5LMNK

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
b'VKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmnK00
1XNRK 4DV5K 4X65K 2UUAK 1N33K 4LFAK 4JI0K 4DR2K 4OX9K 4DV7K 3T1HK 4YHHK 1IBMK 4LF6K 1FJGK 2UU9K 4DUYK 2F4VK 2ZM6K 4B3MK 3J80O 4K0KK 4CW7B 4JI1K 2VQEK 4LF9K 4DR3K 4DR7K 4X64K 1N32K 1N34K 3J7AP 4JI4K 4JI2K 4V19S 4LFCK 1HNXK 1IBLK 4DR1K 4JI6K 5LMNK 4DV4K 2HHHK 4DR4K 2UXCK 4DV1K 4YY3K 2UXDK 2UUBK 4LF8K 4JI8K 4DV0K 1J5EK 5AJ3K 5IWAK 4JI5K 4DR6K 4X62K 4B3TK 4AQYK 4KHPK 5FLXO 2VQFK 4JI7K 2UUCK 4B3RK 4JYAK 4CVNE 2E5LK 5IT9O 1N36K 5A2QO 4LFBK 4NXNK 3J7YP 5LMUK 4JV5K 1HNWK 4DR5K 4X66K 4LF7K 2UXBK 4DV6K 5BR8K 1I94K 1XNQK 4DV2K 1HR0K 4B3SK 3T1YK 1XMOK 4JI3K 1HNZK 4GKKK 4LF4K 4DUZK 3JAMO 4NXMK 4LF5K 3J81O 4DV3K 1IBKK 1XMQK 4GKJK 3OTOK 5LL6Z
chains in the Genus database with same CATH superfamily
3ZSYA 2RKIA 2HBJA 2FBTA 1TK8A 3R9PA 2Z1IA 4WQ4A 3B6PA 4FJLA 4JI0K 4CEFA 2BANA 3AVBA 4CJ5A 3C0BA 3DRSA 1JXEA 3VGKA 4FK4A 2ZQBA 5AQPA 3VEOA 3BUZB 4WCEL 3SV3A 3QFPA 1VQ4N 2PYLA 3LALA 1VRTA 4B3MK 2P9KA 5F1XA 2B6AA 1SL0A 1NWKA 5AQJA 4E7IA 1U48A 1FXXA 2VWKA 4KB0A 3QDKA 4FWQA 3P39A 1C0MA 5AZIB 1X3NA 4L3QA 2QWOA 3THWA 4FWRA 4B1ZA 3PX0A 3NHGA 4KPYA 1IKYA 4CESA 4BR7A 3DLGA 4FLUA 1GOBA 5CR4A 4BVPA 3EYZA 3MWTA 3LP3A 3DRRA 3ZT1A 3HI0A 3VQ7A 2G8FA 4BR0A 1NGBA 2QA4N 2FBVA 3SPZA 2IVNA 4HCBA 4B3TK 2OTJN 4KHPK 4OGEA 4QS8A 3RVCA 3WNGA 2VQFK 1YJNN 4BGBA 5KQDA 4JRPA 1NU0A 4YOVA 1RBUA 2NRVA 3A2FA 3K9KA 3TSQA 3MK6A 1TYQA 5HRRA 2GBZA 4OVLA 1IH7A 3SJJA 3Q7BA 5LMUK 3V1OA 1WN7A 3ENOA 1T44A 1VSEA 3W3DA 3L2VA 1NK7A 3P31A 5M1NA 1RCHA 3CJCA 3KK3A 5T7BA 1SUQA 3QINA 3HP6A 3VF2A 3QICA 3JS6A 3K59A 5F0XA 3ZETA 2LSNA 4K42A 3T1YK 1LCUA 1HNZK 2V7YA 2HHQA 4GKKK 1N8RO 4LF4K 1WBDA 2FBYA 2GEMA 1MWMA 4B9SA 4E0DA 3D2FA 4DQ8A 2VGNA 2X74A 4CF9A 4A2AA 1S9GA 4C8MA 3OTOK 3KLIA 1IKVA 4M45A 4KREA 4JD2B 1VSHA 3MWPA 4F2SA 4JKFA 2A3ZA 4DQSA 5F2RA 4FLZA 1EETA 3IS9A 4KHNA 4DFJA 2QKKA 4FJ8A 3C6AA 2AA4A 1C6VA 4PUOA 3OJSA 4YORA 1K6YA 4RWTA 3IKMA 4DSIA 3THYB 4HTUA 2HHSA 4A62A 4CJTA 3V9UA 4FOEA 3CM5A 2ETJA 4OGCA 1GLDG 1I39A 3FZMA 3O80A 3AGRA 4FM1A 3ULEB 4FJJA 3CD6N 1J9AA 1D9FA 3AVFA 1YHQN 1T6DA 2ATQA 2E20A 4CFBA 1QZ5A 1W0HA 3E9PA 5HBMA 1E4FT 1HYVA 4E7KA 2KFNA 1GOAA 1CZ9A 3AO2A 4OKEA 3V9WA 5AQSA 1HX1A 5AQYA 4PKIA 4B1VA 3EL2A 1S6PA 4R79A 4M7XA 4JHDA 3QNOA 4JYAK 4DTRA 3O1WA 2OZSA 1JJ2M 4FJ5A 3H46O 4J2BA 1Q86O 1ASUA 4HUFA 3C6HA 2QK9A 4BG8A 1S22A 2ASOA 4FJHA 5EXWA 2VG6A 2KHOA 4DTUA 2F7TA 2YJFA 5C0YA 1RTJA 5GAEP 3JSMA 1KAXA 4DV2K 1YJWN 4N5SA 1XMOK 3ID8A 1ZC6A 2I7PA 5EU7A 1IG9A 4BC3A 4ELUA 2GV9A 1X9SA 1J6ZA 2A42A 2QKBA 1TKXA 3HSCA 4YDUA 4BVOA 4RTFD 2A6AA 2QM1A 3RR8A 3GL1A 4CK3A 2W42A 4W5RA 2F8SA 1ZXOA 4DFMA 2E4LA 4EZ6A 3F2KA 3VQ5A 1YT3A 5J2QA 1JL1A 1IV0A 4WF9L 2P9IB 3ID6A 3AVIA 3UKRA 2NUBA 3OYLA 3O5BA 2P5OA 2ASMA 3N4PA 3S3NA 4B9UA 2ZWHA 3G25A 1QQNA 5HP1A 3F73A 3DLBA 1BGXT 4DCHA 1VSFA 4Z4CA 4Z94A 3V6DA 1C0GA 4DFPA 2FLOA 2F96A 1X9MA 4BC5A 3ZX3A 1HNXK 5BPNA 3G4SN 4DR1K 2G8UA 3MN6A 4OPKA 5J2MA 4Z4EA 4KHSA 3CCUN 3ZT2A 4LSNA 4CEDA 3VGMA 4YOWA 3KKSA 4KH4A 2PBDA 1XWLA 1VQKN 5K14A 4FJNA 1K8KA 4M3YA 4Y1DA 1B9FA 4EP4A 4FJGA 2NRXA 4BRIA 2ZE2A 3WQTA 4ID5A 2EHGA 3D7EO 3KWGA 4KB1A 1NJZA 4BE0A 4NCAA 1WAFA 3NCIA 1H1VA 1D9DA 4RW8A 3M3ZA 1YXQA 1Z6RA 3LPTA 2DY4A 4KH5A 1NGFA 2P1JA 3DXKA 4NXNK 4E3SA 1LW0A 3VMFB 3C94A 4JRQA 3OBYA 4DQRA 3EN9A 3O3GA 2O8CB 3DRPA 4KTQA 1YI2N 4KH6A 3VQDA 3SV4A 3OYMA 1RBTA 2VG7A 3VEWA 4KAZA 1JLCA 4CCHA 4K8XA 1TVRA 3O4NA 4CJQA 1XC3A 4DQPA 4M42A 3UIQA 1TKDA 1ZBHA 4B9TA 4M63C 4CGDA 4KI6A 4BDPA 3AVNA 3QIOA 4CJUA 1WLJA 4DQQA 3I56N 4AILC 4DV3K 4CD1A 4FJIA 1XMQK 3HPOA 3A0IX 3NH0A 1D4XA 2HHTA 5KRSA 3SQ1A 1N33K 3EO3A 2O4IA 5M1OA 4J2AA 4BRNA 2GELA 4B9MA 5AQFA 4H0VB 3F5TA 1FKPA 3H1VX 1SKSA 4IOAL 1FJGK 2YHWA 4RCHA 3SK3A 3TARA 4B9QA 2F9TA 4XH1A 3SQ4A 2OPPA 4ISFA 3CJAA 4K43A 1LWFA 3KJVA 4E89A 1FW6A 1CXUA 4O8UA 4H5WA 3G0ZA 3MDQA 4A61A 5EOYA 3VTIA 4QAGA 3FFKB 1V4TA 1IBLK 4IJAA 2IC3A 5LMNK 4O4GA 1ATNA 1T05A 4PQUA 1VQLN 2F9WA 4DF8A 2IVPA 2V51B 4FPBA 4YFUA 2P9UB 3MEGA 3LP0A 3CG7A 4F3OA 3DAWA 3SPYA 5IWAK 4PKHA 3OA9A 2QWPA 2XY8A 4A2BA 3P4IA 5DM6L 2D0AA 5FLXO 5JS2A 4DHYA 5AR0A 5FDLA 4LC9B 3CPWM 1RILA 2HHXA 1JL2A 3ZT0A 4CZIA 1WSGA 5CYMA 1NOYA 3V9XA 1OVYA 1T3VA 4IDHA 4DLGA 3VEYA 1QVFM 3O9UA 4LF7K 4YOYA 3K2PA 4FWSA 4DS4A 1VQON 1BIZA 3MMVA 3SUOA 4WE1A 5KTQA 4JS4A 3AO1A 4ZTFA 1G15A 4NCGA 3VQ9A 3EKUA 5CY4A 4DU1A 4KTWA 1RT2A 4JD2A 4H4MA 1C1AA 2Q0UA 3SUPA 4H0XB 4YOTA 3GBTA 4UY8O 3VQCA 3H3OB 1ZBFA 