5LMNI

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnI00
1EA6A 3J7AM 1ZM9A 1A6FA 4FW9A 4JV5E 2V2VA 3T1HE 3B82A 3D4JA 2UU9I 4JYAI 4PRXA 1S16A 1HNZI 1N0UA 4HACB 4YY3I 4JI2E 3PYEA 1Z5CA 1QZRA 4JI3I 1FJGI 5L3JA 1FKAE 1XHKA 4B3SI 3PYFA 1XNQE 4DV0I 4DR5I 2UXBE 4GKKE 4AQYI 4JI7E 2VF3A 2BV3A 2DEJA 1OJ4A 1PKPA 3B78A 4USMA 3WU4A 4DR2E 2VQFE 4LF9E 1N32I 1Z0WA 2UUBE 1B63A 2E5LI 1NHJA 2UXCE 1XNQI 4PU9A 2E5LE 1Z0VA 2R42A 1BKNA 4DR2I 2EFGA 1KVKA 4DPXA 4DR3I 3WU3A 3QT5A 3ZZ0A 2X36A 5LMUI 4DV7I 2J7KA 3OTOI 3J81Q 4DV1I 4P7AA 3V2UC 4LF4E 1KTVA 4X65E 4JI1I 4JI7I 4JI0I 1NHHA 4DV6E 4DR6I 4ED4A 4YHHI 4DV1E 1N36I 3J7AG 4B3TI 3ZKDA 1HR0I 4FN5A 2UXBI 2HK3A 4LF7I 4X66I 4KHPI 2CZ9A 4DR3E 1N0VC 3ZZTA 2UUCE 2R3VA 3WU6A 2GS8A 4DV2E 3T1HI 4DR1E 2HK2A 4LF7E 4Z7CA 4DPTA 1K47A 3K1JA 3QT8A 4NXMI 1FWKA 4DV5E 4LF5I 2LJPA 3F0NA 1HNXI 4MYTA 4RPFA 4OX9I 1H72C 3GONA 4LFAE 2UXDE 1ZM4A 4K0KI 3JAMQ 4NXME 1Z5AA 1N36E 5BR8E 2HKJA 1XMOE 4P52A 4UT4A 4ZVIA 1HNZE 3HULA 2ZM6I 4DUYE 4NXNI 4FWGA 1IBMI 4OX9E 2VQEE 2E1RA 3T1YE 2UUCI 4DPWA 2V8PA 4DV2I 2V2ZA 3J80Q 2VQEI 2ZM6E 5GMDA 4LFCE 4DUYI 5IWAE 4USKA 1ZXMA 1IBLI 1Z0EA 2UUAE 4WUBA 1H7UA 4JI4E 4B3MI 1MU5A 3Q1QA 4DV6I 4DR6E 2NPFA 5IWAI 4B3ME 4DPUA 5LMUE 4DV7E 4JI0E 2A2CA 4MYUA 3OTOE 1DARA 4JYAE 2HFSA 3J80C 5FLXQ 1I94I 4Z7YA 4LF8I 2UUBI 3J81C 4DV3E 4I3HA 3T1YI 3V5RA 3QT7A 4HACA 4LF8E 4YHHE 4JI8I 1N33E 4X64E 2X7IA 4WUDA 1I94E 2XEXA 3QT6A 3B8HA 5BR8I 1Z0TA 2ZITA 3WU5A 1PVGA 3K17A 1HNWE 1IBLE 1J5EE 2UUAI 1Z0BA 2BM0A 4DPYA 1Z0CA 5IT9Q 4B3RE 4LF4I 4DV5I 1HNXE 5GMEA 4JI3E 2V2QA 1XMQE 1RREA 4LFBI 4LFAI 5A2QC 4DR5E 1NZ0A 1XMQI 4LFCI 1ZM3A 4JI5E 4YY3E 2UXCI 5LL6R 4GKJI 4DV3I 1ZXNA 2WW4A 4KHPE 4LF6E 2Q2EB 4NXNE 4UTGA 1KKHA 4URLA 1WUUA 4X65I 4JV5I 5LMNI 3ZZUA 4DUZI 4AQYE 2UXDI 4KQVA 4JI6I 2F4VE 1RR9A 1PIEA 2HHHI 1N33I 1HNWI 1B62A 4JI4I 1Z5BA 5A2QQ 5LMNE 4DV0E 3CWVA 4DV4I 2OI2A 2ZBKB 1FJGE 3LTOA 1FNMA 1H7SA 4R1FA 1H74A 4JI2I 4GKKI 4EMDA 1ZM2A 1IBME 1H73A 1D6TA 4JI8E 3PYGA 1N34E 4XTJA 3LNUA 1Z0GA 4HXZA 4LF9I 2HKEA 1VISA 4FWHA 4WUCA 3ZKBA 1IBKE 2A2DA 1MX0A 1Z59A 4X66E 1KIJA 4X62I 5FLXC 4JI6E 2F4VI 1ELOA 4B3TE 2HFUA 3JAMC 4X62E 3M6AA 1J5EI 4JG4A 1S4EA 4X64I 1FI4A 4DR4E 4DR7I 4M1KA 4GKJE 3LPSA 4HYMA 1EI1A 1XNRE 4JI5I 2V34A 4DR7E 5IT9C 2UU9E 1N34I 4HY1A 3PYDA 1NHIA 4DV4E 1XNRI 1UEKA 4LFBE 4DU8A 1MG7A 4FWDA 3ZM7A 4B3RI 1N32E 1HR0E 2AJ4A 1U2RA 4DR4I 2HHHE 4PRVA 2BM1A 4K0KE 3H4LA 4LF6I 2DEIA 4DU7A 1XMOI 2VQFI 4DUZE 1IBKI 4JI1E 4B3SE 4LF5E 4DR1I 4DXLA 1FWLA
chains in the Genus database with same CATH superfamily
