5LMNI

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnI00
1RREA 2E5LE 4P7AA 1MG7A 4WUCA 1A6FA 3ZKDA 4JV5I 4WUBA 4HACA 1NHIA 4DPWA 4B3TE 1H73A 3J81C 4JI8I 2UXBE 4URLA 3K1JA 4P52A 4DV6I 1H7SA 4DR5I 4OX9E 1PKPA 2J7KA 2HHHI 5LL6R 2OI2A 1MX0A 4JV5E 4NXMI 1ELOA 3J80C 1B63A 2V2VA 4DR1I 2V2QA 4LF5I 4JI8E 3OTOI 4YY3I 4DV6E 4JI1I 4DR5E 2HHHE 3D4JA 1Z59A 3V5RA 4AQYI 4LF8I 4DV1I 4NXME 1OJ4A 2CZ9A 1N34I 4LFCI 2LJPA 4X66I 4DR1E 4LF5E 1Z0EA 4DU7A 3OTOE 4X64I 3J80Q 4JG4A 4JI1E 1UEKA 2HFUA 1N33I 4AQYE 4KQVA 4LF8E 1NZ0A 3LPSA 4DR7I 1N34E 4LFCE 4X66E 1KVKA 2UXCI 4X64E 4X62E 3J7AG 1IBMI 3T1YI 1Z0CA 1N33E 2DEJA 4JI3I 4MYUA 3HULA 1XNQE 4DR7E 3QT8A 1Z0GA 2WW4A 2F4VI 4DUZI 4NXNE 1Z0VA 3LTOA 2HK3A 4LF7I 2UXCE 2E1RA 4JYAI 2UUBI 4DPYA 1HNZE 1H72C 1IBME 4LFAE 1PIEA 3T1YE 2UXDI 4FWDA 3Q1QA 5BR8I 2F4VE 2HKJA 1WUUA 4DUZE 4JI4I 4DV7E 4DR3I 4LF7E 4PRXA 4JYAE 2UUBE 2A2DA 2ZITA 2UXDE 5BR8E 2HK2A 1FWKA 4PU9A 4DPXA 5A2QC 4PRVA 1KTVA 4JI4E 3LNUA 4DR3E 3ZZUA 2BM0A 1XHKA 4USMA 1B62A 4JI5E 1ZXNA 3PYFA 1ZM2A 4ZVIA 4EMDA 4GKKI 2UUCE 3J81Q 5A2QQ 1NHJA 2EFGA 4DUYI 2ZBKB 1EA6A 5IT9C 2UU9I 5FLXC 3T1HI 1FI4A 4LF4I 4X62I 4GKJI 4JI6I 4GKKE 1FJGE 1N0VC 1Z0BA 4DV3I 1ZXMA 2GS8A 3K17A 1XNQI 4DUYE 2UU9E 3QT5A 3B78A 4NXNI 3T1HE 1VISA 4LF4E 4FN5A 3ZZTA 4FW9A 2X7IA 4GKJE 1HNZI 4DV5E 4JI6E 4LFAI 2HKEA 4JI7I 1IBKI 1FWLA 4DV3E 4JI2I 3F0NA 3WU5A 3CWVA 3WU3A 2V2ZA 4DV7I 4DU8A 4WUDA 5L3JA 5GMEA 1S4EA 3ZM7A 5LMNI 4YHHI 4JI7E 1IBKE 2XEXA 4DV4I 4JI2E 1H74A 1XMQI 1I94I 1N36I 2BM1A 2AJ4A 4B3SE 1QZRA 5LMNE 4YHHE 1HNWI 1Z5AA 4DXLA 3PYEA 4DR4E 3B82A 4DV4E 4LF6E 1Z5BA 1XMQE 1J5EI 4DV0I 1I94E 4USKA 4DR2I 1N36E 4JI5I 1DARA 1KKHA 1FNMA 4MYTA 1S16A 2UUCI 2V8PA 3B8HA 1XMOI 1HNWE 5GMDA 4JI0E 3JAMC 4HACB 2X36A 4KHPI 1U2RA 4Z7YA 1J5EE 4DV0E 1ZM4A 1XNRI 4DR2E 1HR0E 2VQFI 1FJGI 1Z0TA 3H4LA 1XMOE 4DPTA 4R1FA 3ZKBA 2R3VA 2VQEI 1PVGA 1FKAE 3WU6A 1IBLI 4Z7CA 1N0UA 3GONA 2V34A 4KHPE 4DV2I 3JAMQ 2R42A 2NPFA 1XNRE 1KIJA 2BV3A 2VQFE 4DPUA 1N32I 1ZM9A 4X65I 4DV5I 4B3MI 2UUAI 2VQEE 4M1KA 1NHHA 1IBLE 5LMUI 4HYMA 4DV2E 1EI1A 3M6AA 3V2UC 4ED4A 4YY3E 1N32E 4X65E 5IT9Q 5FLXQ 3J7AM 2ZM6I 4B3ME 1MU5A 4DV1E 4FWHA 4RPFA 2UUAE 4K0KI 3QT6A 4LFBI 4DR6I 3ZZ0A 5LMUE 4B3SI 5IWAI 1Z0WA 4UTGA 2HFSA 4HY1A 4XTJA 1BKNA 2ZM6E 4I3HA 4DR4I 4LF6I 1HNXI 4K0KE 2A2CA 4FWGA 4LFBE 4DR6E 4LF9I 4B3RI 5IWAE 4HXZA 1D6TA 1H7UA 1ZM3A 2E5LI 1RR9A 4JI0I 4JI3E 4B3TI 1HNXE 2DEIA 3PYGA 2UXBI 3WU4A 4LF9E 4B3RE 4UT4A 1HR0I 1Z5CA 3PYDA 2VF3A 1K47A 4OX9I 2Q2EB 3QT7A
chains in the Genus database with same CATH superfamily
