QIJ A;  3HM3 A;  4ICV A;  3LDZ E;  2ZPN A;  1P98 A;  4HJK A;  2IO0 B;  3PS6 A;  3KYD D;  3IBE A;  4I6L B;  3V62 A;  3ZVV A;  1V86 A;  4IWP A;  1R4M I;  2NBW B;  3A1Q B;  1V80 A;  2LZ6 A;  3ENE A;  4WWN A;  3QJZ A;  4MM3 A;  2K6Q A;  2L76 A;  5D2M B;  3MTN B;  5D6J B;  1SE9 A;  2K39 A;  4W9D A;  2KWC A;  2KTR A;  2Z59 B;  1SIF A;  2MP2 A;  1WY8 A;  4FBJ B;  5L95 C;  3WAO A;  1WYW B;  3CF6 E;  5LXI B;  1ZW7 A;  1WE6 A;  3DDC B;  2C7H A;  3CST A;  3AI5 A;  3R3M A;  2O2V A;  3PHX B;  4KSK C;  3O65 B;  4FUL A;  4MJS A;  5DPR A;  4GDK B;  2ASQ A;  2LVP A;  4GDL A;  2J7Q B;  3RCZ A;  3V60 A;  3VVW B;  4PS3 A;  4W9J A;  2RD0 A;  4IM2 A;  4MEM A;  1M94 A;  4W9K A;  2LRU A;  2DHZ A;  5LLI A;  4WWO A;  2CHZ A;  2ZCC A;  5L83 A;  3V6C B;  3RT3 B;  3IHP C;  3HK0 A;  2N7D A;  2GBR A;  2IYD B;  4KIK B;  1YQB A;  2ZVN A;  5JHA A;  3PGE A;  4HVB A;  2IO1 B;  2CR5 A;  4HXD A;  2LRW A;  3MJW A;  2D10 A;  3B08 A;  4OVV A;  4DHJ B;  3VUW A;  3NZU A;  2YVC A;  3PLV A;  2BYF A;  3X23 A;  3X0W A;  4DHJ D;  3U8Z A;  3ALB A;  4HCN B;  1EUV B;  3PPA A;  1WIA A;  1WMH A;  2ZNV C;  2M8S A;  2L05 A;  3KH0 A;  4W9G A;  1K8R B;  2CU1 A;  3JYU A;  4KV2 A;  4II3 B;  4EZJ A;  1KLV A;  5AZH A;  3L10 B;  3MHS D;  4GDK A;  1HE8 A;  3SU8 X;  1J19 A;  4TQ0 A;  2LXA A;  3M3J A;  2KN5 A;  3ZNI D;  1WX9 A;  3WAN A;  5E6O A;  3UQB A;  3ZTC A;  1VD2 A;  5G2N A;  1Z5S B;  3ZTD A;  5IA7 A;  3PRP B;  2BWE S;  2DZJ A;  2CKH B;  4A20 A;  2NR2 A;  4ZRK A;  5EDS A;  5JHB A;  5C1Z A;  2NBU A;  1TZ1 A;  3JVZ X;  4BVU C;  3DVN U;  4GGQ A;  3JSV A;  2N7E A;  3HM6 X;  4IW0 A;  2FIF A;  4URK A;  4GXB A;  1OGW A;  1XQQ A;  2NPT A;  4J6I A;  1E5W A;  5D94 A;  2MBE A;  1Y8R C;  1GC6 A;  4DWF A;  3UIN B;  3WAM A;  4AP4 C;  1WJN A;  3VTU A;  4ZDV A;  4WJN A;  3PLU A;  3ZKJ C;  2J0K A;  2C9W B;  2JZ3 B;  2N1W A;  3VFK A;  2PEA A;  1S1Q B;  2KMC A;  2JPH A;  2I1J A;  4DDG D;  2D11 A;  2BKF A;  1OTR B;  2EMT A;  2G4D B;  2MP2 B;  3A4S C;  3W1S A;  4RMA A;  1KJT A;  2V3S A;  3VUX A;  2JXX A;  3K9O B;  4IC7 B;  1VCB A;  4NY0 A;  3H1U A;  2N9X A;  4LCD E;  4WJO A;  4E74 A;  2LI5 A;  4GB9 A;  1UEL A;  2HD5 B;  3KYC D;  4ASW C;  2NPT B;  4DHZ B;  4F7Z A;  1WM2 A;  2MW5 A;  1C3T A;  2K25 A;  2G3Q B;  4DK5 A;  2GBJ A;  2KO3 A;  3CMM B;  1V9J A;  2MBO A;  4TUU A;  1GNU A;  3DCG A;  4WJQ A;  3TBL D;  2KLC A;  3C0R B;  2QHO A;  2RPQ A;  1TBE A;  4MGK E;  1WMH B;  2BYV E;  2MA9 B;  1WH3 A;  1WGY A;  4W9I A;  2MBH A;  2D3G A;  3QA8 A;  2IY0 B;  2V4L A;  3OLM D;  3UIP B;  2FCM A;  4NJ6 A;  1ISN A;  2AEH A;  2N4F A;  2MBQ A;  1V5O A;  5LXH A;  4E3C A;  1MG8 A;  1WM3 A;  2KJH B;  2KDB A;  4LDT D;  2JZZ A;  2G45 B;  2RSU A;  4W9H A;  3T8M A;  2K8H A;  4BOZ B;  2D2Q A;  3ONS A;  3L54 A;  3DVN V;  2K1F A;  2KQS A;  5J18 A;  2JY6 A;  1E8W A;  3ZO5 B;  4II2 B;  2Z0D B;  2KJR A;  2FUH B;  3L08 A;  2BYE A;  2KC1 A;  4E71 A;  4PYZ A;  2GOW A;  2KWU B;  4IUM B;  3VH4 B;  2NS5 A;  2KNB A;  3NZS A;  2W9N A;  2JWZ A;  2N1V A;  4KZ0 A;  4BKS D;  2M4N A;  3A33 B;  3OJ4 B;  4G50 A;  3RUI B;  2ZZP B;  3D32 A;  2FNJ B;  1UH6 A;  5KHO A;  2MRP A; 
#chains in the Genus database with same CATH topology
