5LMNK

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
VKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmnK00
3JAMO 4X64K 4LF4K 1FJGK 1HNXK 2UUBK 4DUYK 4B3MK 4LF8K 4OX9K 1IBKK 4B3SK 4GKJK 4LFCK 1N34K 4DUZK 2UXCK 4DR6K 4DV2K 4DR1K 1N36K 2E5LK 5BR8K 3J7YP 1J5EK 4DR7K 3J81O 3J7AP 4K0KK 2VQFK 3J80O 4DV4K 4JI0K 4DV6K 4JI5K 2UXDK 4LF6K 4LF7K 2F4VK 4DR4K 4B3RK 1HNWK 4JI6K 4DV1K 2ZM6K 1N32K 2UXBK 2UU9K 2UUCK 4DR2K 4JI1K 4AQYK 4JI8K 4X62K 4DV0K 5FLXO 3OTOK 2VQEK 4LF5K 4KHPK 4YHHK 4JI3K 4DV5K 5A2QO 2UUAK 4JV5K 5AJ3K 1XMOK 1XNRK 4DR5K 5LMUK 4V19S 4LFBK 4NXNK 4NXMK 4YY3K 1IBMK 3T1YK 1HR0K 4X66K 4DV3K 5LL6Z 4CVNE 4CW7B 4JI4K 1HNZK 4JI7K 1IBLK 4B3TK 1XMQK 5IWAK 4LFAK 4X65K 4JYAK 4GKKK 1I94K 1XNQK 5IT9O 5LMNK 1N33K 4DR3K 4LF9K 4JI2K 4DV7K 3T1HK 2HHHK
chains in the Genus database with same CATH superfamily
4Y1DA 4JKGB 3S3MA 2GX9A 4E7IA 3VQ5A 4PKGA 2YNHA 3RWUA 4LSNA 1U47A 4DUYK 5FRNA 3C6AA 3MWTA 3S41A 3LZJA 3D45A 2HMIA 1EXQA 1RT4A 3TAMA 3LP1A 3VEYA 2YI1A 3CQ8A 3KWGA 1SL0A 4FK0A 1K73O 3O8MA 3FR0A 4CGFA 2UXCK 1ATSA 1BIZA 4CEAA 2NRRA 1O1WA 1C0FA 1VQPN 3C7NB 1OVQA 3RMBA 3C95A 2YNFA 4DFJA 4F2RA 4CHZA 1QS4A 4H5VA 1LWFA 4JI0K 2UXDK 3NGZA 3DRRA 3H1VX 4M42A 1QZ6A 3C6HA 5C24A 3H6EA 2HHWA 3MEEA 4WYBA 4DSIA 2GUPA 3LP2A 2ZM6K 1LW0A 3MAQA 2UXBK 4BC4A 1L3TA 3G6EN 1VQMN 1IKYA 3LP0A 3MDQA 5CZ1A 1S9GA 3D2EB 4CJQA 5M1KA 2ETJA 4DB3A 1BG3A 3HT3A 2HHXA 3OTOK 5FPDA 3AARA 4E19A 3WNFA 3C65A 4R5PA 4JKCA 1JCGA 1WB9A 4AM6A 4DV5K 3QIPA 1SKRA 1QZ5A 1N5YA 1JLGA 4K43A 5AJ3K 3JSMA 4RWTA 2Q1NA 3OYIA 4A2BA 1KQSM 4BRLA 3V9WA 4LY7A 5J2QA 3QFUA 3DLKA 4H0OA 3TARA 5JICA 3TTDA 4OPAA 1VQ9N 3KKRA 3VEZA 4H5NA 4ISFA 5HL7L 3OYGA 1YTAA 2YNGA 1G15A 4GY2B 3L6QA 3L2QA 4BC2A 1NK7A 2VWJA 4O55A 3OYLA 2ZGZA 2GTDA 1E4GT 2DFHA 3O4QA 1OH7A 2HHHK 4HUFA 3G4SN 2UUBK 1TKTA 1GOAA 1J5OA 4BDZA 4E7HA 3OVNA 1RT2A 4CIGA 1NGIA 1IH7A 5AR0A 1I3AA 4FZZA 3LALA 5KGWA 4RTFD 4QAGA 5KGXA 4CERA 3IRXA 4B08A 4FPAA 5T7BA 3E9PA 4FO0A 1VRUA 3SQ4A 3D2FA 2KTQA 3AVIA 4BDYA 2P1JA 4CJ3A 3HXMA 3SJJA 3MWPA 1C0GA 2F4VK 3CCVN 5KRTA 4JD2B 4A5BA 1UOCA 1EQYA 2RKIA 1TVRA 4DTSA 5HROA 4KH5A 4BR0A 4O8UA 3LPUA 3HTVA 3LDPA 5BPNA 1HNVA 1WSHA 1NK4A 2I7PA 5AQUA 1VQ7N 2D0BA 4DSKA 4CZFA 1GLAG 3M1FA 1X3NA 4BE2A 4CFBA 4QS7A 2XRIA 1TV6A 1DLOA 4CECA 4FJJA 4B3OA 1H1VA 4A59A 4PKIA 3O80A 1W0HA 3V4IA 4KTQA 1IV0A 4C8OA 3ZSXA 4BRAA 4DFKA 5CYMA 3HP6A 1IBMK 1VQLN 3CJ1A 2OPPA 1T7PA 3H1QA 4DLEA 1VQ4N 1NK6A 2I7NA 4XH1A 3OYCA 1B92A 2V7ZA 1FKPA 2RHKA 5AQNA 3DRSA 4FXDA 5H1SQ 4XEIA 4W5QA 4X65K 5AQFA 1NGDA 4PL8A 4OGEA 1NGFA 2IIRA 1S1TA 1DTTA 1JL1A 1JLCA 4WFAL 4WQ5A 3SI6A 2DTUA 3DOLA 2XHBA 2NRXA 3KTQA 4DTMA 4H0TB 3HSCA 4FK2A 4FW2A 1SZ2A 2QWLA 3SQ1A 1YXQA 4HHTA 5HLFA 1WUAA 2EHGA 1T03A 4H03B 5ADXA 2G8WA 2YKNA 3MXIA 1HQUA 4KB1A 3AO2A 2E5LK 3QLHA 2GWKA 4ILGB 1WSEA 3ASMA 4FVMA 4CJ5A 3THYA 3CPEA 1TUUA 4H5RA 5JVHL 1ZBSA 5HOOA 3BP8A 1X9WA 1BU6O 1S1VA 1YJ9N 4F8RA 2QM1A 5F0XA 1TYQB 3VEVA 4IO8A 2BE2A 1RT1A 3B6PA 3IMXA 2D1KA 1DTQA 3KLHA 1CLQA 1V4SA 3S3OA 5BRHA 1KVAA 3LDQA 2QI2A 4FZYA 3M5RA 1QHTA 2DPNA 1FW6A 3F5TA 2O8CB 1X9JA 1B9DA 1RDBA 3WT0A 4HTUA 3VQBA 3GDQA 4XH4A 4GV6A 4K25A 3IDHA 5AQVA 2W42A 4ELVA 1BL3A 4ZTFA 4DS5A 5JS2A 3CETA 1FXXA 3A5MC 2VG6A 3TANA 1XNRK 1GLLO 1BA0A 3JXUA 3IFRA 4OKKA 4CZGA 1T44A 4KV8A 5AZIA 3HPGA 3CJ7A 4I9QA 2LSNA 4YDUC 1VSFA 4K8ZA 1EKEA 3CIPA 5AQQA 4WF9L 4KRFA 2HW3A 5I42A 1TL3A 3CMEN 3MECA 3KLGA 4BACA 2E2NA 4CK1A 4OO1J 3K5NA 5ADXH 4GKKK 1BWFO 1VSJA 4FLVA 4CJPA 5LMNK 4M3XA 3NVMA 4Z94A 4KTWA 3R8EA 2E4LA 3SAHA 4FYDA 3PX6A 4JKGA 3VQPA 3ZX3A 4M3WA 1GOCA 3K9KA 1FK9A 2O8BA 4OPJA 5HRNA 3O3GA 4OVLA 4Z0UA 4DQQA 3ZSYA 2HHVA 1D8YA 4ILHA 2P9UA 3BEXA 4FPBA 1TAQA 3ZSZA 2QTDA 2HOEA 5KI6A 4BR2A 2HF3A 1LW2A 4HVJA 1KLNA 4K0KK 3EKUA 4NCBA 4DWIA 4E1JA 3KJVA 2AP1A 3PIPL 4BG8A 3CFPA 2OPSA 2O4IA 4L3QA 4CZHA 4OKJA 3LM9A 3FLCO 2YHYA 5FPEA 1U48A 3V81A 4JI6K 4DV1K 4FOIA 3ZT1A 4FWMA 3SUQA 2ZJQL 4JEPA 1HKBA 3ZCMA 1SUQA 3M6GA 5SZTA 4OKEA 2QK9A 4KHYA 2QW9A 1HJRA 1OH5A 1K6YA 1U4BA 3C0BA 3R9PA 3FZLA 4CEQA 4JI3K 3I0RA 3I8BA 4A62A 2HNDA 4B9SA 2NUBA 3JS6A 3MX5A 4F4KA 3AVJA 4E1MA 1NGAA 3DRPA 2WTUA 1KAZA 4NXMK 1F21A 3FFIA 3MCAB 4BGAA 3KKSA 4UQGA 3NGYA 3TSQA 1SKSA 2A41A 2ZD1A 3R3LA 5GAEP 4QOZB 2PZSA 3VQCA 3VF6A 1CZBA 4CGHA 3TAFA 1ASUA 1RBRA 3WXIA 5FRMA 2JWKA 3IAYA 3PX4A 1S1UA 2D4WA 4F3TA 4B8CA 4AHTA 1HKGA 1D4XA 2X6NA 4YFUA 1TKZA 4BGBA 2JWLA 1I94K 3EO3A 4EZ9A 4YOXA 2HHSA 4ID1A 4I7FA 4FK4A 3DOKA 4DF4A 4EP5A 4O44A 4C8MA 1GLBG 3CF5L 1RBVA 3WXKA 4CZJA 1YITN 4M3UA 3NFAA 2FXUA 4Z4IA 4RW7A 2YHWA 1NK8A 1U2VB 5CR4A 1RTJA 3VQ8A 4BREA 1WOQA 3GOIA 3UKRA 4DSFA 3KLIA 4DUZK 1VQ5N 3CD6N 4DR6K 3J7YP 3VF2A 3I56N 5AQKA 2VWKA 1WAJA 3EE8A 3KD5E 2Z1HA 1A5WA 3E66A 2KFNA 3ID8A 1CZ9A 1W9HA 2WOMA 4DLGA 4DKWA 2ZGYA 1LWCA 4BRGA 2GELA 3TU5A 4NCAA 1W97L 4CD3A 4FWRA 5AQLA 4J2BA 2P9LB 2F9TA 5AZIB 4JI8K 1KAXA 3VQ9A 1HUXA 3FGUA 