1EA6A 3J7AM 1ZM9A 1A6FA 4FW9A 4JV5E 2V2VA 4J3DA 3T1HE 2PNLA 4OO1B 3B82A 3D4JA 5DNXA 2C39A 3H1CA 2UU9I 4JYAI 4PRXA 2PO0B 1S16A 1HNZI 5C0XF 5C0XB 1N0UA 4HACB 4YY3I 4JI2E 2BR2A 2IOPA 3P3CA 3PYEA 1Z5CA 4MU4A 1QZRA 3DD6A 4JI3I 1FJGI 5L3JA 2Z5CA 1FKAE 1XHKA 4B3SI 4OO1C 3PYFA 1XNQE 4DV0I 4DR5I 2UXBE 4LPFA 4GKKE 5JEAA 3HJCA 5C0XC 5K36C 4AQYI 4JI7E 2VF3A 2BV3A 1R6MA 2DEJA 1OJ4A 1PKPA 3B78A 4USMA 2NN6A 3WU4A 2BR2B 4DR2E 2VQFE 4LCGA 2C38B 4LF9E 1N32I 1Z0WA 2UUBE 1B63A 2E5LI 1OYSA 1NHJA 2UXCE 1XNQI 1VI7A 4PU9A 5JEAC 2E5LE 5FWKA 4FW7A 1Z0VA 4ISAA 4MQYA 2R42A 1BKNA 4DR2I 4IFDA 2EFGA 1KVKA 4DPXA 4DR3I 5C0XD 3WU3A 3QT5A 3ZZ0A 2X36A 4FW6A 2JE6B 5LMUI 4DV7I 2J7KA 3OTOI 3J81Q 4DV1I 4P7AA 1RHYA 3V2UC 4LF4E 1KTVA 4IS9A 4X65E 4JI1I 2GO4A 2IERA 4JI7I 4JI0I 1NHHA 4DV6E 4DR6I 4ED4A 4YHHI 4DV1E 3L7ZA 1N36I 3J7AG 4B3TI 3ZKDA 2JEAA 1HR0I 4FN5A 2UXBI 2HK3A 1UDNA 4LF7I 4X66I 2PNZB 4FW4A 4KHPI 2CZ9A 4DR3E 1N0VC 3ZZTA 4OO1F 2UUCE 5C0XE 4FW3A 2R3VA 3WU6A 2GS8A 3HKMA 4DV2E 3T1HI 4DR1E 2HK2A 4LF7E 2C37B 4Z7CA 4DPTA 3M7NG 1K47A 3K1JA 2BA1G 3QT8A 4NXMI 3PS1A 1FWKA 4DV5E 4LF5I 2LJPA 3F0NA 1HNXI 4MYTA 4RPFA 4OX9I 1H72C 3GONA 4LFAE 2UXDE 3U1YA 1ZM4A 3U1KA 4IZKA 2WNRA 2CVEA 4K0KI 1YHCA 3JAMQ 4NXME 4OKGA 1Z5AA 1N36E 5BR8E 2HKJA 3B4TA 1XMOE 4P52A 3M7ND 4UT4A 2Z5BB 4ZVIA 1R6LA 1OYPA 1YH8A 5DRQA 1HNZE 3HULA 2ZM6I 4DUYE 1UDQA 2NN6D 4NXNI 1E3PA 4FWGA 4IZJB 2PNMA 1IBMI 4OX9E 2VQEE 2E1RA 3T1YE 2UUCI 4DPWA 5ELWA 2PO2A 2V8PA 4DV2I 2V2ZA 4NBQA 3J80Q 2VQEI 2ZM6E 5JEAF 2J65A 5GMDA 4MDTA 4LFCE 2GO3A 4IZJD 3NZKA 2O1VA 4DUYI 5IWAE 4USKA 1ZXMA 1IBLI 1Z0EA 2UUAE 4WUBA 1H7UA 4JI4E 4B3MI 1MU5A 3P3GA 5C0XA 3Q1QA 4DV6I 4DR6E 3CDJA 2NPFA 5IWAI 4U3DA 4BA1B 2NN6F 4B3ME 5JEAB 4DPUA 3UHMA 5LMUE 4DV7E 4JI0E 2A2CA 4MYUA 3OTOE 2Z5EA 1DARA 4JYAE 2HFSA 3J80C 2JE6A 4QNJA 5FLXQ 1I94I 1Y4UA 2PO0A 5K36D 4Z7YA 1E3HA 4LF8I 2UUBI 3J81C 4DV3E 4I3HA 3T1YI 2NN6C 1USVA 1UDSA 1OYRA 3V5RA 4HACA 3QT7A 2O1WA 4LF8E 4YHHE 2Z5CB 4JI8I 1N33E 5EL9A 4X64E 2X7IA 4WUDA 1I94E 2XEXA 1USUA 5K36B 3QT6A 3B8HA 4MU1A 5BR8I 1Z0TA 2ZITA 2GQ0A 3WU5A 2JT2A 1PVGA 3K17A 1HNWE 1IBLE 3P06A 1J5EE 2UUAI 4GQUA 1Z0BA 2BM0A 2C38A 4DPYA 1Z0CA 2NN6B 4OO1A 5IT9Q 4B3RE 4LF4I 4DV5I 1HNXE 5GMEA 5DRPA 4JI3E 4AM3A 2V2QA 2C39B 1XMQE 1RREA 2WP8B 4LFBI 4LFAI 5A2QC 4DR5E 3K85A 4LCHA 1NZ0A 2NN6E 1XMQI 4U3BA 4LFCI 1Y60A 1ZM3A 2PNZA 1HK7A 3M85G 1P42A 4JI5E 4YY3E 2AE8A 2UXCI 3GMEA 3P76A 5LL6R 4GKJI 1Y6ZA 4DV3I 3GCMA 1ZXNA 2WW4A 4KHPE 4LF6E 2Q2EB 4NXNE 4UTGA 1KKHA 4URLA 1WUUA 3PS2A 4X65I 5LMNI 4JV5I 3ZZUA 4DUZI 4AQYE 2UXDI 4KQVA 4IFDF 4IZJA 4AIDA 4JI6I 2F4VE 5K36F 4FW5A 1RR9A 2VESA 1PIEA 2HHHI 1N33I 1HNWI 4QNKA 1B62A 4JI4I 1Z5BA 3L7ZB 5A2QQ 5LMNE 2IESA 4DV0E 3CWVA 4DV4I 2OI2A 2ZBKB 1FJGE 2JEBA 4BA2A 3LTOA 1FNMA 1H7SA 4R1FA 1H74A 4LOMA 4JI2I 4GKKI 4EMDA 1ZM2A 4IFDB 2WP8A 1IBME 1H73A 1D6TA 4JI8E 3PYGA 1N34E 1Y4SA 4XTJA 3LNUA 4IFDE 2BA0D 1Z0GA 4HXZA 1XXEA 4LF9I 5K36A 3GLLA 2HKEA 1VISA 2C37A 1UDOA 2JEBB 5JEAD 4FWHA 4BA2B 1Y5YA 4WUCA 3ZKBA 1IBKE 2JEAB 2PO1A 2A2DA 1MX0A 