 2INN E;  4NAW B;  1D3Z A;  3ZNH B;  3GP7 A;  2NBV B;  3DWM A;  2DX5 B;  1I4P A;  4EKU A;  1MPE A;  2O2V B;  3KW5 B;  3RUL A;  1K53 A;  1YX6 B;  1B1Z A;  2C5L C;  2Y3A A;  4GIV A;  3V3X A;  4KGS A;  5DCN A;  1VR9 A;  3W1Y A;  1KTK A;  3L13 A;  2J52 A;  2PJH A;  1XF5 L;  1N6Z A;  4XE0 A;  2AYO B;  1WR6 E;  2FAZ A;  3MC9 A;  2G9H D;  1Z2M A;  2WXG A;  4ICU A;  1E7U A;  4RFB A;  5BO4 B;  1VJK A;  3ZLZ A;  5G55 A;  1HEZ E;  4A3P A;  5D7G A;  2EMS A;  1FO4 A;  3EUB 2;  4JX1 C;  2KFK B;  2N7J A;  4IM0 A;  1RLF A;  3B1L X;  3FKY A;  2PPH A;  1QOA A;  4YT0 B;  4KGT A;  2G4S A;  4ZRQ A;  1OQR A;  2BBC A;  5IP4 D;  3M95 A;  2LGY A;  3Q6B A;  4BKS A;  1JML A;  3TSS A;  1Y56 A;  2KJ6 A;  3ML8 A;  1TGZ B;  3TCA A;  3PRM B;  4EUT A;  3AV8 A;  4NAM A;  4LJP B;  1UBI A;  1RAX A;  2KFK A;  2E6X A;  2JXT A;  3AU4 A;  4XZ4 A;  3UQA A;  1WWT A;  5DPT A;  4G11 A;  3DBR B;  1AWD A;  1LM8 B;  4AOF A;  1UGJ A;  2LHD A;  1E90 A;  3DBS A;  2HJ8 A;  4GLS C;  4K7S A;  5EE0 A;  4CYE A;  1V1P A;  3ECI A;  1ZKH A;  1V1O A;  4DXG A;  4D2K A;  2IO3 B;  2BKR B;  3AE8 B;  3P42 A;  2WWZ A;  3DBL B;  3LJ3 A;  2JUO A;  3GOE A;  5CX3 A;  2WXH A;  4W9L A;  2GI9 A;  4RCO A;  1C9F A;  1JRP A;  4JL9 A;  4ZRI A;  4MGI E;  2M1M A;  2JX5 A;  1WSP A;  4A55 A;  1T0Y A;  2BW2 A;  3S2A A;  3SR6 A;  3ZQ4 A;  3VTW A;  2O6V B;  3MP9 A;  1FNW A;  3EEC A;  2O6V D;  4N6E B;  3PHW B;  1F0Z A;  3QWZ B;  4B6W A;  1AN8 A;  2CU3 A;  4WQO B;  1FXT B;  1PGB A;  5HHD G;  3VRA B;  3DBR I;  3QX1 A;  1ACC A;  1UUP A;  4AUQ C;  3QQ8 B;  1NVI D;  1Q5W B;  1I4G A;  4ACF A;  1XEE A;  4HDQ A;  1DYQ A;  3QHT A;  5TR5 A;  3W1S C;  2WU5 B;  4KIK A;  2K8B A;  3HVZ A;  1LFD A;  2N0S B;  1KM7 A;  3EFC A;  1WJ4 A;  2JSV X;  4FJV B;  2XK5 A;  3PRE A;  2G1E A;  2GBM A;  4LJO B;  4GDL B;  1MG4 A;  2LGD A;  3KUC B;  2HTH A;  2NTS A;  1V6E A;  3OWE B;  1HTO A;  2LGS A;  1V5T A;  4LNK A;  1I7H A;  1UWX A;  1YIW A;  1PDX A;  4W9E A;  2OJR A;  4OZC A;  1QOF A;  2DLB A;  4M00 A;  4RH6 A;  3MJ5 A;  4HPP A;  4A90 A;  2MJE A;  3N1Y C;  4IG7 B;  1C4P A;  4RF0 A;  3URY A;  1Q10 A;  4MH8 A;  3RFZ B;  4JLC A;  4IOI E;  4MM3 B;  1SJH D;  1AAR A;  1UD7 A;  3APC A;  5D3D A;  1H4R A;  1WGH A;  3RD2 A;  2FID A;  3IVF A;  1ZUD 2;  3BZD B;  1KH0 A;  3ZYY X;  3GZN I;  4FHK A;  3DVG X;  3VDZ A;  2LD9 A;  4EZK A;  2KAC A;  4TQ1 A;  4ZHO A;  1WXA A;  4YSY B;  4DBG A;  4FN2 A;  5AZF A;  1FRR A;  1KFY B;  2C7M B;  3RYT A;  3PVL A;  1L0Y B;  2Q5W D;  3QIJ A;  3HM3 A;  3LDZ E;  1ZXH A;  1T0S C;  5C2T B;  2LZ6 A;  4NZL B;  3QJZ A;  5D2M B;  2KWC A;  2WXN A;  2KTR A;  1SIF A;  1FRD A;  3WAO A;  1WYW B;  2WXO A;  4YWG G;  3PHX B;  3O65 B;  4FUL A;  4MJS A;  2EKI A;  2J42 A;  3TUO A;  4GDL A;  3Q69 A;  1C77 A;  4WWO A;  3ZJT A;  2CHZ A;  2ZCC A;  3IHP C;  3HK0 A;  2IJ0 A;  4C80 A;  1YN4 A;  1YQB A;  3PGE A;  1BML C;  2CR5 A;  4HXD A;  4JWS C;  4ZRP A;  1ZDV A;  3PLV A;  3X0W A;  3AEC B;  3PO0 A;  1WMH A;  2PLP A;  1YJI A;  1GPX A;  2LGI A;  4W9G A;  1K8R B;  4KV2 A;  3JYU A;  1KLV A;  1AYF A;  3L10 B;  4TQ0 A;  3ZNI D;  3WAN A;  5E6O A;  5G5H A;  1VD2 A;  3ZTD A;  1NYQ A;  2J53 A;  2GB1 A;  4A20 A;  5BMH A;  1EU4 A;  1YMH E;  3DVN U;  3B2G A;  3AE1 B;  3HM6 X;  4GXB A;  2NPT A;  2MBE A;  1Y8R C;  4CQN A;  3WAM A;  4QAY A;  4ZDV A;  3PLU A;  3VFK A;  5BYR A;  2PEA A;  1S1Q B;  2JPH A;  1KLG D;  2I1J A;  4DDG D;  2MP2 B;  1SE3 A;  2IGD A;  3AEF B;  1L0V B;  4NY0 A;  2N9X A;  1QKZ A;  2LUM A;  1UEL A;  2HD5 B;  4ASW C;  3HRD D;  1WM2 A;  1C3T A;  3E56 A;  1HZ5 A;  3Q3O C;  2GBJ A;  3CMM B;  1M4V A;  3DHI C;  4TUU A;  2BTE A;  3TBL D;  2KLC A;  2PTL A;  2L1A A;  1BXT A;  3AE2 B;  1JQ4 A;  1WMH B;  2BYV E;  3AM9 A;  2MBH A;  2D3G A;  1NYR A;  2IY0 B;  2V4L A;  2FCM A;  1ISN A;  1TS2 A;  3Q8F A;  3C8Y A;  2MBQ A;  2KJH B;  4LDT D;  2KDB A;  4B0M A;  2E3T A;  2RSU A;  4RF1 A;  