4OGCA 2VQEK 4JLHA 1NGCA 3TSPA 4CHPA 4CBXA 3HOTA 1ATNA 3VF4A 4CBWA 5C12A 1YVUA 4IEEA 4BVOA 4OLAA 3U3GA 3MCPA 3ULDA 1XMOK 2O8FB 4NLBA 2G8VA 4DR5K 3P4IA 5B8HA 3GL1A 4E3SA 4LD0A 3F73A 1YJNN 3CERA 5M1FA 1U04A 4JK9A 2XY5A 3SYZA 1XC3A 3DXKB 1Q81O 4DTXA 3CC4N 5KQ8A 1NK0A 1T6DA 4IFEA 1LV5A 1GLJO 3L3UA 4JI7K 3VGMA 1Q8IA 4FWKA 2QWRA 2Q3SA 3RRGA 4CF8A 2FBTA 2FBYA 1XNQK 3CFRA 3SPYA 1BQMA 5TKWA 4B1UB 1L3UA 3ZETB 3EYZA 1UA0A 5HP1A 3DI6A 4PL7A 1C0UA 1NNEA 2O8BB 1HPZA 1NKEA 3OHRA 3OJSA 2I5JA 4BRHA 2JLEA 3QINA 4NYNA 1NG9A 4XIUA 4IG0A 1QQNA 3A5NC 3DM2A 4FM1A 4PQUA 4CIEA 3U3YA 4IKFA 4YOWA 3NCIA 4IJNA 4CJLA 1KVBA 2ASPA 2HNZA 3V9XA 4FOEA 4DR1K 1NBWA 3RTVA 3SBGA 4IG3A 1L5UA 3J81O 4FJLA 2IS3A 5JVGL 3DYAA 4IDKA 4WCEL 1HNIA 3PX0A 2Y1JA 3VEWA 4DU1A 3H46O 3K57A 2OPQA 3ID6A 5BPLA 1NKCA 4IFVA 4BY9C 4LF7K 4DR4K 3THWA 3V9UA 1NGHA 4AHUA 3FFKB 4BVPA 4A61A 3U6FA 2RF2A 1QTMA 3CCEN 1OVYA 2UU9K 1WNSA 1ATRA 2YCHA 3EKSA 1JCEA 1JL2A 1S1XA 2GWJA 2HBJA 4FLWA 3OBYA 2V51B 2OYQA 1QQMA 5AQSA 3OYBA 2PYJA 4HWIA 4IZ9A 3HOSA 4B9QA 2BUPA 3AVGA 3MEGA 3ZT0A 1TUYA 5KQDA 1KRPA 3ATUA 1LOTB 1M1KO 4NCGA 1HKCA 3WXMB 1Q7YO 3QESA 3IUCA 4ELUA 4ZHRA 3PUFA 1QSLA 4HUGA 3BF3A 2NRZA 2H3GX 4FJNA 3LDLA 5IWAK 2VG7A 4B9UA 2FF3B 2GUIA 1YI2N 3F2KA 3VTIA 4JI2K 1NJWA 5K14A 3OA9A 3OYDA 4AHSA 1TKXA 1C1BA 1D9DA 3VERA 3LAKA 3U8XA 3AO5A 3TTFA 4PUOA 1OH8A 4GKJK 4M63C 4DTOA 5CY4A 3P39A 4Z4FA 4FVUA 3HJFA 4MDBA 4LH4A 3AGRA 1YIJN 1RNHA 1NMDA 1J5EK 4DF8A 1Z26A 2OANA 4FLYA 3NF7A 3V9SA 2BGGA 3D6RA 2Y1IA 1LWEA 2WUSA 3I8DA 3VQ4A 5AFUA 4CI6A 5AQRA 3WEEB 4TSXA 4LF6K 4GV9A 3QFPA 1C6VA 1SQKA 2QA4N 4QS9A 2HSTA 3OS1A 3VQAA 5JLHA 3B8AX 2A40A 2O8EA 4W5OA 1TK0A 4B8AB 3OYFA 3VQ6A 1NWKA 2A5XA 2QEXN 4J2DA 4A5AA 1N8RO 1ASWA 4YHHK 2Q36A 4GW6A 2E8AA 4BRPA 3NHGA 1CXQA 2B6AA 4ICLA 3O08A 1VSHA 3RVCA 3MXJA 4HCBA 3O9SA 5F2RA 3EZ5A 2EX3A 3VA3A 3HM9A 3NDKA 3U9DA 2WONA 1HPMA 4IOCL 5LL6Z 2QKKA 3AVNA 1GLCG 4F2SA 1RT5A 2P9NB 3SLCA 3NGIA 1XMQK 5HBMA 1GLDG 3TTCA 1ZC6A 4KHNA 4KFBA 4LSLA 4MDAA 3HZ6A 4R79A 3DLGA 3RSEA 3OYJA 2OZSA 3HM8A 1K9MO 1NGGA 4JD2A 3CFOA 5AFUH 2ZJRL 4WQ4C 1S72N 1RDDA 1HNXK 2IAJA 2VCPA 3VA0A 4OX9K 2PBDA 5BRDA 1MA9B 3CJBA 2FLOA 3KK7A 4C1NI 4BRIA 3GE1A 1WBDA 3RSEB 2HVHA 3VETA 4AHCA 5EX5A 4Z4EA 4CJFA 2G8IA 4JS5A 4RG8A 5AQJA 4O0IA 2FSNA 1WSFA 2KQ2A 4OLBA 5CHIA 3IKMA 3J80O 4YNQA 3NVKA 1BO5O 4CE9A 3QNOA 4DU4A 1WSJA 1QHAA 1IG9A 4AF1A 4JAXA 1W7AA 4E1NA 1L3SA 5SWMA 1KFDA 1NGEA 3TAGA 4BRDA 5E41A 3RMDA 2V52B 3MK6A 3BGRA 1SKWA 1RGIA 1X3MA 3T3FA 4FWOA 5EY4A 4X62K 4GVMA 4JKFA 4CJEA 1IKXA 1NJZA 1JLBA 2X78A 3ISNC 3TPQA 5LY3A 4JRPA 1SL1A 1N6QA 3FZFA 1KTQA 1HQEA 1DEJA 3D2EA 3PO5A 1U45A 5BR9A 2X74A 4FL9A 3TSUA 3CM6A 1R59O 4DQPA 1JKHA 4IEIA 3KZBA 5EOYA 3K5LA 1YAGA 2HB5A 1I39A 2O4GA 4MO5A 1X1PA 3PIOL 2Z1IA 4X66K 4BE0A 1E3MA 4H0YB 5JMVA 3LP3A 3TR8A 4CK2A 3ENOA 2CH6A 5GAGP 3C94A 4IOXA 1LAWA 1MDUB 5AQZA 4CF1A 2YHXA 3PLAA 4I9LA 1VSMA 2NRTA 4NYFA 3M8QA 3T1HK 2XO7A 3KK3A 1Z25A 1E4FT 2YHBA 3RMAA 3CQYA 3L2WA 4FWPA 1J54A 3TAPA 3OYKA 1VQ8N 4B3SK 2P9IA 3CQXA 5BRFA 4CEBA 2OA8A 1XC9A 3MX2A 3ZSWA 3KHYA 3RMCA 3CJAA 1YJWN 4JKHA 4IO9L 3SUNA 1DGKN 4CGJA 1UA1A 4WQ4A 2KKZA 4CJRA 3VQ7A 1RBUA 4JK8A 4DS4A 1V4TA 1REVA 1S5JA 5AQXA 1HNWK 1VAZA 3DWLA 3LANA 1BUPA 4FJMA 2A1SA 2A42A 4KI6A 1MWMA 1MU2A 1IKWA 3THXB 4DR2K 1XI1A 2P9SA 4J2EA 3CI5A 1RILA 1BI4B 4CEEA 3LDSA 3HYFA 4DFPA 4FJKA 1Z05A 4H4OA 5AQMA 3FE1A 4E0DA 3THXA 4CHNA 3H08A 4FJ7A 2ASOA 1KD1O 4H4MA 4CK3A 1T6CA 2VYPA 4FWQA 3ZSVA 1KXPA 4JK7A 2RE2A 3HL8A 3QIOA 4NXNK 3BZCA 2VG5A 4RW8A 3CJCA 3VOVA 4YY3K 3ATVA 4M7YA 4CVNE 5EU7A 3H3OB 4JI4K 1HNZK 2WFBA 2NNWA 4B9MA 3DLBA 2FSJA 3HK2A 4L8RB 3DLHA 1ZXOA 2Z1GA 2RN2A 3O9QA 4FJGA 1Q82O 3AVCA 1YUWA 5AQOA 1IKVA 4DV7K 3VEXA 1T8EA 3HRGA 4MFBA 3OYHA 2UYTA 2P9KB 3L2UA 2YX6A 5M1OA 4O5BA 1TK8A 3K59A 3O5BA 3QEXA 3EY1A 3ZETA 5I3UA 3IG1A 2NRVA 1U2VA 3QEWA 3ZT3A 1J6ZA 4Q5VA 4B9VA 5JS1A 2P9NA 3WNGA 1RDCA 5BR8K 3HPOA 3SZ2A 2P5OA 2CGLA 3A2FA 3A8YA 4FJ8A 2KZMA 3P5JA 2VQFK 3CPWM 4FJ5A 5J2NA 1NJIO 1MWKA 4H8KA 4G1QA 3MEDA 4JHDB 3QNNA 3H3NO 4DQSA 1K8KA 3LL3A 4QS8A 1T05A 5I9EB 4CEFA 2R7YA 3ULEB 3L4IA 4KPYA 3NH2A 3KWIA 1C0TA 3O6WA 4W5NA 3QO9A 3ZT4A 3EEQA 3M8SA 4JKDA 5AQHA 1JLQA 2AA4A 2BTFA 4FLZA 1XUPO 1VHXA 3MXMA 3O3FA 3WXJA 1KFSA 4FWLA 3NE6A 3OJUA 3PY8A 4I6MA 4CHQA 3NF8A 2NRWA 5LMUK 3S9HA 2IVPA 4CESA 1B9FA 3ZEUB 2WC9A 2DY4A 4IWVA 4CIFA 2FSKA 4H0VB 3D0PA 1VSDA 3R6MA 3HVRA 4W5RA 2QWMA 5M1PA 1Q9XA 4W5TA 2P9UB 4NB4A 4B1ZA 4PA1A 3A5LC 2YJFA 4OPKA 3GBTA 4B1YB 1ZYQA 3VTHA 3VESA 5LJWA 3E9OA 5GAHP 1YHQN 4EZ6A 4BR5A 1RBTA 1NGBA 2KFZA 3KVGA 3V6DA 3TI0A 3BDPA 4MO4A 4O0JA 4CGIA 1XHXA 2ASMA 4JKBA 5C42A 3SK3A 1NJXA 4KHWA 4AHVA 3ZSQA 4DFMA 3E9LA 4CZIA 2QXFA 1VSIA 2E1YA 4H0PA 4IFYA 3CG7A 4MQ3A 3OS0A 1VSKA 2W6LA 3L8BA 1RCHA 3VN5A 4BC5A 4EAHD 3SUPA 1NOYA 4DV4K 3SV4A 2WBNA 2A3ZA 3AVBA 1R0AA 3SMSA 3N4PA 1KAYA 5C2DA 3QEIA 4WE1A 3HI0A 