4FW5A 1RREA 3HKMA 2E5LE 4P7AA 1MG7A 4WUCA 1A6FA 4NBQA 3ZKDA 4JV5I 4WUBA 4HACA 1NHIA 4DPWA 4IZKA 5DNXA 4B3TE 1H73A 3J81C 4JI8I 2UXBE 2NN6C 2JEBB 4LCGA 4URLA 2J65A 5K36F 3K1JA 4P52A 4BA1A 4DV6I 1H7SA 4DR5I 4OX9E 1PKPA 2GO4A 2J7KA 2BA1G 2HHHI 5LL6R 2OI2A 2PO1A 1Y5YA 1MX0A 4JV5E 4NXMI 5K36B 5DRQA 1ELOA 2PO0A 2PO2B 1B63A 3J80C 4IZJD 2IOQA 4IZJB 2V2VA 4DR1I 2V2QA 3P3CA 4LF5I 4JI8E 3OTOI 2Z5CB 4YY3I 4DV6E 4MU4A 4JI1I 4DR5E 3P76A 5EL9A 2HHHE 3D4JA 1Z59A 3V5RA 4AQYI 4LF8I 4DV1I 2WNRB 4NXME 1OJ4A 2CZ9A 1N34I 2AE8A 4LFCI 2LJPA 5JEAE 3PS1A 4X66I 4DR1E 4LF5E 1Z0EA 4DU7A 3OTOE 4X64I 2JEAB 3J80Q 4JG4A 4JI1E 4OO1A 1UEKA 2HFUA 3M85D 3KRNA 1N33I 4AQYE 4BA2B 2GQ0A 4FW7A 4KQVA 4LF8E 1NZ0A 3LPSA 4LCFA 4DR7I 4FW4A 5C0XE 1N34E 1E3PA 4LFCE 4FW3A 3HJCA 4X66E 1KVKA 2BA0G 2UXCI 5JEAC 4X64E 4X62E 3J7AG 5DROA 3H1CA 2NN6F 4J3DA 1IBMI 3T1YI 3U1KA 1Z0CA 1N33E 2DEJA 4JI3I 4MYUA 2C37A 3HULA 1XNQE 4DR7E 3QT8A 2NN6B 4IFDF 1Z0GA 2WW4A 2F4VI 4DUZI 3B4TA 4NXNE 2IOPA 1Z0VA 3LTOA 5C0XC 2HK3A 4LF7I 2UXCE 2IERA 2E1RA 4JYAI 2UUBI 4IFDB 4DPYA 1HNZE 1H72C 3K85A 1IBME 4LFAE 1PIEA 3T1YE 2UXDI 4FWDA 3Q1QA 5BR8I 2PNZB 2F4VE 2HKJA 1WUUA 4DUZE 4JI4I 2O3ZA 3PRYA 4DV7E 2JT2A 4DR3I 4LF7E 4PRXA 3M7NG 4JYAE 2UUBE 2IESA 2A2DA 2ZITA 2O1TA 2UXDE 4AIDA 1UDOA 5BR8E 1OYRA 2HK2A 1FWKA 4PU9A 4DPXA 5ELWA 5A2QC 4PRVA 1KTVA 2O1VA 4JI4E 2C39B 3LNUA 2JEBA 4DR3E 4GQUA 4IFDC 5JEAF 5K36D 1UDQA 4IZKB 3CDIA 3ZZUA 5K36A 2BM0A 1XHKA 4USMA 1B62A 5JEAB 4IZJA 1UDNA 4JI5E 1ZXNA 3PYFA 1ZM2A 2O1WA 4ZVIA 2CGEA 4EMDA 4GKKI 1RHYA 2UUCE 2Z5CA 2Z5BB 3J81Q 5C0XF 5A2QQ 2PO0B 1NHJA 2EFGA 2BA1D 4DUYI 2WNRA 2ZBKB 1EA6A 5IT9C 2UU9I 5FLXC 5C0XD 5C0XB 2VESA 3T1HI 1FI4A 4LF4I 4X62I 4GKJI 4JI6I 4GKKE 2C38B 1FJGE 1N0VC 1Z0BA 4DV3I 1ZXMA 2GS8A 3K17A 1XNQI 4DUYE 1VI7A 4OO1F 2UU9E 4QNJA 1USVA 3B78A 3L7ZB 3QT5A 4NXNI 3T1HE 4MQYA 1VISA 4LF4E 4FN5A 3ZZTA 4FW9A 1XXEA 3Q6MA 2X7IA 4GKJE 1HNZI 4IS9A 4DV5E 4JI6E 4LFAI 2GO3A 4AM3A 2HKEA 4JI7I 1IBKI 1FWLA 2BR2B 4DV3E 4JI2I 3F0NA 2NN6D 3WU5A 2PNLA 3CWVA 2NN6A 3WU3A 2V2ZA 4AIMA 1OYSA 4DV7I 4DU8A 4WUDA 5L3JA 2CVEA 5GMEA 4OO1E 1S4EA 3ZM7A 4IFDD 5LMNI 4YHHI 1HK7A 2BA0D 4IFDA 2WP8A 4JI7E 1IBKE 2XEXA 4DV4I 1UDSA 5EKWA 4JI2E 2PNZA 1H74A 1XMQI 1I94I 1N36I 2BM1A 2AJ4A 4B3SE 3DD6A 3GMEA 1QZRA 5LMNE 4YHHE 2JE6A 1HNWI 1Z5AA 4DXLA 3PYEA 4OO1C 1USUA 4DR4E 3B82A 4DV4E 4LF6E 1Z5BA 3P06A 3U1YA 1XMQE 3P3EA 1J5EI 4DV0I 1I94E 4USKA 4DR2I 1N36E 4JI5I 1DARA 1KKHA 1FNMA 4MYTA 2C39A 1S16A 2UUCI 3PS3A 2V8PA 3B8HA 3NZKA 1XMOI 1R6MA 1HNWE 5GMDA 4JI0E 3JAMC 2Z5EA 1YHCA 3M7ND 4HACB 2X36A 4KHPI 2PO2A 1U2RA 5JEAD 4Z7YA 1P42A 4QNKA 1J5EE 4DV0E 1ZM4A 1XNRI 4BA1B 5JEAA 4DR2E 1HR0E 2VQFI 3PS2A 1R6LA 1FJGI 2PO1B 1OYPA 1Z0TA 1Y4UA 3H4LA 1XMOE 2Z5BA 4DPTA 4R1FA 3ZKBA 2R3VA 2VQEI 4N3OA 1PVGA 1FKAE 4OZEA 3WU6A 4Z7CA 1N0UA 1IBLI 3GONA 2V34A 4KHPE 1Y6ZA 4U3BA 4DV2I 3JAMQ 2R42A 5C0XA 1E3HA 2NPFA 1Y4SA 4OKGA 3M85G 1XNRE 1KIJA 2BV3A 2VQFE 4DPUA 1N32I 1ZM9A 4X65I 4DV5I 2JEAA 2C38A 4B3MI 4MU0A 5K36E 4BA2A 2UUAI 2VQEE 4M1KA 1NHHA 1IBLE 5LMUI 