1Z59A 4X66E 1KIJA 4X62I 5FLXC 4JI6E 2F4VI 1ELOA 4B3TE 2BA0G 2HFUA 4LCFA 4IFDC 3JAMC 3Q6MA 4X62E 2PO1B 3M6AA 3Q6NA 3KRNA 4BA1A 1J5EI 4JG4A 1S4EA 4X64I 2IOQA 1FI4A 4DR4E 4DR7I 4OO1D 4OO1E 4AIMA 5JEAE 3PRYA 2O1UA 4M1KA 4N3OA 3LPSA 4GKJE 4HYMA 1EI1A 1XNRE 4JI5I 3PS3A 2V34A 4DR7E 5IT9C 2UU9E 4IFDD 1N34I 4HY1A 3PYDA 1NHIA 4DV4E 1XNRI 1UEKA 4LFBE 4DU8A 1MG7A 4OZEA 4FWDA 3ZM7A 4B3RI 2WNRB 4IZKB 3CDIA 1N32E 5K36E 1HR0E 4MU0A 5DNLA 2AJ4A 1U2RA 2CG9A 4DR4I 2HHHE 5DRRA 4PRVA 2O3ZA 2CGEA 2BM1A 2Z5BA 4K0KE 3H4LA 4LF6I 2DEIA 3M85D 4DU7A 1XMOI 2VQFI 5DROA 4DUZE 1IBKI 4JI1E 4MU3A 4B3SE 2BA1D 3P3EA 2F1DA 2O1TA 5EKWA 4LF5E 4DR1I 4DXLA 2PO2B 1FWLA
chains in the Genus database with same CATH topology
1EA6A 3J7AM 1ZM9A 1A6FA 4FW9A 4JV5E 2V2VA 3T1HE 2PNLA 3B82A 3D4JA 2UU9I 4JYAI 4PRXA 1S16A 1HNZI 1N0UA 4HACB 4YY3I 4JI2E 2IOPA 3PYEA 1Z5CA 1QZRA 4JI3I 1FJGI 5L3JA 2Z5CA 1FKAE 1XHKA 4B3SI 3PYFA 1XNQE 4DV0I 4DR5I 2UXBE 4GKKE 3HJCA 4AQYI 4JI7E 2VF3A 2BV3A 2DEJA 1OJ4A 1PKPA 3B78A 4USMA 3WU4A 4DR2E 2VQFE 4LF9E 1N32I 1Z0WA 2UUBE 1B63A 2E5LI 1NHJA 2UXCE 1XNQI 4PU9A 2E5LE 5FWKA 1Z0VA 2R42A 1BKNA 4DR2I 2EFGA 1KVKA 4DPXA 4DR3I 3WU3A 3QT5A 3ZZ0A 2X36A 5LMUI 4DV7I 2J7KA 3OTOI 3J81Q 4DV1I 4P7AA 3V2UC 4LF4E 1KTVA 4X65E 4JI1I 4JI7I 4JI0I 1NHHA 4DV6E 4DR6I 4ED4A 4YHHI 4DV1E 1N36I 3J7AG 4B3TI 3ZKDA 1HR0I 4FN5A 2UXBI 2HK3A 4LF7I 4X66I 4KHPI 2CZ9A 4DR3E 1N0VC 3ZZTA 2UUCE 2R3VA 3WU6A 2GS8A 4DV2E 3T1HI 4DR1E 2HK2A 4LF7E 4Z7CA 4DPTA 1K47A 3K1JA 3QT8A 4NXMI 1FWKA 4DV5E 4LF5I 2LJPA 3F0NA 1HNXI 4MYTA 4RPFA 4OX9I 1H72C 3GONA 4LFAE 2UXDE 1ZM4A 4IZKA 4K0KI 3JAMQ 4NXME 1Z5AA 1N36E 5BR8E 2HKJA 1XMOE 4P52A 4UT4A 2Z5BB 4ZVIA 1HNZE 3HULA 2ZM6I 4DUYE 4NXNI 4FWGA 4IZJB 2PNMA 1IBMI 4OX9E 2VQEE 2E1RA 3T1YE 2UUCI 4DPWA 2V8PA 4DV2I 2V2ZA 3J80Q 2VQEI 2ZM6E 5GMDA 4LFCE 4IZJD 2O1VA 4DUYI 5IWAE 4USKA 1ZXMA 1IBLI 1Z0EA 2UUAE 4WUBA 1H7UA 4JI4E 4B3MI 1MU5A 3Q1QA 4DV6I 4DR6E 2NPFA 5IWAI 4B3ME 4DPUA 5LMUE 4DV7E 4JI0E 2A2CA 4MYUA 3OTOE 2Z5EA 1DARA 4JYAE 2HFSA 3J80C 5FLXQ 1I94I 1Y4UA 4Z7YA 4LF8I 2UUBI 3J81C 4DV3E 4I3HA 3T1YI 1USVA 3V5RA 3QT7A 4HACA 2O1WA 4LF8E 4YHHE 2Z5CB 4JI8I 1N33E 4X64E 2X7IA 4WUDA 1I94E 2XEXA 1USUA 3QT6A 3B8HA 5BR8I 1Z0TA 2ZITA 2GQ0A 3WU5A 1PVGA 3K17A 1HNWE 1IBLE 3P06A 1J5EE 2UUAI 1Z0BA 2BM0A 4DPYA 1Z0CA 5IT9Q 4B3RE 4LF4I 4DV5I 1HNXE 5GMEA 4JI3E 2V2QA 1XMQE 1RREA 4LFBI 4LFAI 5A2QC 4DR5E 3K85A 1NZ0A 1XMQI 4LFCI 1ZM3A 1HK7A 4JI5E 4YY3E 2UXCI 5LL6R 4GKJI 1Y6ZA 4DV3I 1ZXNA 2WW4A 4KHPE 4LF6E 2Q2EB 4NXNE 4UTGA 1KKHA 4URLA 1WUUA 4X65I 4JV5I 5LMNI 3ZZUA 4DUZI 4AQYE 2UXDI 4KQVA 4IZJA 4JI6I 2F4VE 1RR9A 1PIEA 2HHHI 1N33I 1HNWI 1B62A 4JI4I 1Z5BA 5A2QQ 5LMNE 4DV0E 3CWVA 4DV4I 2OI2A 2ZBKB 1FJGE 3LTOA 1FNMA 1H7SA 4R1FA 1H74A 4JI2I 4GKKI 4EMDA 1ZM2A 1IBME 1H73A 1D6TA 4JI8E 3PYGA 1N34E 