4CGFA 3NH2A 2KW4A 1BQNA 1MDUB 1NGJA 4OKKA 4FO0A 4PY5A 3ENBA 2G8HA 1XNRK 2WTUA 2HMPA 4DSKA 5J1EA 1HYZA 4DTOA 4FW1A 1QHTA 4OX9K 2D0PA 5FPEA 1W9HA 3PX4A 2P9LB 4A57A 2NLXA 3KD1E 1S1WA 5M1PA 3BDPA 3JXUA 2ITGA 5ELZA 1Q9XA 1IG8A 2CGLA 3A5MC 4DTMA 3QB0A 1X9JA 4GV6A 3B6OA 5J2PA 4KFBA 2X6NA 4U7BA 1NNEA 1X3MA 3G10A 4FSVA 5AQOA 4IFVA 4BGAA 3TR8A 2E8AA 2O8FB 4CK2A 3P83D 4JKGB 3ZSOA 4LFCK 3BGRA 1RT7A 1TUYA 1EO1A 1P90A 4DR4K 1SV5A 1U49A 4JK9A 3O3FA 1XHXA 3AVLA 4J2DA 3L0QA 3KIOA 3QEXA 3CC2N 4DV0K 4FOIA 5C42A 4EHTA 4AF1A 1YIJN 3FGUA 5AQTA 2XY5A 4FM0A 3CCLN 1W97L 3K5NA 4CGGA 3K5LA 1NGIA 3QEWA 5I3UA 3VQEA 3HT3A 4B3RK 3CHWA 4IBNA 2VG5A 5IT9O 2HB5A 1BI4A 1TGOA 1QSYA 1YITN 4FXDA 1ZBLA 4Z0UA 5C24A 3OYAA 1BIUA 3QNNA 1F21A 3Q7CA 1NK4A 3ZSRA 3CETA 1TKZA 1VQ7N 4FJKA 5BR8K 4W5NA 2AP1A 4OLAA 1RT1A 4FWNA 2Q97A 3OYEA 3FZLA 3ITHA 5AZJB 2O8BB 1TL3A 4B8AB 3IAYA 3CXCM 4CHZA 2DPNA 5JICA 1GLFO 3KVGA 3RSEB 3SLCA 2OZMA 1IBKK 2HBLA 5C2FA 1ASWA 3OYGA 1T7PA 3VN5A 4M3TA 2HNDA 3NAEA 4NYNA 1VAZA 4KHQA 4GVEA 3L2UA 1ATSA 3T1HK 2XRIA 4HUEA 1L3SA 2ZF5O 3AVGA 1WBBA 4LF6K 3KLGA 1HNIA 4B1UB 4CHYA 1FK9A 4BQLA 3EE8A 3C95A 4O5BA 1VHXA 3HOSA 4LH4A 3HXMA 1U4BA 1VK0A 1MA9B 2IS3A 3OHRA 1RTDA 4GY2B 3UKUB 2ZD1A 5B8HA 2HVHA 2GUIA 2E6LA 5GINA 3V4IA 4BROA 4JI6K 4CF8A 3VERA 1S1TA 4NO7A 2OPSA 3T69A 3DOKA 4B9NA 3HM9A 3W0LA 2QWRA 1YTAA 3LAMA 1HQEA 1HLUA 2X6SA 4AM6A 4FCYA 1QHAA 3PV8A 3VEXA 4BRDA 1BDGA 4FJ7A 4BRMA 4M3ZA 3DLRA 5AQZA 1NK6A 1DGKN 4DU3A 2GUPA 3DXKB 3PO4A 1RBSA 1BISA 1GLBG 4MQ3A 2UUCK 5EX5A 1IKWA 1ESVA 3HVRA 4I7FA 2W6KA 4BY9C 3E9LA 3CCJN 2OCEA 3U9DA 3IUCA 2P9SB 3TANA 4H5VA 1RDWX 3AVHA 4G1QA 4CD3A 1VQ9N 1UWBA 4IG0A 3HRGA 1DTQA 1CZBA 4BRKA 4JI3K 5E26A 1K73O 1HRHA 1X9WA 3AA4A 4BRLA 1L3TA 1KLMA 4B3OA 4BRFA 4OKJA 3V9ZA 2QTDA 5FPDA 2RF2A 3MN9A 4O44A 1BCOA 1KTQA 3AA5X 3CCRN 5FRMA 2A1RA 4CBXA 3DMJA 2HHWA 1YAGA 4DR2K 3CQXA 1DKGD 4DV7K 2QWNA 5HRSA 2HNYA 3MEDA 5JS1A 3I33A 4H03B 3O8MA 4IKFA 3NF7A 3VQPA 4CHNA 2JWLA 4LF9K 3KK2A 2KTQA 3QMLA 1EWQA 3QERA 3OYBA 2DTUA 3LZIA 3HBTA 4Z4FA 1T8EA 4CJWA 3NF6A 1D8YA 3NMUA 1IJJA 2QXFA 4OLBA 1HUXA 1CLQA 1VQNN 3CCMN 3ALYA 2E1YA 3M8SA 1T03A 4FWPA 2HMIA 1KLNA 3V9SA 4ISEA 1WNSA 1RNHA 2HOEA 1BG3A 3FE1A 4FLWA 4LF8K 4HUGA 1RT6A 3SBTA 3BEXA 2P9PA 3PLAA 4FZZA 4B1WB 1KVBA 2A40A 2Y1JA 4KTZA 4OPAA 1P8ZA 3IRXA 3VQBA 1ITGA 2WBNA 1OVQA 3J8AA 5AQQA 4ICLA 4XEIA 2KZZA 3AVJA 3VA0A 4BDYA 1TAUA 4ID1A 4LFBK 3E01A 3CJ7A 1EXQA 4QCLA 1HJRA 1HPMA 3BZKA 3LZJA 3D2FB 3AVCA 3WNHA 3S3OA 4L8RB 2HBKA 5M1KA 3CC7N 3AA3A 4CZJA 5EY4A 2YKNA 1GOCA 3SZ2A 1TV6A 4GW6A 1Q18A 4IZ9A 4DTXA 2HNZA 3QEVA 2HF3A 1M90O 3U4LA 3ASMA 4DV5K 1NGAA 2IIRA 4BRGA 1REVA 1YVNA 4CFAA 4CECA 2HHUA 4BR2A 3BF1A 3THYA 3TSPA 1J53A 3LP1A 1OH6A 1S6QA 1U2VA 1JCEA 1NBWA 1LOTB 2YV0X 1YVUA 1QQMA 3KD5E 2O8FA 4O0IA 4JKGA 4DLEA 2Z1GA 4HVJA 2YNGA 3WXIA 3K57A 1KFSA 5BRFA 4B9LA 2HVIA 3PSFA 3PUFA 1RDDA 4JKCA 5AQRA 2ASPA 4B1YB 2W6LA 4CJRA 2JGUA 2BGGA 1RT4A 1EP4A 3VQ4A 3T19A 3I0SA 3KTQA 4CJPA 3EEQA 4YY3K 1LAWA 2BDPA 3RRHA 1JLBA 1BI4B 4B8CA 5AJ3K 4PL7A 4H5NA 4Z4HA 1VQ6N 3FZFA 3SNNA 3ZX0A 4B1XB 1WUAA 3ZT3A 4ZTJA 4CVNE 3K5OA 3R1XA 1ZBSA 3LAKA 2VWJA 4FWLA 3RMCA 4BACA 3U6FA 3IFRA 3THXB 1ZBUA 1VSLA 5DK5A 2CGKA 5CZ1A 4DTJA 5AZJA 5C2DA 4E19A 4DSFA 1SS6A 1NGGA 2DFHA 2RE2A 4W5OA 4BDZA 3DLEA 1V4SA 3LDQA 1DTTA 3AARA 4CF0A 4A5BA 5AFUH 3KLEA 3CFOA 3S3MA 2QEXN 2NNWA 4CZMA 4M3XA 4RW4A 4LF5K 4H8KA 5AQVA 3SQ0A 4H5TA 2CH5A 5AQHA 4GV3A 3HTVA 3K0SA 1NK9A 4IDKA 1NMDA 2P9IA 1BUPA 4BWMA 4ISGA 1GLLO 3VENA 4ELTA 3S41A 3O9SA 4CHPA 2W41A 4AM7A 1ILYA 1Q81O 3I55N 5CZ2A 3CC4N 3NGIA 3NVMA 1ZBIA 3VEVA 4BR4A 4AHTA 4CJ3A 4DR3K 2VWBA 4OJRA 3WT0A 4F9OA 5DMRA 4W5QA 1A5WA 3NVKA 3LDSA 3O9QA 4CJSA 1OH7A 3TAQA 3NGYA 4V19S 1NGCA 4CF2A 2EWSA 2Z1JA 3NE6A 5I42A 4F3TA 5J2NA 2ZGZA 3NF8A 1K8KB 1LAVA 4DV4K 2FBXA 1X1PA 1Y97A 4FLVA 1WSJA 4Y0WA 5CHIA 4KRFA 2ZJPL 2O8DB 4WFAL 3OY9A 5HOOA 1HKGA 2QWLA 3KZBA 3VQ6A 1BO5O 4AHRA 3A5LC 4X62K 2D0BA 5BN8A 1HKBA 1HKCA 3SI6A 5BR9A 3C7NA 3TSUA 3ZSQA 3L4IA 2ZJRL 2WC9A 4C1NK 5AQWA 3VQ8A 4FVMA 3M8PA 4DTPA 5AQLA 2XY6A 4FK0A 3TAFA 1WB9A 3ZEUB 3WEEB 4BE1A 4FLYA 1N6QA 4F4KA 3PY8A 2W40A 3AV9A 3QBXA 4GVMA 4PA1A 4PHTX 2OANA 3L3UA 1XUPO 3LDLA 1XI1A 1Y64A 1SZ2A 1C0FA 4KHUA 4CEOA 5AQGA 3EE9A 3FR0A 2YCHA 3LM2A 4WFBL 1NGHA 3LWMA 3NFAA 2D1KA 4C1NI 2BH1A 1VQPN 1BOTO 1QVGM 1S1XA 3PX6A 1VQ8N 1IBMK 4DMNA 2YHXA 4CHQA 4M41A 3NH1A 1RDBA 1OKJA 4N56A 3EKSA 3J80O 3QO9A 3OYIA 3SMSA 4MO5A 3LDNA 2GTDA 4IO8A 3HK2A 4IFYA 1N32K 3UB5A 3FLCO 3PIOL 4M3WA 5AQKA 1GLCG 4IOCL 