4HYMA 4DV2E 3L7ZA 5FWKA 5DNLA 4LCHA 1EI1A 2CG9A 3M6AA 3V2UC 4ED4A 4OO1D 5DRPA 4YY3E 1N32E 4X65E 2O1UA 5FLXQ 4OO1B 5IT9Q 3J7AM 2ZM6I 3P3GA 4B3ME 1MU5A 2BR2A 4DV1E 4FWHA 4LOMA 4RPFA 2UUAE 4K0KI 3QT6A 4LFBI 4ISAA 4DR6I 5K36C 3ZZ0A 5LMUE 5DRRA 4FW6A 4B3SI 3GCMA 5IWAI 1Z0WA 4UTGA 4MU1A 4LPFA 2HFSA 4MDTA 4HY1A 4XTJA 3UHMA 4U3DA 1BKNA 2ZM6E 4I3HA 4DR4I 2C37B 4LF6I 1HNXI 4K0KE 2A2CA 4FWGA 4LFBE 2F1DA 4DR6E 4LF9I 3Q6NA 4B3RI 1Y60A 3CDJA 5IWAE 4HXZA 2PNMA 1D6TA 1H7UA 1ZM3A 2WP8B 1YH8A 2E5LI 1RR9A 4JI0I 4MU3A 4JI3E 2NN6E 3GLLA 4B3TI 1HNXE 2DEIA 3PYGA 2UXBI 3WU4A 4LF9E 4B3RE 4UT4A 1HR0I 1Z5CA 3PYDA 4IFDE 2VF3A 1K47A 4OX9I 2JE6B 2Q2EB 3QT7A
chains in the Genus database with same CATH topology
1RREA 2E5LE 4P7AA 1MG7A 4WUCA 1A6FA 3ZKDA 4JV5I 4WUBA 4HACA 1NHIA 4DPWA 4IZKA 4B3TE 1H73A 3J81C 4JI8I 2UXBE 4URLA 3K1JA 4P52A 4DV6I 1H7SA 4DR5I 4OX9E 1PKPA 2J7KA 2HHHI 5LL6R 2OI2A 1MX0A 4JV5E 4NXMI 1ELOA 3J80C 1B63A 4IZJD 2IOQA 4IZJB 2V2VA 4DR1I 2V2QA 4LF5I 4JI8E 3OTOI 2Z5CB 4YY3I 4DV6E 4JI1I 4DR5E 2HHHE 3D4JA 1Z59A 3V5RA 4AQYI 4LF8I 4DV1I 4NXME 1OJ4A 2CZ9A 1N34I 4LFCI 2LJPA 4X66I 4DR1E 4LF5E 1Z0EA 4DU7A 3OTOE 4X64I 3J80Q 4JG4A 4JI1E 1UEKA 2HFUA 1N33I 4AQYE 2GQ0A 4KQVA 4LF8E 1NZ0A 3LPSA 4DR7I 1N34E 4LFCE 3HJCA 4X66E 1KVKA 2UXCI 4X64E 4X62E 3J7AG 1IBMI 3T1YI 1Z0CA 1N33E 2DEJA 4JI3I 4MYUA 3HULA 1XNQE 4DR7E 3QT8A 1Z0GA 2WW4A 2F4VI 4DUZI 4NXNE 2IOPA 1Z0VA 3LTOA 2HK3A 4LF7I 2UXCE 2E1RA 4JYAI 2UUBI 4DPYA 1HNZE 1H72C 3K85A 1IBME 4LFAE 1PIEA 3T1YE 2UXDI 4FWDA 3Q1QA 5BR8I 2F4VE 2HKJA 1WUUA 4DUZE 4JI4I 3PRYA 4DV7E 4DR3I 4LF7E 4PRXA 4JYAE 2UUBE 2A2DA 2ZITA 2O1TA 2UXDE 5BR8E 2HK2A 1FWKA 4PU9A 4DPXA 5A2QC 4PRVA 1KTVA 2O1VA 4JI4E 3LNUA 4DR3E 4IZKB 3ZZUA 2BM0A 1XHKA 4USMA 1B62A 4IZJA 4JI5E 1ZXNA 3PYFA 1ZM2A 2O1WA 4ZVIA 2CGEA 4EMDA 4GKKI 2UUCE 2Z5CA 2Z5BB 3J81Q 5A2QQ 1NHJA 2EFGA 4DUYI 2ZBKB 1EA6A 5IT9C 2UU9I 5FLXC 3T1HI 1FI4A 4LF4I 4X62I 4GKJI 4JI6I 4GKKE 1FJGE 1N0VC 1Z0BA 4DV3I 1ZXMA 2GS8A 3K17A 1XNQI 4DUYE 2UU9E 1USVA 3B78A 3QT5A 4NXNI 3T1HE 1VISA 4LF4E 4FN5A 3ZZTA 4FW9A 3Q6MA 2X7IA 4GKJE 1HNZI 4DV5E 4JI6E 4LFAI 2HKEA 4JI7I 1IBKI 1FWLA 4DV3E 4JI2I 3F0NA 3WU5A 2PNLA 3CWVA 3WU3A 2V2ZA 4DV7I 4DU8A 4WUDA 5L3JA 5GMEA 1S4EA 3ZM7A 5LMNI 4YHHI 1HK7A 4JI7E 1IBKE 2XEXA 4DV4I 4JI2E 1H74A 1XMQI 1I94I 1N36I 2BM1A 2AJ4A 4B3SE 1QZRA 5LMNE 4YHHE 1HNWI 1Z5AA 4DXLA 3PYEA 1USUA 4DR4E 3B82A 4DV4E 4LF6E 1Z5BA 3P06A 1XMQE 1J5EI 4DV0I 1I94E 4USKA 4DR2I 1N36E 4JI5I 1DARA 1KKHA 1FNMA 4MYTA 1S16A 2UUCI 2V8PA 3B8HA 1XMOI 1HNWE 5GMDA 4JI0E 3JAMC 2Z5EA 4HACB 2X36A 4KHPI 1U2RA 4Z7YA 1J5EE 4DV0E 1ZM4A 1XNRI 4DR2E 1HR0E 2VQFI 1FJGI 1Z0TA 1Y4UA 3H4LA 1XMOE 2Z5BA 4DPTA 4R1FA 3ZKBA 2R3VA 2VQEI 4N3OA 1PVGA 1FKAE 3WU6A 1IBLI 4Z7CA 1N0UA 3GONA 2V34A 4KHPE 1Y6ZA 4DV2I 3JAMQ 2R42A 2NPFA 1XNRE 