5LMNI

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnI00
2UUBE 5L3JA 3B78A 5A2QC 4DV4I 4YHHI 1IBKI 4JI6I 2UUAE 1A6FA 2E5LI 3T1HE 4LF9I 1S16A 2UXDE 4DR7I 5LMUE 1PIEA 4HY1A 1IBLE 1FJGE 4LFCI 4JI3I 3CWVA 4B3RI 4NXME 2Q2EB 2CZ9A 3T1YI 4NXNI 1EI1A 1HNWE 1IBKE 2HHHI 1N0VC 2BM0A 1XNQE 1Z0CA 5IT9Q 1Z5CA 3QT7A 5FLXQ 4DU7A 5IWAI 4DU8A 5A2QQ 2AJ4A 4DPUA 1MX0A 4DV3I 2UXDI 1Z0BA 4USMA 4AQYE 1H7UA 3PYGA 1KIJA 2VQEE 4WUDA 2WW4A 2F4VI 4HYMA 4JI4E 4DR7E 4JI8I 4JI1E 1Z0EA 2UUAI 4JI5I 4YHHE 4GKKE 3ZZTA 3ZZ0A 4EMDA 2OI2A 4NXMI 4MYTA 4ED4A 4FWDA 1FI4A 1XMQI 1H73A 4HXZA 4R1FA 4DR5I 4KHPE 4DR3E 5IT9C 1ZM9A 3J81C 1N32E 2UUCE 1KVKA 4JV5E 4OX9I 4JYAI 4JI6E 4MYUA 4JI7E 4PRXA 2NPFA 4DV4E 4DR1I 4LF7E 3J7AM 4X64E 1HNZE 2UXCE 2A2CA 1N36I 4K0KE 1PKPA 3JAMQ 1MG7A 4LF5I 1J5EE 1S4EA 4DV6E 4B3ME 4GKJI 3WU6A 4HACB 2VQFI 2XEXA 1NHJA 4PU9A 1ZM2A 4WUCA 1NHIA 4DV7I 2HKEA 1N33I 1RREA 1HNXI 4DV2E 1I94E 4ZVIA 2VF3A 2DEJA 4DPYA 3WU4A 2X7IA 1K47A 4DR6I 1NZ0A 4LFBI 3HULA 1FKAE 4JI2I 1N0UA 4B3SE 2ZBKB 3J80Q 3B8HA 4X65E 1ELOA 1WUUA 5GMEA 1Z0WA 1BKNA 4JI8E 2F4VE 4DR2I 2VQEI 1N33E 4JI7I 4FN5A 1B62A 3GONA 3V2UC 2ZITA 3LTOA 2X36A 1Z0VA 1H72C 1XNRE 4DUZI 3M6AA 1Z5BA 3OTOE 4USKA 1XHKA 4LF5E 4LFBE 4URLA 2BM1A 5LMNI 4DV5I 4WUBA 4Z7CA 1MU5A 4LF7I 2V8PA 4LFAI 4DPTA 3T1YE 1EA6A 1I94I 4FWHA 3J7AG 4I3HA 4UTGA 2HK2A 2GS8A 1IBLI 3PYDA 4DV0I 4RPFA 3K1JA 3ZKBA 2VQFE 1XMQE 1FWKA 2E5LE 2HKJA 4DR4I 3JAMC 1H7SA 3ZM7A 4LF4I 4P7AA 1H74A 2ZM6I 2UUBI 4YY3I 4YY3E 4X62I 1ZM3A 2HFUA 3J80C 1ZXMA 4DR4E 4JV5I 2BV3A 2EFGA 2UUCI 1N32I 3LPSA 1KKHA 1Z5AA 5LMUI 4FWGA 4LF8E 3T1HI 1XNQI 5FLXC 2R42A 1B63A 4KQVA 3F0NA 4JI5E 4NXNE 4X62E 3QT6A 5LMNE 4JI1I 1FNMA 4LF8I 2ZM6E 4B3RE 4DV1I 3J81Q 1FJGI 2V34A 5GMDA 4LF4E 1ZM4A 4HACA 1OJ4A 3V5RA 4DUYE 3PYFA 4B3TE 4DUZE 4DV3E 1XNRI 2V2VA 2V2ZA 4Z7YA 4X66E 1ZXNA 3QT5A 1PVGA 4DXLA 5IWAE 4DPXA 4DV5E 3PYEA 3QT8A 2HHHE 3ZZUA 3OTOI 1HNWI 1XMOE 5LL6R 2V2QA 4B3SI 1U2RA 1N34E 4JI3E 4LFCE 4JI0E 2A2DA 4DV0E 1UEKA 2E1RA 1Z59A 2UXBI 2UXBE 4LF9E 2UU9I 4DPWA 4LFAE 4UT4A 4P52A 4M1KA 5BR8E 1IBME 1KTVA 4GKJE 3H4LA 1XMOI 1RR9A 1IBMI 5BR8I 4DR6E 2UXCI 1HNXE 1HR0E 4LF6I 2DEIA 3Q1QA 1QZRA 1HR0I 4XTJA 4DR2E 4LF6E 4OX9E 4JYAE 3ZKDA 4X66I 2J7KA 4FW9A 4B3TI 4X65I 3WU5A 4DV7E 4DR5E 4KHPI 3WU3A 2R3VA 4JI2E 1N34I 4DV1E 2HK3A 4B3MI 4DV6I 2HFSA 1J5EI 1Z0GA 2LJPA 4DR1E 3B82A 4GKKI 4K0KI 1Z0TA 2UU9E 4PRVA 4DV2I 1HNZI 4X64I 1DARA 4JI4I 4AQYI 4JI0I 1NHHA 1FWLA 4JG4A 4DUYI 4DR3I 1VISA 3LNUA 1D6TA 3K17A 1N36E 3D4JA
chains in the Genus database with same CATH superfamily