2JZP A;  3DVN V;  1E8W A;  1FMA D;  4II2 B;  2KJR A;  1TY0 A;  5FKA C;  2KC1 A;  5I4D A;  4YTP B;  4IUM B;  1AW7 A;  2W9N A;  4BKS D;  3A33 B;  4G50 A;  2JWU A;  3D32 A;  5KHO A;  2MRP A;  1TYG B;  1HXY D;  1L4Z B;  4AWJ A;  3BY4 B;  2NVU I;  3KUZ A;  2A4Z A;  1I4Q A;  3VAW A;  3ZUN A;  2KX0 A;  1F2R C;  2KTR B;  1Q0W B;  3SD5 A;  2M19 A;  3QAR A;  1T5X D;  2WHI A;  4DHZ E;  4NQK E;  1NBF C;  4W9F A;  2KVR A;  2XEW A;  3TEW A;  1CZP A;  4E3C A;  2AL6 A;  4TMA B;  2JVC A;  1X1M A;  4K7W A;  2KXJ A;  5C3J B;  3ETR A;  2MQJ A;  2FCN A;  5EE1 A;  3A9K A;  5DPS A;  2UWQ A;  1E8Y A;  2ZEQ A;  4K3B A;  4RGT A;  1GUA B;  1FM0 D;  3ZIM A;  2DZI A;  1MFW A;  4Q2J A;  2RDG A;  2IBI B;  5BMI A;  1UGM A;  1RM6 C;  1G6J A;  3MHZ A;  4DDI D;  3A4R A;  2L7R A;  2KQ7 A;  4XDC A;  4PS8 A;  3TEZ A;  3AEA B;  1E7V A;  1MI0 A;  2WDT B;  3MC8 A;  2KAN A;  1ZGU B;  1ET6 A;  1UBQ A;  3LXF A;  1GAQ B;  2LXC A;  1KLU D;  3AEG B;  2GLS A;  1I42 A;  2M0X A;  1WXS A;  2OED A;  3SDL C;  4JIO U;  2BGF A;  2INC C;  3APD A;  2LJ5 A;  1T0R C;  1N5X A;  2D5G A;  4MT5 A;  2K6D B;  3ZDT A;  4DQO C;  4JWU C;  1WGG A;  2K3U A;  2MSE D;  1WGD A;  5J17 A;  2XK5 B;  1ROE A;  3P2B A;  1SBB B;  3A9J B;  1H8C A;  1WRD B;  4IWQ A;  3A1Q A;  4NJC A;  4BKG A;  2KKC A;  2L3Z A;  1C1Y B;  4HKZ E;  1XO3 A;  3RNE C;  4LTU A;  2MJD A;  4PK1 A;  3SHQ A;  1KOT A;  3Q3M C;  4S17 A;  3Q3J A;  2DYO A;  3AXC A;  2NCN A;  3FIL A;  4CO7 A;  3I9V 1;  4KZC A;  2QMT A;  4RGO S;  4RGN A;  4XC2 A;  4C56 C;  4YL8 A;  1F77 A;  1YN3 A;  4JPS A;  2V3P A;  3OG5 A;  4WWP A;  3DQV A;  4FJZ A;  3U30 A;  2V9H A;  4XWW A;  2BVC A;  1FD6 A;  4EE2 A;  1I35 A;  2KDF B;  4LLG M;  5JZE B;  4ANW A;  3KWL A;  1LO5 D;  1K52 A;  2WXI A;  2WXL A;  3EC8 A;  3QK0 A;  4MAC A;  1NI2 A;  2KN4 A;  2V1Y A;  2KVZ A;  4IKG A;  2EEL A;  2KWD A;  3RNC C;  4NPN A;  3DOW A;  4I6N B;  2OOB B;  4NJ7 A;  2PW9 A;  3U4E G;  1V8C A;  4GSW A;  4RNA A;  2ZPY A;  3QCA A;  1VRA B;  1NEK B;  3MFG A;  2PE9 A;  4MH0 E;  3P4Q B;  2DWQ A;  4GN1 A;  2IPK D;  4ZRJ A;  3AEE B;  2WXP A;  1YOV B;  3KWV A;  2GBN A;  2FCS A;  2DZM A;  2VH1 A;  4K1R B;  2V4I B;  3Q3F A;  2JT4 B;  1R7S A;  2DYB A;  2WDR B;  2J0M A;  1IGC A;  2MCN B;  1JRU A;  4WQM A;  2KK8 A;  3WAP A;  3OAW A;  3NS8 A;  2LFI A;  2LAS A;  1UZX B;  1L5P A;  2DAJ A;  2RMM A;  1E8X A;  1WFY A;  3VXW A;  1ESF A;  2HTM E;  4BOS C;  5CHV C;  3BVZ A;  3E9S A;  1GB1 A;  2J4X A;  1OFF A;  4ZHP A;  4EOY A;  2WXJ A;  2BQQ A;  3T3N A;  3DHG C;  3BIN A;  4J3O D;  4LNF A;  1L2N A;  3N20 C;  3PRZ A;  2WP9 B;  3Q8B A;  3N3K B;  1OEY J;  3Q8E A;  5J2R A;  2MWS B;  3CSF A;  1TT5 B;  1C76 A;  2YLM A;  1CJE A;  3DBH B;  2WLB A;  3NY5 A;  1XCT L;  1E6E B;  1WI0 A;  3H7S A;  4JGH B;  2QIE B;  3RNF C;  4RGM A;  2O6V A;  4P6V F;  5BYS A;  5JXV A;  4XX5 A;  3AU5 A;  1R4N B;  3N32 A;  3ZNG C;  2C60 A;  3J9C A;  1PFD A;  1R4N I;  3TJP A;  3BYT B;  4ZOH C;  2PVO D;  2Y5P A;  1A5R A;  3P4P B;  1WZ3 A;  1BT0 A;  1RRB A;  4YSZ B;  4ANV A;  2DNF A;  1JWM D;  4ICV A;  1P98 A;  3PS6 A;  3KYD D;  1V80 A;  3ENE A;  1FEH A;  3ZGZ A;  5L95 C;  5HFY A;  3CF6 E;  5LXI B;  2ACZ B;  1WE6 A;  5T8I A;  4N58 A;  3CST A;  4KSK C;  5DPR A;  3IXS A;  4GDK B;  2ASQ A;  1L0X B;  2RD0 A;  4W9K A;  1SF0 A;  2JU6 X;  1T0Q C;  3RNA C;  3V6C B;  3RT3 B;  1T3Q A;  4TSS A;  1K50 A;  1MHH E;  1QLB B;  2GBR A;  5AUK A;  3AE4 B;  2NMQ A;  2LRW A;  1JAL A;  1TKE A;  1MHX A;  2I38 A;  3P63 A;  4DHJ B;  3VUW A;  3NZU A;  2AQ2 B;  2BYF A;  3AE5 B;  