1JXBA 4WFNL 1D5AA 1S3XA 1N32K 5AQYA 1DT9A 1GLEG 4IBNA 3V1OA 2UUCK 4Y1CA 1RFQA 2YHAA 1NKBA 3FZMA 4BRQA 1ITGA 1BI4A 3O1WA 4PWDA 3W0LA 2BANA 4CZMA 4ISEA 5BREA 1S6QA 5FLXO 2PAVA 2NZTA 4E7KA 1JLFA 3QEVA 1KC8O 4N47A 3K2PA 3ZYYX 2ZF5O 4WFBL 4YOVA 1NOZA 2P5GA 4DG1A 3ZLJA 3WUHA 5FROA 4KH4A 3CYMA 3THWB 1LAVA 2NRHA 3CCJN 3P31A 4KHQA 2IOCA 3W3DA 2E6LA 3T1YK 1ESVA 1RT6A 3MN7A 4DTUA 3OS2A 3BY5A 3C6TA 1G99A 4NLCA 4CFDA 5GADP 2P9PA 1IBLK 3C7NA 1DKGD 1HLUA 1UWBA 5AZJA 3DXMA 3QETA 2KHOA 5JLFA 4Z4CA 3CC2N 1N33K 3CM5A 3T69A 4C8KA 5ELZA 4B9NA 4X64K 2E1ZA 3AAQA 2ZE2A 4M3ZA 1NM1A 1RTHA 3VGKA 1JLAA 2A6AA 3SQ0A 2PFUA 2AJQA 1Y64A 4PHTX 4CBUA 2KZZA 1HX1A 3QMLA 2EWSA 1N34K 3PV8A 2O8DA 3O4WA 1RT3A 1NJYA 3PSIA 1N36K 3LZIA 3AA3A 4C8NA 3P38A 4DSEA 4K41A 2W6KA 5GIPA 1ZBUA 3HP9A 1OH6A 3K9JA 1QQCA 4Q0BA 1JXEA 1XQSC 4DQRA 4LC9B 5AQPA 2IVOA 4BQLA 3Q7BA 5FPMA 4EHUA 5HRPA 3AO1A 1L3VA 3DLLL 3UKUB 3G71N 2F8TA 3LWMA 4C23A 3CCLN 3DLEA 3SQ2A 1U6ZA 4BWMA 2F8SA 5E84A 3ITHA 3T7ZA 3QEPA 4CJSA 4CFAA 4E7JA 3BUZB 2GBZA 3D7EO 4Z4HA 3E1YA 4BR9A 2OTJN 3QERA 3JYTA 3H45C 1HYSA 1NLVA 4B1WB 1C1AA 1NGJA 4DQ8A 4GV3A 4KHUA 3WNHA 4G9ZA 4BROA 4CFCA 1TAUA 4DTPA 3AO3A 5DK5A 4QCLA 1ZBLA 1HR0K 2F7TA 4PY5A 3SAFA 4JKEA 1S9EA 1A5XA 1KCFA 3NAEA 1ASVA 4BRNA 3QBXA 1QSSA 2IGIA 3EN9A 1VQNN 4XH5A 3L4QA 1KSPA 2IVNA 3PO4A 5IT9O 2E2QA 2E2OA 1UAXA 4H0XB 2Q0UA 5KPTA 4MLEA 1QE1A 1YTUA 1SAZA 4H5WA 3WEEA 3SV3A 4CF2A 4B3MK 3CCRN 5KPZA 4FLUA 3LPTA 1EP4A 1VSEA 1J53A 1U49A 3AVMA 4C8LA 1BISA 4DR7K 1VK0A 2HBLA 1Q18A 1P8ZA 3K5MA 3VEOA 5J2MA 3N4QA 2RPIA 4BG9A 2YKMA 3O4NA 4CZKA 2CGKA 1WBBA 3QBWA 4IJAA 4YOUA 2OZMA 4CJKA 1TGOA 2XY7A 2DFFA 1EWRA 3BF1A 1NK9A 1GOBA 3ZX0A 1XWLA 4CJTA 2E6MA 2Q0RA 2O8FA 5KPRA 3WQUA 3CC7N 4CHOA 4JI1K 4FJIA 1CZAN 4FJXA 3F9MA 4DHYA 4OJRA 1ZBFA 3M8RA 4DQIA 4Y0WA 4KHSA 1FKOA 5LJVA 1HJOA 2DFEA 3AVHA 3KK1A 5M1QA 4FWSA 1Y97A 2HNYA 1NK5A 4RW4A 1EO1A 2GEMA 2P9LA 1JLEA 2W41A 1RDUA 1IG8A 4CEDA 1NMNA 5FDLA 3AGKA 2OPRA 4HCCA 1BIUA 3KIOA 3HO1A 4B9LA 3VENA 4GNIA 1GLFO 4ZTJA 2NLXA 2B4JA 5C2FA 2YJEA 4NO7A 2ZQBA 4E7LA 4ELTA 4CD1A 2G8HA 3SMPA 4BWJA 3CCMN 3ZT2A 4KB0A 4EFHA 3FZHA 4CW7B 3D2FB 4CGGA 4IDHA 4YDUA 1K8AO 2F9WA 1RTIA 1RTDA 4KTZA 3CMAN 4B3TK 5C0YA 4F3OA 4O8KA 3LDOA 4LFAK 1EETA 2Z1JA 3SUOA 1EX4A 1VSLA 4DU3A 4CEZA 2B5JA 1RDWX 2VWBA 3G25A 4OPHA 3LWLA 3O9RA 4DR3K 1QVGM 4U7BA 3QICA 3JAMO 3G10A 1TYQA 1FJGK 1VQ6N 3ENBA 4FCYA 2QXLA 4DSJA 5HRRA 1SV5A 2CGJA 2GV9A 4CEOA 3K58A 3V9ZA 3EZWA 2BH1A 4FJ9A 1IBKK 3ZSOA 4CCHA 1A5VA 1BGXT 1RT7A 5BPMA 3NF6A 2XY6A 4LFCK 2HVIA 1QVFM 5M1NA 3SPZA 1S1WA 1YF5L 2W40A 2O8DB 4IOAL 2ITMA 4JRQA 3J7AP 3EL2A 4AH9A 1KLMA 1J9AA 4FM0A 5J1EA 1W2BM 4AHRA 3K5OA 1VQKN 3OW2M 3OBWA 5AQIA 4CJ7A 2HHQA 3TABA 2YV0X 4N41A 2FF6A 3VGLA 3RR7A 5DMRA 4B3RK 4RCHA 3HVTA 3OYMA 3NH0A 3UIQA 3TAEA 1ILYA 3CHWA 3Q7CA 4F9OA 4O5FA 4E89A 3DXMB 1BA1A 1WLJA 1BCOA 5BN9A 2G8KA 5HRSA 2P9PB 2O8CA 2J4RA 3ZEUA 4DTRA 1BCMA 3VPZA 4LF5K 1C0MA 4N56A 1Q9YA 4J8FA 3I55N 3DXKA 1WSGA 1IJJA 3DAWA 4I2QA 4M3RA 3OYAA 4KH6A 1RBSA 1HRHA 3U4LA 1HYVA 4IXCA 3ZX2A 5C10A 4PKHA 4K8XA 4EP4A 3CXCM 1M90O 3TWHA 4V19S 2OTLN 5AQTA 3RRHA 4CJVA 3HPHA 4I2PA 4YORA 2QKBA 3A0IX 3THYB 1SS6A 4O4GA 4Z4GA 3M8PA 3B6OA 4FW1A 4H5TA 2PY5A 3F9KA 3WNEA 3ZSRA 4A57A 3CCSN 2P9IB 2V7YA 4BDPA 2JGUA 5EVZA 4UY8O 5MLCQ 1P90A 1S6PA 3NMUA 3KD1E 4DTNA 3NF9A 3AAPA 3BZKA 3SAGA 5DM6L 3WQTA 3AVFA 2IDOA 3DLRA 2HBKA 1Z6RA 4YOYA 4KO0A 3OYNA 2FBXA 3S3NA 3THVA 1BHLA 3L3VA 2CH5A 1WAFA 3L2VA 3ENHA 4DV2K 3SCXA 3UKRB 1TL1A 5EXWA 1QSYA 5AQGA 3AA4A 3WXLA 4CZEA 3QDKA 5E26A 1LCUA 4FJHA 3L2RA 3VQDA 1Q86O 1WN7A 1S22A 4DV6K 2P51A 1WSIA 4HUEA 3LM2A 4JI5K 3AV9A 2QWOA 1BQNA 3GG4A 1HYZA 5C15A 1ZBIA 4BR4A 4EIAA 4FM2A 2FC0A 3I33A 3ALYA 3E01A 3O3HA 3LDNA 3OYEA 3HBTA 3T1AA 4DTJA 3AA5X 1JCFA 4B1VA 3DMJA 3MN9A 3QB0A 4RW6A 3UB5A 2HHTA 4B9TA 3V1RA 4AM7A 4KBOA 5AQWA 3VQEA 4BC3A 1BDGA 4KHPK 2A1RA 3SNNA 4BRFA 4YOTA 3P1GA 3AY9A 4BRKA 4N76A 3UE5A 4C1NK 5FPNA 4N5SA 5GINA 2G8FA 3J7ZO 1T3VA 5J2PA 3P83D 2Q97A 4JKAA 3R1XA 4FLTA 1NU0A 3AVLA 2G8UA 1O13A 4BE1A 3ULEA 4I6MB 5GIOA 2OCEA 1HMVA 1K8KB 2P9SB 1JJ2M 4JS4A 5CE3A 4A2AA 4ISGA 4HTLA 2QWNA 1YVNA 4J2AA 3J8AA 1XHZA 1C1CA 4JN4A 3CCQN 3AVKA 2IC3A 5D3GA 3UKUA 3FZKA 2VGMA 3NH1A 4KREA 4BRCA 1EWQA 2HHUA 3OY9A 5CYQA 3NBPA 4DCHA 2D5RA 1KVCA 1ZBHA 4JYAK 3EE9A 4LF4K 4CHYA 4K42A 5C25A 3T19A 4JHDA 3VQQA 2P9KA 3U9ZA 4LF8K 1IO2A 4ILJA 5CZ2A 1X9SA 4AILC 1X9MA 1CXUA 3O9TA 5BN8A 4WQ5C 3V1QA 3KLFA 5KRSA 3I0SA 4CF9A 5KTQA 1BOTO 4CJWA 4BRMA 4BQZA 3AA2A 1VRTA 5F1XA 2HMPA 1TKDA 3G0ZA 4LH5A 4RW9A 2PYLA 4M3YA 1D9FA 5AZJB 2ATQA 1SL2A 2E88A 4U67L 3KK2A 3LAMA 3SBTA 3C6UA 2F96A 4GMJB 3RR8A 3CJ9A 4FLXA 3KLEA 3DJCA 2E2PA 4DSLA 4CF0A 2D0AA 4AQYK 4ID5A 2ZWHA 1TK5A 2KLAA 2BDPA 3IS9A 2YNIA 4DV0K 2O8EB 3A5OC 4B1XB 3SJHA 2QWQA 5A2QO 3L0QA 4KI4A 2UUAK 2XY8A 2D0OA 4FWNA 4JV5K 4CJ4A 3TAQA 4FSVA 4JNEA 4MLHA 2Q2RA 4LFBK 4M41A 1QQOA 1OKJA 4EHTA 4KAZA 4M45A 2D0CA 4BR7A 2D0PA 4CGDA 3CCUN 4DV3K 2VGNA 4CZLA 2E20A 2ZJPL 2X6SA 3AVAA 3HSTB 2KW4A 3MN6A 4GVEA 3M3ZA 2Q31A 5DM7L 2HF4A 4CJUA 4FZXC 4M7XA 1YT3A 3MN5A 4DMNA 4KKOA 3MMVA 2ITGA 3AO4A 2FBVA 2HBMA 5TKYA 3PSFA 3VMFB 2QWPA 4M3TA 3O9UA 3O1BA 1VQON 1RDAA 4LF9K 3K0SA