2UUBE 5L3JA 3B78A 5A2QC 2BA1G 5EL9A 4YHHI 4DV4I 1IBKI 4JI6I 2UUAE 1A6FA 1OYPA 1P42A 4MQYA 2E5LI 3T1HE 4LF9I 4OO1C 1S16A 2UXDE 4DR7I 3M7ND 5LMUE 2CGEA 2C38B 4MDTA 4AM3A 5K36A 1PIEA 4HY1A 5DRRA 1IBLE 1USUA 5JEAD 1FJGE 4LFCI 4JI3I 3CWVA 2NN6A 2IERA 4B3RI 4NXME 2Q2EB 2CZ9A 2JEBA 3T1YI 4NXNI 1EI1A 1HNWE 1IBKE 2HHHI 5C0XC 1N0VC 2BM0A 5DNLA 1XNQE 4IFDC 1Z0CA 5IT9Q 2PO0B 5K36C 1Z5CA 3QT7A 5FLXQ 4DU7A 5IWAI 4IFDB 4DU8A 3K85A 4AIMA 5A2QQ 2AJ4A 4DPUA 1MX0A 2NN6B 4DV3I 2UXDI 1Z0BA 2NN6E 2PO2B 4USMA 4AQYE 1H7UA 3PYGA 1KIJA 4LOMA 2VQEE 2WNRA 4WUDA 2WW4A 2F4VI 4HYMA 4JI4E 4DR7E 1Y4SA 3PRYA 4JI8I 4JI1E 1Z0EA 2UUAI 4JI5I 4YHHE 5C0XF 4GKKE 3ZZTA 3ZZ0A 2O1UA 4EMDA 2OI2A 4NXMI 3M85G 4MYTA 4ED4A 4FWDA 1FI4A 1XMQI 1H73A 5K36E 4OO1F 4HXZA 4R1FA 4MU1A 4DR5I 4BA2B 4KHPE 4DR3E 5K36B 4OKGA 5IT9C 3GLLA 5JEAE 1ZM9A 5JEAC 1USVA 3J81C 2UUCE 1N32E 1KVKA 3DD6A 4IZKB 1YHCA 4JV5E 2GO3A 4OX9I 4JYAI 4JI6E 4MYUA 4JI7E 4PRXA 2NPFA 4DV4E 4DR1I 2BR2A 4LF7E 4MU4A 3J7AM 4X64E 1HNZE 5JEAF 2UXCE 3U1YA 2A2CA 4ISAA 1N36I 4K0KE 1PKPA 3JAMQ 1MG7A 1HK7A 4LF5I 1J5EE 5K36F 1S4EA 4DV6E 4B3ME 4GKJI 3WU6A 3KRNA 2O1TA 4HACB 2VQFI 2XEXA 1NHJA 4PU9A 1ZM2A 4WUCA 1NHIA 3HJCA 5C0XE 4DV7I 4IZJB 2HKEA 1N33I 5C0XB 3M85D 1RREA 2Z5BA 1HNXI 4DV2E 1I94E 4ZVIA 2VF3A 2WNRB 2DEJA 4DPYA 2C39A 3WU4A 2Z5EA 5JEAA 2X7IA 4IS9A 1K47A 4DR6I 2GO4A 1NZ0A 4LFBI 3HULA 4OO1D 1FKAE 4JI2I 1OYSA 1N0UA 4B3SE 2ZBKB 3J80Q 3B8HA 3B4TA 4FW3A 3P76A 4X65E 2O3ZA 1Y60A 1ELOA 1WUUA 5GMEA 1Z0WA 1BKNA 4JI8E 5DROA 2F4VE 4DR2I 4BA1A 4GQUA 2VQEI 1OYRA 1N33E 4JI7I 1E3PA 4FN5A 3Q6NA 3H1CA 1B62A 3GONA 3V2UC 2ZITA 3LTOA 4U3BA 2Z5CA 2X36A 1Z0VA 4IFDD 1H72C 1XNRE 4DUZI 4OZEA 3M6AA 1Z5BA 3OTOE 3PS1A 4USKA 4FW7A 1XHKA 2C37A 4LF5E 4LPFA 2PNZB 4LFBE 4URLA 2BM1A 5LMNI 4DV5I 4WUBA 5JEAB 4Z7CA 1MU5A 4LF7I 4MU0A 2V8PA 2VESA 4LFAI 5DRQA 4DPTA 3T1YE 1EA6A 1I94I 4FWHA 4BA1B 3J7AG 4I3HA 2JE6A 4UTGA 2HK2A 2GS8A 1IBLI 3PYDA 4DV0I 4RPFA 3K1JA 3ZKBA 2VQFE 4OO1B 2O1WA 1XMQE 1FWKA 4OO1E 2E5LE 2BA1D 4IZJD 2HKJA 1Y6ZA 5FWKA 3JAMC 4DR4I 2PO1B 1H7SA 3ZM7A 4LF4I 3PS3A 4P7AA 1H74A 2ZM6I 2UUBI 4YY3I 4YY3E 4X62I 1ZM3A 2HFUA 2BR2B 4J3DA 3J80C 4QNKA 1ZXMA 2CVEA 4U3DA 2C37B 3GCMA 4DR4E 4JV5I 2BV3A 5DNXA 2EFGA 2UUCI 1N32I 2NN6D 3LPSA 3M7NG 2IOQA 1KKHA 4OO1A 2JEAB 1Z5AA 5LMUI 1Y4UA 4FWGA 2C39B 4LF8E 2IESA 2BA0D 3T1HI 1XNQI 5FLXC 2R42A 1B63A 4KQVA 4LCFA 3F0NA 4JI5E 2Z5BB 4NXNE 4X62E 3QT6A 5LMNE 4JI1I 1FNMA 2NN6C 4LF8I 2ZM6E 4B3RE 5C0XA 4DV1I 3J81Q 1FJGI 2V34A 5GMDA 4LF4E 1ZM4A 5K36D 4HACA 1OJ4A 3V5RA 4DUYE 4MU3A 3PYFA 4NBQA 4B3TE 4DUZE 4DV3E 1XNRI 2V2VA 2V2ZA 4Z7YA 4X66E 3L7ZA 2F1DA 2JT2A 2PO0A 1ZXNA 4LCHA 3NZKA 3QT5A 2WP8B 1PVGA 4DXLA 5IWAE 3P3EA 4DPXA 4DV5E 3PYEA 2PO1A 3QT8A 5EKWA 2PNZA 1UDQA 3ZZUA 3OTOI 2HHHE 1R6LA 2CG9A 1XMOE 1HNWI 5LL6R 2V2QA 4B3SI 2JEBB 2NN6F 3CDIA 1U2RA 1Y5YA 1N34E 4JI3E 4LFCE 5C0XD 4JI0E 2A2DA 4DV0E 1UEKA 1UDOA 4IFDF 2E1RA 3HKMA 1Z59A 4FW4A 2UXBI 2UXBE 4LF9E 2UU9I 4DPWA 3GMEA 4LFAE 4UT4A 4P52A 4M1KA 5BR8E 3Q6MA 1IBME 1YH8A 4N3OA 3P06A 1KTVA 4GKJE 