3ZX2A 2D0CA 3CQ8A 2P9UA 1HNVA 5TKYA 3TAGA 1OH5A 4H0TB 1QQOA 3R8EA 1NKCA 2VYPA 3OYCA 3O3HA 4CBUA 2P9PB 2XHBA 3HP9A 3WUHA 1Q9YA 4FLTA 1JCFA 4JK8A 4RW9A 2HSTA 3TWHA 3VPZA 1QSLA 4IJNA 2CGJA 3O9TA 3I8BA 3QETA 4JKHA 4UQGA 1NLVA 4JI5K 1VSJA 3ATVA 5FPNA 1L3VA 4AQYK 3ISNC 3CFPA 1S9EA 3E1YA 3FZKA 2BUPA 4KV8A 5GADP 3KK1A 3SQ2A 3U3GA 3H1QA 3LP2A 4CGHA 1N36K 1K8AO 4CE9A 3TPQA 2G8KA 1Q7YO 5SZTA 4E7LA 3I8DA 4C8LA 1KVAA 3BY5A 3CJBA 4CJLA 4DWIA 4CZGA 4Y1CA 2FXUA 3DI6A 3CCQN 4H0YB 3CERA 3MXJA 1I94K 2YNHA 4EFHA 4KBOA 3WQUA 4K8ZA 5AQNA 5ADXH 1NOZA 4I6MB 1TK0A 1RBRA 3JAMO 4JNEA 4H5RA 3DXMA 4RW7A 1NJIO 2QWMA 1EKEA 3OYFA 1VSKA 3MN7A 2JWKA 3WXKA 4DB3A 3IMXA 3O08A 1A5VA 3VF4A 5JVGL 4BR5A 1NJXA 4LD0A 1RT3A 2JLEA 2PAVA 1SKRA 3C6TA 5DM7L 3VETA 2UU9K 3OYNA 5KGXA 2F4VK 3IDHA 3SBGA 4MLEA 3I0RA 4I9LA 3V1QA 4KKOA 2CH6A 2E2QA 1YTUA 1E3MA 1U04A 4O55A 5LY3A 3ATUA 3U9ZA 1JLEA 1O13A 4ZHRA 5GAHP 4HTLA 3OYJA 1HJOA 4JLHA 2QW9A 1BHLA 3A8YA 4YOUA 1MU2A 4I2PA 5AZIA 2I5JA 3ENHA 2NRHA 2WONA 3BP8A 5C10A 3DWLA 4G9ZA 4LH5A 3THWB 2G8VA 4F2RA 3O4WA 3ZYYX 1CZAN 1TUUA 3M1FA 3H45C 4H4OA 3GE1A 5KI6A 1J5EK 3THVA 2BE2A 2IOCA 1QQCA 3HYFA 2IAJA 4C8OA 4C8KA 3THXA 5AQMA 1A5XA 1WSFA 3QEPA 5FPMA 2YKMA 3TTFA 4E7HA 1MWKA 4CK1A 1KVCA 4M7YA 2FF6A 4MDBA 2KLAA 2P9NA 4BE2A 4NYFA 1GLAG 4OO1J 2HBMA 2Y1IA 2NZTA 4M3RA 3CF5L 5JLFA 5KPTA 4JN4A 2O8BA 2KKZA 1NK5A 5GIPA 1R59O 5HRNA 2QXLA 3GDQA 3QBWA 1L5UA 3LANA 1SAZA 3L4QA 4NB4A 3PO5A 4MLHA 1JLAA 3MECA 3RWUA 3F9MA 5KRTA 1LW2A 2O4GA 2YI1A 5M1FA 4M3UA 1VRUA 4C8NA 4FYDA 4CIGA 3TI0A 3TTCA 3AAQA 1VSMA 4IOXA 1KXPA 2KFZA 4JK7A 2WFBA 4FZYA 4DF4A 4DQIA 3DYAA 1JLQA 2P51A 4DSLA 4PKGA 3UE5A 1C1CA 1NJWA 4O5FA 4CIEA 2OPQA 2Q2RA 4CJFA 1QSSA 2Z1HA 2YX6A 4DSJA 2YNIA 4LSLA 4EAHD 3AO5A 4I2QA 5BRHA 4Q0BA 3D2EA 1VQ5N 4JI2K 3CCSN 1NG9A 4NCBA 2XY7A 4FJXA 2O8DA 2H3GX 1RDAA 1QTMA 4BG9A 3RMAA 4CI6A 2HHHK 4JKEA 3EZWA 3AY9A 1BCMA 2UXCK 4N41A 3NF9A 4DV1K 3GOIA 3M8QA 5KQ8A 4XH4A 3LM9A 3ULEA 4RW6A 2E2OA 4DR6K 1XQSC 3U8XA 3P5JA 1GLJO 2ZGYA 4NLCA 4FZXC 5E84A 3O6WA 1GLEG 1ASVA 5EVZA 3ZEUA 4DS5A 3WEEA 5E41A 2D5RA 4NLBA 1TK5A 3ZSXA 1WAJA 2RN2A 3WXJA 4DTSA 1RDUA 3WXMB 1BA0A 4JEPA 2QWQA 3SAHA 4ILGB 3L8BA 3K9JA 3SJHA 3KWIA 3MCPA 1G99A 3VTHA 3AA2A 4DFKA 1XNQK 5KPZA 1LV5A 1NJYA 3JYTA 5CYQA 3O1BA 3K5MA 4H0OA 2WUSA 4YNQA 2YNFA 3L2RA 4FL9A 4MDAA 1NMNA 3EZ5A 4GNIA 1OH8A 5M1QA 3NBPA 1NK8A 4K41A 4KHYA 5AQUA 4CZKA 5SWMA 3OW2M 1W7AA 4KI4A 1RT5A 1HQUA 3G6EN 3HZ6A 3DLLL 3VOVA 3TAPA 3C6UA 1J54A 2VCPA 2VQEK 3O9RA 1BWFO 1KQSM 1EQYA 1B9DA 3KHYA 3QIPA 3L2WA 2D0OA 3HPHA 2V52B 4X64K 3UKRB 1E4GT 1O1WA 1YUWA 3N4QA 1N34K 3J7AP 3OYHA 3ZLJA 4FPAA 3CCVN 1FKOA 4IO9L 3BZCA 3K58A 3EY1A 1SL2A 3P1GA 4HCCA 2WOMA 1UA0A 1JCGA 1M1KO 3NDKA 2D4WA 1HMVA 2UXDK 2UUBK 3H6EA 3CI5A 3GG4A 1BL3A 1K9MO 1LWCA 3G71N 2IVOA 4FJ9A 1B92A 2O8EB 1DLOA 1Z25A 5LJVA 4BWJA 2J4RA 3LDPA 4FLXA 4W5TA 2OYQA 3DLKA 2GX9A 1BQMA 3KK7A 2R7YA 4MFBA 1RTIA 3LWLA 5C25A 4JKDA 4OPJA 3SUNA 2Q3SA 3T3FA 4CZEA 1J5OA 5D3GA 4FWMA 4JV5K 3ZSZA 4DR5K 1UA1A 4ELVA 4X66K 1NM1A 3CCEN 1S5JA 2QI2A 4IXCA 5C15A 4CEEA 4HWIA 4U67L 3S9HA 4EZ9A 4CJKA 2O8CA 1S3XA 3VF6A 4IG3A 2DFEA 4YDUC 3RMDA 3ZCMA 4IEIA 4GKJK 3LDOA 4BRQA 2VGMA 1VSDA 5I9EB 4A59A 2AJQA 4X65K 1U2VB 4WQ4C 2UYTA 4EP5A 5HLFA 1KFDA 1RDCA 1JKHA 1QE1A 2YHAA 3CIPA 1S72N 5JLHA 2FSJA 2Q0RA 3ZSVA 4BC4A 4YHHK 3OYDA 2GWKA 5ADXA 4B08A 5MLCQ 2HW3A 2KZMA 4J8FA 4JI1K 4CEAA 3O4QA 3OS1A 1IO2A 4DG1A 4BRCA 3HOTA 5KPRA 3LPUA 3QLHA 2A1SA 4K25A 4KHWA 2E2NA 3MX5A 3WXLA 2P9KB 5AQXA 4AHCA 4IEEA 4CGIA 1Z26A 1NK0A 3VQAA 5TKWA 2PY5A 2YHYA 4FM2A 1C0TA 4DTNA 1IKXA 1TKTA 1S1UA 1KD1O 2ITMA 4DSEA 1HPZA 4JI8K 2G8WA 4CZHA 2NRTA 2NRRA 4I9QA 1XC9A 1HYSA 4AHUA 4EIAA 3QEIA 2P9NB 3A5OC 4WFNL 3OS2A 4A5AA 3L6QA 1SL1A 3M5RA 1YF5L 4JI7K 4CIFA 3E66A 5KGWA 3HL8A 2E5LK 3SAFA 5CE3A 1W2BM 5A2QO 3TABA 3F9KA 3J7YP 5GAGP 1VQMN 3AAPA 3V1RA 4CEQA 1TAQA 3RTVA 2FSNA 2X78A 1KCFA 4HHTA 3SMPA 3AVAA 4DV6K 4CZLA 3SCXA 3T1AA 1TYQB 4JKBA 4FWOA 1HR0K 1NGDA 1BU6O 4ILHA 4EHUA 1WSEA 4CJ7A 3VQQA 3V81A 1S1VA 2NRWA 3FZHA 3ZETB 1QS4A 3FFIA 4BREA 4Q5VA 3CPEA 3OS0A 4FVUA 3SAGA 3P38A 1DEJA 4FJMA 2E2PA 5LL6Z 3CM6A 4R5PA 2FC0A 1EWRA 4C23A 5HROA 3RR7A 4TSXA 3VESA 5AQIA 2YHBA 3C65A 5HRPA 3HO1A 2BTFA 2P5GA 4MO4A 3OJUA 1WOQA 4OPHA 1U47A 5FROA 1Z05A 2ZM6K 5BN9A 1U6ZA 4CW7B 3D2EB 4CJVA 3R6MA 3KLFA 3AO3A 1Q8IA 2PZSA 4CF1A 1KAZA 1WSHA 3AVKA 4CJ4A 3ZT4A 4J2EA 3MCAB 3MAQA 4WQ5A 2P9LA 1NKBA 1JLFA 1NGEA 2HHVA 2PYJA 4LY7A 1TL1A 3H08A 4O0JA 5BRDA 3CMEN 4N47A 4CEZA 1L3UA 1KC8O 4WYBA 3KLHA 