1Y4SA 4XTJA 3LNUA 1Z0GA 4HXZA 4LF9I 2HKEA 1VISA 4FWHA 4WUCA 3ZKBA 1IBKE 2A2DA 1MX0A 1Z59A 4X66E 1KIJA 4X62I 5FLXC 4JI6E 2F4VI 1ELOA 4B3TE 2HFUA 3JAMC 3Q6MA 4X62E 3M6AA 3Q6NA 1J5EI 4JG4A 1S4EA 4X64I 2IOQA 1FI4A 4DR4E 4DR7I 3PRYA 2O1UA 4M1KA 4N3OA 3LPSA 4GKJE 4HYMA 1EI1A 1XNRE 4JI5I 2V34A 4DR7E 5IT9C 2UU9E 1N34I 4HY1A 3PYDA 1NHIA 4DV4E 1XNRI 1UEKA 4LFBE 4DU8A 1MG7A 4FWDA 3ZM7A 4B3RI 4IZKB 1N32E 1HR0E 2AJ4A 1U2RA 2CG9A 4DR4I 2HHHE 4PRVA 2CGEA 2BM1A 2Z5BA 4K0KE 3H4LA 4LF6I 2DEIA 4DU7A 1XMOI 2VQFI 4DUZE 1IBKI 4JI1E 4B3SE 2O1TA 4LF5E 4DR1I 4DXLA 1FWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA6 A;  3J7A M;  1ZM9 A;  1A6F A;  4FW9 A;  4JV5 E;  2V2V A;  3T1H E;  3B82 A;  3D4J A;  2UU9 I;  4JYA I;  4PRX A;  1S16 A;  1HNZ I;  1N0U A;  4HAC B;  4YY3 I;  4JI2 E;  3PYE A;  1Z5C A;  1QZR A;  4JI3 I;  1FJG I;  5L3J A;  1FKA E;  1XHK A;  4B3S I;  3PYF A;  1XNQ E;  4DV0 I;  4DR5 I;  2UXB E;  4GKK E;  4AQY I;  4JI7 E;  2VF3 A;  2BV3 A;  2DEJ A;  1OJ4 A;  1PKP A;  3B78 A;  4USM A;  3WU4 A;  4DR2 E;  2VQF E;  4LF9 E;  1N32 I;  1Z0W A;  2UUB E;  1B63 A;  2E5L I;  1NHJ A;  2UXC E;  1XNQ I;  4PU9 A;  2E5L E;  1Z0V A;  2R42 A;  1BKN A;  4DR2 I;  2EFG A;  1KVK A;  4DPX A;  4DR3 I;  3WU3 A;  3QT5 A;  3ZZ0 A;  2X36 A;  5LMU I;  4DV7 I;  2J7K A;  3OTO I;  3J81 Q;  4DV1 I;  4P7A A;  3V2U C;  4LF4 E;  1KTV A;  4X65 E;  4JI1 I;  4JI7 I;  4JI0 I;  1NHH A;  4DV6 E;  4DR6 I;  4ED4 A;  4YHH I;  4DV1 E;  1N36 I;  3J7A G;  4B3T I;  3ZKD A;  1HR0 I;  4FN5 A;  2UXB I;  2HK3 A;  4LF7 I;  4X66 I;  4KHP I;  2CZ9 A;  4DR3 E;  1N0V C;  3ZZT A;  2UUC E;  2R3V A;  3WU6 A;  2GS8 A;  4DV2 E;  3T1H I;  4DR1 E;  2HK2 A;  4LF7 E;  4Z7C A;  4DPT A;  1K47 A;  3K1J A;  3QT8 A;  4NXM I;  1FWK A;  4DV5 E;  4LF5 I;  2LJP A;  3F0N A;  1HNX I;  4MYT A;  4RPF A;  4OX9 I;  1H72 C;  3GON A;  4LFA E;  2UXD E;  1ZM4 A;  4K0K I;  3JAM Q;  4NXM E;  1Z5A A;  1N36 E;  5BR8 E;  2HKJ A;  1XMO E;  4P52 A;  4UT4 A;  4ZVI A;  1HNZ E;  3HUL A;  2ZM6 I;  4DUY E;  4NXN I;  4FWG A;  1IBM I;  4OX9 E;  2VQE E;  2E1R A;  3T1Y E;  2UUC I;  4DPW A;  2V8P A;  4DV2 I;  2V2Z A;  3J80 Q;  2VQE I;  2ZM6 E;  5GMD A;  4LFC E;  4DUY I;  5IWA E;  4USK A;  1ZXM A;  1IBL I;  1Z0E A;  2UUA E;  4WUB A;  1H7U A;  4JI4 E;  4B3M I;  1MU5 A;  3Q1Q A;  4DV6 I;  4DR6 E;  2NPF A;  5IWA I;  4B3M E;  4DPU A;  5LMU E;  4DV7 E;  4JI0 E;  2A2C A;  4MYU A;  3OTO E;  1DAR A;  4JYA E;  2HFS A;  3J80 C;  5FLX Q;  1I94 I;  4Z7Y A;  4LF8 I;  2UUB I;  3J81 C;  4DV3 E;  4I3H A;  3T1Y I;  3V5R A;  3QT7 A;  4HAC A;  4LF8 E;  4YHH E;  4JI8 I;  1N33 E;  4X64 E;  2X7I A;  4WUD A;  1I94 E;  2XEX A;  3QT6 A;  3B8H A;  5BR8 I;  1Z0T A;  2ZIT A;  3WU5 A;  1PVG A;  3K17 A;  1HNW E;  1IBL E;  1J5E E;  2UUA I;  1Z0B A;  2BM0 A;  