3L7ZB 2C38A 3H4LA 1XMOI 2PO2A 2J65A 2IOPA 2PNLA 5ELWA 1RR9A 4FW5A 1IBMI 5BR8I 4DR6E 2UXCI 1HNXE 4IZKA 1HR0E 4LF6I 2DEIA 3Q1QA 1QZRA 1HR0I 4XTJA 4DR2E 4LF6E 4OX9E 4JYAE 3ZKDA 1RHYA 4X66I 4IFDE 4FW6A 2J7KA 4FW9A 2WP8A 4IZJA 4B3TI 4X65I 2GQ0A 3WU5A 4DV7E 4BA2A 4DR5E 4KHPI 3WU3A 3P3GA 2R3VA 4JI2E 1N34I 2PNMA 4DV1E 2JE6B 2HK3A 4B3MI 4DV6I 2HFSA 1R6MA 3CDJA 1UDSA 1J5EI 1Z0GA 3UHMA 2AE8A 2LJPA 4DR1E 3B82A 4GKKI 4K0KI 1Z0TA 2UU9E 4PRVA 4DV2I 1HNZI 4X64I 1DARA 4JI4I 2BA0G 1VI7A 3U1KA 1E3HA 4AQYI 1N36E 4AIDA 4JI0I 3P3CA 1NHHA 5DRPA 2O1VA 1FWLA 4JG4A 4IFDA 4DUYI 2JEAA 4DR3I 1VISA 3PS2A 1UDNA 2Z5CB 3LNUA 1XXEA 4LCGA 1D6TA 3K17A 4QNJA 3D4JA
chains in the Genus database with same CATH topology
2UUBE 5L3JA 3B78A 5A2QC 4DV4I 4YHHI 1IBKI 4JI6I 2UUAE 1A6FA 2E5LI 3T1HE 4LF9I 1S16A 2UXDE 4DR7I 5LMUE 2CGEA 1PIEA 4HY1A 1IBLE 1USUA 1FJGE 4LFCI 4JI3I 3CWVA 4B3RI 4NXME 2Q2EB 2CZ9A 3T1YI 4NXNI 1EI1A 1HNWE 1IBKE 2HHHI 1N0VC 2BM0A 1XNQE 1Z0CA 5IT9Q 1Z5CA 3QT7A 5FLXQ 4DU7A 5IWAI 4DU8A 3K85A 5A2QQ 2AJ4A 4DPUA 1MX0A 4DV3I 2UXDI 1Z0BA 4USMA 4AQYE 1H7UA 3PYGA 1KIJA 2VQEE 4WUDA 2WW4A 2F4VI 4HYMA 4JI4E 4DR7E 1Y4SA 3PRYA 4JI8I 4JI1E 1Z0EA 2UUAI 4JI5I 4YHHE 4GKKE 3ZZTA 3ZZ0A 2O1UA 4EMDA 2OI2A 4NXMI 4MYTA 4ED4A 4FWDA 1FI4A 1XMQI 1H73A 4HXZA 4R1FA 4DR5I 4KHPE 4DR3E 5IT9C 1ZM9A 1USVA 3J81C 2UUCE 1N32E 1KVKA 4IZKB 4JV5E 4OX9I 4JYAI 4JI6E 4MYUA 4JI7E 4PRXA 2NPFA 4DV4E 4DR1I 4LF7E 3J7AM 4X64E 1HNZE 2UXCE 2A2CA 1N36I 4K0KE 1PKPA 3JAMQ 1MG7A 1HK7A 4LF5I 1J5EE 1S4EA 4DV6E 4B3ME 4GKJI 3WU6A 2O1TA 4HACB 2VQFI 2XEXA 1NHJA 4PU9A 1ZM2A 4WUCA 1NHIA 3HJCA 4DV7I 4IZJB 2HKEA 1N33I 1RREA 2Z5BA 1HNXI 4DV2E 1I94E 4ZVIA 2VF3A 2DEJA 4DPYA 3WU4A 2Z5EA 2X7IA 1K47A 4DR6I 1NZ0A 4LFBI 3HULA 1FKAE 4JI2I 1N0UA 4B3SE 2ZBKB 3J80Q 3B8HA 4X65E 1ELOA 1WUUA 5GMEA 1Z0WA 1BKNA 4JI8E 2F4VE 4DR2I 2VQEI 1N33E 4JI7I 4FN5A 3Q6NA 1B62A 3GONA 3V2UC 2ZITA 3LTOA 2Z5CA 2X36A 1Z0VA 1H72C 1XNRE 4DUZI 3M6AA 1Z5BA 3OTOE 4USKA 1XHKA 4LF5E 4LFBE 4URLA 2BM1A 5LMNI 4DV5I 4WUBA 4Z7CA 1MU5A 4LF7I 2V8PA 4LFAI 4DPTA 3T1YE 1EA6A 1I94I 4FWHA 3J7AG 4I3HA 4UTGA 2HK2A 2GS8A 1IBLI 3PYDA 4DV0I 4RPFA 3K1JA 3ZKBA 2VQFE 2O1WA 1XMQE 1FWKA 2E5LE 4IZJD 2HKJA 1Y6ZA 5FWKA 3JAMC 4DR4I 1H7SA 3ZM7A 4LF4I 4P7AA 1H74A 2ZM6I 2UUBI 4YY3I 4YY3E 4X62I 1ZM3A 2HFUA 3J80C 1ZXMA 4DR4E 4JV5I 2BV3A 2EFGA 2UUCI 1N32I 3LPSA 2IOQA 1KKHA 1Z5AA 5LMUI 1Y4UA 4FWGA 4LF8E 3T1HI 1XNQI 5FLXC 2R42A 1B63A 4KQVA 3F0NA 4JI5E 2Z5BB 4NXNE 4X62E 3QT6A 5LMNE 4JI1I 1FNMA 4LF8I 2ZM6E 4B3RE 4DV1I 3J81Q 1FJGI 2V34A 5GMDA 4LF4E 1ZM4A 4HACA 1OJ4A 3V5RA 4DUYE 3PYFA 4B3TE 4DUZE 4DV3E 1XNRI 2V2VA 2V2ZA 4Z7YA 4X66E 1ZXNA 3QT5A 1PVGA 4DXLA 5IWAE 4DPXA 4DV5E 3PYEA 3QT8A 2HHHE 3ZZUA 3OTOI 2CG9A 1XMOE 1HNWI 5LL6R 2V2QA 4B3SI 1U2RA 1N34E 4JI3E 4LFCE 4JI0E 2A2DA 4DV0E 1UEKA 