5LMNI

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnI00
4JI7I 4DR5I 5IWAE 1HNWE 3V2UC 3ZKDA 1Z0BA 4JI0I 4JI6I 4OX9E 4DR1I 2V2QA 4DPYA 1H74A 4LF5E 5LL6R 4LF5I 3LPSA 3K17A 4X64I 4DPXA 4DV1I 1N33E 3K1JA 4LFBE 3V5RA 1XMQE 5LMUI 4DUYI 1KVKA 3OTOE 4DUZI 1ZM3A 4HACB 4DV3I 2VQFI 5FLXQ 4JI8I 4X66E 2UUCI 4LF6I 1Z0CA 3J7AG 4AQYE 2ZITA 1IBLE 4K0KI 3B82A 4LF9I 4JI5I 3PYDA 1ZXMA 4DR7E 2E1RA 2HHHI 4WUBA 4DV3E 2UUBE 1IBKI 4USMA 5GMEA 1B62A 4KHPE 4NXNI 4M1KA 5IWAI 1HNWI 4USKA 4JI4I 1FWKA 4MYTA 2UXCI 1NHIA 1I94I 4GKJI 4DR1E 4Z7CA 4DR2I 2NPFA 5A2QC 2V2ZA 1Z0VA 2GS8A 4JI5E 1H72C 1ZM2A 4DR5E 4JV5E 4I3HA 2A2CA 2Q2EB 4RPFA 1S4EA 5GMDA 4LF8I 1XNRE 2OI2A 4DR7I 3PYGA 1XNQI 3JAMC 4DV5I 5L3JA 1MG7A 1N0VC 4JI3E 4AQYI 1XMOE 1J5EE 1XMQI 3WU5A 4B3SE 1EI1A 4URLA 4DUZE 4DV1E 1KKHA 4WUDA 4DV6I 3H4LA 1HNXE 3GONA 1Z0EA 1KIJA 4DR3I 4JI6E 2UXCE 4DPTA 1FJGI 4DV2I 4DV2E 1N33I 3T1YI 3LNUA 4LF4I 4LFCI 4KHPI 4GKKE 1IBKE 3PYFA 4X65I 4DXLA 4B3RE 3LTOA 4X62I 4B3SI 2VQEE 4HACA 2VQEI 4XTJA 2UUAI 1EA6A 1FNMA 2UXDI 3Q1QA 4JYAI 2HK3A 1Z0TA 3F0NA 1HR0I 2A2DA 1Z59A 3PYEA 2CZ9A 4FW9A 2VQFE 4NXME 4DPUA 4JV5I 1H7SA 1HNZI 1N36I 1K47A 2EFGA 2UU9I 2HFSA 4B3MI 5LMNE 3CWVA 3J81Q 3ZZTA 1MX0A 5A2QQ 4ZVIA 4DV6E 4DR4I 1Z5CA 1IBLI 4DV0E 2V8PA 4FWDA 3T1HE 5BR8E 4UT4A 5BR8I 4JI8E 4X66I 3J7AM 4PU9A 2V34A 1B63A 1NHJA 4K0KE 1N32I 4DV7E 5IT9C 4PRVA 1N0UA 1PKPA 2BM0A 1FWLA 2DEJA 4DU7A 1ZM9A 4NXNE 4OX9I 1VISA 4YHHI 2V2VA 4YHHE 3ZZ0A 1I94E 2HFUA 2LJPA 1XHKA 2X7IA 2BV3A 3J81C 1D6TA 4B3ME 2ZBKB 1S16A 4HYMA 4JYAE 4JI3I 3HULA 3D4JA 2HKJA 4X62E 4FN5A 1N32E 1J5EI 1BKNA 4DR4E 1Z0WA 4LF8E 3OTOI 1Z0GA 1NHHA 2DEIA 1N34E 3ZZUA 4JI4E 4DR6E 4MYUA 4JI1E 2WW4A 4JI1I 4LF4E 5IT9Q 1MU5A 2UUBI 4JI7E 1FJGE 4ED4A 4DR6I 4P52A 4P7AA 3B78A 1PIEA 4DV7I 4LF9E 3B8HA 3T1HI 1N34I 2UUCE 3QT8A 4UTGA 4FWGA 4B3TI 2E5LE 3WU6A 4DR2E 1ZM4A 4LF6E 4JI2I 2F4VE 4PRXA 4WUCA 4KQVA 4LFAI 2R3VA 5LMNI 2BM1A 4DU8A 4FWHA 4GKKI 2HK2A 2R42A 2UXBI 4JG4A 1NZ0A 1PVGA 1U2RA 4JI2E 4Z7YA 1IBMI 1OJ4A 4DR3E 1A6FA 2XEXA 1HNXI 1HR0E 2HKEA 3QT5A 2E5LI 4DV5E 4DV4I 4NXMI 2F4VI 2UUAE 4LF7E 2UXDE 4R1FA 1H7UA 4DV0I 1XNQE 4HY1A 3J80C 1Z5AA 2X36A 3J80Q 1Z5BA 1KTVA 1IBME 4HXZA 4LFBI 3QT6A 4B3RI 2UXBE 4DV4E 2VF3A 3ZM7A 4X64E 3T1YE 4YY3I 5FLXC 4YY3E 1HNZE 4LFCE 4EMDA 2UU9E 4LFAE 1UEKA 1ELOA 1FKAE 2J7KA 3QT7A 3ZKBA 4JI0E 1XMOI 1N36E 1WUUA 3WU4A 3M6AA 2HHHE 1DARA 4DPWA 1QZRA 4B3TE 2ZM6E 2ZM6I 1FI4A 4X65E 1RR9A 4LF7I 4GKJE 3JAMQ 1H73A 1XNRI 5LMUE 1RREA 2AJ4A 4DUYE 1ZXNA 3WU3A
chains in the Genus database with same CATH superfamily