3TTDA 5HL7L 4F8RA 2V7ZA 2F8TA 3TAEA 3TAMA 4AHSA 3C7NB 1UOCA 2A5XA 4DKWA 4H0PA 3HVTA 1ZYQA 2YJEA 2DFFA 1QZ6A 3M8RA 4JKAA 2HF4A 2OPRA 3CJ1A 3A5NC 3MN5A 4BRHA 4BQZA 1SQKA 2B5JA 4CEBA 3HJFA 3AVMA 4CFDA 4XIUA 4GV9A 4GMJB 5GIOA 1HNWK 1VSIA 1RFQA 4JHDB 3DLHA 1LWEA 4E7JA 4FW2A 3VA3A 3MX2A 1ATRA 1WSIA 2E6MA 2Q31A 5JMVA 3U3YA 3NGZA 3BF3A 2ZJQL 4QS7A 1I3AA 4IWVA 3OVNA 5C12A 2XO7A 4PL8A 1DT9A 4E1NA 4QOZB 4DUZK 1N5YA 4AHVA 4B9VA 4NXMK 1RTHA 2E1ZA 4BR9A 3OYKA 2IGIA 3PSIA 3J81O 1U45A 2OA8A 5FRNA 3D45A 2GWJA 4BRAA 1JXBA 2EX3A 4IFEA 3ZSWA 2I7NA 5BPMA 3CMAN 3AO4A 1EX4A 3MXMA 2UUAK 3LL3A 4CGJA 4LFAK 4JS5A 4RG8A 3TU5A 1UAXA 3RSEA 4CFCA 4E1MA 3MEEA 1NKEA 4CBWA 3RMBA 4CERA 3PIPL 4DUYK 1RBVA 3SYZA 3CFRA 1R0AA 4K0KK 5H1SQ 2Q36A 2KQ2A 2RPIA 1C0UA 4N76A 4KO0A 3R3LA 4DU4A 4CZFA 4WQ5C 4DR7K 3D0PA 1KRPA 4PWDA 2RHKA 3HPGA 1T6CA 4JI4K 3WNEA 3AGKA 4QS9A 1KSPA 3CQYA 2PFUA 3HSTB 5LJWA 1KAYA 3H3NO 2FF3B 2O8EA 3QFUA 3DOLA 3VGLA 4CHOA 3B8AX 5AFUA 5BPLA 4BC2A 3CJ9A 3UKUA 2E88A 2Q1NA 2B4JA 3T7ZA 4O8KA 1RGIA 3J7ZO 4YOXA 5JVHL 3ULDA 1BA1A 2NRZA 4JAXA 3VEZA 3MXIA 1C1BA 3DJCA 3RRGA 2G8IA 2FSKA 1JLGA 4AH9A 4I6MA 3HM8A 4XH5A 4Z4IA 1D5AA 3SUQA 2UXBK 4FWKA 3D6RA 3QESA 3CYMA 3DM2A 3DXMB 2A41A 3OBWA 3WNFA 4E1JA 4B3SK 3E9OA 2P9SA 1XHZA 1SKWA 1YJ9N 4CJEA 3IG1A 4BRPA 3M6GA 5BREA 4FK2A 2IDOA 1Q82O 3KKRA 2OTLN 1CXQA 3L2QA 3L3VA 4ILJA 4Z4GA
chains in the Genus database with same CATH topology
1XNRK 4DV5K 4X65K 2UUAK 1N33K 4LFAK 4JI0K 4DR2K 4OX9K 4DV7K 3T1HK 4YHHK 1IBMK 4LF6K 1FJGK 2UU9K 4DUYK 2F4VK 2ZM6K 4B3MK 3J80O 4K0KK 4CW7B 4JI1K 2VQEK 4LF9K 4DR3K 4DR7K 4X64K 1N32K 1N34K 3J7AP 4JI4K 4JI2K 4V19S 4LFCK 1HNXK 1IBLK 4DR1K 4JI6K 5LMNK 4DV4K 2HHHK 4DR4K 2UXCK 4DV1K 4YY3K 2UXDK 2UUBK 4LF8K 4JI8K 4DV0K 1J5EK 5AJ3K 5IWAK 4JI5K 4DR6K 4X62K 4B3TK 4AQYK 4KHPK 5FLXO 2VQFK 4JI7K 2UUCK 4B3RK 4JYAK 4CVNE 2E5LK 5IT9O 1N36K 5A2QO 4LFBK 4NXNK 3J7YP 5LMUK 4JV5K 1HNWK 4DR5K 4X66K 4LF7K 2UXBK 4DV6K 5BR8K 1I94K 1XNQK 4DV2K 1HR0K 4B3SK 3T1YK 1XMOK 4JI3K 1HNZK 4GKKK 4LF4K 4DUZK 3JAMO 4NXMK 4LF5K 3J81O 4DV3K 1IBKK 1XMQK 4GKJK 3OTOK 5LL6Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR K;  4DV5 K;  4X65 K;  2UUA K;  1N33 K;  4LFA K;  4JI0 K;  4DR2 K;  4OX9 K;  4DV7 K;  3T1H K;  4YHH K;  1IBM K;  4LF6 K;  1FJG K;  2UU9 K;  4DUY K;  2F4V K;  2ZM6 K;  4B3M K;  3J80 O;  4K0K K;  4CW7 B;  4JI1 K;  2VQE K;  4LF9 K;  4DR3 K;  4DR7 K;  4X64 K;  1N32 K;  1N34 K;  3J7A P;  4JI4 K;  4JI2 K;  4V19 S;  4LFC K;  1HNX K;  1IBL K;  4DR1 K;  4JI6 K;  5LMN K;  4DV4 K;  2HHH K;  4DR4 K;  2UXC K;  4DV1 K;  4YY3 K;  2UXD K;  2UUB K;  4LF8 K;  4JI8 K;  4DV0 K;  1J5E K;  5AJ3 K;  5IWA K;  4JI5 K;  4DR6 K;  4X62 K;  4B3T K;  4AQY K;  4KHP K;  5FLX O;  2VQF K;  4JI7 K;  2UUC K;  4B3R K;  4JYA K;  4CVN E;  2E5L K;  5IT9 O;  1N36 K;  5A2Q O;  4LFB K;  4NXN K;  3J7Y P;  5LMU K;  4JV5 K;  1HNW K;  4DR5 K;  4X66 K;  4LF7 K;  2UXB K;  4DV6 K;  5BR8 K;  1I94 K;  1XNQ K;  4DV2 K;  1HR0 K;  4B3S K;  3T1Y K;  1XMO K;  4JI3 K;  1HNZ K;  4GKK K;  4LF4 K;  4DUZ K;  3JAM O;  4NXM K;  4LF5 K;  3J81 O;  4DV3 K;  1IBK K;  1XMQ K;  4GKJ K;  3OTO K;  5LL6 Z; 
#chains in the Genus database with same CATH topology
 3ZSY A;  2RKI A;  2HBJ A;  2FBT A;  1TK8 A;  3R9P A;  2Z1I A;  4WQ4 A;  3B6P A;  4FJL A;  4JI0 K;  4CEF A;  2BAN A;  3AVB A;  4CJ5 A;  3C0B A;  3DRS A;  1JXE A;  3VGK A;  4FK4 A;  2ZQB A;  5AQP A;  3VEO A;  3BUZ B;  4WCE L;  3SV3 A;  3QFP A;  1VQ4 N;  2PYL A;  3LAL A;  1VRT A;  4B3M K;  2P9K A;  5F1X A;  2B6A A;  1SL0 A;  1NWK A;  5AQJ A;  4E7I A;  1U48 A;  1FXX A;  2VWK A;  4KB0 A;  3QDK A;  4FWQ A;  3P39 A;  1C0M A;  5AZI B;  1X3N A;  4L3Q A;  2QWO A;  3THW A;  4FWR A;  4B1Z A;  3PX0 A;  3NHG A;  4KPY A;  1IKY A;  4CES A;  4BR7 A;  3DLG A;  4FLU A;  1GOB A;  5CR4 A;  4BVP A;  3EYZ A;  3MWT A;  3LP3 A;  3DRR A;  3ZT1 A;  3HI0 A;  3VQ7 A;  2G8F A;  4BR0 A;  1NGB A;  2QA4 N;  2FBV A;  3SPZ A;  2IVN A;  4HCB A;  4B3T K;  2OTJ N;  4KHP K;  4OGE A;  4QS8 A;  3RVC A;  3WNG A;  2VQF K;  1YJN N;  4BGB A;  5KQD A;  4JRP A;  1NU0 A;  4YOV A;  1RBU A;  2NRV A;  3A2F A;  3K9K A;  3TSQ A;  3MK6 A;  1TYQ A;  5HRR A;  2GBZ A;  4OVL A;  1IH7 A;  3SJJ A;  3Q7B A;  5LMU K;  3V1O A;  1WN7 A;  3ENO A;  1T44 A;  1VSE A;  3W3D A;  3L2V A;  1NK7 A;  3P31 A;  5M1N A;  1RCH A;  3CJC A;  3KK3 A;  5T7B A;  1SUQ A;  3QIN A;  3HP6 A;  3VF2 A;  3QIC A;  3JS6 A;  3K59 A;  5F0X A;  3ZET A;  2LSN A;  4K42 A;  3T1Y K;  1LCU A;  1HNZ K;  2V7Y