3NZ3 A;  4DHJ D;  3U8Z A;  4XYC A;  3SEB A;  4HCN B;  1UNS A;  3GE3 C;  2M8S A;  2L05 A;  3RNG C;  1FNU A;  1SE4 A;  4HRO A;  3MHS D;  3AE3 B;  2QSD A;  2W3S A;  3BK2 A;  2N9K A;  3ZTC A;  1DOI A;  2JYT A;  1Z5S B;  1OQQ A;  3PRP B;  2BWE S;  5IN7 A;  2CKH B;  2VZK D;  1I4X A;  2NBU A;  2PKO A;  3AE6 B;  4GGQ A;  2VZK B;  4IW0 A;  3BWU D;  4C7Y A;  2N9L A;  1XQQ A;  4J6I A;  5D94 A;  2QIL A;  3AN1 A;  5FR3 A;  1QF6 A;  1JRO A;  3HUI A;  4C4V A;  4WJN A;  4US8 A;  1PYW D;  1OTR B;  3W1S A;  3VUX A;  4AS1 A;  4USA A;  4E74 A;  1J7C A;  2DBY A;  2NPT B;  4DHZ B;  1P7E A;  3CIR B;  2MW5 A;  2G3Q B;  4DK5 A;  2KO3 A;  1V9J A;  5IO9 A;  2WNM A;  3C0R B;  4KX6 B;  3W5U B;  2RPQ A;  1NEN B;  2KT7 A;  2MA9 B;  2L52 A;  1WGY A;  1ENF A;  2AEH A;  1V5O A;  1MG8 A;  1WM3 A;  5IOI A;  1N60 A;  2JZZ A;  4W9H A;  2PVG C;  1FCL A;  2D2Q A;  3L54 A;  1MVK A;  2K1F A;  1IGD A;  1XLO A;  1UF0 A;  3ZO5 B;  3ZJU A;  2Z0D B;  2IDY A;  2FUH B;  1ZDX A;  2GOW A;  2FE8 A;  3NZS A;  2N1V A;  3RUI B;  1D5X C;  1PUT A;  1QOG A;  2FNJ B;  1UH6 A;  3PZ8 A;  4BZA A;  4MSM B;  4M02 A;  4MGY E;  1D4B A;  2ZVO A;  1BUI C;  3VRB B;  2MLB A;  4KDI C;  4RM8 A;  1J7B A;  2BWF A;  1YQ3 B;  1PQS A;  1A70 A;  1WGR A;  2DZK A;  4BFR A;  1XXG A;  2CJN A;  3PTF C;  4FHJ A;  1I4R A;  1SXT A;  5FK9 C;  3U52 E;  2N9E B;  4FJY A;  3L0W B;  2FUG 1;  1P0R A;  3NS1 A;  1WZ0 A;  3P4S B;  1DOX A;  2M0A A;  1L6U A;  1QIL A;  5C23 A;  3DHH C;  3L16 A;  1YD8 U;  1FCC C;  1FPY A;  3PZD A;  4WWM A;  1U4A A;  3R7R A;  3FAH A;  1VLB A;  2V0G A;  1JW9 D;  1F2R I;  3QC8 B;  4FXC A;  2LVO A;  3W5V B;  2JYE A;  2KMM A;  4P1B C;  3PT2 B;  1KF6 B;  5CTR C;  1P3Q U;  1F1H A;  3EA6 A;  3L17 A;  3SFE B;  3Q3N C;  3IT4 B;  2JQR B;  3UI3 A;  2L83 A;  2ZW0 A;  4M8N A;  3N1X C;  2QEJ C;  3AH7 A;  4P7I A;  3IFW B;  3V05 A;  3B0A A;  1E8Z A;  2WXM A;  1FIQ A;  3V61 A;  3HVD A;  1WF9 A;  2CHX A;  5G5G A;  4LDT B;  3H6N A;  2EKE C;  2AWT A;  3P1M A;  1EF5 A;  3V6E B;  5H92 C;  3UIO B;  1CK1 A;  3H8H A;  2GRI A;  3AED B;  1ZE3 D;  2VH2 A;  5BYQ A;  1SIJ A;  3AB5 A;  2K9X A;  5GMV A;  2K0P A;  2KFJ A;  1MJD A;  2WU2 B;  2MX2 A;  1WJ6 A;  4KVG B;  2SAK A;  5HKH A;  3HHM A;  1WXQ A;  3KUD B;  1N5W A;  4O1N A;  2YEP B;  4UDU C;  2WS3 B;  3WIM A;  2BS4 B;  3VUY A;  3N1Z C;  1WX7 A;  4OVZ A;  3N30 A;  1EF1 A;  4K3C A;  2GBK A;  2QJL A;  3B9J A;  4AJY B;  1ZOY B;  2Z0E B;  2W54 A;  3M63 B;  3KQ4 A;  1JWA D;  3T3O A;  2R2O A;  2K8C A;  3ABV B;  4MGZ E;  1XLQ A;  1WXM A;  1WX8 A;  2L8J A;  3RZW C;  3IAM 1;  4ARC A;  3RN9 C;  2X8X X;  4DXF A;  3NUH B;  2BF8 B;  4LK0 M;  5HI1 A;  3NOB A;  2KZR A;  1OQY A;  1P1A A;  2ZJD A;  4PT5 A;  1D5M C;  3UGB B;  1V81 A;  3CWI A;  2ZCB A;  4HLE A;  3RI7 C;  1SEB D;  1ET9 A;  4KDL B;  3I3T B;  3DBH I;  1TIF A;  3VH3 B;  1RYJ A;  1CMX B;  3BVM A;  5LNK 1;  4AQ7 A;  4WAF A;  5DPW A;  4HK2 A;  4NQL B;  3EHV A;  5KHQ A;  1TKY A;  1WXV A;  3NVY A;  3RZF A;  3TIX A;  3M62 B;  1YJ1 A;  3VHT C;  4A8X C;  4IM3 A;  1RFA A;  1JWB D;  2BT6 A;  4MDK E;  4OVU A;  1TZO A;  2KX3 A;  1OEY A;  4BAX A;  1V2Y A;  4X57 B;  2AQ1 B;  4A3O A;  4M0W B;  4MSQ B;  3PV1 A;  4B9K A;  1IUE A;  1R4M B;  4HCP B;  4TV3 A;  1E7P B;  3LYY A;  4HPM B;  4GU2 A;  1K51 A;  4G3X B;  4OHJ A;  3I63 C;  3HIZ A;  3NG0 A;  4F8C B;  3GS2 A;  2RPV A;  2L0F A;  1SGH A;  2KOX A;  4KKJ A;  2KMA A;  1WE7 A;  5BMG A;  2MEK A;  2R2Q A;  1V1P B;  1ZP0 B;  4DXA B;  3TL5 A;  2AL3 A;  2WX0 A;  1C4A A;  1WR1 A;  1IBX B;  3BYY B;  2XBB C;  