2E1RA 1Z59A 2UXBI 2UXBE 4LF9E 2UU9I 4DPWA 4LFAE 4UT4A 4P52A 4M1KA 5BR8E 3Q6MA 1IBME 4N3OA 3P06A 1KTVA 4GKJE 3H4LA 1XMOI 2IOPA 2PNLA 1RR9A 1IBMI 5BR8I 4DR6E 2UXCI 1HNXE 4IZKA 1HR0E 4LF6I 2DEIA 3Q1QA 1QZRA 1HR0I 4XTJA 4DR2E 4LF6E 4OX9E 4JYAE 3ZKDA 4X66I 2J7KA 4FW9A 4IZJA 4B3TI 4X65I 2GQ0A 3WU5A 4DV7E 4DR5E 4KHPI 3WU3A 2R3VA 4JI2E 1N34I 2PNMA 4DV1E 2HK3A 4B3MI 4DV6I 2HFSA 1J5EI 1Z0GA 2LJPA 4DR1E 3B82A 4GKKI 4K0KI 1Z0TA 2UU9E 4PRVA 4DV2I 1HNZI 4X64I 1DARA 4JI4I 4AQYI 4JI0I 1NHHA 2O1VA 1FWLA 4JG4A 4DUYI 4DR3I 1VISA 2Z5CB 3LNUA 1D6TA 3K17A 1N36E 3D4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB E;  5L3J A;  3B78 A;  5A2Q C;  4DV4 I;  4YHH I;  1IBK I;  4JI6 I;  2UUA E;  1A6F A;  2E5L I;  3T1H E;  4LF9 I;  1S16 A;  2UXD E;  4DR7 I;  5LMU E;  1PIE A;  4HY1 A;  1IBL E;  1FJG E;  4LFC I;  4JI3 I;  3CWV A;  4B3R I;  4NXM E;  2Q2E B;  2CZ9 A;  3T1Y I;  4NXN I;  1EI1 A;  1HNW E;  1IBK E;  2HHH I;  1N0V C;  2BM0 A;  1XNQ E;  1Z0C A;  5IT9 Q;  1Z5C A;  3QT7 A;  5FLX Q;  4DU7 A;  5IWA I;  4DU8 A;  5A2Q Q;  2AJ4 A;  4DPU A;  1MX0 A;  4DV3 I;  2UXD I;  1Z0B A;  4USM A;  4AQY E;  1H7U A;  3PYG A;  1KIJ A;  2VQE E;  4WUD A;  2WW4 A;  2F4V I;  4HYM A;  4JI4 E;  4DR7 E;  4JI8 I;  4JI1 E;  1Z0E A;  2UUA I;  4JI5 I;  4YHH E;  4GKK E;  3ZZT A;  3ZZ0 A;  4EMD A;  2OI2 A;  4NXM I;  4MYT A;  4ED4 A;  4FWD A;  1FI4 A;  1XMQ I;  1H73 A;  4HXZ A;  4R1F A;  4DR5 I;  4KHP E;  4DR3 E;  5IT9 C;  1ZM9 A;  3J81 C;  1N32 E;  2UUC E;  1KVK A;  4JV5 E;  4OX9 I;  4JYA I;  4JI6 E;  4MYU A;  4JI7 E;  4PRX A;  2NPF A;  4DV4 E;  4DR1 I;  4LF7 E;  3J7A M;  4X64 E;  1HNZ E;  2UXC E;  2A2C A;  1N36 I;  4K0K E;  1PKP A;  3JAM Q;  1MG7 A;  4LF5 I;  1J5E E;  1S4E A;  4DV6 E;  4B3M E;  4GKJ I;  3WU6 A;  4HAC B;  2VQF I;  2XEX A;  1NHJ A;  4PU9 A;  1ZM2 A;  4WUC A;  1NHI A;  4DV7 I;  2HKE A;  1N33 I;  1RRE A;  1HNX I;  4DV2 E;  1I94 E;  4ZVI A;  2VF3 A;  2DEJ A;  4DPY A;  3WU4 A;  2X7I A;  1K47 A;  4DR6 I;  1NZ0 A;  4LFB I;  3HUL A;  1FKA E;  4JI2 I;  1N0U A;  4B3S E;  2ZBK B;  3J80 Q;  3B8H A;  4X65 E;  1ELO A;  1WUU A;  5GME A;  1Z0W A;  1BKN A;  4JI8 E;  2F4V E;  4DR2 I;  2VQE I;  1N33 E;  4JI7 I;  4FN5 A;  1B62 A;  3GON A;  3V2U C;  2ZIT A;  3LTO A;  2X36 A;  1Z0V A;  1H72 C;  1XNR E;  4DUZ I;  3M6A A;  1Z5B A;  3OTO E;  4USK A;  1XHK A;  4LF5 E;  4LFB E;  4URL A;  2BM1 A;  5LMN I;  4DV5 I;  4WUB A;  4Z7C A;  1MU5 A;  4LF7 I;  2V8P A;  4LFA I;  4DPT A;  3T1Y E;  1EA6 A;  1I94 I;  4FWH A;  3J7A G;  4I3H A;  4UTG A;  2HK2 A;  2GS8 A;  1IBL I;  3PYD A;  4DV0 I;  4RPF A;  3K1J A;  3ZKB A;  2VQF E;  1XMQ E;  1FWK A;  2E5L E;  2HKJ A;  4DR4 I;  3JAM C;  1H7S A;  3ZM7 A;  4LF4 I;  4P7A A;  1H74 A;  2ZM6 I;  2UUB I;  4YY3 I;  4YY3 E;  4X62 I;  1ZM3 A;  2HFU A;  