chains in the Genus database with same CATH topology
3JAMO 4X64K 4LF4K 1FJGK 1HNXK 2UUBK 4DUYK 4B3MK 4LF8K 4OX9K 1IBKK 4B3SK 4GKJK 4LFCK 1N34K 4DUZK 2UXCK 4DR6K 4DV2K 4DR1K 1N36K 2E5LK 5BR8K 3J7YP 1J5EK 4DR7K 3J81O 3J7AP 4K0KK 2VQFK 3J80O 4DV4K 4JI0K 4DV6K 4JI5K 2UXDK 4LF6K 4LF7K 2F4VK 4DR4K 4B3RK 1HNWK 4JI6K 4DV1K 2ZM6K 1N32K 2UXBK 2UU9K 2UUCK 4DR2K 4JI1K 4AQYK 4JI8K 4X62K 4DV0K 5FLXO 3OTOK 2VQEK 4LF5K 4KHPK 4YHHK 4JI3K 4DV5K 5A2QO 2UUAK 4JV5K 5AJ3K 1XMOK 1XNRK 4DR5K 5LMUK 4V19S 4LFBK 4NXNK 4NXMK 4YY3K 1IBMK 3T1YK 1HR0K 4X66K 4DV3K 5LL6Z 4CVNE 4CW7B 4JI4K 1HNZK 4JI7K 1IBLK 4B3TK 1XMQK 5IWAK 4LFAK 4X65K 4JYAK 4GKKK 1I94K 1XNQK 5IT9O 5LMNK 1N33K 4DR3K 4LF9K 4JI2K 4DV7K 3T1HK 2HHHK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM O;  4X64 K;  4LF4 K;  1FJG K;  1HNX K;  2UUB K;  4DUY K;  4B3M K;  4LF8 K;  4OX9 K;  1IBK K;  4B3S K;  4GKJ K;  4LFC K;  1N34 K;  4DUZ K;  2UXC K;  4DR6 K;  4DV2 K;  4DR1 K;  1N36 K;  2E5L K;  5BR8 K;  3J7Y P;  1J5E K;  4DR7 K;  3J81 O;  3J7A P;  4K0K K;  2VQF K;  3J80 O;  4DV4 K;  4JI0 K;  4DV6 K;  4JI5 K;  2UXD K;  4LF6 K;  4LF7 K;  2F4V K;  4DR4 K;  4B3R K;  1HNW K;  4JI6 K;  4DV1 K;  2ZM6 K;  1N32 K;  2UXB K;  2UU9 K;  2UUC K;  4DR2 K;  4JI1 K;  4AQY K;  4JI8 K;  4X62 K;  4DV0 K;  5FLX O;  3OTO K;  2VQE K;  4LF5 K;  4KHP K;  4YHH K;  4JI3 K;  4DV5 K;  5A2Q O;  2UUA K;  4JV5 K;  5AJ3 K;  1XMO K;  1XNR K;  4DR5 K;  5LMU K;  4V19 S;  4LFB K;  4NXN K;  4NXM K;  4YY3 K;  1IBM K;  3T1Y K;  1HR0 K;  4X66 K;  4DV3 K;  5LL6 Z;  4CVN E;  4CW7 B;  4JI4 K;  1HNZ K;  4JI7 K;  1IBL K;  4B3T K;  1XMQ K;  5IWA K;  4LFA K;  4X65 K;  4JYA K;  4GKK K;  1I94 K;  1XNQ K;  5IT9 O;  5LMN K;  1N33 K;  4DR3 K;  4LF9 K;  4JI2 K;  4DV7 K;  3T1H K;  2HHH K; 
#chains in the Genus database with same CATH topology
 4Y1D A;  4JKG B;  3S3M A;  2GX9 A;  4E7I A;  3VQ5 A;  4PKG A;  2YNH A;  3RWU A;  4LSN A;  1U47 A;  4DUY K;  5FRN A;  3C6A A;  3MWT A;  3S41 A;  3LZJ A;  3D45 A;  2HMI A;  1EXQ A;  1RT4 A;  3TAM A;  3LP1 A;  3VEY A;  2YI1 A;  3CQ8 A;  3KWG A;  1SL0 A;  4FK0 A;  1K73 O;  3O8M A;  3FR0 A;  4CGF A;  2UXC K;  1ATS A;  1BIZ A;  4CEA A;  2NRR A;  1O1W A;  1C0F A;  1VQP N;  3C7N B;  1OVQ A;  3RMB A;  3C95 A;  2YNF A;  4DFJ A;  4F2R A;  4CHZ A;  1QS4 A;  4H5V A;  1LWF A;  4JI0 K;  2UXD K;  3NGZ A;  3DRR A;  3H1V X;  4M42 A;  1QZ6 A;  3C6H A;  5C24 A;  3H6E A;  2HHW A;  3MEE A;  4WYB A;  4DSI A;  2GUP A;  3LP2 A;  2ZM6 K;  1LW0 A;  3MAQ A;  2UXB K;  4BC4 A;  1L3T A;  3G6E N;  1VQM N;  1IKY A;  3LP0 A;  3MDQ A;  5CZ1 A;  1S9G A;  3D2E B;  4CJQ A;  5M1K A;  2ETJ A;  4DB3 A;  1BG3 A;  3HT3 A;  2HHX A;  3OTO K;  5FPD A;  3AAR A;  4E19 A;  3WNF A;  3C65 A;  4R5P A;  4JKC A;  1JCG A;  1WB9 A;  4AM6 A;  4DV5 K;  3QIP A;  1SKR A;  1QZ5 A;  1N5Y A;  1JLG A;  4K43 A;  5AJ3 K;  3JSM A;  4RWT A;  2Q1N A;  3OYI A;  4A2B A;  1KQS M;  4BRL A;  3V9W A;  4LY7 A;  5J2Q A;  3QFU A;  3DLK A;  4H0O A;  3TAR A;  5JIC A;  3TTD A;  4OPA A;  1VQ9 N;  3KKR A;  3VEZ A;  4H5N A;  4ISF A;  5HL7 L;  3OYG A;  1YTA A;  2YNG A;  1G15 A;  4GY2 B;  3L6Q A;  3L2Q A;  4BC2 A;  1NK7 A;  2VWJ A;  4O55 A;  3OYL A;  2ZGZ A;  2GTD A;  1E4G T;  2DFH A;  3O4Q A;  1OH7 A;  2HHH K;  4HUF A;  3G4S N;  2UUB K;  1TKT A;  1GOA A;  1J5O A;  4BDZ A;  4E7H A;  3OVN A;  1RT2 A;  4CIG A;  1NGI A;  1IH7 A;  5AR0 A;  1I3A A;  4FZZ A;  3LAL A;  5KGW A;  4RTF D;  4QAG A;  5KGX A;  4CER A;  3IRX A;  4B08 A;  4FPA A;  5T7B A;  3E9P A;  4FO0 A;  1VRU A;  3SQ4 A;  3D2F A;  2KTQ A;  3AVI A;  4BDY A;  2P1J A;  4CJ3 A;  3HXM A;  3SJJ A;  3MWP A;  1C0G A;  2F4V K;  3CCV N;  5KRT A;  4JD2 B;  4A5B A;  1UOC A;  1EQY A;  2RKI A;  1TVR A;  4DTS A;  5HRO A;  4KH5 A;  4BR0 A;  4O8U A;  3LPU A;  3HTV A;  3LDP A;  5BPN A;  1HNV A;  1WSH A;  1NK4 A;  2I7P A;  5AQU A;  1VQ7 N;  2D0B A;  4DSK A;  4CZF A;  1GLA G;  3M1F A;  1X3N A;  4BE2 A;  4CFB A;  4QS7 A;  2XRI A;  1TV6 A;  1DLO A;  4CEC A;  4FJJ A;  4B3O A;  1H1V A;  4A59 A;  4PKI A;  3O80 A;  1W0H A;  3V4I A;  4KTQ A;  1IV0 A;  4C8O A;  3ZSX A;  4BRA A;  4DFK A;  5CYM A;  3HP6 A;  1IBM K;  1VQL N;  3CJ1 A;  2OPP A;  1T7P A;  3H1Q A;  4DLE A;  1VQ4 N;  1NK6 A;  2I7N A;  4XH1 A;  3OYC A;  1B92 A;  2V7Z A;  1FKP A;  2RHK A;  5AQN A;  3DRS A;  4FXD A;  5H1S Q;  4XEI A;  4W5Q A;  4X65 K;  5AQF A;  1NGD A;  4PL8 A;  4OGE A;  1NGF A;  2IIR A;  1S1T A;  1DTT A;  1JL1 A;  1JLC A;  4WFA L;  4WQ5 A;  3SI6 A;  2DTU A;  3DOL A;  2XHB A;  2NRX A;  3KTQ A;  4DTM A;  4H0T B;  3HSC A;  4FK2 