1Y4SA 1KIJA 2BV3A 2VQFE 4DPUA 1N32I 1ZM9A 4X65I 4DV5I 4B3MI 2UUAI 2VQEE 4M1KA 1NHHA 1IBLE 5LMUI 4HYMA 4DV2E 5FWKA 1EI1A 2CG9A 3M6AA 3V2UC 4ED4A 4YY3E 1N32E 4X65E 2O1UA 5FLXQ 5IT9Q 3J7AM 2ZM6I 4B3ME 1MU5A 4DV1E 4FWHA 4RPFA 2UUAE 4K0KI 3QT6A 4LFBI 4DR6I 3ZZ0A 5LMUE 4B3SI 5IWAI 1Z0WA 4UTGA 2HFSA 4HY1A 4XTJA 1BKNA 2ZM6E 4I3HA 4DR4I 4LF6I 1HNXI 4K0KE 2A2CA 4FWGA 4LFBE 4DR6E 4LF9I 3Q6NA 4B3RI 5IWAE 4HXZA 2PNMA 1D6TA 1H7UA 1ZM3A 2E5LI 1RR9A 4JI0I 4JI3E 4B3TI 1HNXE 2DEIA 3PYGA 2UXBI 3WU4A 4LF9E 4B3RE 4UT4A 1HR0I 1Z5CA 3PYDA 2VF3A 1K47A 4OX9I 2Q2EB 3QT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRE A;  2E5L E;  4P7A A;  1MG7 A;  4WUC A;  1A6F A;  3ZKD A;  4JV5 I;  4WUB A;  4HAC A;  1NHI A;  4DPW A;  4B3T E;  1H73 A;  3J81 C;  4JI8 I;  2UXB E;  4URL A;  3K1J A;  4P52 A;  4DV6 I;  1H7S A;  4DR5 I;  4OX9 E;  1PKP A;  2J7K A;  2HHH I;  5LL6 R;  2OI2 A;  1MX0 A;  4JV5 E;  4NXM I;  1ELO A;  3J80 C;  1B63 A;  2V2V A;  4DR1 I;  2V2Q A;  4LF5 I;  4JI8 E;  3OTO I;  4YY3 I;  4DV6 E;  4JI1 I;  4DR5 E;  2HHH E;  3D4J A;  1Z59 A;  3V5R A;  4AQY I;  4LF8 I;  4DV1 I;  4NXM E;  1OJ4 A;  2CZ9 A;  1N34 I;  4LFC I;  2LJP A;  4X66 I;  4DR1 E;  4LF5 E;  1Z0E A;  4DU7 A;  3OTO E;  4X64 I;  3J80 Q;  4JG4 A;  4JI1 E;  1UEK A;  2HFU A;  1N33 I;  4AQY E;  4KQV A;  4LF8 E;  1NZ0 A;  3LPS A;  4DR7 I;  1N34 E;  4LFC E;  4X66 E;  1KVK A;  2UXC I;  4X64 E;  4X62 E;  3J7A G;  1IBM I;  3T1Y I;  1Z0C A;  1N33 E;  2DEJ A;  4JI3 I;  4MYU A;  3HUL A;  1XNQ E;  4DR7 E;  3QT8 A;  1Z0G A;  2WW4 A;  2F4V I;  4DUZ I;  4NXN E;  1Z0V A;  3LTO A;  2HK3 A;  4LF7 I;  2UXC E;  2E1R A;  4JYA I;  2UUB I;  4DPY A;  1HNZ E;  1H72 C;  1IBM E;  4LFA E;  1PIE A;  3T1Y E;  2UXD I;  4FWD A;  3Q1Q A;  5BR8 I;  2F4V E;  2HKJ A;  1WUU A;  4DUZ E;  4JI4 I;  4DV7 E;  4DR3 I;  4LF7 E;  4PRX A;  4JYA E;  2UUB E;  2A2D A;  2ZIT A;  2UXD E;  5BR8 E;  2HK2 A;  1FWK A;  4PU9 A;  4DPX A;  5A2Q C;  4PRV A;  1KTV A;  4JI4 E;  3LNU A;  4DR3 E;  3ZZU A;  2BM0 A;  1XHK A;  4USM A;  1B62 A;  4JI5 E;  1ZXN A;  3PYF A;  1ZM2 A;  4ZVI A;  4EMD A;  4GKK I;  2UUC E;  3J81 Q;  5A2Q Q;  1NHJ A;  2EFG A;  4DUY I;  2ZBK B;  1EA6 A;  5IT9 C;  2UU9 I;  5FLX C;  3T1H I;  1FI4 A;  4LF4 I;  4X62 I;  4GKJ I;  4JI6 I;  4GKK E;  1FJG E;  1N0V C;  1Z0B A;  4DV3 I;  1ZXM A;  2GS8 A;  3K17 A;  1XNQ I;  4DUY E;  2UU9 E;  3QT5 A;  3B78 A;  4NXN I;  3T1H E;  1VIS A;  4LF4 E;  4FN5 A;  3ZZT A;  4FW9 A;  2X7I A;  4GKJ E;  1HNZ I;  4DV5 E;  4JI6 E;  4LFA I;  2HKE A;  4JI7 I;  1IBK I;  1FWL A;  4DV3 E;  4JI2 I;  3F0N A;  3WU5 A;  3CWV A;  3WU3 A;  2V2Z A;  4DV7 I;  4DU8 A;  4WUD A;  5L3J A;  5GME A;  1S4E A;  3ZM7 A;  5LMN I;  4YHH I;  4JI7 E;  1IBK E;  2XEX A;  4DV4 I;  4JI2 E;  1H74 A;  1XMQ I;  1I94 I;  1N36 I;  