2W3R A;  1GJZ A;  2LWP A;  4XWT A;  1IP9 A;  1J0G A;  2M56 B;  2D3C A;  3VR9 B;  4M8M A;  4HEA 1;  1Q1O A;  4ZYN A;  1GOZ A;  1QZE A;  4WUR A;  1E0Z A;  4HKQ A;  3Q2A C;  2GMI C;  3NJT A;  2WDQ B;  1E10 A;  1LQB A;  2M17 A;  3T9L A;  1FNV A;  2SEB D;  2WX1 A;  2ZPN A;  2IO0 B;  3ZVV A;  3IBE A;  4I6L B;  1V86 A;  2B76 B;  3AE7 B;  3A1Q B;  4WWN A;  2IGH A;  2K6Q A;  5D6J B;  3Q14 C;  1SE9 A;  4OZB A;  1EWY C;  1WY8 A;  2K22 A;  3EGR A;  1ZW7 A;  1V97 A;  3DDC B;  4C4V B;  4ARI A;  1N63 A;  3R3M A;  2O2V A;  1VZ7 A;  4OZA A;  2J7Q B;  4L23 A;  2FBW B;  4MEM A;  3P4R B;  1M94 A;  2LRU A;  2DHZ A;  3RPF C;  5LLI A;  2LEK A;  5D3I B;  3I57 A;  4KIK B;  2ZVN A;  4HVB A;  2IO1 B;  3MJW A;  2D10 A;  3IT6 B;  1QQR A;  3AMZ A;  3ALB A;  4OW0 A;  3PPA A;  1EM7 A;  1WIA A;  3U7Z A;  3MC0 B;  3KH0 A;  4GDK A;  1C78 A;  1HE8 A;  3SU8 X;  2LXA A;  3M3J A;  1TY2 A;  3UQB A;  2DZJ A;  5JHB A;  2NR2 A;  4ZRK A;  5C1Z A;  4H2A A;  3R8B A;  1TZ1 A;  4URK A;  1E5W A;  1GC6 A;  5EE3 A;  1FFU A;  4DWF A;  1ZXI A;  4AP4 C;  4B0E A;  1WJN A;  3ZKJ C;  2C9W B;  2JZ3 B;  2N1W A;  1YN5 A;  2D11 A;  2EMT A;  1KJT A;  2V3S A;  4IC7 B;  2LI5 A;  5IKC M;  4GB9 A;  1FXA A;  2AX5 A;  3DWG C;  2K25 A;  5MPO A;  1GNU A;  3DCG A;  4A6Q A;  1L4D B;  2QHO A;  4IDI A;  1FFV A;  1WH3 A;  3BK1 A;  3QA8 A;  2MJ3 A;  4P16 A;  1RWS A;  2N4F A;  5LXH A;  1DGJ A;  2QCZ A;  2D3B A;  2G45 B;  3T8M A;  1VDV A;  3ONS A;  2XN9 C;  2W82 A;  2MH7 A;  4PYZ A;  2WXQ A;  3VH4 B;  2KNB A;  2JWZ A;  1CQV A;  4KZ0 A;  3OJ4 B;  3I5J C;  2Z8L A;  2ZZP B;  3GE8 C;  4EEW A;  3NHE B;  1J7A A;  2IY1 B;  2LUE A;  1NDD A;  4FAD A;  2KTF A;  2KHW B;  4W9C A;  1B9R A;  1F52 A;  2BPS A;  3BII D;  3ZXV A;  5E6N A;  2XNA C;  3AE9 B;  2OJW A;  3ML9 A;  4N59 A;  3APF A;  1YX5 B;  4JE3 B;  4N9F 4;  3R66 C;  4L1B A;  4MEL A;  5CHW A;  1IBX A;  2WGS A;  2UYZ B;  4K81 A;  2BB5 A;  2CS4 A;  2KDI A;  3GB1 A;  3JW0 X;  4YSX B;  3ZRC A;  2RGF A;  2QC8 A;  2INP E;  2R61 A;  1LGR A;  3RMK C;  2B3A A;  4ITK A;  2QDF A;  2JRH A;  4PYU A;  5JH5 C;  1L6V A;  3UF8 A;  4XDD A;  2C7N B;  1N61 A;  4GMV A;  5EE9 A;  3L4P A;  4WAA A;  1P7F A;  3IG3 A;  3ZNZ B;  2HDE A;  3AEB B;  2KDM A;  3NRZ A;  3K9P B;  2Y5B B;  2L00 B;  3OJ3 A;  2V3N A;  2DYM A;  2KDE B;  4GOC A;  4FLH A;  1V49 A;  2WYQ A;  2ON8 A;  3ZJV A;  3WA0 A;  4B95 A;  4HDO A;  4S0R A;  4YXD B;  4WJP A;  4G0N B;  3FIL B;  3VQI A;  1DOY A;  2BB6 A;  2CJO A;  2KYW A;  5AEK B;  1GC7 A;  3QAQ A;  4ANX A;  2L0T A;  4NNJ B;  2WXF A;  5IAA C;  4C7Z A;  2JRI B;  3B2F A;  3H7P B;  3VTV A;  3A9J A;  4R3D A;  2D3A A;  4EZL A;  1F9J A;  1STE A;  3PZ7 A;  4PS7 A;  3ZRF A;  4P1C C;  1D5Z C;  2TSS A;  1GG3 A;  5E6P A;  1YJJ A;  1WYG A;  2HE7 A;  1HQR D;  4K7U A;  4RM9 A;  1QOB A;  2BS2 B;  2KC2 A;  4IWO A;  2J0J A;  1IPG A;  1QT9 A;  2BS3 B;  4I6P A;  5H8Y E;  4HPL B;  2IZV B;  2W55 A;  2RR9 A;  4BBN C;  1SJE D;  2WXK A;  2LGX A;  4TKN A;  1LXD A;  4JQW C;  2IO2 B;  2KLG A;  4HJG E;  3U7D A;  2FCQ A;  2HJ1 A;  2I1K A;  5GXG B;  3Q8C A;  5HG2 A;  3EFU A;  3ZW3 A;  4FA6 A;  3H9D A;  5FR6 A;  2LJI A;  1XD3 B;  3ZDM C;  4KKI A;  2WXR A;  2ICI A;  3BVG A;  1KRH A;  1TTN A;  2WQY B;  3ZXR A;  2RDH A;  3N9Y C;  2H88 B;  2IND C;  2LVQ A;  3KVF B;  3DVG Y;  4US9 A;  2X38 A;  4ZYS A;  2ZW1 A;  4HWI B;  1JCK B;  4CHK A;  1E9M A;  4LNI A;  1J8C A;  2DAF A;  3RNB C;  3KLS X;  1HZ6 A;  2A5U A;  2D07 B;  4BBN F;  4NAW A;  3A9K B;  3R2T A;  2KWV B;  4BKT A;  1TS4 A;  3H7P A;  3WAL A;  3R7Q A;  