4JI7I 4DR5I 5IWAE 1HNWE 2JT2A 3V2UC 3ZKDA 1Z0BA 4MQYA 4JI0I 4JI6I 4OX9E 4DR1I 2V2QA 4DPYA 2VESA 1H74A 4LF5E 4OO1E 5LL6R 4BA1A 3LPSA 4LF5I 3K17A 4X64I 4DPXA 5DNXA 4DV1I 1N33E 5K36D 3K1JA 1R6MA 5DRPA 4LFBE 3L7ZB 3V5RA 5LMUI 4DUYI 1XMQE 1KVKA 3OTOE 1Y60A 2J65A 4DUZI 1ZM3A 4HACB 4DV3I 1YHCA 5FLXQ 2VQFI 1E3PA 4JI8I 4X66E 1XXEA 2UUCI 4LF6I 1Z0CA 3J7AG 4AQYE 2ZITA 1IBLE 4K0KI 2CVEA 3B82A 4LF9I 4JI5I 3PYDA 1ZXMA 4DR7E 4IZJD 2E1RA 2HHHI 3HKMA 4WUBA 4DV3E 2UUBE 2NN6B 1IBKI 4USMA 5FWKA 5GMEA 1USVA 1B62A 4KHPE 4NXNI 4M1KA 4MU4A 5IWAI 1HNWI 1Y6ZA 4USKA 4JI4I 1FWKA 4MYTA 2NN6E 1NHIA 2UXCI 1I94I 3H1CA 4GKJI 4DR1E 4IFDE 5K36B 4Z7CA 4DR2I 2NPFA 2BA1D 5A2QC 2WP8A 2V2ZA 1Z0VA 2GS8A 4JI5E 1H72C 1ZM2A 4DR5E 4JV5E 4I3HA 2A2CA 2Q2EB 1OYRA 4RPFA 1S4EA 5GMDA 5JEAF 4LF8I 1XNRE 2OI2A 2Z5BB 4DR7I 3PYGA 1XNQI 3P06A 3JAMC 4DV5I 5L3JA 1MG7A 5DROA 5K36E 1N0VC 4JI3E 2BA1G 4MU1A 4AQYI 1XMOE 1J5EE 1UDNA 1XMQI 3WU5A 4B3SE 2JEBB 1EI1A 4URLA 3P76A 4DUZE 4DV1E 1KKHA 4WUDA 4DV6I 3H4LA 1HNXE 3GONA 1Z0EA 1KIJA 5JEAC 4DR3I 4JI6E 2UXCE 4DPTA 2PNMA 1FJGI 4FW3A 3PS2A 4DV2I 3GMEA 4DV2E 1N33I 3T1YI 3LNUA 4OO1F 4LF4I 4LFCI 4LPFA 4KHPI 2IESA 5K36C 5DNLA 4GKKE 1Y5YA 2IERA 1IBKE 3CDIA 3PYFA 5C0XF 4DXLA 4X65I 4B3RE 3LTOA 2Z5CA 4X62I 4B3SI 3NZKA 4HACA 2VQEE 5C0XA 3M7ND 2VQEI 4XTJA 1E3HA 1UDSA 2UUAI 1EA6A 4IZKB 1FNMA 2UXDI 3Q1QA 3CDJA 4JYAI 2HK3A 1Z0TA 3F0NA 4LOMA 2CGEA 3Q6NA 4J3DA 2A2DA 1Z59A 3PYEA 2C37B 4FW5A 3HJCA 4LCFA 2CZ9A 4FW9A 2VQFE 4NXME 4AIDA 4DPUA 4JV5I 1UDQA 1H7SA 2WP8B 1HNZI 2IOQA 1N36I 1K47A 2EFGA 2PO2B 2UU9I 2HFSA 2JEAA 4B3MI 5LMNE 2AE8A 3CWVA 4IFDD 2PNLA 3J81Q 3ZZTA 1MX0A 5A2QQ 4U3DA 4QNJA 5EKWA 4ZVIA 4DV6E 4DR4I 1Z5CA 2NN6A 5C0XB 1IBLI 4DV0E 4U3BA 5ELWA 2V8PA 4FWDA 3T1HE 5BR8E 4UT4A 5BR8I 3K85A 4JI8E 4X66I 4MDTA 3J7AM 4PU9A 2V34A 2PO0A 4MU0A 1B63A 2JE6A 1NHJA 4K0KE 1N32I 4DV7E 5IT9C 4PRVA 1N0UA 1PKPA 1HK7A 3M85G 1RHYA 2BM0A 1FWLA 2DEJA 4DU7A 1VI7A 1ZM9A 4NXNE 4OX9I 2PO1A 4ISAA 1VISA 1USUA 4YHHI 2O1VA 2V2VA 4YHHE 3ZZ0A 1I94E 2HFUA 2LJPA 1XHKA 3UHMA 2X7IA 3P3CA 4IFDF 2BV3A 3J81C 1D6TA 4B3ME 4IZJA 2ZBKB 1S16A 4HYMA 2O1UA 4JYAE 2BA0G 4JI3I 3HULA 2PO2A 5JEAE 2C39B 2BR2B 3D4JA 2HKJA 4X62E 4FN5A 1N32E 1J5EI 1BKNA 3PS3A 4DR4E 2NN6D 3GCMA 1Z0WA 4LF8E 5EL9A 3OTOI 1Z0GA 1NHHA 2DEIA 5JEAB 1N34E 4IZKA 3ZZUA 4JI4E 3DD6A 4NBQA 4DR6E 2CG9A 3P3EA 2BA0D 4MYUA 3U1YA 4JI1E 2WW4A 5DRRA 1R6LA 4JI1I 3P3GA 4LF4E 2WNRB 4OO1A 5IT9Q 1MU5A 2UUBI 4JI7E 2PNZA 4IFDA 1FJGE 2C38B 4N3OA 4ED4A 4DR6I 4P52A 4P7AA 3B78A 1PIEA 4BA2A 2Z5CB 4DV7I 3PS1A 4LF9E 3B8HA 3T1HI 4BA2B 1N34I 2UUCE 4FW7A 4AM3A 4UTGA 3QT8A 4FWGA 5JEAA 1OYPA 4OO1C 4B3TI 2C38A 2E5LE 3WU6A 4DR2E 1ZM4A 4LF6E 1Y4UA 4JI2I 2F4VE 2GO3A 3GLLA 4PRXA 2NN6C 4WUCA 4KQVA 3M85D 4LFAI 4OO1B 2Z5EA 2R3VA 4AIMA 5LMNI 2BM1A 2C39A 4FWHA 4DU8A 4GKKI 1YH8A 3U1KA 2HK2A 4FW6A 2R42A 1OYSA 4IZJB 2JEBA 2UXBI 4OKGA 4JG4A 1NZ0A 1PVGA 1U2RA 4JI2E 4Z7YA 1IBMI 1OJ4A 4DR3E 1A6FA 2XEXA 1HNXI 1HR0E 2NN6F 2HKEA 3QT5A 2E5LI 4DV5E 4DV4I 2Z5BA 4NXMI 4LCGA 3Q6MA 2F4VI 2UUAE 4LF7E 