2BM1 A;  2AJ4 A;  4B3S E;  1QZR A;  5LMN E;  4YHH E;  1HNW I;  1Z5A A;  4DXL A;  3PYE A;  4DR4 E;  3B82 A;  4DV4 E;  4LF6 E;  1Z5B A;  1XMQ E;  1J5E I;  4DV0 I;  1I94 E;  4USK A;  4DR2 I;  1N36 E;  4JI5 I;  1DAR A;  1KKH A;  1FNM A;  4MYT A;  1S16 A;  2UUC I;  2V8P A;  3B8H A;  1XMO I;  1HNW E;  5GMD A;  4JI0 E;  3JAM C;  4HAC B;  2X36 A;  4KHP I;  1U2R A;  4Z7Y A;  1J5E E;  4DV0 E;  1ZM4 A;  1XNR I;  4DR2 E;  1HR0 E;  2VQF I;  1FJG I;  1Z0T A;  3H4L A;  1XMO E;  4DPT A;  4R1F A;  3ZKB A;  2R3V A;  2VQE I;  1PVG A;  1FKA E;  3WU6 A;  1IBL I;  4Z7C A;  1N0U A;  3GON A;  2V34 A;  4KHP E;  4DV2 I;  3JAM Q;  2R42 A;  2NPF A;  1XNR E;  1KIJ A;  2BV3 A;  2VQF E;  4DPU A;  1N32 I;  1ZM9 A;  4X65 I;  4DV5 I;  4B3M I;  2UUA I;  2VQE E;  4M1K A;  1NHH A;  1IBL E;  5LMU I;  4HYM A;  4DV2 E;  1EI1 A;  3M6A A;  3V2U C;  4ED4 A;  4YY3 E;  1N32 E;  4X65 E;  5IT9 Q;  5FLX Q;  3J7A M;  2ZM6 I;  4B3M E;  1MU5 A;  4DV1 E;  4FWH A;  4RPF A;  2UUA E;  4K0K I;  3QT6 A;  4LFB I;  4DR6 I;  3ZZ0 A;  5LMU E;  4B3S I;  5IWA I;  1Z0W A;  4UTG A;  2HFS A;  4HY1 A;  4XTJ A;  1BKN A;  2ZM6 E;  4I3H A;  4DR4 I;  4LF6 I;  1HNX I;  4K0K E;  2A2C A;  4FWG A;  4LFB E;  4DR6 E;  4LF9 I;  4B3R I;  5IWA E;  4HXZ A;  1D6T A;  1H7U A;  1ZM3 A;  2E5L I;  1RR9 A;  4JI0 I;  4JI3 E;  4B3T I;  1HNX E;  2DEI A;  3PYG A;  2UXB I;  3WU4 A;  4LF9 E;  4B3R E;  4UT4 A;  1HR0 I;  1Z5C A;  3PYD A;  2VF3 A;  1K47 A;  4OX9 I;  2Q2E B;  3QT7 A; 
#chains in the Genus database with same CATH topology
 4FW5 A;  1RRE A;  3HKM A;  2E5L E;  4P7A A;  1MG7 A;  4WUC A;  1A6F A;  4NBQ A;  3ZKD A;  4JV5 I;  4WUB A;  4HAC A;  1NHI A;  4DPW A;  4IZK A;  5DNX A;  4B3T E;  1H73 A;  3J81 C;  4JI8 I;  2UXB E;  2NN6 C;  2JEB B;  4LCG A;  4URL A;  2J65 A;  5K36 F;  3K1J A;  4P52 A;  4BA1 A;  4DV6 I;  1H7S A;  4DR5 I;  4OX9 E;  1PKP A;  2GO4 A;  2J7K A;  2BA1 G;  2HHH I;  5LL6 R;  2OI2 A;  2PO1 A;  1Y5Y A;  1MX0 A;  4JV5 E;  4NXM I;  5K36 B;  5DRQ A;  1ELO A;  2PO0 A;  2PO2 B;  1B63 A;  3J80 C;  4IZJ D;  2IOQ A;  4IZJ B;  2V2V A;  4DR1 I;  2V2Q A;  3P3C A;  4LF5 I;  4JI8 E;  3OTO I;  2Z5C B;  4YY3 I;  4DV6 E;  4MU4 A;  4JI1 I;  4DR5 E;  3P76 A;  5EL9 A;  2HHH E;  3D4J A;  1Z59 A;  3V5R A;  4AQY I;  4LF8 I;  4DV1 I;  2WNR B;  4NXM E;  1OJ4 A;  2CZ9 A;  1N34 I;  2AE8 A;  4LFC I;  2LJP A;  5JEA E;  3PS1 A;  4X66 I;  4DR1 E;  4LF5 E;  1Z0E A;  4DU7 A;  3OTO E;  4X64 I;  2JEA B;  3J80 Q;  4JG4 A;  4JI1 E;  4OO1 A;  1UEK A;  2HFU A;  3M85 D;  3KRN A;  1N33 I;  4AQY E;  4BA2 B;  2GQ0 A;  4FW7 A;  4KQV A;  4LF8 E;  1NZ0 A;  3LPS A;  4LCF A;  4DR7 I;  4FW4 A;  5C0X E;  1N34 E;  1E3P A;  4LFC E;  4FW3 A;  3HJC A;  4X66 E;  1KVK A;  2BA0 G;  2UXC I;  5JEA C;  4X64 E;  4X62 E;  3J7A G;  5DRO A;  3H1C