A;  2HHQ A;  4GKK K;  1N8R O;  4LF4 K;  1WBD A;  2FBY A;  2GEM A;  1MWM A;  4B9S A;  4E0D A;  3D2F A;  4DQ8 A;  2VGN A;  2X74 A;  4CF9 A;  4A2A A;  1S9G A;  4C8M A;  3OTO K;  3KLI A;  1IKV A;  4M45 A;  4KRE A;  4JD2 B;  1VSH A;  3MWP A;  4F2S A;  4JKF A;  2A3Z A;  4DQS A;  5F2R A;  4FLZ A;  1EET A;  3IS9 A;  4KHN A;  4DFJ A;  2QKK A;  4FJ8 A;  3C6A A;  2AA4 A;  1C6V A;  4PUO A;  3OJS A;  4YOR A;  1K6Y A;  4RWT A;  3IKM A;  4DSI A;  3THY B;  4HTU A;  2HHS A;  4A62 A;  4CJT A;  3V9U A;  4FOE A;  3CM5 A;  2ETJ A;  4OGC A;  1GLD G;  1I39 A;  3FZM A;  3O80 A;  3AGR A;  4FM1 A;  3ULE B;  4FJJ A;  3CD6 N;  1J9A A;  1D9F A;  3AVF A;  1YHQ N;  1T6D A;  2ATQ A;  2E20 A;  4CFB A;  1QZ5 A;  1W0H A;  3E9P A;  5HBM A;  1E4F T;  1HYV A;  4E7K A;  2KFN A;  1GOA A;  1CZ9 A;  3AO2 A;  4OKE A;  3V9W A;  5AQS A;  1HX1 A;  5AQY A;  4PKI A;  4B1V A;  3EL2 A;  1S6P A;  4R79 A;  4M7X A;  4JHD A;  3QNO A;  4JYA K;  4DTR A;  3O1W A;  2OZS A;  1JJ2 M;  4FJ5 A;  3H46 O;  4J2B A;  1Q86 O;  1ASU A;  4HUF A;  3C6H A;  2QK9 A;  4BG8 A;  1S22 A;  2ASO A;  4FJH A;  5EXW A;  2VG6 A;  2KHO A;  4DTU A;  2F7T A;  2YJF A;  5C0Y A;  1RTJ A;  5GAE P;  3JSM A;  1KAX A;  4DV2 K;  1YJW N;  4N5S A;  1XMO K;  3ID8 A;  1ZC6 A;  2I7P A;  5EU7 A;  1IG9 A;  4BC3 A;  4ELU A;  2GV9 A;  1X9S A;  1J6Z A;  2A42 A;  2QKB A;  1TKX A;  3HSC A;  4YDU A;  4BVO A;  4RTF D;  2A6A A;  2QM1 A;  3RR8 A;  3GL1 A;  4CK3 A;  2W42 A;  4W5R A;  2F8S A;  1ZXO A;  4DFM A;  2E4L A;  4EZ6 A;  3F2K A;  3VQ5 A;  1YT3 A;  5J2Q A;  1JL1 A;  1IV0 A;  4WF9 L;  2P9I B;  3ID6 A;  3AVI A;  3UKR A;  2NUB A;  3OYL A;  3O5B A;  2P5O A;  2ASM A;  3N4P A;  3S3N A;  4B9U A;  2ZWH A;  3G25 A;  1QQN A;  5HP1 A;  3F73 A;  3DLB A;  1BGX T;  4DCH A;  1VSF A;  4Z4C A;  4Z94 A;  3V6D A;  1C0G A;  4DFP A;  2FLO A;  2F96 A;  1X9M A;  4BC5 A;  3ZX3 A;  1HNX K;  5BPN A;  3G4S N;  4DR1 K;  2G8U A;  3MN6 A;  4OPK A;  5J2M A;  4Z4E A;  4KHS A;  3CCU N;  3ZT2 A;  4LSN A;  4CED A;  3VGM A;  4YOW A;  3KKS A;  4KH4 A;  2PBD A;  1XWL A;  1VQK N;  5K14 A;  4FJN A;  1K8K A;  4M3Y A;  4Y1D A;  1B9F A;  4EP4 A;  4FJG A;  2NRX A;  4BRI A;  2ZE2 A;  3WQT A;  4ID5 A;  2EHG A;  3D7E O;  3KWG A;  4KB1 A;  1NJZ A;  4BE0 A;  4NCA A;  1WAF A;  3NCI A;  1H1V A;  1D9D A;  4RW8 A;  3M3Z A;  1YXQ A;  1Z6R A;  3LPT A;  2DY4 A;  4KH5 A;  1NGF A;  2P1J A;  3DXK A;  4NXN K;  4E3S A;  1LW0 A;  3VMF B;  3C94 A;  4JRQ A;  3OBY A;  4DQR A;  3EN9 A;  3O3G A;  2O8C B;  3DRP A;  4KTQ A;  1YI2 N;  4KH6 A;  3VQD A;  3SV4 A;  3OYM A;  1RBT A;  2VG7 A;  3VEW A;  4KAZ A;  1JLC A;  4CCH A;  4K8X A;  1TVR A;  3O4N A;  4CJQ A;  1XC3 A;  4DQP A;  4M42 A;  3UIQ A;  1TKD A;  1ZBH A;  4B9T A;  4M63 C;  4CGD A;  4KI6 A;  4BDP A;  3AVN A;  3QIO A;  4CJU A;  1WLJ A;  4DQQ A;  3I56 N;  4AIL C;  4DV3 K;  4CD1 A;  4FJI A;  1XMQ K;  3HPO A;  3A0I X;  3NH0 A;  1D4X A;  2HHT A;  5KRS A;  3SQ1 A;  1N33 K;  3EO3 A;  2O4I A;  5M1O A;  4J2A A;  4BRN A;  2GEL A;  4B9M A;  5AQF A;  4H0V B;  3F5T A;  1FKP A;  3H1V X;  1SKS A;  4IOA L;  1FJG K;  2YHW A;  4RCH A;  3SK3 A;  3TAR A;  4B9Q A;  2F9T A;  4XH1 A;  3SQ4 A;  2OPP A;  4ISF A;  3CJA A;  4K43 A;  1LWF A;  3KJV A;  4E89 A;  1FW6 A;  1CXU A;  4O8U A;  4H5W A;  3G0Z A;  3MDQ A;  4A61 A;  5EOY A;  3VTI A;  4QAG A;  3FFK B;  1V4T A;  1IBL K;  4IJA A;  2IC3 A;  5LMN K;  4O4G A;  1ATN A;  1T05 A;  4PQU A;  1VQL N;  2F9W A;  4DF8 A;  2IVP A;  2V51 B;  4FPB A;  4YFU A;  2P9U B;  3MEG A;  3LP0 A;  3CG7 A;  4F3O A;  3DAW A;  3SPY A;  5IWA K;  4PKH A;  3OA9 A;  2QWP A;  2XY8 A;  4A2B A;  3P4I A;  5DM6 L;  2D0A A;  5FLX O;  5JS2 A;  4DHY A;  5AR0 A;  5FDL A;  4LC9 B;  3CPW M;  1RIL A;  2HHX A;  1JL2 A;  3ZT0 A;  4CZI A;  1WSG A;  5CYM A;  1NOY A;  3V9X A;  1OVY A;  1T3V A;  4IDH A;  4DLG A;  3VEY A;  1QVF M;  3O9U A;  4LF7 K;  4YOY A;  3K2P A;  4FWS A;  4DS4 A;  1VQO N;  1BIZ A;  3MMV A;  3SUO A;  4WE1 A;  5KTQ A;  4JS4 A;  3AO1 A;  4ZTF A;  1G15 A;  4NCG A;  3VQ9 A;  3EKU A;  5CY4 A;  4DU1 A;  4KTW A;  1RT2 A;  4JD2 A;  4H4M A;  1C1A A;  2Q0U A;  3SUP A;  4H0X B;  4YOT A;  3GBT A;  4UY8 O;  3VQC A;  3H3O B;  1ZBF A;  4CGF A;  3NH2 A;  2KW4 A;  1BQN A;  1MDU B;  1NGJ A;  4OKK A;  4FO0 A;  4PY5 A;  3ENB A;  2G8H A;  1XNR K;  2WTU A;  2HMP A;  4DSK A;  5J1E A;  1HYZ A;  4DTO A;  4FW1 A;  1QHT A;  4OX9 K;  2D0P A;  5FPE A;  1W9H A;  3PX4 A;  2P9L B;  4A57 A;  2NLX A;  3KD1 E;  1S1W A;  5M1P A;  3BDP A;  3JXU A;  2ITG A;  5ELZ A;  1Q9X A;  1IG8 A;  2CGL A;  3A5M C;  4DTM A;  3QB0 A;  1X9J A;  4GV6 A;  3B6O A;  5J2P A;  4KFB A;  2X6N A;  4U7B A;  1NNE A;  1X3M A;  3G10 A;  4FSV A;  5AQO A;  4IFV A;  4BGA A;  3TR8 A;  2E8A A;  2O8F B;  4CK2 A;  3P83 D;  4JKG B;  3ZSO A;  4LFC K;  3BGR A;  1RT7 A;  1TUY A;  1EO1 A;  1P90 A;  4DR4 K;  1SV5 A;  1U49 A;  4JK9 A;  3O3F A;  1XHX A;  3AVL A;  4J2D A;  3L0Q A;  3KIO A;  3QEX A;  3CC2 N;  4DV0 K;  4FOI A;  5C42 A;  4EHT A;  4AF1 A;  1YIJ N;  3FGU A;  5AQT A;  2XY5 A;  4FM0 A;  3CCL N;  1W97 L;  3K5N A;  4CGG A;  3K5L A;  1NGI A;  3QEW A;  5I3U A;  3VQE A;  3HT3 A;  4B3R K;  3CHW A;  4IBN A;  2VG5 A;  5IT9 O;  2HB5 A;  1BI4 A;  1TGO A;  1QSY A;  1YIT N;  4FXD A;  1ZBL A;  4Z0U A;  5C24 A;  3OYA A;  1BIU A;  3QNN A;  1F21 A;  3Q7C A;  1NK4 A;  3ZSR A;  3CET A;  1TKZ A;  1VQ7 N;  4FJK A;  5BR8 K;  4W5N A;  2AP1 A;  4OLA A;  1RT1 A;  4FWN A;  2Q97 A;  3OYE A;  3FZL A;  3ITH A;  5AZJ B;  2O8B B;  1TL3 A;  4B8A B;  3IAY A;  3CXC M;  4CHZ A;  2DPN A;  5JIC A;  1GLF O;  3KVG A;  3RSE B;  3SLC A;  2OZM A;  1IBK K;  2HBL A;  5C2F A;  1ASW A;  3OYG A;  1T7P A;  3VN5 A;  4M3T A;  2HND A;  3NAE A;  4NYN A;  1VAZ A;  4KHQ A;  4GVE A;  3L2U A;  1ATS A;  3T1H K;  2XRI A;  4HUE A;  1L3S A;  2ZF5 O;  3AVG A;  1WBB A;  4LF6 K;  3KLG A;  1HNI A;  4B1U B;  4CHY A;  1FK9 A;  4BQL A;  3EE8 A;  3C95 A;  4O5B A;  1VHX A;  3HOS A;  4LH4 A;  3HXM A;  1U4B A;  1VK0 A;  1MA9 B;  2IS3 A;  3OHR A;  1RTD A;  4GY2 B;  3UKU B;  2ZD1 A;  5B8H A;  2HVH A;  2GUI A;  2E6L A;  5GIN A;  3V4I A;  4BRO A;  4JI6 K;  4CF8 A;  3VER A;  1S1T A;  4NO7 A;  2OPS A;  3T69 A;  3DOK A;  4B9N A;  3HM9 A;  3W0L A;  2QWR A;  1YTA A;  3LAM A;  1HQE A;  1HLU A;  2X6S A;  4AM6 A;  4FCY A;  1QHA A;  3PV8 A;  3VEX A;  4BRD A;  1BDG A;  4FJ7 A;  4BRM A;  4M3Z A;  3DLR A;  5AQZ A;  1NK6 A;  1DGK N;  4DU3 A;  2GUP A;  3DXK B;  3PO4 A;  1RBS A;  1BIS A;  1GLB G;  4MQ3 A;  2UUC K;  5EX5 A;  1IKW A;  1ESV A;  3HVR A;  4I7F A;  2W6K A;  4BY9 C;  3E9L A;  3CCJ N;  2OCE A;  3U9D A;  3IUC A;  2P9S B;  3TAN A;  4H5V A;  1RDW X;  3AVH A;  4G1Q A;  4CD3 A;  1VQ9 N;  1UWB A;  4IG0 A;  3HRG A;  1DTQ A;  1CZB A;  4BRK A;  4JI3 K;  5E26 A;  1K73 O;  1HRH A;  1X9W A;  3AA4 A;  4BRL A;  1L3T A;  1KLM A;  4B3O A;  4BRF A;  4OKJ A;  3V9Z A;  2QTD A;  5FPD A;  2RF2 A;  3MN9 A;  4O44 A;  1BCO A;  1KTQ A;  3AA5 X;  3CCR N;  5FRM A;  2A1R A;  4CBX A;  3DMJ A;  2HHW A;  1YAG A;  4DR2 K;  3CQX A;  1DKG D;  4DV7 K;  2QWN A;  5HRS A;  2HNY A;  3MED A;  5JS1 A;  3I33 A;  4H03 B;  3O8M A;  4IKF A;  3NF7 A;  3VQP A;  4CHN A;  2JWL A;  4LF9 K;  3KK2 A;  2KTQ A;  3QML A;  1EWQ A;  3QER A;  3OYB A;  2DTU A;  3LZI A;  3HBT A;  4Z4F A;  1T8E A;  4CJW A;  3NF6 A;  1D8Y A;  3NMU A;  1IJJ A;  2QXF A;  4OLB A;  1HUX A;  1CLQ A;  1VQN N;  3CCM N;  3ALY A;  2E1Y A;  3M8S A;  1T03 A;  4FWP A;  2HMI A;  1KLN A;  3V9S A;  4ISE A;  1WNS A;  1RNH A;  2HOE A;  1BG3 A;  3FE1 A;  4FLW A;  4LF8 K;  4HUG A;  1RT6 A;  3SBT A;  3BEX A;  2P9P A;  3PLA A;  4FZZ A;  4B1W B;  1KVB A;  2A40 A;  2Y1J A;  4KTZ A;  4OPA A;  1P8Z A;  3IRX A;  3VQB A;  1ITG A;  2WBN A;  1OVQ A;  3J8A A;  5AQQ A;  4ICL A;  4XEI A;  2KZZ A;  3AVJ A;  3VA0 A;  4BDY A;  1TAU A;  4ID1 A;  4LFB K;  3E01 A;  3CJ7 A;  1EXQ A;  4QCL A;  1HJR A;  1HPM A;  3BZK A;  3LZJ A;  3D2F B;  3AVC A;  3WNH A;  3S3O A;  4L8R B;  2HBK A;  5M1K A;  3CC7 N;  3AA3 A;  4CZJ A;  5EY4 A;  2YKN A;  1GOC A;  3SZ2 A;  1TV6 A;  4GW6 A;  1Q18 A;  4IZ9 A;  4DTX A;  2HNZ A;  3QEV A;  2HF3 A;  1M90 O;  3U4L A;  3ASM A;  4DV5 K;  1NGA A;  2IIR A;  4BRG A;  1REV A;  1YVN A;  4CFA A;  4CEC A;  2HHU A;  4BR2 A;  3BF1 A;  3THY A;  3TSP A;  1J53 A;  3LP1 A;  1OH6 A;  1S6Q A;  1U2V A;  1JCE A;  1NBW A;  1LOT B;  2YV0 X;  1YVU A;  1QQM A;  3KD5 E;  2O8F A;  4O0I A;  4JKG A;  4DLE A;  2Z1G A;  4HVJ A;  2YNG A;  3WXI A;  3K57 A;  1KFS A;  5BRF A;  4B9L A;  2HVI A;  3PSF A;  3PUF A;  1RDD A;  4JKC A;  5AQR A;  2ASP A;  4B1Y B;  2W6L A;  4CJR A;  2JGU A;  2BGG A;  1RT4 A;  1EP4 A;  3VQ4 A;  3T19 A;  3I0S A;  3KTQ A;  4CJP A;  3EEQ A;  4YY3 K;  1LAW A;  2BDP A;  3RRH A;  1JLB A;  1BI4 B;  4B8C A;  5AJ3 K;  4PL7 A;  4H5N A;  4Z4H A;  1VQ6 N;  3FZF A;  3SNN A;  3ZX0 A;  4B1X B;  1WUA A;  3ZT3 A;  4ZTJ A;  4CVN E;  3K5O A;  3R1X A;  1ZBS A;  3LAK A;  2VWJ A;  4FWL A;  3RMC A;  4BAC A;  3U6F A;  3IFR A;  3THX B;  1ZBU A;  1VSL A;  5DK5 A;  2CGK A;  5CZ1 A;  4DTJ A;  5AZJ A;  5C2D