2UXDE 3B4TA 4R1FA 5DRQA 1H7UA 2GO4A 4DV0I 4OO1D 1XNQE 5K36A 4HY1A 3J80C 1Z5AA 2X36A 3J80Q 1Z5BA 1KTVA 4GQUA 1IBME 4HXZA 4LFBI 3QT6A 4B3RI 5K36F 5C0XE 1HR0I 2UXBE 4DV4E 4FW4A 5C0XC 2VF3A 2PO1B 3ZM7A 4QNKA 4X64E 3T1YE 3PRYA 4YY3I 5FLXC 4YY3E 1HNZE 4LFCE 4IFDB 2GQ0A 4EMDA 2PNZB 2UU9E 5C0XD 4LFAE 1UEKA 1ELOA 1FKAE 2IOPA 2J7KA 3QT7A 3M7NG 2WNRA 3ZKBA 1P42A 2F1DA 4JI0E 2PO0B 1XMOI 2O1WA 1N36E 5JEAD 2JE6B 2JEAB 2O3ZA 1WUUA 2O1TA 3KRNA 4IS9A 3WU4A 3M6AA 2HHHE 1DARA 4DPWA 1QZRA 4B3TE 1UDOA 2C37A 2ZM6E 3L7ZA 2ZM6I 4IFDC 1FI4A 4OZEA 4X65E 1RR9A 1Y4SA 4LF7I 4LCHA 4GKJE 3JAMQ 4BA1B 1H73A 1XNRI 5LMUE 1RREA 2AJ4A 2BR2A 4MU3A 4DUYE 1ZXNA 3WU3A
chains in the Genus database with same CATH topology
4JI7I 4DR5I 5IWAE 1HNWE 3V2UC 3ZKDA 1Z0BA 4JI0I 4JI6I 4OX9E 4DR1I 2V2QA 4DPYA 1H74A 4LF5E 5LL6R 4LF5I 3LPSA 3K17A 4X64I 4DPXA 4DV1I 1N33E 3K1JA 4LFBE 3V5RA 1XMQE 5LMUI 4DUYI 1KVKA 3OTOE 4DUZI 1ZM3A 4HACB 4DV3I 2VQFI 5FLXQ 4JI8I 4X66E 2UUCI 4LF6I 1Z0CA 3J7AG 4AQYE 2ZITA 1IBLE 4K0KI 3B82A 4LF9I 4JI5I 3PYDA 1ZXMA 4DR7E 2E1RA 4IZJD 2HHHI 4WUBA 4DV3E 2UUBE 1IBKI 4USMA 5FWKA 5GMEA 1USVA 1B62A 4KHPE 4NXNI 4M1KA 5IWAI 1HNWI 1Y6ZA 4USKA 4JI4I 1FWKA 4MYTA 2UXCI 1NHIA 1I94I 4GKJI 4DR1E 4Z7CA 4DR2I 2NPFA 5A2QC 2V2ZA 1Z0VA 2GS8A 4JI5E 1H72C 1ZM2A 4DR5E 4JV5E 4I3HA 2A2CA 2Q2EB 4RPFA 1S4EA 5GMDA 4LF8I 1XNRE 2OI2A 2Z5BB 4DR7I 3PYGA 1XNQI 3P06A 3JAMC 4DV5I 5L3JA 1MG7A 1N0VC 4JI3E 4AQYI 1XMOE 1J5EE 1XMQI 3WU5A 4B3SE 1EI1A 4URLA 4DUZE 4DV1E 1KKHA 4WUDA 4DV6I 3H4LA 1HNXE 3GONA 1Z0EA 1KIJA 4DR3I 4JI6E 2UXCE 4DPTA 2PNMA 1FJGI 4DV2I 4DV2E 1N33I 3T1YI 3LNUA 4LF4I 4LFCI 4KHPI 4GKKE 1IBKE 3PYFA 4X65I 4DXLA 4B3RE 3LTOA 2Z5CA 4X62I 4B3SI 2VQEE 4HACA 2VQEI 4XTJA 2UUAI 1EA6A 4IZKB 1FNMA 2UXDI 3Q1QA 4JYAI 2HK3A 1Z0TA 3F0NA 1HR0I 2CGEA 3Q6NA 2A2DA 1Z59A 3PYEA 3HJCA 2CZ9A 4FW9A 2VQFE 4NXME 4DPUA 4JV5I 1H7SA 1HNZI 2IOQA 1N36I 1K47A 2EFGA 2UU9I 2HFSA 4B3MI 5LMNE 3CWVA 2PNLA 3J81Q 3ZZTA 1MX0A 5A2QQ 4ZVIA 4DV6E 4DR4I 1Z5CA 1IBLI 4DV0E 2V8PA 4FWDA 3T1HE 5BR8E 4UT4A 5BR8I 3K85A 4JI8E 4X66I 3J7AM 4PU9A 2V34A 1B63A 1NHJA 4K0KE 1N32I 4DV7E 5IT9C 4PRVA 1N0UA 1PKPA 1HK7A 2BM0A 1FWLA 2DEJA 4DU7A 1ZM9A 4NXNE 4OX9I 1VISA 1USUA 4YHHI 2O1VA 2V2VA 4YHHE 3ZZ0A 1I94E 2HFUA 2LJPA 1XHKA 2X7IA 2BV3A 3J81C 1D6TA 4B3ME 4IZJA 2ZBKB 1S16A 4HYMA 2O1UA 4JYAE 4JI3I 3HULA 3D4JA 2HKJA 4X62E 4FN5A 1N32E 1J5EI 1BKNA 4DR4E 1Z0WA 4LF8E 3OTOI 1Z0GA 2DEIA 1NHHA 1N34E 4IZKA 3ZZUA 4JI4E 4DR6E 2CG9A 4MYUA 4JI1E 2WW4A 4JI1I 4LF4E 5IT9Q 1MU5A 2UUBI 4JI7E 1FJGE 4N3OA 4ED4A 4DR6I 4P52A 4P7AA 3B78A 1PIEA 2Z5CB 4DV7I 4LF9E 3B8HA 3T1HI 1N34I 2UUCE 3QT8A 4UTGA 4FWGA 4B3TI 2E5LE 3WU6A 4DR2E 1ZM4A 4LF6E 1Y4UA 4JI2I 2F4VE 4PRXA 4WUCA 4KQVA 4LFAI 2Z5EA 2R3VA 5LMNI 2BM1A 4DU8A 4FWHA 4GKKI 2HK2A 2R42A 4IZJB 2UXBI 4JG4A 1NZ0A 