A;  2NN6 F;  4J3D A;  1IBM I;  3T1Y I;  3U1K A;  1Z0C A;  1N33 E;  2DEJ A;  4JI3 I;  4MYU A;  2C37 A;  3HUL A;  1XNQ E;  4DR7 E;  3QT8 A;  2NN6 B;  4IFD F;  1Z0G A;  2WW4 A;  2F4V I;  4DUZ I;  3B4T A;  4NXN E;  2IOP A;  1Z0V A;  3LTO A;  5C0X C;  2HK3 A;  4LF7 I;  2UXC E;  2IER A;  2E1R A;  4JYA I;  2UUB I;  4IFD B;  4DPY A;  1HNZ E;  1H72 C;  3K85 A;  1IBM E;  4LFA E;  1PIE A;  3T1Y E;  2UXD I;  4FWD A;  3Q1Q A;  5BR8 I;  2PNZ B;  2F4V E;  2HKJ A;  1WUU A;  4DUZ E;  4JI4 I;  2O3Z A;  3PRY A;  4DV7 E;  2JT2 A;  4DR3 I;  4LF7 E;  4PRX A;  3M7N G;  4JYA E;  2UUB E;  2IES A;  2A2D A;  2ZIT A;  2O1T A;  2UXD E;  4AID A;  1UDO A;  5BR8 E;  1OYR A;  2HK2 A;  1FWK A;  4PU9 A;  4DPX A;  5ELW A;  5A2Q C;  4PRV A;  1KTV A;  2O1V A;  4JI4 E;  2C39 B;  3LNU A;  2JEB A;  4DR3 E;  4GQU A;  4IFD C;  5JEA F;  5K36 D;  1UDQ A;  4IZK B;  3CDI A;  3ZZU A;  5K36 A;  2BM0 A;  1XHK A;  4USM A;  1B62 A;  5JEA B;  4IZJ A;  1UDN A;  4JI5 E;  1ZXN A;  3PYF A;  1ZM2 A;  2O1W A;  4ZVI A;  2CGE A;  4EMD A;  4GKK I;  1RHY A;  2UUC E;  2Z5C A;  2Z5B B;  3J81 Q;  5C0X F;  5A2Q Q;  2PO0 B;  1NHJ A;  2EFG A;  2BA1 D;  4DUY I;  2WNR A;  2ZBK B;  1EA6 A;  5IT9 C;  2UU9 I;  5FLX C;  5C0X D;  5C0X B;  2VES A;  3T1H I;  1FI4 A;  4LF4 I;  4X62 I;  4GKJ I;  4JI6 I;  4GKK E;  2C38 B;  1FJG E;  1N0V C;  1Z0B A;  4DV3 I;  1ZXM A;  2GS8 A;  3K17 A;  1XNQ I;  4DUY E;  1VI7 A;  4OO1 F;  2UU9 E;  4QNJ A;  1USV A;  3B78 A;  3L7Z B;  3QT5 A;  4NXN I;  3T1H E;  4MQY A;  1VIS A;  4LF4 E;  4FN5 A;  3ZZT A;  4FW9 A;  1XXE A;  3Q6M A;  2X7I A;  4GKJ E;  1HNZ I;  4IS9 A;  4DV5 E;  4JI6 E;  4LFA I;  2GO3 A;  4AM3 A;  2HKE A;  4JI7 I;  1IBK I;  1FWL A;  2BR2 B;  4DV3 E;  4JI2 I;  3F0N A;  2NN6 D;  3WU5 A;  2PNL A;  3CWV A;  2NN6 A;  3WU3 A;  2V2Z A;  4AIM A;  1OYS A;  4DV7 I;  4DU8 A;  4WUD A;  5L3J A;  2CVE A;  5GME A;  4OO1 E;  1S4E A;  3ZM7 A;  4IFD D;  5LMN I;  4YHH I;  1HK7 A;  2BA0 D;  4IFD A;  2WP8 A;  4JI7 E;  1IBK E;  2XEX A;  4DV4 I;  1UDS A;  5EKW A;  4JI2 E;  2PNZ A;  1H74 A;  1XMQ I;  1I94 I;  1N36 I;  2BM1 A;  2AJ4 A;  4B3S E;  3DD6 A;  3GME A;  1QZR A;  5LMN E;  4YHH E;  2JE6 A;  1HNW I;  1Z5A A;  4DXL A;  3PYE A;  4OO1 C;  1USU A;  4DR4 E;  3B82 A;  4DV4 E;  4LF6 E;  1Z5B A;  3P06 A;  3U1Y A;  1XMQ E;  3P3E A;  1J5E I;  4DV0 I;  1I94 E;  4USK A;  4DR2 I;  1N36 E;  4JI5 I;  1DAR A;  1KKH A;  1FNM A;  4MYT A;  2C39 A;  1S16 A;  2UUC I;  3PS3 A;  2V8P A;  3B8H A;  3NZK A;  1XMO I;  1R6M A;  1HNW E;  5GMD A;  4JI0 E;  3JAM C;  2Z5E A;  1YHC A;  3M7N D;  4HAC B;  2X36 A;  4KHP I;  2PO2 A;  1U2R A;  5JEA D;  4Z7Y A;  1P42 A;  4QNK A;  1J5E E;  4DV0 E;  1ZM4 A;  1XNR I;  4BA1 B;  5JEA A;  4DR2 E;  1HR0 E;  2VQF I;  3PS2 A;  1R6L A;  1FJG I;  2PO1 B;  1OYP A;  