A;  4FW2 A;  1SZ2 A;  2QWL A;  3SQ1 A;  1YXQ A;  4HHT A;  5HLF A;  1WUA A;  2EHG A;  1T03 A;  4H03 B;  5ADX A;  2G8W A;  2YKN A;  3MXI A;  1HQU A;  4KB1 A;  3AO2 A;  2E5L K;  3QLH A;  2GWK A;  4ILG B;  1WSE A;  3ASM A;  4FVM A;  4CJ5 A;  3THY A;  3CPE A;  1TUU A;  4H5R A;  5JVH L;  1ZBS A;  5HOO A;  3BP8 A;  1X9W A;  1BU6 O;  1S1V A;  1YJ9 N;  4F8R A;  2QM1 A;  5F0X A;  1TYQ B;  3VEV A;  4IO8 A;  2BE2 A;  1RT1 A;  3B6P A;  3IMX A;  2D1K A;  1DTQ A;  3KLH A;  1CLQ A;  1V4S A;  3S3O A;  5BRH A;  1KVA A;  3LDQ A;  2QI2 A;  4FZY A;  3M5R A;  1QHT A;  2DPN A;  1FW6 A;  3F5T A;  2O8C B;  1X9J A;  1B9D A;  1RDB A;  3WT0 A;  4HTU A;  3VQB A;  3GDQ A;  4XH4 A;  4GV6 A;  4K25 A;  3IDH A;  5AQV A;  2W42 A;  4ELV A;  1BL3 A;  4ZTF A;  4DS5 A;  5JS2 A;  3CET A;  1FXX A;  3A5M C;  2VG6 A;  3TAN A;  1XNR K;  1GLL O;  1BA0 A;  3JXU A;  3IFR A;  4OKK A;  4CZG A;  1T44 A;  4KV8 A;  5AZI A;  3HPG A;  3CJ7 A;  4I9Q A;  2LSN A;  4YDU C;  1VSF A;  4K8Z A;  1EKE A;  3CIP A;  5AQQ A;  4WF9 L;  4KRF A;  2HW3 A;  5I42 A;  1TL3 A;  3CME N;  3MEC A;  3KLG A;  4BAC A;  2E2N A;  4CK1 A;  4OO1 J;  3K5N A;  5ADX H;  4GKK K;  1BWF O;  1VSJ A;  4FLV A;  4CJP A;  5LMN K;  4M3X A;  3NVM A;  4Z94 A;  4KTW A;  3R8E A;  2E4L A;  3SAH A;  4FYD A;  3PX6 A;  4JKG A;  3VQP A;  3ZX3 A;  4M3W A;  1GOC A;  3K9K A;  1FK9 A;  2O8B A;  4OPJ A;  5HRN A;  3O3G A;  4OVL A;  4Z0U A;  4DQQ A;  3ZSY A;  2HHV A;  1D8Y A;  4ILH A;  2P9U A;  3BEX A;  4FPB A;  1TAQ A;  3ZSZ A;  2QTD A;  2HOE A;  5KI6 A;  4BR2 A;  2HF3 A;  1LW2 A;  4HVJ A;  1KLN A;  4K0K K;  3EKU A;  4NCB A;  4DWI A;  4E1J A;  3KJV A;  2AP1 A;  3PIP L;  4BG8 A;  3CFP A;  2OPS A;  2O4I A;  4L3Q A;  4CZH A;  4OKJ A;  3LM9 A;  3FLC O;  2YHY A;  5FPE A;  1U48 A;  3V81 A;  4JI6 K;  4DV1 K;  4FOI A;  3ZT1 A;  4FWM A;  3SUQ A;  2ZJQ L;  4JEP A;  1HKB A;  3ZCM A;  1SUQ A;  3M6G A;  5SZT A;  4OKE A;  2QK9 A;  4KHY A;  2QW9 A;  1HJR A;  1OH5 A;  1K6Y A;  1U4B A;  3C0B A;  3R9P A;  3FZL A;  4CEQ A;  4JI3 K;  3I0R A;  3I8B A;  4A62 A;  2HND A;  4B9S A;  2NUB A;  3JS6 A;  3MX5 A;  4F4K A;  3AVJ A;  4E1M A;  1NGA A;  3DRP A;  2WTU A;  1KAZ A;  4NXM K;  1F21 A;  3FFI A;  3MCA B;  4BGA A;  3KKS A;  4UQG A;  3NGY A;  3TSQ A;  1SKS A;  2A41 A;  2ZD1 A;  3R3L A;  5GAE P;  4QOZ B;  2PZS A;  3VQC A;  3VF6 A;  1CZB A;  4CGH A;  3TAF A;  1ASU A;  1RBR A;  3WXI A;  5FRM A;  2JWK A;  3IAY A;  3PX4 A;  1S1U A;  2D4W A;  4F3T A;  4B8C A;  4AHT A;  1HKG A;  1D4X A;  2X6N A;  4YFU A;  1TKZ A;  4BGB A;  2JWL A;  1I94 K;  3EO3 A;  4EZ9 A;  4YOX A;  2HHS A;  4ID1 A;  4I7F A;  4FK4 A;  3DOK A;  4DF4 A;  4EP5 A;  4O44 A;  4C8M A;  1GLB G;  3CF5 L;  1RBV A;  3WXK A;  4CZJ A;  1YIT N;  4M3U A;  3NFA A;  2FXU A;  4Z4I A;  4RW7 A;  2YHW A;  1NK8 A;  1U2V B;  5CR4 A;  1RTJ A;  3VQ8 A;  4BRE A;  1WOQ A;  3GOI A;  3UKR A;  4DSF A;  3KLI A;  4DUZ K;  1VQ5 N;  3CD6 N;  4DR6 K;  3J7Y P;  3VF2 A;  3I56 N;  5AQK A;  2VWK A;  1WAJ A;  3EE8 A;  3KD5 E;  2Z1H A;  1A5W A;  3E66 A;  2KFN A;  3ID8 A;  1CZ9 A;  1W9H A;  2WOM A;  4DLG A;  4DKW A;  2ZGY A;  1LWC A;  4BRG A;  2GEL A;  3TU5 A;  4NCA A;  1W97 L;  4CD3 A;  4FWR A;  5AQL A;  4J2B A;  2P9L B;  2F9T A;  5AZI B;  4JI8 K;  1KAX A;  3VQ9 A;  1HUX A;  3FGU A;  4OGC A;  2VQE K;  4JLH A;  1NGC A;  3TSP A;  4CHP A;  4CBX A;  3HOT A;  1ATN A;  3VF4 A;  4CBW A;  5C12 A;  1YVU A;  4IEE A;  4BVO A;  4OLA A;  3U3G A;  3MCP A;  3ULD A;  1XMO K;  2O8F B;  4NLB A;  2G8V A;  4DR5 K;  3P4I A;  5B8H A;  3GL1 A;  4E3S A;  4LD0 A;  3F73 A;  1YJN N;  3CER A;  5M1F A;  1U04 A;  4JK9 A;  2XY5 A;  3SYZ A;  1XC3 A;  3DXK B;  1Q81 O;  4DTX A;  3CC4 N;  5KQ8 A;  1NK0 A;  1T6D A;  4IFE A;  1LV5 A;  1GLJ O;  3L3U A;  4JI7 K;  3VGM A;  1Q8I A;  4FWK A;  2QWR A;  2Q3S A;  3RRG A;  4CF8 A;  2FBT A;  2FBY A;  1XNQ K;  3CFR A;  3SPY A;  1BQM A;  5TKW A;  4B1U B;  1L3U A;  3ZET B;  3EYZ A;  1UA0 A;  5HP1 A;  3DI6 A;  4PL7 A;  1C0U A;  1NNE A;  2O8B B;  1HPZ A;  1NKE A;  3OHR A;  3OJS A;  2I5J A;  4BRH A;  2JLE A;  3QIN A;  4NYN A;  1NG9 A;  4XIU A;  4IG0 A;  1QQN A;  3A5N C;  3DM2 A;  4FM1 A;  4PQU A;  4CIE A;  3U3Y A;  4IKF A;  4YOW A;  3NCI A;  4IJN A;  4CJL A;  1KVB A;  2ASP A;  2HNZ A;  3V9X A;  4FOE A;  4DR1 K;  1NBW A;  3RTV A;  3SBG A;  4IG3 A;  1L5U A;  3J81 O;  4FJL A;  2IS3 A;  5JVG L;  3DYA A;  4IDK A;  4WCE L;  1HNI A;  3PX0 A;  2Y1J A;  3VEW A;  4DU1 A;  3H46 O;  3K57 A;  2OPQ A;  3ID6 A;  5BPL A;  1NKC A;  4IFV A;  4BY9 C;  4LF7 K;  4DR4 K;  3THW A;  3V9U A;  1NGH A;  4AHU A;  3FFK B;  4BVP A;  4A61 A;  3U6F A;  2RF2 A;  1QTM A;  3CCE N;  1OVY A;  2UU9 K;  1WNS A;  1ATR A;  2YCH A;  3EKS A;  1JCE A;  1JL2 A;  1S1X A;  2GWJ A;  2HBJ A;  4FLW A;  3OBY A;  2V51 B;  2OYQ A;  1QQM A;  5AQS A;  3OYB A;  2PYJ A;  4HWI A;  4IZ9 A;  3HOS A;  4B9Q A;  