4DPY A;  1Z0C A;  5IT9 Q;  4B3R E;  4LF4 I;  4DV5 I;  1HNX E;  5GME A;  4JI3 E;  2V2Q A;  1XMQ E;  1RRE A;  4LFB I;  4LFA I;  5A2Q C;  4DR5 E;  1NZ0 A;  1XMQ I;  4LFC I;  1ZM3 A;  4JI5 E;  4YY3 E;  2UXC I;  5LL6 R;  4GKJ I;  4DV3 I;  1ZXN A;  2WW4 A;  4KHP E;  4LF6 E;  2Q2E B;  4NXN E;  4UTG A;  1KKH A;  4URL A;  1WUU A;  4X65 I;  4JV5 I;  5LMN I;  3ZZU A;  4DUZ I;  4AQY E;  2UXD I;  4KQV A;  4JI6 I;  2F4V E;  1RR9 A;  1PIE A;  2HHH I;  1N33 I;  1HNW I;  1B62 A;  4JI4 I;  1Z5B A;  5A2Q Q;  5LMN E;  4DV0 E;  3CWV A;  4DV4 I;  2OI2 A;  2ZBK B;  1FJG E;  3LTO A;  1FNM A;  1H7S A;  4R1F A;  1H74 A;  4JI2 I;  4GKK I;  4EMD A;  1ZM2 A;  1IBM E;  1H73 A;  1D6T A;  4JI8 E;  3PYG A;  1N34 E;  4XTJ A;  3LNU A;  1Z0G A;  4HXZ A;  4LF9 I;  2HKE A;  1VIS A;  4FWH A;  4WUC A;  3ZKB A;  1IBK E;  2A2D A;  1MX0 A;  1Z59 A;  4X66 E;  1KIJ A;  4X62 I;  5FLX C;  4JI6 E;  2F4V I;  1ELO A;  4B3T E;  2HFU A;  3JAM C;  4X62 E;  3M6A A;  1J5E I;  4JG4 A;  1S4E A;  4X64 I;  1FI4 A;  4DR4 E;  4DR7 I;  4M1K A;  4GKJ E;  3LPS A;  4HYM A;  1EI1 A;  1XNR E;  4JI5 I;  2V34 A;  4DR7 E;  5IT9 C;  2UU9 E;  1N34 I;  4HY1 A;  3PYD A;  1NHI A;  4DV4 E;  1XNR I;  1UEK A;  4LFB E;  4DU8 A;  1MG7 A;  4FWD A;  3ZM7 A;  4B3R I;  1N32 E;  1HR0 E;  2AJ4 A;  1U2R A;  4DR4 I;  2HHH E;  4PRV A;  2BM1 A;  4K0K E;  3H4L A;  4LF6 I;  2DEI A;  4DU7 A;  1XMO I;  2VQF I;  4DUZ E;  1IBK I;  4JI1 E;  4B3S E;  4LF5 E;  4DR1 I;  4DXL A;  1FWL A; 
#chains in the Genus database with same CATH topology
 1EA6 A;  3J7A M;  1ZM9 A;  1A6F A;  4FW9 A;  4JV5 E;  2V2V A;  4J3D A;  3T1H E;  2PNL A;  4OO1 B;  3B82 A;  3D4J A;  5DNX A;  2C39 A;  3H1C A;  2UU9 I;  4JYA I;  4PRX A;  2PO0 B;  1S16 A;  1HNZ I;  5C0X F;  5C0X B;  1N0U A;  4HAC B;  4YY3 I;  4JI2 E;  2BR2 A;  2IOP A;  3P3C A;  3PYE A;  1Z5C A;  4MU4 A;  1QZR A;  3DD6 A;  4JI3 I;  1FJG I;  5L3J A;  2Z5C A;  1FKA E;  1XHK A;  4B3S I;  4OO1 C;  3PYF A;  1XNQ E;  4DV0 I;  4DR5 I;  2UXB E;  4LPF A;  4GKK E;  5JEA A;  3HJC A;  5C0X C;  5K36 C;  4AQY I;  4JI7 E;  2VF3 A;  2BV3 A;  1R6M A;  2DEJ A;  1OJ4 A;  1PKP A;  3B78 A;  4USM A;  2NN6 A;  3WU4 A;  2BR2 B;  4DR2 E;  2VQF E;  4LCG A;  2C38 B;  4LF9 E;  1N32 I;  1Z0W A;  2UUB E;  1B63 A;  2E5L I;  1OYS A;  1NHJ A;  2UXC E;  1XNQ I;  1VI7 A;  4PU9 A;  5JEA C;  2E5L E;  5FWK A;  4FW7 A;  1Z0V A;  4ISA A;  4MQY A;  2R42 A;  1BKN A;  4DR2 I;  4IFD A;  2EFG A;  1KVK A;  4DPX A;  4DR3 I;  5C0X D;  3WU3 A;  3QT5 A;  3ZZ0 A;  2X36 A;  4FW6 A;  2JE6 B;  5LMU I;  4DV7 I;  2J7K A;  3OTO I;  3J81 Q;  4DV1 I;  4P7A A;  1RHY A;  3V2U C;  4LF4 E;  1KTV A;  4IS9 A;  4X65 E;  4JI1 I;  2GO4 A;  2IER A;  4JI7 I;  4JI0 I;  1NHH A;  4DV6 E;  4DR6 I;  4ED4 A;  4YHH I;  4DV1 E;  3L7Z A;  1N36 I;  3J7A