5LMNI

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 5lmnI00
1Z5BA 2X36A 1I94E 1PVGA 2BM1A 2J7KA 1PKPA 1FJGI 1FJGE 5LMNI 4LFAI 1Z0EA 4FN5A 4FWGA 1FWKA 5A2QC 1QZRA 1XMQI 1BKNA 2V34A 3PYDA 1N0VC 1OJ4A 1HNXE 3QT7A 4DR2E 1MX0A 4JI7I 4DPXA 2Q2EB 2A2CA 4DV3I 3ZZTA 3ZM7A 4DV3E 1Z0TA 4JI6E 3K17A 3JAMQ 4UT4A 2F4VE 3PYGA 1A6FA 2UXDI 2DEJA 2X7IA 4R1FA 5A2QQ 4I3HA 4JI1I 1J5EI 2UUCE 2A2DA 1WUUA 4UTGA 1NHHA 3ZZ0A 1HNWI 4B3ME 4GKKE 4NXME 2UXCI 1EI1A 2UUAE 3T1HI 2V2ZA 4OX9E 1XNQE 3T1YI 1B62A 4ED4A 1DARA 4LF6E 1N33E 1I94I 4PRXA 2E5LE 5IWAE 4JI2I 1HNZE 1ZXNA 4WUDA 3LPSA 4KHPI 2ZBKB 4DPTA 2HHHI 4DR4I 4LF7E 1ZM3A 4B3RE 1Z0GA 3PYEA 1J5EE 1HNZI 3J80Q 3H4LA 4X62I 3OTOI 1K47A 4DV7I 5LMNE 4DV0E 3PYFA 4LFBE 4LFCE 1PIEA 4LFCI 4DR4E 2UUAI 5IT9C 4B3SE 2HKJA 4LF8E 4GKKI 2R42A 1Z59A 4B3TI 4FW9A 5LMUE 4LF6I 2ZITA 4JI8I 4DR7E 1H7UA 1XMOI 4DR7I 4DV7E 4JYAE 5GMEA 3HULA 4X66I 2HHHE 4RPFA 2WW4A 1IBMI 4DR5I 4PRVA 4JYAI 4JI8E 4HY1A 4DR1E 2BV3A 2DEIA 5GMDA 3J80C 1H74A 1ZM9A 3QT8A 3WU4A 2OI2A 4P7AA 4JI4E 1Z0CA 2V2VA 3K1JA 1N36I 1HR0I 4AQYE 3B78A 4LFBI 2BM0A 4DUYE 1D6TA 4DV1E 3J7AM 1KVKA 4USKA 1RR9A 2E1RA 5IWAI 1S4EA 1Z0VA 1KTVA 2HFSA 4DV6E 1XMOE 2UUBE 5LMUI 3ZKDA 1MU5A 4HACA 1N32E 2UXBI 1UEKA 4YHHE 1FKAE 1H7SA 4YY3I 4B3MI 4P52A 4DU8A 3LNUA 2HK3A 1MG7A 4DPWA 4FWHA 4DV0I 4LF9E 2E5LI 4JI2E 2HK2A 3OTOE 4B3TE 1FNMA 3B82A 4DV1I 4DR3I 1IBKE 2F4VI 4DUYI 3T1HE 1N34E 1S16A 4B3RI 4DXLA 4JG4A 2VQEI 4JI6I 1RREA 3WU5A 4JI7E 4HYMA 4DUZE 1H73A 4X64I 1EA6A 1Z5AA 4JI1E 1HNXI 2VQFE 1H72C 1FWLA 4X65I 2V8PA 2XEXA 4DR1I 5L3JA 2HFUA 4DU7A 1XNRI 1N33I 4NXNI 4LF9I 4LF5I 4Z7YA 5IT9Q 4DR5E 5BR8E 4XTJA 2EFGA 4X65E 2HKEA 2AJ4A 4X64E 3QT6A 3F0NA 4MYUA 2UXBE 3QT5A 4Z7CA 1HNWE 4M1KA 4KQVA 4DPUA 4JI3E 4EMDA 2V2QA 3LTOA 1N34I 4LF5E 1NZ0A 4DV5I 3GONA 1IBKI 4DR3E 4ZVIA 4USMA 5LL6R 3ZKBA 2UU9I 1NHIA 3J81Q 3D4JA 4B3SI 1ZM2A 4JI5E 1Z0BA 3CWVA 4LF4E 2VQEE 1IBME 2UUCI 4AQYI 4KHPE 4JI0E 4JV5E 4GKJE 1IBLI 1N36E 1HR0E 3V5RA 1Z0WA 5FLXQ 2UXDE 2R3VA 4URLA 1KKHA 3V2UC 4DV6I 3T1YE 1U2RA 1XNQI 4DV2E 4JI0I 1XNRE 4JV5I 3WU3A 1Z5CA 4DV4E 1NHJA 4YY3E 4NXMI 4DR6I 4K0KI 1ELOA 2ZM6E 3J81C 5BR8I 3J7AG 4HXZA 3M6AA 4X66E 1KIJA 4JI5I 2GS8A 2UUBI 4HACB 2LJPA 3WU6A 4OX9I 4DPYA 3ZZUA 4JI4I 2CZ9A 3Q1QA 4WUCA 1VISA 5FLXC 2NPFA 4DR6E 1IBLE 4WUBA 4LF7I 4DV4I 2ZM6I 4K0KE 4LF4I 1ZXMA 4DR2I 1XHKA 1N0UA 1B63A 1N32I 4X62E 1XMQE 4DV2I 2UU9E 1FI4A 2VF3A 4FWDA 4LFAE 4DV5E 4NXNE 3B8HA 3JAMC 4DUZI 4PU9A 4JI3I 1ZM4A 2VQFI 2UXCE 4MYTA 4GKJI 4LF8I 4YHHI
chains in the Genus database with same CATH superfamily