A;  4E19 A;  4DSF A;  1SS6 A;  1NGG A;  2DFH A;  2RE2 A;  4W5O A;  4BDZ A;  3DLE A;  1V4S A;  3LDQ A;  1DTT A;  3AAR A;  4CF0 A;  4A5B A;  5AFU H;  3KLE A;  3CFO A;  3S3M A;  2QEX N;  2NNW A;  4CZM A;  4M3X A;  4RW4 A;  4LF5 K;  4H8K A;  5AQV A;  3SQ0 A;  4H5T A;  2CH5 A;  5AQH A;  4GV3 A;  3HTV A;  3K0S A;  1NK9 A;  4IDK A;  1NMD A;  2P9I A;  1BUP A;  4BWM A;  4ISG A;  1GLL O;  3VEN A;  4ELT A;  3S41 A;  3O9S A;  4CHP A;  2W41 A;  4AM7 A;  1ILY A;  1Q81 O;  3I55 N;  5CZ2 A;  3CC4 N;  3NGI A;  3NVM A;  1ZBI A;  3VEV A;  4BR4 A;  4AHT A;  4CJ3 A;  4DR3 K;  2VWB A;  4OJR A;  3WT0 A;  4F9O A;  5DMR A;  4W5Q A;  1A5W A;  3NVK A;  3LDS A;  3O9Q A;  4CJS A;  1OH7 A;  3TAQ A;  3NGY A;  4V19 S;  1NGC A;  4CF2 A;  2EWS A;  2Z1J A;  3NE6 A;  5I42 A;  4F3T A;  5J2N A;  2ZGZ A;  3NF8 A;  1K8K B;  1LAV A;  4DV4 K;  2FBX A;  1X1P A;  1Y97 A;  4FLV A;  1WSJ A;  4Y0W A;  5CHI A;  4KRF A;  2ZJP L;  2O8D B;  4WFA L;  3OY9 A;  5HOO A;  1HKG A;  2QWL A;  3KZB A;  3VQ6 A;  1BO5 O;  4AHR A;  3A5L C;  4X62 K;  2D0B A;  5BN8 A;  1HKB A;  1HKC A;  3SI6 A;  5BR9 A;  3C7N A;  3TSU A;  3ZSQ A;  3L4I A;  2ZJR L;  2WC9 A;  4C1N K;  5AQW A;  3VQ8 A;  4FVM A;  3M8P A;  4DTP A;  5AQL A;  2XY6 A;  4FK0 A;  3TAF A;  1WB9 A;  3ZEU B;  3WEE B;  4BE1 A;  4FLY A;  1N6Q A;  4F4K A;  3PY8 A;  2W40 A;  3AV9 A;  3QBX A;  4GVM A;  4PA1 A;  4PHT X;  2OAN A;  3L3U A;  1XUP O;  3LDL A;  1XI1 A;  1Y64 A;  1SZ2 A;  1C0F A;  4KHU A;  4CEO A;  5AQG A;  3EE9 A;  3FR0 A;  2YCH A;  3LM2 A;  4WFB L;  1NGH A;  3LWM A;  3NFA A;  2D1K A;  4C1N I;  2BH1 A;  1VQP N;  1BOT O;  1QVG M;  1S1X A;  3PX6 A;  1VQ8 N;  1IBM K;  4DMN A;  2YHX A;  4CHQ A;  4M41 A;  3NH1 A;  1RDB A;  1OKJ A;  4N56 A;  3EKS A;  3J80 O;  3QO9 A;  3OYI A;  3SMS A;  4MO5 A;  3LDN A;  2GTD A;  4IO8 A;  3HK2 A;  4IFY A;  1N32 K;  3UB5 A;  3FLC O;  3PIO L;  4M3W A;  5AQK A;  1GLC G;  4IOC L;  3ZX2 A;  2D0C A;  3CQ8 A;  2P9U A;  1HNV A;  5TKY A;  3TAG A;  1OH5 A;  4H0T B;  1QQO A;  3R8E A;  1NKC A;  2VYP A;  3OYC A;  3O3H A;  4CBU A;  2P9P B;  2XHB A;  3HP9 A;  3WUH A;  1Q9Y A;  4FLT A;  1JCF A;  4JK8 A;  4RW9 A;  2HST A;  3TWH A;  3VPZ A;  1QSL A;  4IJN A;  2CGJ A;  3O9T A;  3I8B A;  3QET A;  4JKH A;  4UQG A;  1NLV A;  4JI5 K;  1VSJ A;  3ATV A;  5FPN A;  1L3V A;  4AQY K;  3ISN C;  3CFP A;  1S9E A;  3E1Y A;  3FZK A;  2BUP A;  4KV8 A;  5GAD P;  3KK1 A;  3SQ2 A;  3U3G A;  3H1Q A;  3LP2 A;  4CGH A;  1N36 K;  1K8A O;  4CE9 A;  3TPQ A;  2G8K A;  1Q7Y O;  5SZT A;  4E7L A;  3I8D A;  4C8L A;  1KVA A;  3BY5 A;  3CJB A;  4CJL A;  4DWI A;  4CZG A;  4Y1C A;  2FXU A;  3DI6 A;  3CCQ N;  4H0Y B;  3CER A;  3MXJ A;  1I94 K;  2YNH A;  4EFH A;  4KBO A;  3WQU A;  4K8Z A;  5AQN A;  5ADX H;  1NOZ A;  4I6M B;  1TK0 A;  1RBR A;  3JAM O;  4JNE A;  4H5R A;  3DXM A;  4RW7 A;  1NJI O;  2QWM A;  1EKE A;  3OYF A;  1VSK A;  3MN7 A;  2JWK A;  3WXK A;  4DB3 A;  3IMX A;  3O08 A;  1A5V A;  3VF4 A;  5JVG L;  4BR5 A;  1NJX A;  4LD0 A;  1RT3 A;  2JLE A;  2PAV A;  1SKR A;  3C6T A;  5DM7 L;  3VET A;  2UU9 K;  3OYN A;  5KGX A;  2F4V K;  3IDH A;  3SBG A;  4MLE A;  3I0R A;  4I9L A;  3V1Q A;  4KKO A;  2CH6 A;  2E2Q A;  1YTU A;  1E3M A;  1U04 A;  4O55 A;  5LY3 A;  3ATU A;  3U9Z A;  1JLE A;  1O13 A;  4ZHR A;  5GAH P;  4HTL A;  3OYJ A;  1HJO A;  4JLH A;  2QW9 A;  1BHL A;  3A8Y A;  4YOU A;  1MU2 A;  4I2P A;  5AZI A;  2I5J A;  3ENH A;  2NRH A;  2WON A;  3BP8 A;  5C10 A;  3DWL A;  4G9Z A;  4LH5 A;  3THW B;  2G8V A;  4F2R A;  3O4W A;  3ZYY X;  1CZA N;  1TUU A;  3M1F A;  3H45 C;  4H4O A;  3GE1 A;  5KI6 A;  1J5E K;  3THV A;  2BE2 A;  2IOC A;  1QQC A;  3HYF A;  2IAJ A;  4C8O A;  4C8K A;  3THX A;  5AQM A;  1A5X A;  1WSF A;  3QEP A;  5FPM A;  2YKM A;  3TTF A;  4E7H A;  1MWK A;  4CK1 A;  1KVC A;  4M7Y A;  2FF6 A;  4MDB A;  2KLA A;  2P9N A;  4BE2 A;  4NYF A;  1GLA G;  4OO1 J;  2HBM A;  2Y1I A;  2NZT A;  4M3R A;  3CF5 L;  5JLF A;  5KPT A;  4JN4 A;  2O8B A;  2KKZ A;  1NK5 A;  5GIP A;  1R59 O;  5HRN A;  2QXL A;  3GDQ A;  3QBW A;  1L5U A;  3LAN A;  1SAZ A;  3L4Q A;  4NB4 A;  3PO5 A;  4MLH A;  1JLA A;  3MEC A;  3RWU A;  3F9M A;  5KRT A;  1LW2 A;  2O4G A;  2YI1 A;  5M1F A;  4M3U A;  1VRU A;  4C8N A;  4FYD A;  4CIG A;  3TI0 A;  3TTC A;  3AAQ A;  1VSM A;  4IOX A;  1KXP A;  2KFZ A;  4JK7 A;  2WFB A;  4FZY A;  4DF4 A;  4DQI A;  3DYA A;  1JLQ A;  2P51 A;  4DSL A;  4PKG A;  3UE5 A;  1C1C A;  1NJW A;  4O5F A;  4CIE A;  2OPQ A;  2Q2R A;  4CJF A;  1QSS A;  2Z1H A;  2YX6 