2KD0 A;  1N62 A;  2ZNV B;  4M0W A;  3U2S C;  4YTM B;  1EO6 A;  4MJS B;  2DEN B;  1XT9 B;  3C19 A;  4ANU A;  1YNT E;  1IYF A;  2JF5 A;  4F1S A;  1JWU D;  2OHF A;  2IGG A;  2LHE A;  1XLP A;  1YQ4 B;  3NVV A;  3GZN B;  1D6E C;  2ONQ A;  2VRR B;  1L7Y A;  2PE6 B;  2REX A;  1EWC A;  3DPD A;  4YTN B;  5CHF A;  1P9D U;  1WJU A;  2Y5C A;  3TMP B;  4REZ A;  4KSL C;  1S3S G;  2N9P C;  4EFO A;  2UU7 A;  3DBL I;  2MBB B;  2CHW A;  5AZG A;  1XLN A;  3AUL A;  4C00 A;  4AJW A;  3PSE B;  3JSV B;  3LB8 C;  1HA5 A;  1SSN A;  4HRS A;  4HJK A;  2K5P A;  3V62 A;  4IWP A;  1R4M I;  2NBW B;  3R2I A;  4MM3 A;  2RDB C;  2L76 A;  2YEP F;  3MTN B;  2K39 A;  4W9D A;  4LNN A;  2Z59 B;  2MP2 A;  3IAS 1;  4FBJ B;  3W2D A;  2NTT A;  1SB3 C;  2KQ4 X;  2C7H A;  3AI5 A;  2WDV B;  1C79 A;  3RCZ A;  2LVP A;  3O13 A;  1UWM A;  3V60 A;  4PS3 A;  4W9J A;  2PIA A;  4IM2 A;  3VVW B;  4LNO A;  1JWS D;  4KGR A;  5L83 A;  4A9A A;  1I4H A;  2N7D A;  2IYD B;  5JHA A;  1WGK A;  3B08 A;  4OVV A;  2YVC A;  5E6J A;  1EU3 A;  1XCQ L;  3X23 A;  1WRI A;  1HTQ A;  1EUV B;  1GB4 A;  2ZNV C;  1VZ8 A;  1NI3 A;  2CU1 A;  4EZJ A;  4II3 B;  1T6B X;  5AZH A;  1J19 A;  4XGA B;  3NVZ A;  2KN5 A;  1WX9 A;  5G2N A;  5TSS A;  5IA7 A;  5EDS A;  2H89 B;  1FXI A;  2L32 A;  3NVW A;  3JVZ X;  4BVU C;  1C4C A;  3JSV A;  4WIP A;  2N7E A;  2FIF A;  1OGW A;  3FC4 A;  1VZ6 A;  3UIN B;  3VTU A;  2LMC A;  2J0K A;  3WCQ A;  2KMC A;  2BKF A;  2G4D B;  2BYT A;  3VR8 B;  3A4S C;  4RMA A;  2JXX A;  2KAJ A;  3K9O B;  1VCB A;  3SFD B;  3H1U A;  4LCD E;  4WJO A;  3KYC D;  4F7Z A;  2AQ3 B;  5AUI A;  1RFK A;  2MBO A;  4WJQ A;  1TKG A;  1TBE A;  4MGK E;  4W9I A;  1TJE A;  4M01 A;  3OLM D;  3UIP B;  4NJ6 A;  1PGX A;  4WH4 A;  3TEX A;  1PGA A;  4BOZ B;  3Q8A A;  2K8H A;  1TS5 A;  2KQS A;  5J18 A;  2JY6 A;  1TS3 A;  3L08 A;  4L2Y A;  2BYE A;  4E71 A;  2KWU B;  2NS5 A;  2MHJ A;  1SE2 A;  3TEY A;  2M4N A;  2I2Y A;  1ZPS A;  3W9C B;  2PMV A; 
#chains in the Genus database with same CATH homology
 4MSM B;  4AWJ A;  4NAW B;  4EEW A;  3NHE B;  3BY4 B;  4MGY E;  2NVU I;  1D3Z A;  3KUZ A;  2IY1 B;  2LUE A;  1NDD A;  2A4Z A;  2ZVO A;  3VAW A;  4FAD A;  3ZUN A;  3ZNH B;  2KTF A;  2NBV B;  2KHW B;  2KX0 A;  2MLB A;  2KTR B;  4W9C A;  4KDI C;  1Q0W B;  2BPS A;  3SD5 A;  4RM8 A;  3QAR A;  2DX5 B;  5E6N A;  4EKU A;  2BWF A;  4DHZ E;  2O2V B;  3KW5 B;  4NQK E;  1NBF C;  1PQS A;  4W9F A;  1WGR A;  3RUL A;  2DZK A;  1YX6 B;  2C5L C;  2KVR A;  2XEW A;  4GIV A;  4BFR A;  4FHJ A;  3ML9 A;  3PTF C;  3APF A;  5DCN A;  2N9E B;  4FJY A;  2AL6 A;  1YX5 B;  2JVC A;  3L0W B;  1X1M A;  3L13 A;  4N9F 4;  3W1Y A;  1P0R A;  3R66 C;  4K7W A;  2PJH A;  2KXJ A;  1WZ0 A;  4MEL A;  5CHW A;  2MQJ A;  2FCN A;  5C23 A;  3L16 A;  2UYZ B;  3A9K A;  1YD8 U;  2AYO B;  1WR6 E;  5DPS A;  2FAZ A;  2UWQ A;  4K81 A;  1E8Y A;  2CS4 A;  3PZD A;  1Z2M A;  2KDI A;  1U4A A;  2ZEQ A;  4ICU A;  3R7R A;  3JW0 X;  1GUA B;  1E7U A;  5BO4 B;  3ZLZ A;  3ZIM A;  5G55 A;  2DZI A;  3ZRC A;  2RGF A;  4A3P A;  5D7G A;  2EMS A;  2IBI B;  1UGM A;  3QC8 B;  1G6J A;  2KFK B;  4IM0 A;  2LVO A;  4DDI D;  1RLF A;  3A4R A;  2L7R A;  2KQ7 A;  3B1L X;  2B3A A;  2PPH A;  3PT2 B;  2JRH A;  4PYU A;  4PS8 A;  5CTR C;  2G4S A;  1P3Q U;  5JH5 C;  1E7V A;  3M95 A;  2WDT B;  2LGY A;  3UF8 A;  2KAN A;  1ZGU B;  3L17 A;  1UBQ A;  2C7N B;  4BKS A;  2LXC A;  4GMV A;  2KJ6 A;  3ML8 A;  1TGZ B;  1I42 A;  2M0X A;  1WXS A;  4M8N A;  3TCA A;  4WAA A;  3IG3 A;  3ZNZ B;  3PRM B;  3SDL C;  4EUT A;  4P7I A;  3IFW B;  4LJP B;  4JIO U;  3B0A A;  1E8Z A;  3K9P B;  2Y5B B;  2BGF A;  1UBI A;  2L00 B;  3OJ3 A;  3APD A;  2LJ5 A;  3V61 A;  1RAX A;  1WF9 A;  2DYM A;  2KDE B;  2KFK A;  4GOC A;  3UQA A;  3AU4 A;  4XZ4 A;  5DPT A;  2K6D B;  4G11 A;  3ZDT A;  4FLH A;  2CHX A;  1V49 A;  1LM8 B;  1WGG A;  2WYQ A;  4LDT B;  2MSE D;  3WA0 A;  4AOF A;  1WGD A;  4B95 A;  3H6N A;  2EKE C;  2XK5 B;  5J17 A;  4HDO A;  3P2B A;  4WJP A;  1E90 A;  2AWT A;  3DBS A;  1EF5 A;  3V6E B;  4G0N B;  2HJ8 A;  3A9J B;  1H8C A;  1WRD B;  3VQI A;  4IWQ A;  3A1Q A;  3UIO B;  4BKG A;  4K7S A;  2KKC A;  2L3Z A;  5AEK B;  4CYE A;  1GC7 A;  1C1Y B;  3ECI A;  1ZKH A;  3QAQ A;  4ANX A;  2IO3 B;  5GMV A;  2BKR B;  2L0T A;  4NNJ B;  3SHQ A;  2KFJ A;  5IAA C;  1KOT A;  2MX2 A;  2DYO A;  2JRI B;  3AXC A;  2WWZ A;  3Q3J A;  3H7P B;  1WJ6 A;  3LJ3 A;  4KVG B;  2NCN A;  3VTV A;  2JUO A;  3A9J A;  3GOE A;  5CX3 A;  5HKH A;  3HHM A;  4W9L A;  4CO7 A;  4EZL A;  1F9J A;  4KZC A;  3KUD B;  4PS7 A;  3ZRF A;  4JL9 A;  4ZRI A;  4MGI E;  4XC2 A;  2M1M A;  4YL8 A;  3WIM A;  1GG3 A;  3VUY A;  1T0Y A;  3S2A A;  5E6P A;  1WX7 A;  3N30 A;  4WWP A;  3DQV A;  3VTW A;  1EF1 A;  2HE7 A;  2O6V B;  4FJZ A;  3U30 A;  4K7U A;  3EEC A;  2GBK A;  4RM9 A;  4AJY B;  1I35 A;  2O6V D;  3PHW B;  2KDF B;  2Z0E B;  2KC2 A;  3QWZ B;  4IWO A;  2J0J A;  3M63 B;  5JZE B;  4ANW A;  1IPG A;  4B6W A;  4I6P A;  4HPL B;  2IZV B;  2R2O A;  2K8C A;  2RR9 A;  4BBN C;  4MGZ E;  4WQO B;  1WXM A;  1WX8 A;  2LGX A;  3EC8 A;  1LXD A;  3QK0 A;  2IO2 B;  1FXT B;  2L8J A;  4JQW C;  4TKN A;  3RZW C;  2KLG A;  1NI2 A;  2V1Y A;  3U7D A;  3DBR I;  2FCQ A;  3QX1 A;  2I1K A;  2BF8 B;  4NPN A;  3DOW A;  3NOB A;  3EFU A;  2KZR A;  4AUQ C;  4I6N B;  2OOB B;  3ZW3 A;  4FA6 A;  4NJ7 A;  1OQY A;  3QQ8 B;  1P1A A;  2ZJD A;  3H9D A;  5FR6 A;  1Q5W B;  1XD3 B;  4GSW A;  3UGB B;  1V81 A;  3ZDM C;  2ZPY A;  2ZCB A;  3QCA A;  4HDQ A;  4HLE A;  1TTN A;  2PE9 A;  3QHT A;  4KDL B;  3I3T B;  4MH0 E;  5TR5 A;  3DBH I;  3W1S C;  3VH3 B;  4KIK A;  1CMX B;  2K8B A;  2LVQ A;  3KVF B;  3DVG Y;  4GN1 A;  4ZRJ A;  1LFD A;  2GBN A;  2FCS A;  1KM7 A;  4HWI B;  2DZM A;  5DPW A;  1WJ4 A;  4HK2 A;  4FJV B;  2XK5 A;  4CHK A;  4K1R B;  4NQL B;  3EHV A;  3Q3F A;  1J8C A;  2DAF A;  3PRE A;  2JT4 B;  5KHQ A;  2A5U A;  2DYB A;  2D07 B;  1WXV A;  2J0M A;  2MCN B;  4BBN F;  2GBM A;  4LJO B;  1JRU A;  3RZF A;  4GDL B;  4NAW A;  3TIX A;  2KK8 A;  2LGD A;  3A9K B;  2KWV B;  3KUC B;  3M62 B;  3OAW A;  3WAP A;  2HTH A;  3H7P A;  1YJ1 A;  3VHT C;  4BKT A;  1V6E A;  4IM3 A;  3NS8 A;  1RFA A;  1V5T A;  3WAL A;  2LAS A;  1UZX B;  3R7Q A;  2DAJ A;  1YIW A;  2KD0 A;  1E8X A;  4W9E A;  2OJR A;  4MDK E;  4OVU A;  1WFY A;  3VXW A;  2ZNV B;  2KX3 A;  1EO6 A;  1OEY A;  1V2Y A;  2DEN B;  4MJS B;  4BOS C;  5CHV C;  4X57 B;  1XT9 B;  4A3O A;  4EOY A;  4ANU A;  3BIN A;  4M0W B;  4MSQ B;  3PV1 A;  1IYF A;  4IG7 B;  1L2N A;  4B9K A;  2JF5 A;  3PRZ A;  4F1S A;  3N3K B;  4HCP B;  4TV3 A;  1OEY J;  4JLC A;  4HPM B;  4GU2 A;  2MWS B;  3CSF A;  4G3X B;  5J2R A;  1AAR A;  1UD7 A;  2YLM A;  3APC A;  3HIZ A;  4F8C B;  1H4R A;  1WGH A;  2L0F A;  3RD2 A;  2FID A;  3IVF A;  3NY5 A;  1SGH A;  2KOX A;  3H7S A;  1WI0 A;  2KMA A;  2VRR B;  1WE7 A;  4JGH B;  1L7Y A;  2R2Q A;  3GZN I;  2O6V A;  4FHK A;  2PE6 B;  3DVG X;  2REX A;  3VDZ A;  4DXA B;  3DPD A;  3TL5 A;  2AL3 A;  2LD9 A;  2WX0 A;  3AU5 A;  4XX5 A;  4EZK A;  1WR1 A;  3N32 A;  4TQ1 A;  2XBB C;  5CHF A;  3ZNG C;  1P9D U;  1GJZ A;  1WXA A;  2C60 A;  1WJU A;  2LWP