2BUP A;  3AVG A;  3MEG A;  3ZT0 A;  1TUY A;  5KQD A;  1KRP A;  3ATU A;  1LOT B;  1M1K O;  4NCG A;  1HKC A;  3WXM B;  1Q7Y O;  3QES A;  3IUC A;  4ELU A;  4ZHR A;  3PUF A;  1QSL A;  4HUG A;  3BF3 A;  2NRZ A;  2H3G X;  4FJN A;  3LDL A;  5IWA K;  2VG7 A;  4B9U A;  2FF3 B;  2GUI A;  1YI2 N;  3F2K A;  3VTI A;  4JI2 K;  1NJW A;  5K14 A;  3OA9 A;  3OYD A;  4AHS A;  1TKX A;  1C1B A;  1D9D A;  3VER A;  3LAK A;  3U8X A;  3AO5 A;  3TTF A;  4PUO A;  1OH8 A;  4GKJ K;  4M63 C;  4DTO A;  5CY4 A;  3P39 A;  4Z4F A;  4FVU A;  3HJF A;  4MDB A;  4LH4 A;  3AGR A;  1YIJ N;  1RNH A;  1NMD A;  1J5E K;  4DF8 A;  1Z26 A;  2OAN A;  4FLY A;  3NF7 A;  3V9S A;  2BGG A;  3D6R A;  2Y1I A;  1LWE A;  2WUS A;  3I8D A;  3VQ4 A;  5AFU A;  4CI6 A;  5AQR A;  3WEE B;  4TSX A;  4LF6 K;  4GV9 A;  3QFP A;  1C6V A;  1SQK A;  2QA4 N;  4QS9 A;  2HST A;  3OS1 A;  3VQA A;  5JLH A;  3B8A X;  2A40 A;  2O8E A;  4W5O A;  1TK0 A;  4B8A B;  3OYF A;  3VQ6 A;  1NWK A;  2A5X A;  2QEX N;  4J2D A;  4A5A A;  1N8R O;  1ASW A;  4YHH K;  2Q36 A;  4GW6 A;  2E8A A;  4BRP A;  3NHG A;  1CXQ A;  2B6A A;  4ICL A;  3O08 A;  1VSH A;  3RVC A;  3MXJ A;  4HCB A;  3O9S A;  5F2R A;  3EZ5 A;  2EX3 A;  3VA3 A;  3HM9 A;  3NDK A;  3U9D A;  2WON A;  1HPM A;  4IOC L;  5LL6 Z;  2QKK A;  3AVN A;  1GLC G;  4F2S A;  1RT5 A;  2P9N B;  3SLC A;  3NGI A;  1XMQ K;  5HBM A;  1GLD G;  3TTC A;  1ZC6 A;  4KHN A;  4KFB A;  4LSL A;  4MDA A;  3HZ6 A;  4R79 A;  3DLG A;  3RSE A;  3OYJ A;  2OZS A;  3HM8 A;  1K9M O;  1NGG A;  4JD2 A;  3CFO A;  5AFU H;  2ZJR L;  4WQ4 C;  1S72 N;  1RDD A;  1HNX K;  2IAJ A;  2VCP A;  3VA0 A;  4OX9 K;  2PBD A;  5BRD A;  1MA9 B;  3CJB A;  2FLO A;  3KK7 A;  4C1N I;  4BRI A;  3GE1 A;  1WBD A;  3RSE B;  2HVH A;  3VET A;  4AHC A;  5EX5 A;  4Z4E A;  4CJF A;  2G8I A;  4JS5 A;  4RG8 A;  5AQJ A;  4O0I A;  2FSN A;  1WSF A;  2KQ2 A;  4OLB A;  5CHI A;  3IKM A;  3J80 O;  4YNQ A;  3NVK A;  1BO5 O;  4CE9 A;  3QNO A;  4DU4 A;  1WSJ A;  1QHA A;  1IG9 A;  4AF1 A;  4JAX A;  1W7A A;  4E1N A;  1L3S A;  5SWM A;  1KFD A;  1NGE A;  3TAG A;  4BRD A;  5E41 A;  3RMD A;  2V52 B;  3MK6 A;  3BGR A;  1SKW A;  1RGI A;  1X3M A;  3T3F A;  4FWO A;  5EY4 A;  4X62 K;  4GVM A;  4JKF A;  4CJE A;  1IKX A;  1NJZ A;  1JLB A;  2X78 A;  3ISN C;  3TPQ A;  5LY3 A;  4JRP A;  1SL1 A;  1N6Q A;  3FZF A;  1KTQ A;  1HQE A;  1DEJ A;  3D2E A;  3PO5 A;  1U45 A;  5BR9 A;  2X74 A;  4FL9 A;  3TSU A;  3CM6 A;  1R59 O;  4DQP A;  1JKH A;  4IEI A;  3KZB A;  5EOY A;  3K5L A;  1YAG A;  2HB5 A;  1I39 A;  2O4G A;  4MO5 A;  1X1P A;  3PIO L;  2Z1I A;  4X66 K;  4BE0 A;  1E3M A;  4H0Y B;  5JMV A;  3LP3 A;  3TR8 A;  4CK2 A;  3ENO A;  2CH6 A;  5GAG P;  3C94 A;  4IOX A;  1LAW A;  1MDU B;  5AQZ A;  4CF1 A;  2YHX A;  3PLA A;  4I9L A;  1VSM A;  2NRT A;  4NYF A;  3M8Q A;  3T1H K;  2XO7 A;  3KK3 A;  1Z25 A;  1E4F T;  2YHB A;  3RMA A;  3CQY A;  3L2W A;  4FWP A;  1J54 A;  3TAP A;  3OYK A;  1VQ8 N;  4B3S K;  2P9I A;  3CQX A;  5BRF A;  4CEB A;  2OA8 A;  1XC9 A;  3MX2 A;  3ZSW A;  3KHY A;  3RMC A;  3CJA A;  1YJW N;  4JKH A;  4IO9 L;  3SUN A;  1DGK N;  4CGJ A;  1UA1 A;  4WQ4 A;  2KKZ A;  4CJR A;  3VQ7 A;  1RBU A;  4JK8 A;  4DS4 A;  1V4T A;  1REV A;  1S5J A;  5AQX A;  1HNW K;  1VAZ A;  3DWL A;  3LAN A;  1BUP A;  4FJM A;  2A1S A;  2A42 A;  4KI6 A;  1MWM A;  1MU2 A;  1IKW A;  3THX B;  4DR2 K;  1XI1 A;  2P9S A;  4J2E A;  3CI5 A;  1RIL A;  1BI4 B;  4CEE A;  3LDS A;  3HYF A;  4DFP A;  4FJK A;  1Z05 A;  4H4O A;  5AQM A;  3FE1 A;  4E0D A;  3THX A;  4CHN A;  3H08 A;  4FJ7 A;  2ASO A;  1KD1 O;  4H4M A;  4CK3 A;  1T6C A;  2VYP A;  4FWQ A;  3ZSV A;  1KXP A;  4JK7 A;  2RE2 A;  3HL8 A;  3QIO A;  4NXN K;  3BZC A;  2VG5 A;  4RW8 A;  3CJC A;  3VOV A;  4YY3 K;  3ATV A;  4M7Y A;  4CVN E;  5EU7 A;  3H3O B;  4JI4 K;  1HNZ K;  2WFB A;  2NNW A;  4B9M A;  3DLB A;  2FSJ A;  3HK2 A;  4L8R B;  3DLH A;  1ZXO A;  2Z1G A;  2RN2 A;  3O9Q A;  4FJG A;  1Q82 O;  3AVC A;  1YUW A;  5AQO A;  1IKV A;  4DV7 K;  3VEX A;  1T8E A;  3HRG A;  4MFB A;  3OYH A;  2UYT A;  2P9K B;  3L2U A;  2YX6 A;  5M1O A;  4O5B A;  1TK8 A;  3K59 A;  3O5B A;  3QEX A;  3EY1 A;  3ZET A;  5I3U A;  3IG1 A;  2NRV A;  1U2V A;  3QEW A;  3ZT3 A;  1J6Z A;  4Q5V A;  4B9V A;  5JS1 A;  2P9N A;  3WNG A;  1RDC A;  5BR8 K;  3HPO A;  3SZ2 A;  2P5O A;  2CGL A;  3A2F A;  3A8Y A;  4FJ8 A;  2KZM A;  3P5J A;  2VQF K;  3CPW M;  4FJ5 A;  5J2N A;  1NJI O;  1MWK A;  4H8K A;  4G1Q A;  3MED A;  4JHD B;  3QNN A;  3H3N O;  4DQS A;  1K8K A;  3LL3 A;  4QS8 A;  1T05 A;  5I9E B;  4CEF A;  2R7Y A;  3ULE B;  3L4I A;  4KPY A;  3NH2 A;  3KWI A;  1C0T A;  3O6W A;  4W5N A;  3QO9 A;  3ZT4 A;  3EEQ A;  3M8S A;  4JKD A;  5AQH A;  1JLQ A;  2AA4 A;  2BTF A;  4FLZ A;  1XUP O;  1VHX A;  3MXM A;  3O3F A;  3WXJ A;  1KFS A;  4FWL A;  3NE6 A;  3OJU A;  3PY8 A;  4I6M A;  4CHQ A;  3NF8 A;  2NRW A;  5LMU