4BA1B 1Z5BA 4GQUA 2X36A 2NN6D 5JEAF 4QNJA 1I94E 1PVGA 5DROA 2BM1A 2J7KA 1PKPA 4MU1A 1FJGI 1FJGE 2PO0A 5LMNI 4LFAI 1Z0EA 2C37B 3P3EA 2PO0B 4FN5A 4FWGA 1FWKA 5A2QC 1QZRA 1XMQI 3U1KA 1BKNA 2V34A 3PYDA 1N0VC 1OJ4A 2IERA 1HNXE 3QT7A 4DR2E 5DRQA 2JEAB 1Y4SA 2BR2A 5DRPA 1MX0A 4JI7I 4DPXA 2Q2EB 2A2CA 4DV3I 3ZZTA 3ZM7A 4DV3E 1Z0TA 4JI6E 3K17A 4MU3A 3JAMQ 4UT4A 2F4VE 3PYGA 5ELWA 3NZKA 4FW7A 4IZKB 5K36B 1A6FA 2UXDI 2DEJA 3KRNA 2X7IA 4R1FA 5A2QQ 4I3HA 4JI1I 3P3GA 1J5EI 3L7ZB 2UUCE 5C0XF 2A2DA 1WUUA 4UTGA 3K85A 1R6MA 1NHHA 3ZZ0A 1HNWI 3PS2A 4U3BA 2WNRB 2O1UA 4B3ME 4GKKE 1VI7A 2O1VA 4NXME 2UXCI 2NN6A 1EI1A 5DNLA 2O3ZA 1RHYA 2UUAE 4QNKA 3T1HI 2V2ZA 4OX9E 1XNQE 3T1YI 3P76A 1B62A 4ED4A 1DARA 4LF6E 1N33E 5JEAC 5JEAE 1I94I 4PRXA 2E5LE 5IWAE 4JI2I 3GMEA 1HNZE 1ZXNA 5FWKA 5DRRA 4OO1B 3P06A 4WUDA 3LPSA 4IZJD 5JEAA 3M85D 4KHPI 2ZBKB 4DPTA 2GQ0A 2HHHI 4DR4I 3Q6MA 4LF7E 1YH8A 1ZM3A 5K36E 4MU0A 4B3RE 1Z0GA 3PYEA 1J5EE 2IESA 2PNMA 1HNZI 3J80Q 3H4LA 2IOPA 4X62I 3OTOI 4FW3A 1K47A 4DV7I 5LMNE 4DV0E 3PYFA 4LFBE 4LFCE 1PIEA 5EKWA 4LFCI 4DR4E 2UUAI 4OO1A 5IT9C 4B3SE 2HKJA 4LF8E 4GKKI 3M85G 2R42A 4IFDC 1Z59A 4B3TI 2PO2A 4FW9A 5LMUE 4LF6I 2JEAA 2ZITA 4BA2B 4JI8I 2CGEA 2JEBA 1H7UA 1XMOI 4DR7E 4DR7I 4DV7E 3PS3A 2NN6F 4IZJA 5JEAD 4JYAE 4IS9A 5GMEA 5K36F 3HULA 4X66I 2HHHE 4RPFA 4FW6A 5C0XD 2WW4A 1IBMI 5K36D 4MU4A 4DR5I 5JEAB 4PRVA 4JYAI 4OZEA 4JI8E 2JEBB 4N3OA 2NN6C 4HY1A 4DR1E 4IZKA 2BV3A 4FW5A 2DEIA 4J3DA 5GMDA 3J80C 1H74A 1ZM9A 3QT8A 3WU4A 2OI2A 4P7AA 4JI4E 1Z0CA 2V2VA 3K1JA 1N36I 1HR0I 4LCHA 4LPFA 4ISAA 2JE6B 4AQYE 3GCMA 5EL9A 2C39A 3B78A 1UDQA 4LFBI 2BM0A 2Z5CB 4DUYE 1D6TA 4DV1E 3UHMA 1Y5YA 2IOQA 2PNZB 3J7AM 1KVKA 4USKA 1RR9A 2E1RA 5IWAI 5K36C 1UDSA 1S4EA 1Z0VA 4IZJB 4AIDA 1KTVA 2HFSA 4DV6E 1XMOE 2UUBE 4IFDF 5K36A 5LMUI 3ZKDA 2Z5CA 1MU5A 4HACA 1N32E 2C38B 2UXBI 1UEKA 4YHHE 2BA1G 1E3HA 4MDTA 2BA0D 2JE6A 1FKAE 2GO4A 1H7SA 4YY3I 4B3MI 4P52A 4DU8A 3LNUA 4IFDA 1R6LA 2HK3A 1MG7A 4DPWA 4LCFA 4FWHA 4DV0I 2AE8A 4OO1C 1P42A 5C0XB 4LF9E 5C0XC 2E5LI 2HK2A 4JI2E 3OTOE 2JT2A 4B3TE 3Q6NA 1OYSA 1FNMA 2C37A 3B82A 4DV1I 4DR3I 1IBKE 4U3DA 2F4VI 4DUYI 2F1DA 3T1HE 1N34E 1S16A 1Y4UA 3M7ND 4B3RI 4DXLA 4JG4A 2VQEI 4JI6I 1RREA 3WU5A 3PRYA 4HYMA 4JI7E 4DUZE 2C39B 1H73A 3L7ZA 4X64I 1EA6A 1Z5AA 4JI1E 2Z5BB 1HNXI 4OO1E 2VQFE 2GO3A 1H72C 1HK7A 1FWLA 4X65I 2V8PA 2XEXA 4DR1I 5L3JA 2HFUA 4DU7A 1XNRI 1N33I 4NXNI 4LF9I 4LF5I 4Z7YA 1USVA 3GLLA 2Z5EA 5IT9Q 4FW4A 4DR5E 5BR8E 2Z5BA 4XTJA 4OKGA 2EFGA 3B4TA 4X65E 2HKEA 2O1TA 2AJ4A 3HJCA 4X64E 3QT6A 3F0NA 4MYUA 2O1WA 2UXBE 3QT5A 4Z7CA 1HNWE 3PS1A 4M1KA 4KQVA 4DPUA 5C0XE 4JI3E 4EMDA 2V2QA 3LTOA 1N34I 1USUA 4LF5E 1NZ0A 4LCGA 4DV5I 4IFDD 3GONA 4DR3E 1IBKI 4ZVIA 4USMA 5LL6R 3ZKBA 5C0XA 2UU9I 1NHIA 3J81Q 3D4JA 4B3SI 4OO1F 1ZM2A 2WP8A 4JI5E 1Z0BA 3CWVA 3M7NG 4LF4E 2VQEE 1IBME 3U1YA 2UUCI 4AQYI 4KHPE 4JI0E 4IFDE 4JV5E 4GKJE 2NN6E 1IBLI 1Y60A 4AM3A 2CVEA 1N36E 1HR0E 1YHCA 3V5RA 4NBQA 1Z0WA 5FLXQ 2UXDE 2R3VA 4MQYA 4URLA 1KKHA 3CDJA 3V2UC 4DV6I 3P3CA 3T1YE 1U2RA 1XNQI 