G;  4B3T I;  3ZKD A;  2JEA A;  1HR0 I;  4FN5 A;  2UXB I;  2HK3 A;  1UDN A;  4LF7 I;  4X66 I;  2PNZ B;  4FW4 A;  4KHP I;  2CZ9 A;  4DR3 E;  1N0V C;  3ZZT A;  4OO1 F;  2UUC E;  5C0X E;  4FW3 A;  2R3V A;  3WU6 A;  2GS8 A;  3HKM A;  4DV2 E;  3T1H I;  4DR1 E;  2HK2 A;  4LF7 E;  2C37 B;  4Z7C A;  4DPT A;  3M7N G;  1K47 A;  3K1J A;  2BA1 G;  3QT8 A;  4NXM I;  3PS1 A;  1FWK A;  4DV5 E;  4LF5 I;  2LJP A;  3F0N A;  1HNX I;  4MYT A;  4RPF A;  4OX9 I;  1H72 C;  3GON A;  4LFA E;  2UXD E;  3U1Y A;  1ZM4 A;  3U1K A;  4IZK A;  2WNR A;  2CVE A;  4K0K I;  1YHC A;  3JAM Q;  4NXM E;  4OKG A;  1Z5A A;  1N36 E;  5BR8 E;  2HKJ A;  3B4T A;  1XMO E;  4P52 A;  3M7N D;  4UT4 A;  2Z5B B;  4ZVI A;  1R6L A;  1OYP A;  1YH8 A;  5DRQ A;  1HNZ E;  3HUL A;  2ZM6 I;  4DUY E;  1UDQ A;  2NN6 D;  4NXN I;  1E3P A;  4FWG A;  4IZJ B;  2PNM A;  1IBM I;  4OX9 E;  2VQE E;  2E1R A;  3T1Y E;  2UUC I;  4DPW A;  5ELW A;  2PO2 A;  2V8P A;  4DV2 I;  2V2Z A;  4NBQ A;  3J80 Q;  2VQE I;  2ZM6 E;  5JEA F;  2J65 A;  5GMD A;  4MDT A;  4LFC E;  2GO3 A;  4IZJ D;  3NZK A;  2O1V A;  4DUY I;  5IWA E;  4USK A;  1ZXM A;  1IBL I;  1Z0E A;  2UUA E;  4WUB A;  1H7U A;  4JI4 E;  4B3M I;  1MU5 A;  3P3G A;  5C0X A;  3Q1Q A;  4DV6 I;  4DR6 E;  3CDJ A;  2NPF A;  5IWA I;  4U3D A;  4BA1 B;  2NN6 F;  4B3M E;  5JEA B;  4DPU A;  3UHM A;  5LMU E;  4DV7 E;  4JI0 E;  2A2C A;  4MYU A;  3OTO E;  2Z5E A;  1DAR A;  4JYA E;  2HFS A;  3J80 C;  2JE6 A;  4QNJ A;  5FLX Q;  1I94 I;  1Y4U A;  2PO0 A;  5K36 D;  4Z7Y A;  1E3H A;  4LF8 I;  2UUB I;  3J81 C;  4DV3 E;  4I3H A;  3T1Y I;  2NN6 C;  1USV A;  1UDS A;  1OYR A;  3V5R A;  4HAC A;  3QT7 A;  2O1W A;  4LF8 E;  4YHH E;  2Z5C B;  4JI8 I;  1N33 E;  5EL9 A;  4X64 E;  2X7I A;  4WUD A;  1I94 E;  2XEX A;  1USU A;  5K36 B;  3QT6 A;  3B8H A;  4MU1 A;  5BR8 I;  1Z0T A;  2ZIT A;  2GQ0 A;  3WU5 A;  2JT2 A;  1PVG A;  3K17 A;  1HNW E;  1IBL E;  3P06 A;  1J5E E;  2UUA I;  4GQU A;  1Z0B A;  2BM0 A;  2C38 A;  4DPY A;  1Z0C A;  2NN6 B;  4OO1 A;  5IT9 Q;  4B3R E;  4LF4 I;  4DV5 I;  1HNX E;  5GME A;  5DRP A;  4JI3 E;  4AM3 A;  2V2Q A;  2C39 B;  1XMQ E;  1RRE A;  2WP8 B;  4LFB I;  4LFA I;  5A2Q C;  4DR5 E;  3K85 A;  4LCH A;  1NZ0 A;  2NN6 E;  1XMQ I;  4U3B A;  4LFC I;  1Y60 A;  1ZM3 A;  2PNZ A;  1HK7 A;  3M85 G;  1P42 A;  4JI5 E;  4YY3 E;  2AE8 A;  2UXC I;  3GME A;  3P76 A;  5LL6 R;  4GKJ I;  1Y6Z A;  4DV3 I;  3GCM A;  1ZXN A;  2WW4 A;  4KHP E;  4LF6 E;  2Q2E B;  4NXN E;  4UTG A;  1KKH A;  4URL A;  1WUU A;  3PS2 A;  4X65 I;  5LMN I;  4JV5 I;  3ZZU A;  4DUZ I;  4AQY E;  2UXD I;  4KQV A;  4IFD F;  4IZJ A;  4AID A;  4JI6 I;  2F4V E;  5K36 F;  4FW5 A;  1RR9 A;  2VES A;  1PIE A;  2HHH I;  1N33 I;  1HNW I;  4QNK A;  1B62 A;  4JI4 I;  1Z5B A;  3L7Z B;  5A2Q Q;  5LMN E;  2IES A;  