K;  3S9H A;  2IVP A;  4CES A;  1B9F A;  3ZEU B;  2WC9 A;  2DY4 A;  4IWV A;  4CIF A;  2FSK A;  4H0V B;  3D0P A;  1VSD A;  3R6M A;  3HVR A;  4W5R A;  2QWM A;  5M1P A;  1Q9X A;  4W5T A;  2P9U B;  4NB4 A;  4B1Z A;  4PA1 A;  3A5L C;  2YJF A;  4OPK A;  3GBT A;  4B1Y B;  1ZYQ A;  3VTH A;  3VES A;  5LJW A;  3E9O A;  5GAH P;  1YHQ N;  4EZ6 A;  4BR5 A;  1RBT A;  1NGB A;  2KFZ A;  3KVG A;  3V6D A;  3TI0 A;  3BDP A;  4MO4 A;  4O0J A;  4CGI A;  1XHX A;  2ASM A;  4JKB A;  5C42 A;  3SK3 A;  1NJX A;  4KHW A;  4AHV A;  3ZSQ A;  4DFM A;  3E9L A;  4CZI A;  2QXF A;  1VSI A;  2E1Y A;  4H0P A;  4IFY A;  3CG7 A;  4MQ3 A;  3OS0 A;  1VSK A;  2W6L A;  3L8B A;  1RCH A;  3VN5 A;  4BC5 A;  4EAH D;  3SUP A;  1NOY A;  4DV4 K;  3SV4 A;  2WBN A;  2A3Z A;  3AVB A;  1R0A A;  3SMS A;  3N4P A;  1KAY A;  5C2D A;  3QEI A;  4WE1 A;  3HI0 A;  1JXB A;  4WFN L;  1D5A A;  1S3X A;  1N32 K;  5AQY A;  1DT9 A;  1GLE G;  4IBN A;  3V1O A;  2UUC K;  4Y1C A;  1RFQ A;  2YHA A;  1NKB A;  3FZM A;  4BRQ A;  1ITG A;  1BI4 A;  3O1W A;  4PWD A;  3W0L A;  2BAN A;  4CZM A;  4ISE A;  5BRE A;  1S6Q A;  5FLX O;  2PAV A;  2NZT A;  4E7K A;  1JLF A;  3QEV A;  1KC8 O;  4N47 A;  3K2P A;  3ZYY X;  2ZF5 O;  4WFB L;  4YOV A;  1NOZ A;  2P5G A;  4DG1 A;  3ZLJ A;  3WUH A;  5FRO A;  4KH4 A;  3CYM A;  3THW B;  1LAV A;  2NRH A;  3CCJ N;  3P31 A;  4KHQ A;  2IOC A;  3W3D A;  2E6L A;  3T1Y K;  1ESV A;  1RT6 A;  3MN7 A;  4DTU A;  3OS2 A;  3BY5 A;  3C6T A;  1G99 A;  4NLC A;  4CFD A;  5GAD P;  2P9P A;  1IBL K;  3C7N A;  1DKG D;  1HLU A;  1UWB A;  5AZJ A;  3DXM A;  3QET A;  2KHO A;  5JLF A;  4Z4C A;  3CC2 N;  1N33 K;  3CM5 A;  3T69 A;  4C8K A;  5ELZ A;  4B9N A;  4X64 K;  2E1Z A;  3AAQ A;  2ZE2 A;  4M3Z A;  1NM1 A;  1RTH A;  3VGK A;  1JLA A;  2A6A A;  3SQ0 A;  2PFU A;  2AJQ A;  1Y64 A;  4PHT X;  4CBU A;  2KZZ A;  1HX1 A;  3QML A;  2EWS A;  1N34 K;  3PV8 A;  2O8D A;  3O4W A;  1RT3 A;  1NJY A;  3PSI A;  1N36 K;  3LZI A;  3AA3 A;  4C8N A;  3P38 A;  4DSE A;  4K41 A;  2W6K A;  5GIP A;  1ZBU A;  3HP9 A;  1OH6 A;  3K9J A;  1QQC A;  4Q0B A;  1JXE A;  1XQS C;  4DQR A;  4LC9 B;  5AQP A;  2IVO A;  4BQL A;  3Q7B A;  5FPM A;  4EHU A;  5HRP A;  3AO1 A;  1L3V A;  3DLL L;  3UKU B;  3G71 N;  2F8T A;  3LWM A;  4C23 A;  3CCL N;  3DLE A;  3SQ2 A;  1U6Z A;  4BWM A;  2F8S A;  5E84 A;  3ITH A;  3T7Z A;  3QEP A;  4CJS A;  4CFA A;  4E7J A;  3BUZ B;  2GBZ A;  3D7E O;  4Z4H A;  3E1Y A;  4BR9 A;  2OTJ N;  3QER A;  3JYT A;  3H45 C;  1HYS A;  1NLV A;  4B1W B;  1C1A A;  1NGJ A;  4DQ8 A;  4GV3 A;  4KHU A;  3WNH A;  4G9Z A;  4BRO A;  4CFC A;  1TAU A;  4DTP A;  3AO3 A;  5DK5 A;  4QCL A;  1ZBL A;  1HR0 K;  2F7T A;  4PY5 A;  3SAF A;  4JKE A;  1S9E A;  1A5X A;  1KCF A;  3NAE A;  1ASV A;  4BRN A;  3QBX A;  1QSS A;  2IGI A;  3EN9 A;  1VQN N;  4XH5 A;  3L4Q A;  1KSP A;  2IVN A;  3PO4 A;  5IT9 O;  2E2Q A;  2E2O A;  1UAX A;  4H0X B;  2Q0U A;  5KPT A;  4MLE A;  1QE1 A;  1YTU A;  1SAZ A;  4H5W A;  3WEE A;  3SV3 A;  4CF2 A;  4B3M K;  3CCR N;  5KPZ A;  4FLU A;  3LPT A;  1EP4 A;  1VSE A;  1J53 A;  1U49 A;  3AVM A;  4C8L A;  1BIS A;  4DR7 K;  1VK0 A;  2HBL A;  1Q18 A;  1P8Z A;  3K5M A;  3VEO A;  5J2M A;  3N4Q A;  2RPI A;  4BG9 A;  2YKM A;  3O4N A;  4CZK A;  2CGK A;  1WBB A;  3QBW A;  4IJA A;  4YOU A;  2OZM A;  4CJK A;  1TGO A;  2XY7 A;  2DFF A;  1EWR A;  3BF1 A;  1NK9 A;  1GOB A;  3ZX0 A;  1XWL A;  4CJT A;  2E6M A;  2Q0R A;  2O8F A;  5KPR A;  3WQU A;  3CC7 N;  4CHO A;  4JI1 K;  4FJI A;  1CZA N;  4FJX A;  3F9M A;  4DHY A;  4OJR A;  1ZBF A;  3M8R A;  4DQI A;  4Y0W A;  4KHS A;  1FKO A;  5LJV A;  1HJO A;  2DFE A;  3AVH A;  3KK1 A;  5M1Q A;  4FWS A;  1Y97 A;  2HNY A;  1NK5 A;  4RW4 A;  1EO1 A;  2GEM A;  2P9L A;  1JLE A;  2W41 A;  1RDU A;  1IG8 A;  4CED A;  1NMN A;  5FDL A;  3AGK A;  2OPR A;  4HCC A;  1BIU A;  3KIO A;  3HO1 A;  4B9L A;  3VEN A;  4GNI A;  1GLF O;  4ZTJ A;  2NLX A;  2B4J A;  5C2F A;  2YJE A;  4NO7 A;  2ZQB A;  4E7L A;  4ELT A;  4CD1 A;  2G8H A;  3SMP A;  4BWJ A;  3CCM N;  3ZT2 A;  4KB0 A;  4EFH A;  3FZH A;  4CW7 B;  3D2F B;  4CGG A;  4IDH A;  4YDU A;  1K8A O;  2F9W A;  1RTI A;  1RTD A;  4KTZ A;  3CMA N;  4B3T K;  5C0Y A;  4F3O A;  4O8K A;  3LDO A;  4LFA K;  1EET A;  2Z1J A;  3SUO A;  1EX4 A;  1VSL A;  4DU3 A;  4CEZ A;  2B5J A;  1RDW X;  2VWB A;  3G25 A;  4OPH A;  3LWL A;  3O9R A;  4DR3 K;  1QVG M;  4U7B A;  3QIC A;  3JAM O;  3G10 A;  1TYQ A;  1FJG K;  1VQ6 N;  3ENB A;  4FCY A;  2QXL A;  4DSJ A;  5HRR A;  1SV5 A;  2CGJ A;  2GV9 A;  4CEO A;  3K58 A;  3V9Z A;  3EZW A;  2BH1 A;  4FJ9 A;  1IBK K;  3ZSO A;  4CCH A;  1A5V A;  1BGX T;  1RT7 A;  5BPM A;  3NF6 A;  2XY6 A;  4LFC K;  2HVI A;  1QVF M;  5M1N A;  3SPZ A;  1S1W A;  1YF5 L;  2W40 A;  2O8D B;  4IOA L;  2ITM A;  4JRQ A;  3J7A P;  3EL2 A;  4AH9 A;  1KLM A;  1J9A A;  4FM0 A;  5J1E A;  1W2B M;  4AHR A;  3K5O A;  1VQK