1XXEA 5DNXA 4DV2E 2NN6B 4JI0I 1XNRE 4JV5I 2PNZA 3WU3A 1Z5CA 2WNRA 4DV4E 1OYPA 1NHJA 2PO1A 4YY3E 4NXMI 4DR6I 4IFDB 4K0KI 1ELOA 2ZM6E 3J81C 5BR8I 3J7AG 4HXZA 3M6AA 4X66E 1UDOA 1KIJA 4JI5I 4OO1D 2GS8A 2WP8B 2UUBI 4LOMA 4HACB 2LJPA 3WU6A 4OX9I 4DPYA 3ZZUA 4JI4I 2CZ9A 3Q1QA 4WUCA 1VISA 5FLXC 2NPFA 4DR6E 1IBLE 4WUBA 2PNLA 2PO1B 4LF7I 1OYRA 2BR2B 4DV4I 2ZM6I 4K0KE 1E3PA 4LF4I 1ZXMA 4DR2I 3DD6A 1XHKA 2VESA 1N0UA 1B63A 1N32I 4X62E 1Y6ZA 1XMQE 4DV2I 3H1CA 2UU9E 1FI4A 2VF3A 4FWDA 4LFAE 4BA2A 2PO2B 4DV5E 4BA1A 4NXNE 3B8HA 3JAMC 4DUZI 4PU9A 3HKMA 4JI3I 2BA1D 1ZM4A 2BA0G 2VQFI 2UXCE 2CG9A 4MYTA 1UDNA 2J65A 3CDIA 4AIMA 4GKJI 4LF8I 4YHHI 2C38A
chains in the Genus database with same CATH topology
1Z5BA 2X36A 1I94E 1PVGA 2BM1A 2J7KA 1PKPA 1FJGI 1FJGE 5LMNI 4LFAI 1Z0EA 4FN5A 4FWGA 1FWKA 5A2QC 1QZRA 1XMQI 1BKNA 2V34A 3PYDA 1N0VC 1OJ4A 1HNXE 3QT7A 4DR2E 1Y4SA 1MX0A 4JI7I 4DPXA 2Q2EB 2A2CA 4DV3I 3ZZTA 3ZM7A 4DV3E 1Z0TA 4JI6E 3K17A 3JAMQ 4UT4A 2F4VE 3PYGA 4IZKB 1A6FA 2UXDI 2DEJA 2X7IA 4R1FA 5A2QQ 4I3HA 4JI1I 1J5EI 2UUCE 2A2DA 1WUUA 4UTGA 3K85A 1NHHA 3ZZ0A 1HNWI 2O1UA 4B3ME 4GKKE 2O1VA 4NXME 2UXCI 1EI1A 2UUAE 3T1HI 2V2ZA 4OX9E 1XNQE 3T1YI 1B62A 4ED4A 1DARA 4LF6E 1N33E 1I94I 4PRXA 2E5LE 5IWAE 4JI2I 1HNZE 1ZXNA 5FWKA 3P06A 4WUDA 3LPSA 4IZJD 4KHPI 2ZBKB 4DPTA 2HHHI 2GQ0A 4DR4I 3Q6MA 4LF7E 1ZM3A 4B3RE 1Z0GA 3PYEA 1J5EE 2PNMA 1HNZI 3J80Q 3H4LA 2IOPA 4X62I 3OTOI 1K47A 4DV7I 5LMNE 4DV0E 3PYFA 4LFBE 4LFCE 1PIEA 4LFCI 4DR4E 2UUAI 5IT9C 4B3SE 2HKJA 4LF8E 4GKKI 2R42A 1Z59A 4B3TI 4FW9A 5LMUE 4LF6I 2ZITA 4JI8I 2CGEA 4DR7E 1H7UA 1XMOI 4DR7I 4DV7E 4IZJA 4JYAE 5GMEA 3HULA 4X66I 2HHHE 4RPFA 2WW4A 1IBMI 4DR5I 4PRVA 4JYAI 4JI8E 4N3OA 4HY1A 4DR1E 4IZKA 2BV3A 2DEIA 5GMDA 3J80C 1H74A 1ZM9A 3QT8A 3WU4A 2OI2A 4P7AA 4JI4E 1Z0CA 2V2VA 3K1JA 1N36I 1HR0I 4AQYE 3B78A 4LFBI 2BM0A 2Z5CB 4DUYE 1D6TA 4DV1E 2IOQA 3J7AM 1KVKA 4USKA 1RR9A 2E1RA 5IWAI 1S4EA 1Z0VA 4IZJB 1KTVA 2HFSA 4DV6E 1XMOE 2UUBE 5LMUI 3ZKDA 2Z5CA 1MU5A 4HACA 1N32E 2UXBI 1UEKA 4YHHE 1FKAE 1H7SA 4YY3I 4B3MI 4P52A 4DU8A 3LNUA 2HK3A 1MG7A 4DPWA 4FWHA 4DV0I 4LF9E 2E5LI 4JI2E 2HK2A 3OTOE 4B3TE 3Q6NA 1FNMA 3B82A 4DV1I 4DR3I 1IBKE 2F4VI 4DUYI 3T1HE 1N34E 1S16A 1Y4UA 4B3RI 4DXLA 4JG4A 2VQEI 4JI6I 1RREA 3WU5A 3PRYA 4HYMA 4JI7E 4DUZE 1H73A 4X64I 1EA6A 1Z5AA 4JI1E 2Z5BB 1HNXI 2VQFE 1H72C 1HK7A 1FWLA 4X65I 2V8PA 2XEXA 4DR1I 5L3JA 2HFUA 4DU7A 1XNRI 1N33I 4NXNI 4LF9I 4LF5I 4Z7YA 1USVA 2Z5EA 5IT9Q 4DR5E 5BR8E 2Z5BA 4XTJA 2EFGA 4X65E 2HKEA 2O1TA 2AJ4A 3HJCA 4X64E 3QT6A 3F0NA 4MYUA 2O1WA 2UXBE 3QT5A 4Z7CA 1HNWE 4M1KA 4KQVA 4DPUA 4JI3E 4EMDA 2V2QA 3LTOA 1N34I 1USUA 4LF5E 1NZ0A 4DV5I 3GONA 4DR3E 1IBKI 4ZVIA 4USMA 5LL6R 3ZKBA 2UU9I 1NHIA 3J81Q 3D4JA 4B3SI 1ZM2A 4JI5E 1Z0BA 3CWVA 4LF4E 2VQEE 1IBME 2UUCI 4AQYI 4KHPE 4JI0E 