1PVGA 1U2RA 4JI2E 4Z7YA 1IBMI 1OJ4A 4DR3E 1A6FA 2XEXA 1HNXI 1HR0E 2HKEA 3QT5A 2E5LI 4DV5E 4DV4I 2Z5BA 4NXMI 3Q6MA 2F4VI 2UUAE 4LF7E 2UXDE 4R1FA 1H7UA 4DV0I 1XNQE 4HY1A 3J80C 1Z5AA 2X36A 3J80Q 1Z5BA 1KTVA 1IBME 4HXZA 4LFBI 3QT6A 4B3RI 2UXBE 4DV4E 2VF3A 3ZM7A 4X64E 3T1YE 3PRYA 4YY3I 5FLXC 4YY3E 1HNZE 4LFCE 2GQ0A 4EMDA 2UU9E 4LFAE 1UEKA 1ELOA 1FKAE 2IOPA 2J7KA 3QT7A 3ZKBA 4JI0E 1XMOI 2O1WA 1N36E 1WUUA 2O1TA 3WU4A 3M6AA 2HHHE 1DARA 4DPWA 1QZRA 4B3TE 2ZM6E 2ZM6I 1FI4A 4X65E 1RR9A 1Y4SA 4LF7I 4GKJE 3JAMQ 1H73A 1XNRI 5LMUE 1RREA 2AJ4A 4DUYE 1ZXNA 3WU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 I;  4DR5 I;  5IWA E;  1HNW E;  3V2U C;  3ZKD A;  1Z0B A;  4JI0 I;  4JI6 I;  4OX9 E;  4DR1 I;  2V2Q A;  4DPY A;  1H74 A;  4LF5 E;  5LL6 R;  4LF5 I;  3LPS A;  3K17 A;  4X64 I;  4DPX A;  4DV1 I;  1N33 E;  3K1J A;  4LFB E;  3V5R A;  1XMQ E;  5LMU I;  4DUY I;  1KVK A;  3OTO E;  4DUZ I;  1ZM3 A;  4HAC B;  4DV3 I;  2VQF I;  5FLX Q;  4JI8 I;  4X66 E;  2UUC I;  4LF6 I;  1Z0C A;  3J7A G;  4AQY E;  2ZIT A;  1IBL E;  4K0K I;  3B82 A;  4LF9 I;  4JI5 I;  3PYD A;  1ZXM A;  4DR7 E;  2E1R A;  2HHH I;  4WUB A;  4DV3 E;  2UUB E;  1IBK I;  4USM A;  5GME A;  1B62 A;  4KHP E;  4NXN I;  4M1K A;  5IWA I;  1HNW I;  4USK A;  4JI4 I;  1FWK A;  4MYT A;  2UXC I;  1NHI A;  1I94 I;  4GKJ I;  4DR1 E;  4Z7C A;  4DR2 I;  2NPF A;  5A2Q C;  2V2Z A;  1Z0V A;  2GS8 A;  4JI5 E;  1H72 C;  1ZM2 A;  4DR5 E;  4JV5 E;  4I3H A;  2A2C A;  2Q2E B;  4RPF A;  1S4E A;  5GMD A;  4LF8 I;  1XNR E;  2OI2 A;  4DR7 I;  3PYG A;  1XNQ I;  3JAM C;  4DV5 I;  5L3J A;  1MG7 A;  1N0V C;  4JI3 E;  4AQY I;  1XMO E;  1J5E E;  1XMQ I;  3WU5 A;  4B3S E;  1EI1 A;  4URL A;  4DUZ E;  4DV1 E;  1KKH A;  4WUD A;  4DV6 I;  3H4L A;  1HNX E;  3GON A;  1Z0E A;  1KIJ A;  4DR3 I;  4JI6 E;  2UXC E;  4DPT A;  1FJG I;  4DV2 I;  4DV2 E;  1N33 I;  3T1Y I;  3LNU A;  4LF4 I;  4LFC I;  4KHP I;  4GKK E;  1IBK E;  3PYF A;  4X65 I;  4DXL A;  4B3R E;  3LTO A;  4X62 I;  4B3S I;  2VQE E;  4HAC A;  2VQE I;  4XTJ A;  2UUA I;  1EA6 A;  1FNM A;  2UXD I;  3Q1Q A;  4JYA I;  2HK3 A;  1Z0T A;  3F0N A;  1HR0 I;  2A2D A;  1Z59 A;  3PYE A;  2CZ9 A;  4FW9 A;  2VQF E;  4NXM E;  4DPU A;  4JV5 I;  1H7S A;  1HNZ I;  1N36 I;  1K47 A;  2EFG A;  2UU9 I;  2HFS A;  4B3M I;  5LMN E;  3CWV A;  3J81 Q;  3ZZT A;  1MX0 A;  5A2Q Q;  4ZVI A;  4DV6 E;  4DR4 I;  1Z5C A;  1IBL I;  4DV0 E;  2V8P A;  4FWD A;  3T1H E;  5BR8 E;  4UT4 A;  5BR8 I;  4JI8 E;  4X66 I;  3J7A M;  4PU9 A;  2V34 A;  1B63 A;  1NHJ A;  4K0K E;  1N32 I;  4DV7 E;  5IT9 C;  4PRV A;  1N0U A;  1PKP A;  2BM0 A;  1FWL A;  2DEJ A;  4DU7 A;  1ZM9 A;  4NXN E;  4OX9 I;  1VIS A;  4YHH I;  2V2V A;  4YHH E;  3ZZ0 A;  1I94 E;  2HFU A;  2LJP A;  1XHK A;  2X7I A;  2BV3 A;  3J81 C;  1D6T A;  