3J80 C;  1ZXM A;  4DR4 E;  4JV5 I;  2BV3 A;  2EFG A;  2UUC I;  1N32 I;  3LPS A;  1KKH A;  1Z5A A;  5LMU I;  4FWG A;  4LF8 E;  3T1H I;  1XNQ I;  5FLX C;  2R42 A;  1B63 A;  4KQV A;  3F0N A;  4JI5 E;  4NXN E;  4X62 E;  3QT6 A;  5LMN E;  4JI1 I;  1FNM A;  4LF8 I;  2ZM6 E;  4B3R E;  4DV1 I;  3J81 Q;  1FJG I;  2V34 A;  5GMD A;  4LF4 E;  1ZM4 A;  4HAC A;  1OJ4 A;  3V5R A;  4DUY E;  3PYF A;  4B3T E;  4DUZ E;  4DV3 E;  1XNR I;  2V2V A;  2V2Z A;  4Z7Y A;  4X66 E;  1ZXN A;  3QT5 A;  1PVG A;  4DXL A;  5IWA E;  4DPX A;  4DV5 E;  3PYE A;  3QT8 A;  2HHH E;  3ZZU A;  3OTO I;  1HNW I;  1XMO E;  5LL6 R;  2V2Q A;  4B3S I;  1U2R A;  1N34 E;  4JI3 E;  4LFC E;  4JI0 E;  2A2D A;  4DV0 E;  1UEK A;  2E1R A;  1Z59 A;  2UXB I;  2UXB E;  4LF9 E;  2UU9 I;  4DPW A;  4LFA E;  4UT4 A;  4P52 A;  4M1K A;  5BR8 E;  1IBM E;  1KTV A;  4GKJ E;  3H4L A;  1XMO I;  1RR9 A;  1IBM I;  5BR8 I;  4DR6 E;  2UXC I;  1HNX E;  1HR0 E;  4LF6 I;  2DEI A;  3Q1Q A;  1QZR A;  1HR0 I;  4XTJ A;  4DR2 E;  4LF6 E;  4OX9 E;  4JYA E;  3ZKD A;  4X66 I;  2J7K A;  4FW9 A;  4B3T I;  4X65 I;  3WU5 A;  4DV7 E;  4DR5 E;  4KHP I;  3WU3 A;  2R3V A;  4JI2 E;  1N34 I;  4DV1 E;  2HK3 A;  4B3M I;  4DV6 I;  2HFS A;  1J5E I;  1Z0G A;  2LJP A;  4DR1 E;  3B82 A;  4GKK I;  4K0K I;  1Z0T A;  2UU9 E;  4PRV A;  4DV2 I;  1HNZ I;  4X64 I;  1DAR A;  4JI4 I;  4AQY I;  4JI0 I;  1NHH A;  1FWL A;  4JG4 A;  4DUY I;  4DR3 I;  1VIS A;  3LNU A;  1D6T A;  3K17 A;  1N36 E;  3D4J A; 
#chains in the Genus database with same CATH topology
 2UUB E;  5L3J A;  3B78 A;  5A2Q C;  2BA1 G;  5EL9 A;  4YHH I;  4DV4 I;  1IBK I;  4JI6 I;  2UUA E;  1A6F A;  1OYP A;  1P42 A;  4MQY A;  2E5L I;  3T1H E;  4LF9 I;  4OO1 C;  1S16 A;  2UXD E;  4DR7 I;  3M7N D;  5LMU E;  2CGE A;  2C38 B;  4MDT A;  4AM3 A;  5K36 A;  1PIE A;  4HY1 A;  5DRR A;  1IBL E;  1USU A;  5JEA D;  1FJG E;  4LFC I;  4JI3 I;  3CWV A;  2NN6 A;  2IER A;  4B3R I;  4NXM E;  2Q2E B;  2CZ9 A;  2JEB A;  3T1Y I;  4NXN I;  1EI1 A;  1HNW E;  1IBK E;  2HHH I;  5C0X C;  1N0V C;  2BM0 A;  5DNL A;  1XNQ E;  4IFD C;  1Z0C A;  5IT9 Q;  2PO0 B;  5K36 C;  1Z5C A;  3QT7 A;  5FLX Q;  4DU7 A;  5IWA I;  4IFD B;  4DU8 A;  3K85 A;  4AIM A;  5A2Q Q;  2AJ4 A;  4DPU A;  1MX0 A;  2NN6 B;  4DV3 I;  2UXD I;  1Z0B A;  2NN6 E;  2PO2 B;  4USM A;  4AQY E;  1H7U A;  3PYG A;  1KIJ A;  4LOM A;  2VQE E;  2WNR A;  4WUD A;  2WW4 A;  2F4V I;  4HYM A;  4JI4 E;  4DR7 E;  1Y4S A;  3PRY A;  4JI8 I;  4JI1 E;  1Z0E A;  2UUA I;  4JI5 I;  4YHH E;  5C0X F;  4GKK E;  3ZZT A;  3ZZ0 A;  2O1U A;  4EMD A;  2OI2 A;  4NXM I;  3M85 G;  4MYT A;  4ED4 A;  4FWD A;  1FI4 A;  1XMQ I;  1H73 A;  5K36 E;  4OO1 F;  4HXZ A;  4R1F A;  4MU1 A;  4DR5 I;  4BA2 B;  4KHP E;  4DR3 E;  5K36 B;  4OKG A;  5IT9 C;  3GLL A;  5JEA E;  1ZM9 