4DV0 E;  3CWV A;  4DV4 I;  2OI2 A;  2ZBK B;  1FJG E;  2JEB A;  4BA2 A;  3LTO A;  1FNM A;  1H7S A;  4R1F A;  1H74 A;  4LOM A;  4JI2 I;  4GKK I;  4EMD A;  1ZM2 A;  4IFD B;  2WP8 A;  1IBM E;  1H73 A;  1D6T A;  4JI8 E;  3PYG A;  1N34 E;  1Y4S A;  4XTJ A;  3LNU A;  4IFD E;  2BA0 D;  1Z0G A;  4HXZ A;  1XXE A;  4LF9 I;  5K36 A;  3GLL A;  2HKE A;  1VIS A;  2C37 A;  1UDO A;  2JEB B;  5JEA D;  4FWH A;  4BA2 B;  1Y5Y A;  4WUC A;  3ZKB A;  1IBK E;  2JEA B;  2PO1 A;  2A2D A;  1MX0 A;  1Z59 A;  4X66 E;  1KIJ A;  4X62 I;  5FLX C;  4JI6 E;  2F4V I;  1ELO A;  4B3T E;  2BA0 G;  2HFU A;  4LCF A;  4IFD C;  3JAM C;  3Q6M A;  4X62 E;  2PO1 B;  3M6A A;  3Q6N A;  3KRN A;  4BA1 A;  1J5E I;  4JG4 A;  1S4E A;  4X64 I;  2IOQ A;  1FI4 A;  4DR4 E;  4DR7 I;  4OO1 D;  4OO1 E;  4AIM A;  5JEA E;  3PRY A;  2O1U A;  4M1K A;  4N3O A;  3LPS A;  4GKJ E;  4HYM A;  1EI1 A;  1XNR E;  4JI5 I;  3PS3 A;  2V34 A;  4DR7 E;  5IT9 C;  2UU9 E;  4IFD D;  1N34 I;  4HY1 A;  3PYD A;  1NHI A;  4DV4 E;  1XNR I;  1UEK A;  4LFB E;  4DU8 A;  1MG7 A;  4OZE A;  4FWD A;  3ZM7 A;  4B3R I;  2WNR B;  4IZK B;  3CDI A;  1N32 E;  5K36 E;  1HR0 E;  4MU0 A;  5DNL A;  2AJ4 A;  1U2R A;  2CG9 A;  4DR4 I;  2HHH E;  5DRR A;  4PRV A;  2O3Z A;  2CGE A;  2BM1 A;  2Z5B A;  4K0K E;  3H4L A;  4LF6 I;  2DEI A;  3M85 D;  4DU7 A;  1XMO I;  2VQF I;  5DRO A;  4DUZ E;  1IBK I;  4JI1 E;  4MU3 A;  4B3S E;  2BA1 D;  3P3E A;  2F1D A;  2O1T A;  5EKW A;  4LF5 E;  4DR1 I;  4DXL A;  2PO2 B;  1FWL A; 
#chains in the Genus database with same CATH homology
 1EA6 A;  3J7A M;  1ZM9 A;  1A6F A;  4FW9 A;  4JV5 E;  2V2V A;  3T1H E;  2PNL A;  3B82 A;  3D4J A;  2UU9 I;  4JYA I;  4PRX A;  1S16 A;  1HNZ I;  1N0U A;  4HAC B;  4YY3 I;  4JI2 E;  2IOP A;  3PYE A;  1Z5C A;  1QZR A;  4JI3 I;  1FJG I;  5L3J A;  2Z5C A;  1FKA E;  1XHK A;  4B3S I;  3PYF A;  1XNQ E;  4DV0 I;  4DR5 I;  2UXB E;  4GKK E;  3HJC A;  4AQY I;  4JI7 E;  2VF3 A;  2BV3 A;  2DEJ A;  1OJ4 A;  1PKP A;  3B78 A;  4USM A;  3WU4 A;  4DR2 E;  2VQF E;  4LF9 E;  1N32 I;  1Z0W A;  2UUB E;  1B63 A;  2E5L I;  1NHJ A;  2UXC E;  1XNQ I;  4PU9 A;  2E5L E;  5FWK A;  1Z0V A;  2R42 A;  1BKN A;  4DR2 I;  2EFG A;  1KVK A;  4DPX A;  4DR3 I;  3WU3 A;  3QT5 A;  3ZZ0 A;  2X36 A;  5LMU I;  4DV7 I;  2J7K A;  3OTO I;  3J81 Q;  4DV1 I;  4P7A A;  3V2U C;  4LF4 E;  1KTV A;  4X65 E;  4JI1 I;  4JI7 I;  4JI0 I;  1NHH A;  4DV6 E;  4DR6 I;  4ED4 A;  4YHH I;  4DV1 E;  1N36 I;  3J7A G;  4B3T I;  3ZKD A;  1HR0 I;  4FN5 A;  2UXB I;  2HK3 A;  4LF7 I;  4X66 I;  4KHP I;  2CZ9 A;  4DR3 E;  1N0V C;  3ZZT A;  2UUC E;  2R3V A;  3WU6 A;  2GS8 A;  4DV2 E;  3T1H I;  4DR1 E;  2HK2 A;  4LF7 E;  4Z7C A;  4DPT A;  1K47 A;  3K1J A;  3QT8 A;  4NXM I;  1FWK A;  4DV5 E;  4LF5 I;  2LJP A;  3F0N A;  1HNX I;  4MYT A;  