4B3M E;  2ZBK B;  1S16 A;  4HYM A;  4JYA E;  4JI3 I;  3HUL A;  3D4J A;  2HKJ A;  4X62 E;  4FN5 A;  1N32 E;  1J5E I;  1BKN A;  4DR4 E;  1Z0W A;  4LF8 E;  3OTO I;  1Z0G A;  1NHH A;  2DEI A;  1N34 E;  3ZZU A;  4JI4 E;  4DR6 E;  4MYU A;  4JI1 E;  2WW4 A;  4JI1 I;  4LF4 E;  5IT9 Q;  1MU5 A;  2UUB I;  4JI7 E;  1FJG E;  4ED4 A;  4DR6 I;  4P52 A;  4P7A A;  3B78 A;  1PIE A;  4DV7 I;  4LF9 E;  3B8H A;  3T1H I;  1N34 I;  2UUC E;  3QT8 A;  4UTG A;  4FWG A;  4B3T I;  2E5L E;  3WU6 A;  4DR2 E;  1ZM4 A;  4LF6 E;  4JI2 I;  2F4V E;  4PRX A;  4WUC A;  4KQV A;  4LFA I;  2R3V A;  5LMN I;  2BM1 A;  4DU8 A;  4FWH A;  4GKK I;  2HK2 A;  2R42 A;  2UXB I;  4JG4 A;  1NZ0 A;  1PVG A;  1U2R A;  4JI2 E;  4Z7Y A;  1IBM I;  1OJ4 A;  4DR3 E;  1A6F A;  2XEX A;  1HNX I;  1HR0 E;  2HKE A;  3QT5 A;  2E5L I;  4DV5 E;  4DV4 I;  4NXM I;  2F4V I;  2UUA E;  4LF7 E;  2UXD E;  4R1F A;  1H7U A;  4DV0 I;  1XNQ E;  4HY1 A;  3J80 C;  1Z5A A;  2X36 A;  3J80 Q;  1Z5B A;  1KTV A;  1IBM E;  4HXZ A;  4LFB I;  3QT6 A;  4B3R I;  2UXB E;  4DV4 E;  2VF3 A;  3ZM7 A;  4X64 E;  3T1Y E;  4YY3 I;  5FLX C;  4YY3 E;  1HNZ E;  4LFC E;  4EMD A;  2UU9 E;  4LFA E;  1UEK A;  1ELO A;  1FKA E;  2J7K A;  3QT7 A;  3ZKB A;  4JI0 E;  1XMO I;  1N36 E;  1WUU A;  3WU4 A;  3M6A A;  2HHH E;  1DAR A;  4DPW A;  1QZR A;  4B3T E;  2ZM6 E;  2ZM6 I;  1FI4 A;  4X65 E;  1RR9 A;  4LF7 I;  4GKJ E;  3JAM Q;  1H73 A;  1XNR I;  5LMU E;  1RRE A;  2AJ4 A;  4DUY E;  1ZXN A;  3WU3 A; 
#chains in the Genus database with same CATH topology
 4JI7 I;  4DR5 I;  5IWA E;  1HNW E;  2JT2 A;  3V2U C;  3ZKD A;  1Z0B A;  4MQY A;  4JI0 I;  4JI6 I;  4OX9 E;  4DR1 I;  2V2Q A;  4DPY A;  2VES A;  1H74 A;  4LF5 E;  4OO1 E;  5LL6 R;  4BA1 A;  3LPS A;  4LF5 I;  3K17 A;  4X64 I;  4DPX A;  5DNX A;  4DV1 I;  1N33 E;  5K36 D;  3K1J A;  1R6M A;  5DRP A;  4LFB E;  3L7Z B;  3V5R A;  5LMU I;  4DUY I;  1XMQ E;  1KVK A;  3OTO E;  1Y60 A;  2J65 A;  4DUZ I;  1ZM3 A;  4HAC B;  4DV3 I;  1YHC A;  5FLX Q;  2VQF I;  1E3P A;  4JI8 I;  4X66 E;  1XXE A;  2UUC I;  4LF6 I;  1Z0C A;  3J7A G;  4AQY E;  2ZIT A;  1IBL E;  4K0K I;  2CVE A;  3B82 A;  4LF9 I;  4JI5 I;  3PYD A;  1ZXM A;  4DR7 E;  4IZJ D;  2E1R A;  2HHH I;  3HKM A;  4WUB A;  4DV3 E;  2UUB E;  2NN6 B;  1IBK I;  4USM A;  5FWK A;  5GME A;  1USV A;  1B62 A;  4KHP E;  4NXN I;  4M1K A;  4MU4 A;  5IWA I;  1HNW I;  1Y6Z A;  4USK A;  4JI4 I;  1FWK A;  4MYT A;  2NN6 E;  1NHI A;  2UXC I;  1I94 I;  3H1C A;  4GKJ I;  4DR1 E;  4IFD E;  5K36 B;  4Z7C A;  4DR2 I;  2NPF A;  2BA1 D;  5A2Q C;  2WP8 A;  2V2Z A;  1Z0V A;  2GS8 A;  4JI5 E;  1H72 C;  1ZM2 A;  4DR5 E;  4JV5 E;  4I3H A;  2A2C A;  2Q2E B;  1OYR A;  4RPF A;  1S4E A;  5GMD A;  5JEA F;  4LF8 I;  1XNR E;  2OI2 A;  2Z5B B;  4DR7 I;  3PYG A;  1XNQ I;  3P06 A;  3JAM C;  4DV5 I;  5L3J A;  1MG7 A;  5DRO A;  5K36 E;  1N0V C;  4JI3 E;  2BA1 G;  4MU1 A;  4AQY I;  1XMO E;  1J5E E;  1UDN A;  1XMQ I;  3WU5 A;  4B3S E;  2JEB B;  1EI1 A;  4URL A;  3P76 A;  4DUZ E;  4DV1 E;  1KKH A;  4WUD A;  4DV6 I;  3H4L A;  1HNX E;  3GON A;  1Z0E A;  1KIJ A;  5JEA C;  4DR3 I;  4JI6 E;  2UXC E;  4DPT A;  2PNM A;  1FJG I;  4FW3 A;  3PS2 A;  4DV2 I;  3GME A;  4DV2 E;  1N33 I;  3T1Y I;  3LNU A;  4OO1 F;  4LF4 I;  4LFC I;  4LPF A;  4KHP I;  2IES A;  5K36 C;  5DNL A;  4GKK E;  1Y5Y A;  2IER A;  1IBK E;  3CDI A;  3PYF A;  5C0X F;  4DXL A;  4X65 I;  4B3R E;  3LTO A;  2Z5C A;  4X62 I;  4B3S I;  3NZK A;  4HAC A;  2VQE E;  5C0X A;  3M7N D;  2VQE I;  4XTJ A;  1E3H A;  1UDS A;  2UUA I;  1EA6 A;  4IZK B;  1FNM A;  2UXD I;  3Q1Q A;  3CDJ A;  4JYA I;  2HK3 A;  1Z0T A;  3F0N A;  4LOM A;  2CGE A;  3Q6N A;  4J3D A;  2A2D A;  1Z59 A;  3PYE A;  2C37 B;  4FW5 A;  3HJC A;  4LCF A;  2CZ9 A;  4FW9 A;  2VQF E;  4NXM E;  4AID A;  4DPU A;  4JV5 I;  1UDQ A;  1H7S A;  2WP8 B;  1HNZ I;  2IOQ A;  1N36 I;  1K47 A;  2EFG A;  2PO2 B;  2UU9 I;  2HFS A;  2JEA A;  4B3M I;  5LMN E;  2AE8 A;  3CWV A;  4IFD D;  2PNL A;  3J81 Q;  3ZZT A;  1MX0 A;  5A2Q Q;  4U3D A;  4QNJ A;  5EKW A;  4ZVI A;  4DV6 E;  4DR4 I;  1Z5C A;  2NN6 A;  5C0X B;  1IBL I;  4DV0 E;  4U3B A;  5ELW A;  2V8P A;  4FWD A;  3T1H E;  5BR8 E;  4UT4 A;  5BR8 I;  3K85 A;  4JI8 E;  4X66 I;  4MDT A;  3J7A M;  4PU9 A;  2V34 A;  2PO0 A;  4MU0 A;  1B63 A;  2JE6 A;  1NHJ A;  4K0K E;  1N32 I;  4DV7 E;  5IT9 C;  4PRV A;  1N0U A;  1PKP A;  1HK7 A;  3M85 G;  1RHY A;  2BM0 A;  1FWL A;  2DEJ A;  4DU7 A;  1VI7 A;  1ZM9 A;  4NXN E;  4OX9 I;  2PO1 A;  4ISA A;  1VIS A;  1USU A;  4YHH I;  2O1V A;  2V2V A;  4YHH E;  3ZZ0 A;  1I94 E;  2HFU A;  2LJP A;  1XHK A;  3UHM A;  2X7I A;  3P3C A;  4IFD F;  2BV3 A;  3J81 C;  1D6T A;  4B3M E;  4IZJ A;  2ZBK B;  1S16 A;  4HYM A;  2O1U A;  4JYA E;  2BA0 G;  4JI3 I;  3HUL A;  2PO2 A;  5JEA E;  2C39 B;  2BR2 B;  3D4J A;  2HKJ A;  4X62 E;  4FN5 A;  1N32 E;  1J5E I;  1BKN A;  3PS3 A;  4DR4 E;  2NN6 D;  3GCM A;  1Z0W A;  4LF8 E;  5EL9 A;  3OTO I;  1Z0G A;  1NHH A;  2DEI A;  5JEA B;  1N34 E;  4IZK A;  3ZZU A;  4JI4 E;  3DD6 A;  4NBQ A;  4DR6 E;  2CG9 A;  3P3E A;  2BA0 D;  4MYU A;  3U1Y A;  4JI1 E;  2WW4 A;  5DRR A;  1R6L A;  4JI1 I;  3P3G A;  4LF4 E;  2WNR B;  4OO1 A;  5IT9 Q;  1MU5 A;  2UUB I;  4JI7 E;  2PNZ A;  4IFD A;  1FJG E;  2C38 B;  4N3O A;  4ED4 A;  4DR6 I;  4P52 A;  4P7A A;  3B78 A;  1PIE A;  4BA2 A;  2Z5C B;  4DV7 I;  3PS1 A;  4LF9 E;  3B8H A;  3T1H I;  4BA2 B;  1N34 I;  2UUC E;  4FW7 A;  4AM3 A;  4UTG A;  3QT8 A;  4FWG A;  5JEA A;  1OYP A;  4OO1 C;  4B3T I;  2C38 A;  2E5L E;  3WU6 A;  4DR2 E;  1ZM4 A;  4LF6 E;  1Y4U A;  4JI2 I;  2F4V E;  2GO3 A;  