A;  5JEA C;  1USV A;  3J81 C;  2UUC E;  1N32 E;  1KVK A;  3DD6 A;  4IZK B;  1YHC A;  4JV5 E;  2GO3 A;  4OX9 I;  4JYA I;  4JI6 E;  4MYU A;  4JI7 E;  4PRX A;  2NPF A;  4DV4 E;  4DR1 I;  2BR2 A;  4LF7 E;  4MU4 A;  3J7A M;  4X64 E;  1HNZ E;  5JEA F;  2UXC E;  3U1Y A;  2A2C A;  4ISA A;  1N36 I;  4K0K E;  1PKP A;  3JAM Q;  1MG7 A;  1HK7 A;  4LF5 I;  1J5E E;  5K36 F;  1S4E A;  4DV6 E;  4B3M E;  4GKJ I;  3WU6 A;  3KRN A;  2O1T A;  4HAC B;  2VQF I;  2XEX A;  1NHJ A;  4PU9 A;  1ZM2 A;  4WUC A;  1NHI A;  3HJC A;  5C0X E;  4DV7 I;  4IZJ B;  2HKE A;  1N33 I;  5C0X B;  3M85 D;  1RRE A;  2Z5B A;  1HNX I;  4DV2 E;  1I94 E;  4ZVI A;  2VF3 A;  2WNR B;  2DEJ A;  4DPY A;  2C39 A;  3WU4 A;  2Z5E A;  5JEA A;  2X7I A;  4IS9 A;  1K47 A;  4DR6 I;  2GO4 A;  1NZ0 A;  4LFB I;  3HUL A;  4OO1 D;  1FKA E;  4JI2 I;  1OYS A;  1N0U A;  4B3S E;  2ZBK B;  3J80 Q;  3B8H A;  3B4T A;  4FW3 A;  3P76 A;  4X65 E;  2O3Z A;  1Y60 A;  1ELO A;  1WUU A;  5GME A;  1Z0W A;  1BKN A;  4JI8 E;  5DRO A;  2F4V E;  4DR2 I;  4BA1 A;  4GQU A;  2VQE I;  1OYR A;  1N33 E;  4JI7 I;  1E3P A;  4FN5 A;  3Q6N A;  3H1C A;  1B62 A;  3GON A;  3V2U C;  2ZIT A;  3LTO A;  4U3B A;  2Z5C A;  2X36 A;  1Z0V A;  4IFD D;  1H72 C;  1XNR E;  4DUZ I;  4OZE A;  3M6A A;  1Z5B A;  3OTO E;  3PS1 A;  4USK A;  4FW7 A;  1XHK A;  2C37 A;  4LF5 E;  4LPF A;  2PNZ B;  4LFB E;  4URL A;  2BM1 A;  5LMN I;  4DV5 I;  4WUB A;  5JEA B;  4Z7C A;  1MU5 A;  4LF7 I;  4MU0 A;  2V8P A;  2VES A;  4LFA I;  5DRQ A;  4DPT A;  3T1Y E;  1EA6 A;  1I94 I;  4FWH A;  4BA1 B;  3J7A G;  4I3H A;  2JE6 A;  4UTG A;  2HK2 A;  2GS8 A;  1IBL I;  3PYD A;  4DV0 I;  4RPF A;  3K1J A;  3ZKB A;  2VQF E;  4OO1 B;  2O1W A;  1XMQ E;  1FWK A;  4OO1 E;  2E5L E;  2BA1 D;  4IZJ D;  2HKJ A;  1Y6Z A;  5FWK A;  3JAM C;  4DR4 I;  2PO1 B;  1H7S A;  3ZM7 A;  4LF4 I;  3PS3 A;  4P7A A;  1H74 A;  2ZM6 I;  2UUB I;  4YY3 I;  4YY3 E;  4X62 I;  1ZM3 A;  2HFU A;  2BR2 B;  4J3D A;  3J80 C;  4QNK A;  1ZXM A;  2CVE A;  4U3D A;  2C37 B;  3GCM A;  4DR4 E;  4JV5 I;  2BV3 A;  5DNX A;  2EFG A;  2UUC I;  1N32 I;  2NN6 D;  3LPS A;  3M7N G;  2IOQ A;  1KKH A;  4OO1 A;  2JEA B;  1Z5A A;  5LMU I;  1Y4U A;  4FWG A;  2C39 B;  4LF8 E;  2IES A;  2BA0 D;  3T1H I;  1XNQ I;  5FLX C;  2R42 A;  1B63 A;  4KQV A;  4LCF A;  3F0N A;  4JI5 E;  2Z5B B;  4NXN E;  4X62 E;  3QT6 A;  5LMN E;  4JI1 I;  1FNM A;  2NN6 C;  4LF8 I;  2ZM6 E;  4B3R E;  5C0X A;  4DV1 I;  3J81 Q;  1FJG I;  2V34 A;  5GMD A;  4LF4 E;  1ZM4 A;  5K36 D;  4HAC A;  1OJ4 A;  3V5R A;  4DUY E;  4MU3 A;  3PYF A;  4NBQ A;  4B3T E;  4DUZ E;  4DV3 E;  1XNR I;  2V2V A;  2V2Z A;  4Z7Y A;  4X66 E;  3L7Z A;  2F1D A;  2JT2 A;  2PO0 A;  1ZXN A;  4LCH A;  3NZK A;  3QT5 A;  2WP8 B;  1PVG A;  4DXL A;  5IWA E;  3P3E A;  4DPX A;  4DV5 E;  