A;  3TMP B;  4DBG A;  1IP9 A;  4KSL C;  4FN2 A;  1J0G A;  1S3S G;  2N9P C;  1R4N I;  4EFO A;  4M8M A;  5AZF A;  3TJP A;  1Q1O A;  3DBL I;  4ZYN A;  2MBB B;  1QZE A;  2CHW A;  5AZG A;  1A5R A;  2C7M B;  2GMI C;  3RYT A;  3PVL A;  1WZ3 A;  1BT0 A;  3AUL A;  1RRB A;  1LQB A;  2M17 A;  4AJW A;  3T9L A;  3PSE B;  3JSV B;  4ANV A;  2WX1 A;  3QIJ A;  3HM3 A;  4ICV A;  3LDZ E;  2ZPN A;  1P98 A;  4HJK A;  2IO0 B;  3PS6 A;  3KYD D;  3IBE A;  4I6L B;  3V62 A;  3ZVV A;  1V86 A;  4IWP A;  1R4M I;  2NBW B;  3A1Q B;  1V80 A;  2LZ6 A;  3ENE A;  4WWN A;  3QJZ A;  4MM3 A;  2K6Q A;  2L76 A;  5D2M B;  3MTN B;  5D6J B;  1SE9 A;  2K39 A;  4W9D A;  2KWC A;  2KTR A;  2Z59 B;  1SIF A;  2MP2 A;  1WY8 A;  4FBJ B;  5L95 C;  3WAO A;  1WYW B;  3CF6 E;  5LXI B;  1ZW7 A;  1WE6 A;  3DDC B;  2C7H A;  3CST A;  3AI5 A;  3R3M A;  2O2V A;  3PHX B;  4KSK C;  3O65 B;  4FUL A;  4MJS A;  5DPR A;  4GDK B;  2ASQ A;  2LVP A;  4GDL A;  2J7Q B;  3RCZ A;  3V60 A;  3VVW B;  4PS3 A;  4W9J A;  2RD0 A;  4IM2 A;  4MEM A;  1M94 A;  4W9K A;  2LRU A;  2DHZ A;  5LLI A;  4WWO A;  2CHZ A;  2ZCC A;  5L83 A;  3V6C B;  3RT3 B;  3IHP C;  3HK0 A;  2N7D A;  2GBR A;  2IYD B;  4KIK B;  1YQB A;  2ZVN A;  5JHA A;  3PGE A;  4HVB A;  2IO1 B;  2CR5 A;  4HXD A;  2LRW A;  3MJW A;  2D10 A;  3B08 A;  4OVV A;  4DHJ B;  3VUW A;  3NZU A;  2YVC A;  3PLV A;  2BYF A;  3X23 A;  3X0W A;  4DHJ D;  3U8Z A;  3ALB A;  4HCN B;  1EUV B;  3PPA A;  1WIA A;  1WMH A;  2ZNV C;  2M8S A;  2L05 A;  3KH0 A;  4W9G A;  1K8R B;  2CU1 A;  3JYU A;  4KV2 A;  4II3 B;  4EZJ A;  1KLV A;  5AZH A;  3L10 B;  3MHS D;  4GDK A;  1HE8 A;  3SU8 X;  1J19 A;  4TQ0 A;  2LXA A;  3M3J A;  2KN5 A;  3ZNI D;  1WX9 A;  3WAN A;  5E6O A;  3UQB A;  3ZTC A;  1VD2 A;  5G2N A;  1Z5S B;  3ZTD A;  5IA7 A;  3PRP B;  2BWE S;  2DZJ A;  2CKH B;  4A20 A;  2NR2 A;  4ZRK A;  5EDS A;  5JHB A;  5C1Z A;  2NBU A;  1TZ1 A;  3JVZ X;  4BVU C;  3DVN U;  4GGQ A;  3JSV A;  2N7E A;  3HM6 X;  4IW0 A;  2FIF A;  4URK A;  4GXB A;  1OGW A;  1XQQ A;  2NPT A;  4J6I A;  1E5W A;  5D94 A;  2MBE A;  1Y8R C;  1GC6 A;  4DWF A;  3UIN B;  3WAM A;  4AP4 C;  1WJN A;  3VTU A;  4ZDV A;  4WJN A;  3PLU A;  3ZKJ C;  2J0K A;  2C9W B;  2JZ3 B;  2N1W A;  3VFK A;  2PEA A;  1S1Q B;  2KMC A;  2JPH A;  2I1J A;  4DDG D;  2D11 A;  2BKF A;  1OTR B;  2EMT A;  2G4D B;  2MP2 B;  3A4S C;  3W1S A;  4RMA A;  1KJT A;  2V3S A;  3VUX A;  2JXX A;  3K9O B;  4IC7 B;  1VCB A;  4NY0 A;  3H1U A;  2N9X A;  4LCD E;  4WJO A;  4E74 A;  2LI5 A;  4GB9 A;  1UEL A;  2HD5 B;  3KYC D;  4ASW C;  2NPT B;  4DHZ B;  4F7Z A;  1WM2 A;  2MW5 A;  1C3T A;  2K25 A;  2G3Q B;  4DK5 A;  2GBJ A;  2KO3 A;  3CMM B;  1V9J A;  2MBO A;  4TUU A;  1GNU A;  3DCG A;  4WJQ A;  3TBL D;  2KLC A;  3C0R B;  2QHO A;  2RPQ A;  1TBE A;  4MGK E;  1WMH B;  2BYV E;  2MA9 B;  1WH3 A;  1WGY A;  4W9I A;  2MBH A;  2D3G A;  3QA8 A;  2IY0 B;  2V4L A;  3OLM D;  3UIP B;  2FCM A;  4NJ6 A;  1ISN A;  2AEH A;  2N4F A;  2MBQ A;  1V5O A;  5LXH A;  4E3C A;  1MG8 A;  1WM3 A;  2KJH B;  2KDB A;  4LDT D;  2JZZ A;  2G45 B;  2RSU A;  4W9H A;  3T8M A;  2K8H A;  4BOZ B;  2D2Q A;  3ONS A;  3L54 A;  3DVN V;  2K1F A;  2KQS A;  5J18 A;  2JY6 A;  1E8W A;  3ZO5 B;  4II2 B;  2Z0D B;  2KJR A;  2FUH B;  3L08 A;  2BYE A;  2KC1 A;  4E71 A;  4PYZ A;  2GOW A;  2KWU B;  4IUM B;  3VH4 B;  2NS5 A;  2KNB A;  3NZS A;  2W9N A;  2JWZ A;  2N1V A;  4KZ0 A;  4BKS D;  2M4N A;  3A33 B;  3OJ4 B;  4G50 A;  3RUI B;  2ZZP B;  3D32 A;  2FNJ B;  1UH6 A;  5KHO A;  2MRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...