3GLL A;  4PRX A;  2NN6 C;  4WUC A;  4KQV A;  3M85 D;  4LFA I;  4OO1 B;  2Z5E A;  2R3V A;  4AIM A;  5LMN I;  2BM1 A;  2C39 A;  4FWH A;  4DU8 A;  4GKK I;  1YH8 A;  3U1K A;  2HK2 A;  4FW6 A;  2R42 A;  1OYS A;  4IZJ B;  2JEB A;  2UXB I;  4OKG A;  4JG4 A;  1NZ0 A;  1PVG A;  1U2R A;  4JI2 E;  4Z7Y A;  1IBM I;  1OJ4 A;  4DR3 E;  1A6F A;  2XEX A;  1HNX I;  1HR0 E;  2NN6 F;  2HKE A;  3QT5 A;  2E5L I;  4DV5 E;  4DV4 I;  2Z5B A;  4NXM I;  4LCG A;  3Q6M A;  2F4V I;  2UUA E;  4LF7 E;  2UXD E;  3B4T A;  4R1F A;  5DRQ A;  1H7U A;  2GO4 A;  4DV0 I;  4OO1 D;  1XNQ E;  5K36 A;  4HY1 A;  3J80 C;  1Z5A A;  2X36 A;  3J80 Q;  1Z5B A;  1KTV A;  4GQU A;  1IBM E;  4HXZ A;  4LFB I;  3QT6 A;  4B3R I;  5K36 F;  5C0X E;  1HR0 I;  2UXB E;  4DV4 E;  4FW4 A;  5C0X C;  2VF3 A;  2PO1 B;  3ZM7 A;  4QNK A;  4X64 E;  3T1Y E;  3PRY A;  4YY3 I;  5FLX C;  4YY3 E;  1HNZ E;  4LFC E;  4IFD B;  2GQ0 A;  4EMD A;  2PNZ B;  2UU9 E;  5C0X D;  4LFA E;  1UEK A;  1ELO A;  1FKA E;  2IOP A;  2J7K A;  3QT7 A;  3M7N G;  2WNR A;  3ZKB A;  1P42 A;  2F1D A;  4JI0 E;  2PO0 B;  1XMO I;  2O1W A;  1N36 E;  5JEA D;  2JE6 B;  2JEA B;  2O3Z A;  1WUU A;  2O1T A;  3KRN A;  4IS9 A;  3WU4 A;  3M6A A;  2HHH E;  1DAR A;  4DPW A;  1QZR A;  4B3T E;  1UDO A;  2C37 A;  2ZM6 E;  3L7Z A;  2ZM6 I;  4IFD C;  1FI4 A;  4OZE A;  4X65 E;  1RR9 A;  1Y4S A;  4LF7 I;  4LCH A;  4GKJ E;  3JAM Q;  4BA1 B;  1H73 A;  1XNR I;  5LMU E;  1RRE A;  2AJ4 A;  2BR2 A;  4MU3 A;  4DUY E;  1ZXN A;  3WU3 A; 
#chains in the Genus database with same CATH homology
 4JI7 I;  4DR5 I;  5IWA E;  1HNW E;  3V2U C;  3ZKD A;  1Z0B A;  4JI0 I;  4JI6 I;  4OX9 E;  4DR1 I;  2V2Q A;  4DPY A;  1H74 A;  4LF5 E;  5LL6 R;  4LF5 I;  3LPS A;  3K17 A;  4X64 I;  4DPX A;  4DV1 I;  1N33 E;  3K1J A;  4LFB E;  3V5R A;  1XMQ E;  5LMU I;  4DUY I;  1KVK A;  3OTO E;  4DUZ I;  1ZM3 A;  4HAC B;  4DV3 I;  2VQF I;  5FLX Q;  4JI8 I;  4X66 E;  2UUC I;  4LF6 I;  1Z0C A;  3J7A G;  4AQY E;  2ZIT A;  1IBL E;  4K0K I;  3B82 A;  4LF9 I;  4JI5 I;  3PYD A;  1ZXM A;  4DR7 E;  2E1R A;  4IZJ D;  2HHH I;  4WUB A;  4DV3 E;  2UUB E;  1IBK I;  4USM A;  5FWK A;  5GME A;  1USV A;  1B62 A;  4KHP E;  4NXN I;  4M1K A;  5IWA I;  1HNW I;  1Y6Z A;  4USK A;  4JI4 I;  1FWK A;  4MYT A;  2UXC I;  1NHI A;  1I94 I;  4GKJ I;  4DR1 E;  4Z7C A;  4DR2 I;  2NPF A;  5A2Q C;  2V2Z A;  1Z0V A;  2GS8 A;  4JI5 E;  1H72 C;  1ZM2 A;  4DR5 E;  4JV5 E;  4I3H A;  2A2C A;  2Q2E B;  4RPF A;  1S4E A;  5GMD A;  4LF8 I;  1XNR E;  2OI2 A;  2Z5B B;  4DR7 I;  3PYG A;  1XNQ I;  3P06 A;  3JAM C;  4DV5 I;  5L3J A;  1MG7 A;  1N0V C;  4JI3 E;  4AQY I;  1XMO E;  1J5E E;  1XMQ I;  3WU5 A;  4B3S E;  1EI1 A;  4URL A;  4DUZ E;  4DV1 E;  1KKH A;  4WUD A;  4DV6 I;  3H4L A;  1HNX E;  3GON A;  1Z0E A;  1KIJ A;  4DR3 I;  