4JV5E 4GKJE 1IBLI 1N36E 1HR0E 3V5RA 1Z0WA 5FLXQ 2UXDE 2R3VA 4URLA 1KKHA 3V2UC 4DV6I 3T1YE 1U2RA 1XNQI 4DV2E 4JI0I 1XNRE 4JV5I 3WU3A 1Z5CA 4DV4E 1NHJA 4YY3E 4NXMI 4DR6I 4K0KI 1ELOA 2ZM6E 3J81C 5BR8I 3J7AG 4HXZA 3M6AA 4X66E 1KIJA 4JI5I 2GS8A 2UUBI 4HACB 2LJPA 3WU6A 4OX9I 4DPYA 3ZZUA 4JI4I 2CZ9A 3Q1QA 4WUCA 1VISA 5FLXC 2NPFA 4DR6E 1IBLE 4WUBA 2PNLA 4LF7I 4DV4I 2ZM6I 4K0KE 4LF4I 1ZXMA 4DR2I 1XHKA 1N0UA 1B63A 1N32I 4X62E 1Y6ZA 1XMQE 4DV2I 2UU9E 1FI4A 2VF3A 4FWDA 4LFAE 4DV5E 4NXNE 3B8HA 3JAMC 4DUZI 4PU9A 4JI3I 1ZM4A 2VQFI 2UXCE 2CG9A 4MYTA 4GKJI 4LF8I 4YHHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5B A;  2X36 A;  1I94 E;  1PVG A;  2BM1 A;  2J7K A;  1PKP A;  1FJG I;  1FJG E;  5LMN I;  4LFA I;  1Z0E A;  4FN5 A;  4FWG A;  1FWK A;  5A2Q C;  1QZR A;  1XMQ I;  1BKN A;  2V34 A;  3PYD A;  1N0V C;  1OJ4 A;  1HNX E;  3QT7 A;  4DR2 E;  1MX0 A;  4JI7 I;  4DPX A;  2Q2E B;  2A2C A;  4DV3 I;  3ZZT A;  3ZM7 A;  4DV3 E;  1Z0T A;  4JI6 E;  3K17 A;  3JAM Q;  4UT4 A;  2F4V E;  3PYG A;  1A6F A;  2UXD I;  2DEJ A;  2X7I A;  4R1F A;  5A2Q Q;  4I3H A;  4JI1 I;  1J5E I;  2UUC E;  2A2D A;  1WUU A;  4UTG A;  1NHH A;  3ZZ0 A;  1HNW I;  4B3M E;  4GKK E;  4NXM E;  2UXC I;  1EI1 A;  2UUA E;  3T1H I;  2V2Z A;  4OX9 E;  1XNQ E;  3T1Y I;  1B62 A;  4ED4 A;  1DAR A;  4LF6 E;  1N33 E;  1I94 I;  4PRX A;  2E5L E;  5IWA E;  4JI2 I;  1HNZ E;  1ZXN A;  4WUD A;  3LPS A;  4KHP I;  2ZBK B;  4DPT A;  2HHH I;  4DR4 I;  4LF7 E;  1ZM3 A;  4B3R E;  1Z0G A;  3PYE A;  1J5E E;  1HNZ I;  3J80 Q;  3H4L A;  4X62 I;  3OTO I;  1K47 A;  4DV7 I;  5LMN E;  4DV0 E;  3PYF A;  4LFB E;  4LFC E;  1PIE A;  4LFC I;  4DR4 E;  2UUA I;  5IT9 C;  4B3S E;  2HKJ A;  4LF8 E;  4GKK I;  2R42 A;  1Z59 A;  4B3T I;  4FW9 A;  5LMU E;  4LF6 I;  2ZIT A;  4JI8 I;  4DR7 E;  1H7U A;  1XMO I;  4DR7 I;  4DV7 E;  4JYA E;  5GME A;  3HUL A;  4X66 I;  2HHH E;  4RPF A;  2WW4 A;  1IBM I;  4DR5 I;  4PRV A;  4JYA I;  4JI8 E;  4HY1 A;  4DR1 E;  2BV3 A;  2DEI A;  5GMD A;  3J80 C;  1H74 A;  1ZM9 A;  3QT8 A;  3WU4 A;  2OI2 A;  4P7A A;  4JI4 E;  1Z0C A;  2V2V A;  3K1J A;  1N36 I;  1HR0 I;  4AQY E;  3B78 A;  4LFB I;  2BM0 A;  4DUY E;  1D6T A;  4DV1 E;  3J7A M;  1KVK A;  4USK A;  1RR9 A;  2E1R A;  5IWA I;  1S4E A;  1Z0V A;  1KTV A;  2HFS A;  4DV6 E;  1XMO E;  2UUB E;  5LMU I;  3ZKD A;  1MU5 A;  4HAC A;  1N32 E;  2UXB I;  1UEK A;  4YHH E;  1FKA E;  1H7S A;  4YY3 I;  4B3M I;  4P52 A;  4DU8 A;  3LNU A;  2HK3 A;  1MG7 A;  4DPW A;  4FWH A;  4DV0 I;  4LF9 E;  2E5L I;  4JI2 E;  2HK2 A;  3OTO E;  4B3T E;  1FNM A;  3B82 A;  4DV1 I;  4DR3 I;  1IBK E;  2F4V I;  4DUY I;  3T1H E;  1N34 E;  1S16 A;  4B3R I;  4DXL A;  4JG4 A;  2VQE I;  4JI6 I;  1RRE A;  3WU5 A;  4JI7 E;  4HYM A;  4DUZ E;  1H73 A;  4X64 I;  1EA6 A;  1Z5A A;  4JI1 