1Z0T A;  1Y4U A;  3H4L A;  1XMO E;  2Z5B A;  4DPT A;  4R1F A;  3ZKB A;  2R3V A;  2VQE I;  4N3O A;  1PVG A;  1FKA E;  4OZE A;  3WU6 A;  4Z7C A;  1N0U A;  1IBL I;  3GON A;  2V34 A;  4KHP E;  1Y6Z A;  4U3B A;  4DV2 I;  3JAM Q;  2R42 A;  5C0X A;  1E3H A;  2NPF A;  1Y4S A;  4OKG A;  3M85 G;  1XNR E;  1KIJ A;  2BV3 A;  2VQF E;  4DPU A;  1N32 I;  1ZM9 A;  4X65 I;  4DV5 I;  2JEA A;  2C38 A;  4B3M I;  4MU0 A;  5K36 E;  4BA2 A;  2UUA I;  2VQE E;  4M1K A;  1NHH A;  1IBL E;  5LMU I;  4HYM A;  4DV2 E;  3L7Z A;  5FWK A;  5DNL A;  4LCH A;  1EI1 A;  2CG9 A;  3M6A A;  3V2U C;  4ED4 A;  4OO1 D;  5DRP A;  4YY3 E;  1N32 E;  4X65 E;  2O1U A;  5FLX Q;  4OO1 B;  5IT9 Q;  3J7A M;  2ZM6 I;  3P3G A;  4B3M E;  1MU5 A;  2BR2 A;  4DV1 E;  4FWH A;  4LOM A;  4RPF A;  2UUA E;  4K0K I;  3QT6 A;  4LFB I;  4ISA A;  4DR6 I;  5K36 C;  3ZZ0 A;  5LMU E;  5DRR A;  4FW6 A;  4B3S I;  3GCM A;  5IWA I;  1Z0W A;  4UTG A;  4MU1 A;  4LPF A;  2HFS A;  4MDT A;  4HY1 A;  4XTJ A;  3UHM A;  4U3D A;  1BKN A;  2ZM6 E;  4I3H A;  4DR4 I;  2C37 B;  4LF6 I;  1HNX I;  4K0K E;  2A2C A;  4FWG A;  4LFB E;  2F1D A;  4DR6 E;  4LF9 I;  3Q6N A;  4B3R I;  1Y60 A;  3CDJ A;  5IWA E;  4HXZ A;  2PNM A;  1D6T A;  1H7U A;  1ZM3 A;  2WP8 B;  1YH8 A;  2E5L I;  1RR9 A;  4JI0 I;  4MU3 A;  4JI3 E;  2NN6 E;  3GLL A;  4B3T I;  1HNX E;  2DEI A;  3PYG A;  2UXB I;  3WU4 A;  4LF9 E;  4B3R E;  4UT4 A;  1HR0 I;  1Z5C A;  3PYD A;  4IFD E;  2VF3 A;  1K47 A;  4OX9 I;  2JE6 B;  2Q2E B;  3QT7 A; 
#chains in the Genus database with same CATH homology
 1RRE A;  2E5L E;  4P7A A;  1MG7 A;  4WUC A;  1A6F A;  3ZKD A;  4JV5 I;  4WUB A;  4HAC A;  1NHI A;  4DPW A;  4IZK A;  4B3T E;  1H73 A;  3J81 C;  4JI8 I;  2UXB E;  4URL A;  3K1J A;  4P52 A;  4DV6 I;  1H7S A;  4DR5 I;  4OX9 E;  1PKP A;  2J7K A;  2HHH I;  5LL6 R;  2OI2 A;  1MX0 A;  4JV5 E;  4NXM I;  1ELO A;  3J80 C;  1B63 A;  4IZJ D;  2IOQ A;  4IZJ B;  2V2V A;  4DR1 I;  2V2Q A;  4LF5 I;  4JI8 E;  3OTO I;  2Z5C B;  4YY3 I;  4DV6 E;  4JI1 I;  4DR5 E;  2HHH E;  3D4J A;  1Z59 A;  3V5R A;  4AQY I;  4LF8 I;  4DV1 I;  4NXM E;  1OJ4 A;  2CZ9 A;  1N34 I;  4LFC I;  2LJP A;  4X66 I;  4DR1 E;  4LF5 E;  1Z0E A;  4DU7 A;  3OTO E;  4X64 I;  3J80 Q;  4JG4 A;  4JI1 E;  1UEK A;  2HFU A;  1N33 I;  4AQY E;  2GQ0 A;  4KQV A;  4LF8 E;  1NZ0 A;  3LPS A;  4DR7 I;  1N34 E;  4LFC E;  3HJC A;  4X66 E;  1KVK A;  2UXC I;  4X64 E;  4X62 E;  3J7A G;  1IBM I;  3T1Y I;  1Z0C A;  1N33 E;  2DEJ A;  4JI3 I;  4MYU A;  3HUL A;  1XNQ E;  4DR7 E;  3QT8 A;  1Z0G A;  2WW4 A;  2F4V I;  4DUZ I;  4NXN E;  2IOP A;  1Z0V A;  3LTO A;  2HK3 A;  4LF7 I;  2UXC E;  2E1R A;  4JYA I;  2UUB I;  4DPY A;  1HNZ E;  1H72 C;  3K85 A;  1IBM E;  4LFA E;  1PIE A;  3T1Y E;  2UXD I;  4FWD A;  3Q1Q A;  5BR8 I;  2F4V E;  2HKJ A;  