4RPF A;  4OX9 I;  1H72 C;  3GON A;  4LFA E;  2UXD E;  1ZM4 A;  4IZK A;  4K0K I;  3JAM Q;  4NXM E;  1Z5A A;  1N36 E;  5BR8 E;  2HKJ A;  1XMO E;  4P52 A;  4UT4 A;  2Z5B B;  4ZVI A;  1HNZ E;  3HUL A;  2ZM6 I;  4DUY E;  4NXN I;  4FWG A;  4IZJ B;  2PNM A;  1IBM I;  4OX9 E;  2VQE E;  2E1R A;  3T1Y E;  2UUC I;  4DPW A;  2V8P A;  4DV2 I;  2V2Z A;  3J80 Q;  2VQE I;  2ZM6 E;  5GMD A;  4LFC E;  4IZJ D;  2O1V A;  4DUY I;  5IWA E;  4USK A;  1ZXM A;  1IBL I;  1Z0E A;  2UUA E;  4WUB A;  1H7U A;  4JI4 E;  4B3M I;  1MU5 A;  3Q1Q A;  4DV6 I;  4DR6 E;  2NPF A;  5IWA I;  4B3M E;  4DPU A;  5LMU E;  4DV7 E;  4JI0 E;  2A2C A;  4MYU A;  3OTO E;  2Z5E A;  1DAR A;  4JYA E;  2HFS A;  3J80 C;  5FLX Q;  1I94 I;  1Y4U A;  4Z7Y A;  4LF8 I;  2UUB I;  3J81 C;  4DV3 E;  4I3H A;  3T1Y I;  1USV A;  3V5R A;  3QT7 A;  4HAC A;  2O1W A;  4LF8 E;  4YHH E;  2Z5C B;  4JI8 I;  1N33 E;  4X64 E;  2X7I A;  4WUD A;  1I94 E;  2XEX A;  1USU A;  3QT6 A;  3B8H A;  5BR8 I;  1Z0T A;  2ZIT A;  2GQ0 A;  3WU5 A;  1PVG A;  3K17 A;  1HNW E;  1IBL E;  3P06 A;  1J5E E;  2UUA I;  1Z0B A;  2BM0 A;  4DPY A;  1Z0C A;  5IT9 Q;  4B3R E;  4LF4 I;  4DV5 I;  1HNX E;  5GME A;  4JI3 E;  2V2Q A;  1XMQ E;  1RRE A;  4LFB I;  4LFA I;  5A2Q C;  4DR5 E;  3K85 A;  1NZ0 A;  1XMQ I;  4LFC I;  1ZM3 A;  1HK7 A;  4JI5 E;  4YY3 E;  2UXC I;  5LL6 R;  4GKJ I;  1Y6Z A;  4DV3 I;  1ZXN A;  2WW4 A;  4KHP E;  4LF6 E;  2Q2E B;  4NXN E;  4UTG A;  1KKH A;  4URL A;  1WUU A;  4X65 I;  4JV5 I;  5LMN I;  3ZZU A;  4DUZ I;  4AQY E;  2UXD I;  4KQV A;  4IZJ A;  4JI6 I;  2F4V E;  1RR9 A;  1PIE A;  2HHH I;  1N33 I;  1HNW I;  1B62 A;  4JI4 I;  1Z5B A;  5A2Q Q;  5LMN E;  4DV0 E;  3CWV A;  4DV4 I;  2OI2 A;  2ZBK B;  1FJG E;  3LTO A;  1FNM A;  1H7S A;  4R1F A;  1H74 A;  4JI2 I;  4GKK I;  4EMD A;  1ZM2 A;  1IBM E;  1H73 A;  1D6T A;  4JI8 E;  3PYG A;  1N34 E;  1Y4S A;  4XTJ A;  3LNU A;  1Z0G A;  4HXZ A;  4LF9 I;  2HKE A;  1VIS A;  4FWH A;  4WUC A;  3ZKB A;  1IBK E;  2A2D A;  1MX0 A;  1Z59 A;  4X66 E;  1KIJ A;  4X62 I;  5FLX C;  4JI6 E;  2F4V I;  1ELO A;  4B3T E;  2HFU A;  3JAM C;  3Q6M A;  4X62 E;  3M6A A;  3Q6N A;  1J5E I;  4JG4 A;  1S4E A;  4X64 I;  2IOQ A;  1FI4 A;  4DR4 E;  4DR7 I;  3PRY A;  2O1U A;  4M1K A;  4N3O A;  3LPS A;  4GKJ E;  4HYM A;  1EI1 A;  1XNR E;  4JI5 I;  2V34 A;  4DR7 E;  5IT9 C;  2UU9 E;  1N34 I;  4HY1 A;  3PYD A;  1NHI A;  4DV4 E;  1XNR I;  1UEK A;  4LFB E;  4DU8 A;  1MG7 A;  4FWD A;  3ZM7 A;  4B3R I;  4IZK B;  1N32 E;  1HR0 E;  2AJ4 A;  1U2R A;  2CG9 A;  4DR4 I;  2HHH E;  4PRV A;  2CGE A;  2BM1 A;  2Z5B A;  4K0K E;  3H4L A;  4LF6 I;  2DEI A;  4DU7 A;  1XMO I;  2VQF I;  4DUZ E;  1IBK I;  4JI1 E;  4B3S E;  2O1T A;  4LF5 E;  4DR1 I;  4DXL A;  1FWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...