E;  1HNX I;  2VQF E;  1H72 C;  1FWL A;  4X65 I;  2V8P A;  2XEX A;  4DR1 I;  5L3J A;  2HFU A;  4DU7 A;  1XNR I;  1N33 I;  4NXN I;  4LF9 I;  4LF5 I;  4Z7Y A;  5IT9 Q;  4DR5 E;  5BR8 E;  4XTJ A;  2EFG A;  4X65 E;  2HKE A;  2AJ4 A;  4X64 E;  3QT6 A;  3F0N A;  4MYU A;  2UXB E;  3QT5 A;  4Z7C A;  1HNW E;  4M1K A;  4KQV A;  4DPU A;  4JI3 E;  4EMD A;  2V2Q A;  3LTO A;  1N34 I;  4LF5 E;  1NZ0 A;  4DV5 I;  3GON A;  1IBK I;  4DR3 E;  4ZVI A;  4USM A;  5LL6 R;  3ZKB A;  2UU9 I;  1NHI A;  3J81 Q;  3D4J A;  4B3S I;  1ZM2 A;  4JI5 E;  1Z0B A;  3CWV A;  4LF4 E;  2VQE E;  1IBM E;  2UUC I;  4AQY I;  4KHP E;  4JI0 E;  4JV5 E;  4GKJ E;  1IBL I;  1N36 E;  1HR0 E;  3V5R A;  1Z0W A;  5FLX Q;  2UXD E;  2R3V A;  4URL A;  1KKH A;  3V2U C;  4DV6 I;  3T1Y E;  1U2R A;  1XNQ I;  4DV2 E;  4JI0 I;  1XNR E;  4JV5 I;  3WU3 A;  1Z5C A;  4DV4 E;  1NHJ A;  4YY3 E;  4NXM I;  4DR6 I;  4K0K I;  1ELO A;  2ZM6 E;  3J81 C;  5BR8 I;  3J7A G;  4HXZ A;  3M6A A;  4X66 E;  1KIJ A;  4JI5 I;  2GS8 A;  2UUB I;  4HAC B;  2LJP A;  3WU6 A;  4OX9 I;  4DPY A;  3ZZU A;  4JI4 I;  2CZ9 A;  3Q1Q A;  4WUC A;  1VIS A;  5FLX C;  2NPF A;  4DR6 E;  1IBL E;  4WUB A;  4LF7 I;  4DV4 I;  2ZM6 I;  4K0K E;  4LF4 I;  1ZXM A;  4DR2 I;  1XHK A;  1N0U A;  1B63 A;  1N32 I;  4X62 E;  1XMQ E;  4DV2 I;  2UU9 E;  1FI4 A;  2VF3 A;  4FWD A;  4LFA E;  4DV5 E;  4NXN E;  3B8H A;  3JAM C;  4DUZ I;  4PU9 A;  4JI3 I;  1ZM4 A;  2VQF I;  2UXC E;  4MYT A;  4GKJ I;  4LF8 I;  4YHH I; 
#chains in the Genus database with same CATH topology
 4BA1 B;  1Z5B A;  4GQU A;  2X36 A;  2NN6 D;  5JEA F;  4QNJ A;  1I94 E;  1PVG A;  5DRO A;  2BM1 A;  2J7K A;  1PKP A;  4MU1 A;  1FJG I;  1FJG E;  2PO0 A;  5LMN I;  4LFA I;  1Z0E A;  2C37 B;  3P3E A;  2PO0 B;  4FN5 A;  4FWG A;  1FWK A;  5A2Q C;  1QZR A;  1XMQ I;  3U1K A;  1BKN A;  2V34 A;  3PYD A;  1N0V C;  1OJ4 A;  2IER A;  1HNX E;  3QT7 A;  4DR2 E;  5DRQ A;  2JEA B;  1Y4S A;  2BR2 A;  5DRP A;  1MX0 A;  4JI7 I;  4DPX A;  2Q2E B;  2A2C A;  4DV3 I;  3ZZT A;  3ZM7 A;  4DV3 E;  1Z0T A;  4JI6 E;  3K17 A;  4MU3 A;  3JAM Q;  4UT4 A;  2F4V E;  3PYG A;  5ELW A;  3NZK A;  4FW7 A;  4IZK B;  5K36 B;  1A6F A;  2UXD I;  2DEJ A;  3KRN A;  2X7I A;  4R1F A;  5A2Q Q;  4I3H A;  4JI1 I;  3P3G A;  1J5E I;  3L7Z B;  2UUC E;  5C0X F;  2A2D A;  1WUU A;  4UTG A;  3K85 A;  1R6M A;  1NHH A;  3ZZ0 A;  1HNW I;  3PS2 A;  4U3B A;  2WNR B;  2O1U A;  4B3M E;  4GKK E;  1VI7 A;  2O1V A;  4NXM E;  2UXC I;  2NN6 A;  1EI1 A;  5DNL A;  2O3Z A;  1RHY A;  2UUA E;  4QNK A;  3T1H I;  2V2Z A;  4OX9 E;  1XNQ E;  3T1Y I;  3P76 A;  1B62 A;  4ED4 A;  1DAR A;  4LF6 E;  1N33 E;  5JEA C;  5JEA E;  1I94 I;  4PRX A;  2E5L E;  5IWA E;  4JI2 I;  3GME A;  1HNZ E;  1ZXN A;  5FWK A;  5DRR A;  4OO1 B;  3P06 A;  4WUD A;  3LPS A;  4IZJ D;  5JEA A;  3M85 D;  4KHP I;  2ZBK B;  4DPT A;  2GQ0 A;  2HHH I;  4DR4 I;  3Q6M A;  4LF7 E;  1YH8 A;  1ZM3 A;  5K36 E;  4MU0 A;  4B3R E;  1Z0G A;  3PYE A;  1J5E E;  2IES A;  2PNM A;  1HNZ I;  3J80 Q;  3H4L A;  2IOP A;  4X62 I;  3OTO I;  4FW3 A;  1K47 A;  4DV7 I;  5LMN E;  4DV0 E;  3PYF A;  4LFB E;  4LFC E;  1PIE A;  5EKW A;  4LFC I;  4DR4 E;  2UUA I;  4OO1 A;  5IT9 C;  4B3S E;  2HKJ A;  4LF8 E;  4GKK I;  3M85 G;  2R42 A;  4IFD C;  1Z59 A;  4B3T I;  2PO2 A;  4FW9 A;  5LMU E;  4LF6 I;  2JEA A;  2ZIT A;  4BA2 B;  4JI8 I;  2CGE A;  2JEB A;  1H7U A;  1XMO I;  4DR7 E;  4DR7 I;  4DV7 E;  3PS3 A;  2NN6 F;  4IZJ A;  5JEA D;  4JYA E;  4IS9 A;  5GME A;  5K36 F;  3HUL A;  4X66 I;  2HHH E;  4RPF A;  4FW6 A;  5C0X D;  2WW4 A;  1IBM I;  5K36 D;  4MU4 A;  4DR5 I;  5JEA B;  4PRV A;  4JYA I;  4OZE A;  4JI8 E;  2JEB B;  4N3O A;  2NN6 C;  4HY1 A;  4DR1 E;  4IZK A;  2BV3 A;  4FW5 A;  2DEI A;  4J3D A;  5GMD A;  3J80 C;  1H74 A;  1ZM9 A;  3QT8 A;  3WU4 A;  2OI2 A;  4P7A A;  4JI4 E;  1Z0C A;  2V2V A;  3K1J A;  1N36 I;  1HR0 I;  4LCH A;  4LPF A;  4ISA A;  2JE6 B;  4AQY E;  3GCM A;  5EL9 A;  2C39 A;  3B78 A;  1UDQ A;  4LFB I;  2BM0 A;  2Z5C B;  4DUY E;  1D6T A;  4DV1 E;  3UHM A;  1Y5Y A;  2IOQ A;  2PNZ B;  3J7A M;  1KVK A;  4USK A;  1RR9 A;  2E1R A;  5IWA I;  5K36 C;  1UDS A;  1S4E A;  1Z0V A;  4IZJ B;  4AID A;  1KTV A;  2HFS A;  4DV6 E;  1XMO E;  2UUB E;  4IFD F;  5K36 A;  5LMU I;  3ZKD A;  2Z5C A;  1MU5 A;  4HAC A;  1N32 E;  2C38 B;  2UXB I;  1UEK A;  4YHH E;  2BA1 G;  1E3H A;  4MDT A;  2BA0 D;  2JE6 A;  1FKA E;  2GO4 A;  1H7S A;  4YY3 I;  4B3M I;  4P52 A;  4DU8 A;  3LNU A;  4IFD A;  1R6L A;  2HK3 A;  1MG7 A;  4DPW A;  4LCF A;  4FWH A;  4DV0 I;  2AE8 A;  4OO1 C;  1P42 A;  5C0X B;  4LF9 E;  5C0X C;  2E5L I;  2HK2 A;  4JI2 E;  3OTO E;  2JT2 A;  4B3T E;  3Q6N A;  1OYS A;  1FNM A;  2C37 A;  3B82 A;  4DV1 I;  4DR3 I;  1IBK E;  4U3D A;  2F4V I;  4DUY I;  2F1D A;  3T1H E;  1N34 E;  1S16 A;  1Y4U A;  3M7N D;  4B3R I;  4DXL A;  4JG4 A;  2VQE I;  4JI6 I;  1RRE A;  3WU5 A;  3PRY A;  4HYM A;  4JI7 E;  4DUZ E;  2C39 B;  1H73 A;  3L7Z A;  4X64 I;  1EA6 A;  1Z5A A;  4JI1 E;  2Z5B B;  1HNX I;  4OO1 E;  2VQF E;  2GO3 A;  1H72 C;  1HK7 A;  1FWL A;  4X65 I;  2V8P A;  2XEX A;  4DR1 I;  5L3J A;  2HFU A;  4DU7 A;  1XNR I;  1N33 I;  4NXN I;  4LF9 I;  4LF5 I;  4Z7Y A;  1USV A;  3GLL A;  2Z5E A;  5IT9 Q;  4FW4 A;  4DR5 E;  5BR8 E;  2Z5B A;  4XTJ A;  4OKG A;  2EFG A;  3B4T A;  4X65 E;  2HKE A;  2O1T A;  2AJ4 A;  3HJC A;  4X64 E;  3QT6 A;  3F0N A;  4MYU A;  2O1W A;  2UXB E;  3QT5 A;  4Z7C A;  1HNW E;  3PS1 A;  4M1K A;  4KQV A;  4DPU A;  5C0X E;  4JI3 E;  4EMD A;  2V2Q A;  3LTO A;  1N34 I;  1USU A;  4LF5 E;  1NZ0 A;  4LCG A;  4DV5 I;  4IFD D;  3GON A;  4DR3 E;  