1WUU A;  4DUZ E;  4JI4 I;  3PRY A;  4DV7 E;  4DR3 I;  4LF7 E;  4PRX A;  4JYA E;  2UUB E;  2A2D A;  2ZIT A;  2O1T A;  2UXD E;  5BR8 E;  2HK2 A;  1FWK A;  4PU9 A;  4DPX A;  5A2Q C;  4PRV A;  1KTV A;  2O1V A;  4JI4 E;  3LNU A;  4DR3 E;  4IZK B;  3ZZU A;  2BM0 A;  1XHK A;  4USM A;  1B62 A;  4IZJ A;  4JI5 E;  1ZXN A;  3PYF A;  1ZM2 A;  2O1W A;  4ZVI A;  2CGE A;  4EMD A;  4GKK I;  2UUC E;  2Z5C A;  2Z5B B;  3J81 Q;  5A2Q Q;  1NHJ A;  2EFG A;  4DUY I;  2ZBK B;  1EA6 A;  5IT9 C;  2UU9 I;  5FLX C;  3T1H I;  1FI4 A;  4LF4 I;  4X62 I;  4GKJ I;  4JI6 I;  4GKK E;  1FJG E;  1N0V C;  1Z0B A;  4DV3 I;  1ZXM A;  2GS8 A;  3K17 A;  1XNQ I;  4DUY E;  2UU9 E;  1USV A;  3B78 A;  3QT5 A;  4NXN I;  3T1H E;  1VIS A;  4LF4 E;  4FN5 A;  3ZZT A;  4FW9 A;  3Q6M A;  2X7I A;  4GKJ E;  1HNZ I;  4DV5 E;  4JI6 E;  4LFA I;  2HKE A;  4JI7 I;  1IBK I;  1FWL A;  4DV3 E;  4JI2 I;  3F0N A;  3WU5 A;  2PNL A;  3CWV A;  3WU3 A;  2V2Z A;  4DV7 I;  4DU8 A;  4WUD A;  5L3J A;  5GME A;  1S4E A;  3ZM7 A;  5LMN I;  4YHH I;  1HK7 A;  4JI7 E;  1IBK E;  2XEX A;  4DV4 I;  4JI2 E;  1H74 A;  1XMQ I;  1I94 I;  1N36 I;  2BM1 A;  2AJ4 A;  4B3S E;  1QZR A;  5LMN E;  4YHH E;  1HNW I;  1Z5A A;  4DXL A;  3PYE A;  1USU A;  4DR4 E;  3B82 A;  4DV4 E;  4LF6 E;  1Z5B A;  3P06 A;  1XMQ E;  1J5E I;  4DV0 I;  1I94 E;  4USK A;  4DR2 I;  1N36 E;  4JI5 I;  1DAR A;  1KKH A;  1FNM A;  4MYT A;  1S16 A;  2UUC I;  2V8P A;  3B8H A;  1XMO I;  1HNW E;  5GMD A;  4JI0 E;  3JAM C;  2Z5E A;  4HAC B;  2X36 A;  4KHP I;  1U2R A;  4Z7Y A;  1J5E E;  4DV0 E;  1ZM4 A;  1XNR I;  4DR2 E;  1HR0 E;  2VQF I;  1FJG I;  1Z0T A;  1Y4U A;  3H4L A;  1XMO E;  2Z5B A;  4DPT A;  4R1F A;  3ZKB A;  2R3V A;  2VQE I;  4N3O A;  1PVG A;  1FKA E;  3WU6 A;  1IBL I;  4Z7C A;  1N0U A;  3GON A;  2V34 A;  4KHP E;  1Y6Z A;  4DV2 I;  3JAM Q;  2R42 A;  2NPF A;  1XNR E;  1Y4S A;  1KIJ A;  2BV3 A;  2VQF E;  4DPU A;  1N32 I;  1ZM9 A;  4X65 I;  4DV5 I;  4B3M I;  2UUA I;  2VQE E;  4M1K A;  1NHH A;  1IBL E;  5LMU I;  4HYM A;  4DV2 E;  5FWK A;  1EI1 A;  2CG9 A;  3M6A A;  3V2U C;  4ED4 A;  4YY3 E;  1N32 E;  4X65 E;  2O1U A;  5FLX Q;  5IT9 Q;  3J7A M;  2ZM6 I;  4B3M E;  1MU5 A;  4DV1 E;  4FWH A;  4RPF A;  2UUA E;  4K0K I;  3QT6 A;  4LFB I;  4DR6 I;  3ZZ0 A;  5LMU E;  4B3S I;  5IWA I;  1Z0W A;  4UTG A;  2HFS A;  4HY1 A;  4XTJ A;  1BKN A;  2ZM6 E;  4I3H A;  4DR4 I;  4LF6 I;  1HNX I;  4K0K E;  2A2C A;  4FWG A;  4LFB E;  4DR6 E;  4LF9 I;  3Q6N A;  4B3R I;  5IWA E;  4HXZ A;  2PNM A;  1D6T A;  1H7U A;  1ZM3 A;  2E5L I;  1RR9 A;  4JI0 I;  4JI3 E;  4B3T I;  1HNX E;  2DEI A;  3PYG A;  2UXB I;  3WU4 A;  4LF9 E;  4B3R E;  4UT4 A;  1HR0 I;  1Z5C A;  3PYD A;  2VF3 A;  1K47 A;  4OX9 I;  2Q2E B;  3QT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...