N;  3OW2 M;  3OBW A;  5AQI A;  4CJ7 A;  2HHQ A;  3TAB A;  2YV0 X;  4N41 A;  2FF6 A;  3VGL A;  3RR7 A;  5DMR A;  4B3R K;  4RCH A;  3HVT A;  3OYM A;  3NH0 A;  3UIQ A;  3TAE A;  1ILY A;  3CHW A;  3Q7C A;  4F9O A;  4O5F A;  4E89 A;  3DXM B;  1BA1 A;  1WLJ A;  1BCO A;  5BN9 A;  2G8K A;  5HRS A;  2P9P B;  2O8C A;  2J4R A;  3ZEU A;  4DTR A;  1BCM A;  3VPZ A;  4LF5 K;  1C0M A;  4N56 A;  1Q9Y A;  4J8F A;  3I55 N;  3DXK A;  1WSG A;  1IJJ A;  3DAW A;  4I2Q A;  4M3R A;  3OYA A;  4KH6 A;  1RBS A;  1HRH A;  3U4L A;  1HYV A;  4IXC A;  3ZX2 A;  5C10 A;  4PKH A;  4K8X A;  4EP4 A;  3CXC M;  1M90 O;  3TWH A;  4V19 S;  2OTL N;  5AQT A;  3RRH A;  4CJV A;  3HPH A;  4I2P A;  4YOR A;  2QKB A;  3A0I X;  3THY B;  1SS6 A;  4O4G A;  4Z4G A;  3M8P A;  3B6O A;  4FW1 A;  4H5T A;  2PY5 A;  3F9K A;  3WNE A;  3ZSR A;  4A57 A;  3CCS N;  2P9I B;  2V7Y A;  4BDP A;  2JGU A;  5EVZ A;  4UY8 O;  5MLC Q;  1P90 A;  1S6P A;  3NMU A;  3KD1 E;  4DTN A;  3NF9 A;  3AAP A;  3BZK A;  3SAG A;  5DM6 L;  3WQT A;  3AVF A;  2IDO A;  3DLR A;  2HBK A;  1Z6R A;  4YOY A;  4KO0 A;  3OYN A;  2FBX A;  3S3N A;  3THV A;  1BHL A;  3L3V A;  2CH5 A;  1WAF A;  3L2V A;  3ENH A;  4DV2 K;  3SCX A;  3UKR B;  1TL1 A;  5EXW A;  1QSY A;  5AQG A;  3AA4 A;  3WXL A;  4CZE A;  3QDK A;  5E26 A;  1LCU A;  4FJH A;  3L2R A;  3VQD A;  1Q86 O;  1WN7 A;  1S22 A;  4DV6 K;  2P51 A;  1WSI A;  4HUE A;  3LM2 A;  4JI5 K;  3AV9 A;  2QWO A;  1BQN A;  3GG4 A;  1HYZ A;  5C15 A;  1ZBI A;  4BR4 A;  4EIA A;  4FM2 A;  2FC0 A;  3I33 A;  3ALY A;  3E01 A;  3O3H A;  3LDN A;  3OYE A;  3HBT A;  3T1A A;  4DTJ A;  3AA5 X;  1JCF A;  4B1V A;  3DMJ A;  3MN9 A;  3QB0 A;  4RW6 A;  3UB5 A;  2HHT A;  4B9T A;  3V1R A;  4AM7 A;  4KBO A;  5AQW A;  3VQE A;  4BC3 A;  1BDG A;  4KHP K;  2A1R A;  3SNN A;  4BRF A;  4YOT A;  3P1G A;  3AY9 A;  4BRK A;  4N76 A;  3UE5 A;  4C1N K;  5FPN A;  4N5S A;  5GIN A;  2G8F A;  3J7Z O;  1T3V A;  5J2P A;  3P83 D;  2Q97 A;  4JKA A;  3R1X A;  4FLT A;  1NU0 A;  3AVL A;  2G8U A;  1O13 A;  4BE1 A;  3ULE A;  4I6M B;  5GIO A;  2OCE A;  1HMV A;  1K8K B;  2P9S B;  1JJ2 M;  4JS4 A;  5CE3 A;  4A2A A;  4ISG A;  4HTL A;  2QWN A;  1YVN A;  4J2A A;  3J8A A;  1XHZ A;  1C1C A;  4JN4 A;  3CCQ N;  3AVK A;  2IC3 A;  5D3G A;  3UKU A;  3FZK A;  2VGM A;  3NH1 A;  4KRE A;  4BRC A;  1EWQ A;  2HHU A;  3OY9 A;  5CYQ A;  3NBP A;  4DCH A;  2D5R A;  1KVC A;  1ZBH A;  4JYA K;  3EE9 A;  4LF4 K;  4CHY A;  4K42 A;  5C25 A;  3T19 A;  4JHD A;  3VQQ A;  2P9K A;  3U9Z A;  4LF8 K;  1IO2 A;  4ILJ A;  5CZ2 A;  1X9S A;  4AIL C;  1X9M A;  1CXU A;  3O9T A;  5BN8 A;  4WQ5 C;  3V1Q A;  3KLF A;  5KRS A;  3I0S A;  4CF9 A;  5KTQ A;  1BOT O;  4CJW A;  4BRM A;  4BQZ A;  3AA2 A;  1VRT A;  5F1X A;  2HMP A;  1TKD A;  3G0Z A;  4LH5 A;  4RW9 A;  2PYL A;  4M3Y A;  1D9F A;  5AZJ B;  2ATQ A;  1SL2 A;  2E88 A;  4U67 L;  3KK2 A;  3LAM A;  3SBT A;  3C6U A;  2F96 A;  4GMJ B;  3RR8 A;  3CJ9 A;  4FLX A;  3KLE A;  3DJC A;  2E2P A;  4DSL A;  4CF0 A;  2D0A A;  4AQY K;  4ID5 A;  2ZWH A;  1TK5 A;  2KLA A;  2BDP A;  3IS9 A;  2YNI A;  4DV0 K;  2O8E B;  3A5O C;  4B1X B;  3SJH A;  2QWQ A;  5A2Q O;  3L0Q A;  4KI4 A;  2UUA K;  2XY8 A;  2D0O A;  4FWN A;  4JV5 K;  4CJ4 A;  3TAQ A;  4FSV A;  4JNE A;  4MLH A;  2Q2R A;  4LFB K;  4M41 A;  1QQO A;  1OKJ A;  4EHT A;  4KAZ A;  4M45 A;  2D0C A;  4BR7 A;  2D0P A;  4CGD A;  3CCU N;  4DV3 K;  2VGN A;  4CZL A;  2E20 A;  2ZJP L;  2X6S A;  3AVA A;  3HST B;  2KW4 A;  3MN6 A;  4GVE A;  3M3Z A;  2Q31 A;  5DM7 L;  2HF4 A;  4CJU A;  4FZX C;  4M7X A;  1YT3 A;  3MN5 A;  4DMN A;  4KKO A;  3MMV A;  2ITG A;  3AO4 A;  2FBV A;  2HBM A;  5TKY A;  3PSF A;  3VMF B;  2QWP A;  4M3T A;  3O9U A;  3O1B A;  1VQO N;  1RDA A;  4LF9 K;  3K0S A; 
#chains in the Genus database with same CATH homology
 3JAM O;  4X64 K;  4LF4 K;  1FJG K;  1HNX K;  2UUB K;  4DUY K;  4B3M K;  4LF8 K;  4OX9 K;  1IBK K;  4B3S K;  4GKJ K;  4LFC K;  1N34 K;  4DUZ K;  2UXC K;  4DR6 K;  4DV2 K;  4DR1 K;  1N36 K;  2E5L K;  5BR8 K;  3J7Y P;  1J5E K;  4DR7 K;  3J81 O;  3J7A P;  4K0K K;  2VQF K;  3J80 O;  4DV4 K;  4JI0 K;  4DV6 K;  4JI5 K;  2UXD K;  4LF6 K;  4LF7 K;  2F4V K;  4DR4 K;  4B3R K;  1HNW K;  4JI6 K;  4DV1 K;  2ZM6 K;  1N32 K;  2UXB K;  2UU9 K;  2UUC K;  4DR2 K;  4JI1 K;  4AQY K;  4JI8 K;  4X62 K;  4DV0 K;  5FLX O;  3OTO K;  2VQE K;  4LF5 K;  4KHP K;  4YHH K;  4JI3 K;  4DV5 K;  5A2Q O;  2UUA K;  4JV5 K;  5AJ3 K;  1XMO K;  1XNR K;  4DR5 K;  5LMU K;  4V19 S;  4LFB K;  4NXN K;  4NXM K;  4YY3 K;  1IBM K;  3T1Y K;  1HR0 K;  4X66 K;  4DV3 K;  5LL6 Z;  4CVN E;  4CW7 B;  4JI4 K;  1HNZ K;  4JI7 K;  1IBL K;  4B3T K;  1XMQ K;  5IWA K;  4LFA K;  4X65 K;  4JYA K;  4GKK K;  1I94 K;  1XNQ K;  5IT9 O;  5LMN K;  1N33 K;  4DR3 K;  4LF9 K;  4JI2 K;  4DV7 K;  3T1H K;  2HHH K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...