1IBK I;  4ZVI A;  4USM A;  5LL6 R;  3ZKB A;  5C0X A;  2UU9 I;  1NHI A;  3J81 Q;  3D4J A;  4B3S I;  4OO1 F;  1ZM2 A;  2WP8 A;  4JI5 E;  1Z0B A;  3CWV A;  3M7N G;  4LF4 E;  2VQE E;  1IBM E;  3U1Y A;  2UUC I;  4AQY I;  4KHP E;  4JI0 E;  4IFD E;  4JV5 E;  4GKJ E;  2NN6 E;  1IBL I;  1Y60 A;  4AM3 A;  2CVE A;  1N36 E;  1HR0 E;  1YHC A;  3V5R A;  4NBQ A;  1Z0W A;  5FLX Q;  2UXD E;  2R3V A;  4MQY A;  4URL A;  1KKH A;  3CDJ A;  3V2U C;  4DV6 I;  3P3C A;  3T1Y E;  1U2R A;  1XNQ I;  1XXE A;  5DNX A;  4DV2 E;  2NN6 B;  4JI0 I;  1XNR E;  4JV5 I;  2PNZ A;  3WU3 A;  1Z5C A;  2WNR A;  4DV4 E;  1OYP A;  1NHJ A;  2PO1 A;  4YY3 E;  4NXM I;  4DR6 I;  4IFD B;  4K0K I;  1ELO A;  2ZM6 E;  3J81 C;  5BR8 I;  3J7A G;  4HXZ A;  3M6A A;  4X66 E;  1UDO A;  1KIJ A;  4JI5 I;  4OO1 D;  2GS8 A;  2WP8 B;  2UUB I;  4LOM A;  4HAC B;  2LJP A;  3WU6 A;  4OX9 I;  4DPY A;  3ZZU A;  4JI4 I;  2CZ9 A;  3Q1Q A;  4WUC A;  1VIS A;  5FLX C;  2NPF A;  4DR6 E;  1IBL E;  4WUB A;  2PNL A;  2PO1 B;  4LF7 I;  1OYR A;  2BR2 B;  4DV4 I;  2ZM6 I;  4K0K E;  1E3P A;  4LF4 I;  1ZXM A;  4DR2 I;  3DD6 A;  1XHK A;  2VES A;  1N0U A;  1B63 A;  1N32 I;  4X62 E;  1Y6Z A;  1XMQ E;  4DV2 I;  3H1C A;  2UU9 E;  1FI4 A;  2VF3 A;  4FWD A;  4LFA E;  4BA2 A;  2PO2 B;  4DV5 E;  4BA1 A;  4NXN E;  3B8H A;  3JAM C;  4DUZ I;  4PU9 A;  3HKM A;  4JI3 I;  2BA1 D;  1ZM4 A;  2BA0 G;  2VQF I;  2UXC E;  2CG9 A;  4MYT A;  1UDN A;  2J65 A;  3CDI A;  4AIM A;  4GKJ I;  4LF8 I;  4YHH I;  2C38 A; 
#chains in the Genus database with same CATH homology
 1Z5B A;  2X36 A;  1I94 E;  1PVG A;  2BM1 A;  2J7K A;  1PKP A;  1FJG I;  1FJG E;  5LMN I;  4LFA I;  1Z0E A;  4FN5 A;  4FWG A;  1FWK A;  5A2Q C;  1QZR A;  1XMQ I;  1BKN A;  2V34 A;  3PYD A;  1N0V C;  1OJ4 A;  1HNX E;  3QT7 A;  4DR2 E;  1Y4S A;  1MX0 A;  4JI7 I;  4DPX A;  2Q2E B;  2A2C A;  4DV3 I;  3ZZT A;  3ZM7 A;  4DV3 E;  1Z0T A;  4JI6 E;  3K17 A;  3JAM Q;  4UT4 A;  2F4V E;  3PYG A;  4IZK B;  1A6F A;  2UXD I;  2DEJ A;  2X7I A;  4R1F A;  5A2Q Q;  4I3H A;  4JI1 I;  1J5E I;  2UUC E;  2A2D A;  1WUU A;  4UTG A;  3K85 A;  1NHH A;  3ZZ0 A;  1HNW I;  2O1U A;  4B3M E;  4GKK E;  2O1V A;  4NXM E;  2UXC I;  1EI1 A;  2UUA E;  3T1H I;  2V2Z A;  4OX9 E;  1XNQ E;  3T1Y I;  1B62 A;  4ED4 A;  1DAR A;  4LF6 E;  1N33 E;  1I94 I;  4PRX A;  2E5L E;  5IWA E;  4JI2 I;  1HNZ E;  1ZXN A;  5FWK A;  3P06 A;  4WUD A;  3LPS A;  4IZJ D;  4KHP I;  2ZBK B;  4DPT A;  2HHH I;  2GQ0 A;  4DR4 I;  3Q6M A;  4LF7 E;  1ZM3 A;  4B3R E;  1Z0G A;  3PYE A;  1J5E E;  2PNM A;  1HNZ I;  3J80 Q;  3H4L A;  2IOP A;  4X62 I;  3OTO I;  1K47 A;  4DV7 I;  5LMN E;  4DV0 E;  3PYF A;  4LFB E;  4LFC E;  1PIE A;  4LFC I;  4DR4 E;  2UUA I;  5IT9 C;  4B3S E;  2HKJ A;  4LF8 E;  4GKK I;  2R42 A;  1Z59 A;  4B3T I;  4FW9 A;  