4JI6 E;  2UXC E;  4DPT A;  2PNM A;  1FJG I;  4DV2 I;  4DV2 E;  1N33 I;  3T1Y I;  3LNU A;  4LF4 I;  4LFC I;  4KHP I;  4GKK E;  1IBK E;  3PYF A;  4X65 I;  4DXL A;  4B3R E;  3LTO A;  2Z5C A;  4X62 I;  4B3S I;  2VQE E;  4HAC A;  2VQE I;  4XTJ A;  2UUA I;  1EA6 A;  4IZK B;  1FNM A;  2UXD I;  3Q1Q A;  4JYA I;  2HK3 A;  1Z0T A;  3F0N A;  1HR0 I;  2CGE A;  3Q6N A;  2A2D A;  1Z59 A;  3PYE A;  3HJC A;  2CZ9 A;  4FW9 A;  2VQF E;  4NXM E;  4DPU A;  4JV5 I;  1H7S A;  1HNZ I;  2IOQ A;  1N36 I;  1K47 A;  2EFG A;  2UU9 I;  2HFS A;  4B3M I;  5LMN E;  3CWV A;  2PNL A;  3J81 Q;  3ZZT A;  1MX0 A;  5A2Q Q;  4ZVI A;  4DV6 E;  4DR4 I;  1Z5C A;  1IBL I;  4DV0 E;  2V8P A;  4FWD A;  3T1H E;  5BR8 E;  4UT4 A;  5BR8 I;  3K85 A;  4JI8 E;  4X66 I;  3J7A M;  4PU9 A;  2V34 A;  1B63 A;  1NHJ A;  4K0K E;  1N32 I;  4DV7 E;  5IT9 C;  4PRV A;  1N0U A;  1PKP A;  1HK7 A;  2BM0 A;  1FWL A;  2DEJ A;  4DU7 A;  1ZM9 A;  4NXN E;  4OX9 I;  1VIS A;  1USU A;  4YHH I;  2O1V A;  2V2V A;  4YHH E;  3ZZ0 A;  1I94 E;  2HFU A;  2LJP A;  1XHK A;  2X7I A;  2BV3 A;  3J81 C;  1D6T A;  4B3M E;  4IZJ A;  2ZBK B;  1S16 A;  4HYM A;  2O1U A;  4JYA E;  4JI3 I;  3HUL A;  3D4J A;  2HKJ A;  4X62 E;  4FN5 A;  1N32 E;  1J5E I;  1BKN A;  4DR4 E;  1Z0W A;  4LF8 E;  3OTO I;  1Z0G A;  2DEI A;  1NHH A;  1N34 E;  4IZK A;  3ZZU A;  4JI4 E;  4DR6 E;  2CG9 A;  4MYU A;  4JI1 E;  2WW4 A;  4JI1 I;  4LF4 E;  5IT9 Q;  1MU5 A;  2UUB I;  4JI7 E;  1FJG E;  4N3O A;  4ED4 A;  4DR6 I;  4P52 A;  4P7A A;  3B78 A;  1PIE A;  2Z5C B;  4DV7 I;  4LF9 E;  3B8H A;  3T1H I;  1N34 I;  2UUC E;  3QT8 A;  4UTG A;  4FWG A;  4B3T I;  2E5L E;  3WU6 A;  4DR2 E;  1ZM4 A;  4LF6 E;  1Y4U A;  4JI2 I;  2F4V E;  4PRX A;  4WUC A;  4KQV A;  4LFA I;  2Z5E A;  2R3V A;  5LMN I;  2BM1 A;  4DU8 A;  4FWH A;  4GKK I;  2HK2 A;  2R42 A;  4IZJ B;  2UXB I;  4JG4 A;  1NZ0 A;  1PVG A;  1U2R A;  4JI2 E;  4Z7Y A;  1IBM I;  1OJ4 A;  4DR3 E;  1A6F A;  2XEX A;  1HNX I;  1HR0 E;  2HKE A;  3QT5 A;  2E5L I;  4DV5 E;  4DV4 I;  2Z5B A;  4NXM I;  3Q6M A;  2F4V I;  2UUA E;  4LF7 E;  2UXD E;  4R1F A;  1H7U A;  4DV0 I;  1XNQ E;  4HY1 A;  3J80 C;  1Z5A A;  2X36 A;  3J80 Q;  1Z5B A;  1KTV A;  1IBM E;  4HXZ A;  4LFB I;  3QT6 A;  4B3R I;  2UXB E;  4DV4 E;  2VF3 A;  3ZM7 A;  4X64 E;  3T1Y E;  3PRY A;  4YY3 I;  5FLX C;  4YY3 E;  1HNZ E;  4LFC E;  2GQ0 A;  4EMD A;  2UU9 E;  4LFA E;  1UEK A;  1ELO A;  1FKA E;  2IOP A;  2J7K A;  3QT7 A;  3ZKB A;  4JI0 E;  1XMO I;  2O1W A;  1N36 E;  1WUU A;  2O1T A;  3WU4 A;  3M6A A;  2HHH E;  1DAR A;  4DPW A;  1QZR A;  4B3T E;  2ZM6 E;  2ZM6 I;  1FI4 A;  4X65 E;  1RR9 A;  1Y4S A;  4LF7 I;  4GKJ E;  3JAM Q;  1H73 A;  1XNR I;  5LMU E;  1RRE A;  2AJ4 A;  4DUY E;  1ZXN A;  3WU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...