3PYE A;  2PO1 A;  3QT8 A;  5EKW A;  2PNZ A;  1UDQ A;  3ZZU A;  3OTO I;  2HHH E;  1R6L A;  2CG9 A;  1XMO E;  1HNW I;  5LL6 R;  2V2Q A;  4B3S I;  2JEB B;  2NN6 F;  3CDI A;  1U2R A;  1Y5Y A;  1N34 E;  4JI3 E;  4LFC E;  5C0X D;  4JI0 E;  2A2D A;  4DV0 E;  1UEK A;  1UDO A;  4IFD F;  2E1R A;  3HKM A;  1Z59 A;  4FW4 A;  2UXB I;  2UXB E;  4LF9 E;  2UU9 I;  4DPW A;  3GME A;  4LFA E;  4UT4 A;  4P52 A;  4M1K A;  5BR8 E;  3Q6M A;  1IBM E;  1YH8 A;  4N3O A;  3P06 A;  1KTV A;  4GKJ E;  3L7Z B;  2C38 A;  3H4L A;  1XMO I;  2PO2 A;  2J65 A;  2IOP A;  2PNL A;  5ELW A;  1RR9 A;  4FW5 A;  1IBM I;  5BR8 I;  4DR6 E;  2UXC I;  1HNX E;  4IZK A;  1HR0 E;  4LF6 I;  2DEI A;  3Q1Q A;  1QZR A;  1HR0 I;  4XTJ A;  4DR2 E;  4LF6 E;  4OX9 E;  4JYA E;  3ZKD A;  1RHY A;  4X66 I;  4IFD E;  4FW6 A;  2J7K A;  4FW9 A;  2WP8 A;  4IZJ A;  4B3T I;  4X65 I;  2GQ0 A;  3WU5 A;  4DV7 E;  4BA2 A;  4DR5 E;  4KHP I;  3WU3 A;  3P3G A;  2R3V A;  4JI2 E;  1N34 I;  2PNM A;  4DV1 E;  2JE6 B;  2HK3 A;  4B3M I;  4DV6 I;  2HFS A;  1R6M A;  3CDJ A;  1UDS A;  1J5E I;  1Z0G A;  3UHM A;  2AE8 A;  2LJP A;  4DR1 E;  3B82 A;  4GKK I;  4K0K I;  1Z0T A;  2UU9 E;  4PRV A;  4DV2 I;  1HNZ I;  4X64 I;  1DAR A;  4JI4 I;  2BA0 G;  1VI7 A;  3U1K A;  1E3H A;  4AQY I;  1N36 E;  4AID A;  4JI0 I;  3P3C A;  1NHH A;  5DRP A;  2O1V A;  1FWL A;  4JG4 A;  4IFD A;  4DUY I;  2JEA A;  4DR3 I;  1VIS A;  3PS2 A;  1UDN A;  2Z5C B;  3LNU A;  1XXE A;  4LCG A;  1D6T A;  3K17 A;  4QNJ A;  3D4J A; 
#chains in the Genus database with same CATH homology
 2UUB E;  5L3J A;  3B78 A;  5A2Q C;  4DV4 I;  4YHH I;  1IBK I;  4JI6 I;  2UUA E;  1A6F A;  2E5L I;  3T1H E;  4LF9 I;  1S16 A;  2UXD E;  4DR7 I;  5LMU E;  2CGE A;  1PIE A;  4HY1 A;  1IBL E;  1USU A;  1FJG E;  4LFC I;  4JI3 I;  3CWV A;  4B3R I;  4NXM E;  2Q2E B;  2CZ9 A;  3T1Y I;  4NXN I;  1EI1 A;  1HNW E;  1IBK E;  2HHH I;  1N0V C;  2BM0 A;  1XNQ E;  1Z0C A;  5IT9 Q;  1Z5C A;  3QT7 A;  5FLX Q;  4DU7 A;  5IWA I;  4DU8 A;  3K85 A;  5A2Q Q;  2AJ4 A;  4DPU A;  1MX0 A;  4DV3 I;  2UXD I;  1Z0B A;  4USM A;  4AQY E;  1H7U A;  3PYG A;  1KIJ A;  2VQE E;  4WUD A;  2WW4 A;  2F4V I;  4HYM A;  4JI4 E;  4DR7 E;  1Y4S A;  3PRY A;  4JI8 I;  4JI1 E;  1Z0E A;  2UUA I;  4JI5 I;  4YHH E;  4GKK E;  3ZZT A;  3ZZ0 A;  2O1U A;  4EMD A;  2OI2 A;  4NXM I;  4MYT A;  4ED4 A;  4FWD A;  1FI4 A;  1XMQ I;  1H73 A;  4HXZ A;  4R1F A;  4DR5 I;  4KHP E;  4DR3 E;  5IT9 C;  1ZM9 A;  1USV A;  3J81 C;  2UUC E;  1N32 E;  1KVK A;  4IZK B;  4JV5 E;  4OX9 I;  4JYA I;  4JI6 E;  4MYU A;  4JI7 E;  4PRX A;  2NPF A;  4DV4 E;  4DR1 I;  4LF7 E;  3J7A M;  4X64 E;  1HNZ E;  2UXC E;  2A2C A;  1N36 I;  4K0K E;  1PKP A;  3JAM Q;  1MG7 A;  1HK7 A;  4LF5 I;  1J5E E;  1S4E A;  4DV6 E;  4B3M E;  4GKJ I;  3WU6 A;  2O1T A;  