5LMU E;  4LF6 I;  2ZIT A;  4JI8 I;  2CGE A;  4DR7 E;  1H7U A;  1XMO I;  4DR7 I;  4DV7 E;  4IZJ A;  4JYA E;  5GME A;  3HUL A;  4X66 I;  2HHH E;  4RPF A;  2WW4 A;  1IBM I;  4DR5 I;  4PRV A;  4JYA I;  4JI8 E;  4N3O A;  4HY1 A;  4DR1 E;  4IZK A;  2BV3 A;  2DEI A;  5GMD A;  3J80 C;  1H74 A;  1ZM9 A;  3QT8 A;  3WU4 A;  2OI2 A;  4P7A A;  4JI4 E;  1Z0C A;  2V2V A;  3K1J A;  1N36 I;  1HR0 I;  4AQY E;  3B78 A;  4LFB I;  2BM0 A;  2Z5C B;  4DUY E;  1D6T A;  4DV1 E;  2IOQ A;  3J7A M;  1KVK A;  4USK A;  1RR9 A;  2E1R A;  5IWA I;  1S4E A;  1Z0V A;  4IZJ B;  1KTV A;  2HFS A;  4DV6 E;  1XMO E;  2UUB E;  5LMU I;  3ZKD A;  2Z5C A;  1MU5 A;  4HAC A;  1N32 E;  2UXB I;  1UEK A;  4YHH E;  1FKA E;  1H7S A;  4YY3 I;  4B3M I;  4P52 A;  4DU8 A;  3LNU A;  2HK3 A;  1MG7 A;  4DPW A;  4FWH A;  4DV0 I;  4LF9 E;  2E5L I;  4JI2 E;  2HK2 A;  3OTO E;  4B3T E;  3Q6N A;  1FNM A;  3B82 A;  4DV1 I;  4DR3 I;  1IBK E;  2F4V I;  4DUY I;  3T1H E;  1N34 E;  1S16 A;  1Y4U A;  4B3R I;  4DXL A;  4JG4 A;  2VQE I;  4JI6 I;  1RRE A;  3WU5 A;  3PRY A;  4HYM A;  4JI7 E;  4DUZ E;  1H73 A;  4X64 I;  1EA6 A;  1Z5A A;  4JI1 E;  2Z5B B;  1HNX I;  2VQF E;  1H72 C;  1HK7 A;  1FWL A;  4X65 I;  2V8P A;  2XEX A;  4DR1 I;  5L3J A;  2HFU A;  4DU7 A;  1XNR I;  1N33 I;  4NXN I;  4LF9 I;  4LF5 I;  4Z7Y A;  1USV A;  2Z5E A;  5IT9 Q;  4DR5 E;  5BR8 E;  2Z5B A;  4XTJ A;  2EFG A;  4X65 E;  2HKE A;  2O1T A;  2AJ4 A;  3HJC A;  4X64 E;  3QT6 A;  3F0N A;  4MYU A;  2O1W A;  2UXB E;  3QT5 A;  4Z7C A;  1HNW E;  4M1K A;  4KQV A;  4DPU A;  4JI3 E;  4EMD A;  2V2Q A;  3LTO A;  1N34 I;  1USU A;  4LF5 E;  1NZ0 A;  4DV5 I;  3GON A;  4DR3 E;  1IBK I;  4ZVI A;  4USM A;  5LL6 R;  3ZKB A;  2UU9 I;  1NHI A;  3J81 Q;  3D4J A;  4B3S I;  1ZM2 A;  4JI5 E;  1Z0B A;  3CWV A;  4LF4 E;  2VQE E;  1IBM E;  2UUC I;  4AQY I;  4KHP E;  4JI0 E;  4JV5 E;  4GKJ E;  1IBL I;  1N36 E;  1HR0 E;  3V5R A;  1Z0W A;  5FLX Q;  2UXD E;  2R3V A;  4URL A;  1KKH A;  3V2U C;  4DV6 I;  3T1Y E;  1U2R A;  1XNQ I;  4DV2 E;  4JI0 I;  1XNR E;  4JV5 I;  3WU3 A;  1Z5C A;  4DV4 E;  1NHJ A;  4YY3 E;  4NXM I;  4DR6 I;  4K0K I;  1ELO A;  2ZM6 E;  3J81 C;  5BR8 I;  3J7A G;  4HXZ A;  3M6A A;  4X66 E;  1KIJ A;  4JI5 I;  2GS8 A;  2UUB I;  4HAC B;  2LJP A;  3WU6 A;  4OX9 I;  4DPY A;  3ZZU A;  4JI4 I;  2CZ9 A;  3Q1Q A;  4WUC A;  1VIS A;  5FLX C;  2NPF A;  4DR6 E;  1IBL E;  4WUB A;  2PNL A;  4LF7 I;  4DV4 I;  2ZM6 I;  4K0K E;  4LF4 I;  1ZXM A;  4DR2 I;  1XHK A;  1N0U A;  1B63 A;  1N32 I;  4X62 E;  1Y6Z A;  1XMQ E;  4DV2 I;  2UU9 E;  1FI4 A;  2VF3 A;  4FWD A;  4LFA E;  4DV5 E;  4NXN E;  3B8H A;  3JAM C;  4DUZ I;  4PU9 A;  4JI3 I;  1ZM4 A;  2VQF I;  2UXC E;  2CG9 A;  4MYT A;  4GKJ I;  4LF8 I;  4YHH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...