4HAC B;  2VQF I;  2XEX A;  1NHJ A;  4PU9 A;  1ZM2 A;  4WUC A;  1NHI A;  3HJC A;  4DV7 I;  4IZJ B;  2HKE A;  1N33 I;  1RRE A;  2Z5B A;  1HNX I;  4DV2 E;  1I94 E;  4ZVI A;  2VF3 A;  2DEJ A;  4DPY A;  3WU4 A;  2Z5E A;  2X7I A;  1K47 A;  4DR6 I;  1NZ0 A;  4LFB I;  3HUL A;  1FKA E;  4JI2 I;  1N0U A;  4B3S E;  2ZBK B;  3J80 Q;  3B8H A;  4X65 E;  1ELO A;  1WUU A;  5GME A;  1Z0W A;  1BKN A;  4JI8 E;  2F4V E;  4DR2 I;  2VQE I;  1N33 E;  4JI7 I;  4FN5 A;  3Q6N A;  1B62 A;  3GON A;  3V2U C;  2ZIT A;  3LTO A;  2Z5C A;  2X36 A;  1Z0V A;  1H72 C;  1XNR E;  4DUZ I;  3M6A A;  1Z5B A;  3OTO E;  4USK A;  1XHK A;  4LF5 E;  4LFB E;  4URL A;  2BM1 A;  5LMN I;  4DV5 I;  4WUB A;  4Z7C A;  1MU5 A;  4LF7 I;  2V8P A;  4LFA I;  4DPT A;  3T1Y E;  1EA6 A;  1I94 I;  4FWH A;  3J7A G;  4I3H A;  4UTG A;  2HK2 A;  2GS8 A;  1IBL I;  3PYD A;  4DV0 I;  4RPF A;  3K1J A;  3ZKB A;  2VQF E;  2O1W A;  1XMQ E;  1FWK A;  2E5L E;  4IZJ D;  2HKJ A;  1Y6Z A;  5FWK A;  3JAM C;  4DR4 I;  1H7S A;  3ZM7 A;  4LF4 I;  4P7A A;  1H74 A;  2ZM6 I;  2UUB I;  4YY3 I;  4YY3 E;  4X62 I;  1ZM3 A;  2HFU A;  3J80 C;  1ZXM A;  4DR4 E;  4JV5 I;  2BV3 A;  2EFG A;  2UUC I;  1N32 I;  3LPS A;  2IOQ A;  1KKH A;  1Z5A A;  5LMU I;  1Y4U A;  4FWG A;  4LF8 E;  3T1H I;  1XNQ I;  5FLX C;  2R42 A;  1B63 A;  4KQV A;  3F0N A;  4JI5 E;  2Z5B B;  4NXN E;  4X62 E;  3QT6 A;  5LMN E;  4JI1 I;  1FNM A;  4LF8 I;  2ZM6 E;  4B3R E;  4DV1 I;  3J81 Q;  1FJG I;  2V34 A;  5GMD A;  4LF4 E;  1ZM4 A;  4HAC A;  1OJ4 A;  3V5R A;  4DUY E;  3PYF A;  4B3T E;  4DUZ E;  4DV3 E;  1XNR I;  2V2V A;  2V2Z A;  4Z7Y A;  4X66 E;  1ZXN A;  3QT5 A;  1PVG A;  4DXL A;  5IWA E;  4DPX A;  4DV5 E;  3PYE A;  3QT8 A;  2HHH E;  3ZZU A;  3OTO I;  2CG9 A;  1XMO E;  1HNW I;  5LL6 R;  2V2Q A;  4B3S I;  1U2R A;  1N34 E;  4JI3 E;  4LFC E;  4JI0 E;  2A2D A;  4DV0 E;  1UEK A;  2E1R A;  1Z59 A;  2UXB I;  2UXB E;  4LF9 E;  2UU9 I;  4DPW A;  4LFA E;  4UT4 A;  4P52 A;  4M1K A;  5BR8 E;  3Q6M A;  1IBM E;  4N3O A;  3P06 A;  1KTV A;  4GKJ E;  3H4L A;  1XMO I;  2IOP A;  2PNL A;  1RR9 A;  1IBM I;  5BR8 I;  4DR6 E;  2UXC I;  1HNX E;  4IZK A;  1HR0 E;  4LF6 I;  2DEI A;  3Q1Q A;  1QZR A;  1HR0 I;  4XTJ A;  4DR2 E;  4LF6 E;  4OX9 E;  4JYA E;  3ZKD A;  4X66 I;  2J7K A;  4FW9 A;  4IZJ A;  4B3T I;  4X65 I;  2GQ0 A;  3WU5 A;  4DV7 E;  4DR5 E;  4KHP I;  3WU3 A;  2R3V A;  4JI2 E;  1N34 I;  2PNM A;  4DV1 E;  2HK3 A;  4B3M I;  4DV6 I;  2HFS A;  1J5E I;  1Z0G A;  2LJP A;  4DR1 E;  3B82 A;  4GKK I;  4K0K I;  1Z0T A;  2UU9 E;  4PRV A;  4DV2 I;  1HNZ I;  4X64 I;  1DAR A;  4JI4 I;  4AQY I;  4JI0 I;  1NHH A;  2O1V A;  1FWL A;  4JG4 A;  4DUY I;  4DR3 I;  1VIS A;  2Z5C B;  3LNU A;  1D6T A;  3K17 A;  1N36 E;  3D4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...