A;  4DSJ A;  2YNI A;  4LSL A;  4EAH D;  3AO5 A;  4I2Q A;  5BRH A;  4Q0B A;  3D2E A;  1VQ5 N;  4JI2 K;  3CCS N;  1NG9 A;  4NCB A;  2XY7 A;  4FJX A;  2O8D A;  2H3G X;  1RDA A;  1QTM A;  4BG9 A;  3RMA A;  4CI6 A;  2HHH K;  4JKE A;  3EZW A;  3AY9 A;  1BCM A;  2UXC K;  4N41 A;  3NF9 A;  4DV1 K;  3GOI A;  3M8Q A;  5KQ8 A;  4XH4 A;  3LM9 A;  3ULE A;  4RW6 A;  2E2O A;  4DR6 K;  1XQS C;  3U8X A;  3P5J A;  1GLJ O;  2ZGY A;  4NLC A;  4FZX C;  5E84 A;  3O6W A;  1GLE G;  1ASV A;  5EVZ A;  3ZEU A;  4DS5 A;  3WEE A;  5E41 A;  2D5R A;  4NLB A;  1TK5 A;  3ZSX A;  1WAJ A;  2RN2 A;  3WXJ A;  4DTS A;  1RDU A;  3WXM B;  1BA0 A;  4JEP A;  2QWQ A;  3SAH A;  4ILG B;  3L8B A;  3K9J A;  3SJH A;  3KWI A;  3MCP A;  1G99 A;  3VTH A;  3AA2 A;  4DFK A;  1XNQ K;  5KPZ A;  1LV5 A;  1NJY A;  3JYT A;  5CYQ A;  3O1B A;  3K5M A;  4H0O A;  2WUS A;  4YNQ A;  2YNF A;  3L2R A;  4FL9 A;  4MDA A;  1NMN A;  3EZ5 A;  4GNI A;  1OH8 A;  5M1Q A;  3NBP A;  1NK8 A;  4K41 A;  4KHY A;  5AQU A;  4CZK A;  5SWM A;  3OW2 M;  1W7A A;  4KI4 A;  1RT5 A;  1HQU A;  3G6E N;  3HZ6 A;  3DLL L;  3VOV A;  3TAP A;  3C6U A;  1J54 A;  2VCP A;  2VQE K;  3O9R A;  1BWF O;  1KQS M;  1EQY A;  1B9D A;  3KHY A;  3QIP A;  3L2W A;  2D0O A;  3HPH A;  2V52 B;  4X64 K;  3UKR B;  1E4G T;  1O1W A;  1YUW A;  3N4Q A;  1N34 K;  3J7A P;  3OYH A;  3ZLJ A;  4FPA A;  3CCV N;  1FKO A;  4IO9 L;  3BZC A;  3K58 A;  3EY1 A;  1SL2 A;  3P1G A;  4HCC A;  2WOM A;  1UA0 A;  1JCG A;  1M1K O;  3NDK A;  2D4W A;  1HMV A;  2UXD K;  2UUB K;  3H6E A;  3CI5 A;  3GG4 A;  1BL3 A;  1K9M O;  1LWC A;  3G71 N;  2IVO A;  4FJ9 A;  1B92 A;  2O8E B;  1DLO A;  1Z25 A;  5LJV A;  4BWJ A;  2J4R A;  3LDP A;  4FLX A;  4W5T A;  2OYQ A;  3DLK A;  2GX9 A;  1BQM A;  3KK7 A;  2R7Y A;  4MFB A;  1RTI A;  3LWL A;  5C25 A;  4JKD A;  4OPJ A;  3SUN A;  2Q3S A;  3T3F A;  4CZE A;  1J5O A;  5D3G A;  4FWM A;  4JV5 K;  3ZSZ A;  4DR5 K;  1UA1 A;  4ELV A;  4X66 K;  1NM1 A;  3CCE N;  1S5J A;  2QI2 A;  4IXC A;  5C15 A;  4CEE A;  4HWI A;  4U67 L;  3S9H A;  4EZ9 A;  4CJK A;  2O8C A;  1S3X A;  3VF6 A;  4IG3 A;  2DFE A;  4YDU C;  3RMD A;  3ZCM A;  4IEI A;  4GKJ K;  3LDO A;  4BRQ A;  2VGM A;  1VSD A;  5I9E B;  4A59 A;  2AJQ A;  4X65 K;  1U2V B;  4WQ4 C;  2UYT A;  4EP5 A;  5HLF A;  1KFD A;  1RDC A;  1JKH A;  1QE1 A;  2YHA A;  3CIP A;  1S72 N;  5JLH A;  2FSJ A;  2Q0R A;  3ZSV A;  4BC4 A;  4YHH K;  3OYD A;  2GWK A;  5ADX A;  4B08 A;  5MLC Q;  2HW3 A;  2KZM A;  4J8F A;  4JI1 K;  4CEA A;  3O4Q A;  3OS1 A;  1IO2 A;  4DG1 A;  4BRC A;  3HOT A;  5KPR A;  3LPU A;  3QLH A;  2A1S A;  4K25 A;  4KHW A;  2E2N A;  3MX5 A;  3WXL A;  2P9K B;  5AQX A;  4AHC A;  4IEE A;  4CGI A;  1Z26 A;  1NK0 A;  3VQA A;  5TKW A;  2PY5 A;  2YHY A;  4FM2 A;  1C0T A;  4DTN A;  1IKX A;  1TKT A;  1S1U A;  1KD1 O;  2ITM A;  4DSE A;  1HPZ A;  4JI8 K;  2G8W A;  4CZH A;  2NRT A;  2NRR A;  4I9Q A;  1XC9 A;  1HYS A;  4AHU A;  4EIA A;  3QEI A;  2P9N B;  3A5O C;  4WFN L;  3OS2 A;  4A5A A;  3L6Q A;  1SL1 A;  3M5R A;  1YF5 L;  4JI7 K;  4CIF A;  3E66 A;  5KGW A;  3HL8 A;  2E5L K;  3SAF A;  5CE3 A;  1W2B M;  5A2Q O;  3TAB A;  3F9K A;  3J7Y P;  5GAG P;  1VQM N;  3AAP A;  3V1R A;  4CEQ A;  1TAQ A;  3RTV A;  2FSN A;  2X78 A;  1KCF A;  4HHT A;  3SMP A;  3AVA A;  4DV6 K;  4CZL A;  3SCX A;  3T1A A;  1TYQ B;  4JKB A;  4FWO A;  1HR0 K;  1NGD A;  1BU6 O;  4ILH A;  4EHU A;  1WSE A;  4CJ7 A;  3VQQ A;  3V81 A;  1S1V A;  2NRW A;  3FZH A;  3ZET B;  1QS4 A;  3FFI A;  4BRE A;  4Q5V A;  3CPE A;  3OS0 A;  4FVU A;  3SAG A;  3P38 A;  1DEJ A;  4FJM A;  2E2P A;  5LL6 Z;  3CM6 A;  4R5P A;  2FC0 A;  1EWR A;  4C23 A;  5HRO A;  3RR7 A;  4TSX A;  3VES A;  5AQI A;  2YHB A;  3C65 A;  5HRP A;  3HO1 A;  2BTF A;  2P5G A;  4MO4 A;  3OJU A;  1WOQ A;  4OPH A;  1U47 A;  5FRO A;  1Z05 A;  2ZM6 K;  5BN9 A;  1U6Z A;  4CW7 B;  3D2E B;  4CJV A;  3R6M A;  3KLF A;  3AO3 A;  1Q8I A;  2PZS A;  4CF1 A;  1KAZ A;  1WSH A;  3AVK A;  4CJ4 A;  3ZT4 A;  4J2E A;  3MCA B;  3MAQ A;  4WQ5 A;  2P9L A;  1NKB A;  1JLF A;  1NGE A;  2HHV A;  2PYJ A;  4LY7 A;  1TL1 A;  3H08 A;  4O0J A;  5BRD A;  3CME N;  4N47 A;  4CEZ A;  1L3U A;  1KC8 O;  4WYB A;  3KLH A;  3TTD A;  5HL7 L;  4F8R A;  2V7Z A;  2F8T A;  3TAE A;  3TAM A;  4AHS A;  3C7N B;  1UOC A;  2A5X A;  4DKW A;  4H0P A;  3HVT A;  1ZYQ A;  2YJE A;  2DFF A;  1QZ6 A;  3M8R A;  4JKA A;  2HF4 A;  2OPR A;  3CJ1 A;  3A5N C;  3MN5 A;  4BRH A;  4BQZ A;  1SQK A;  2B5J A;  4CEB A;  3HJF A;  3AVM A;  4CFD A;  4XIU A;  4GV9 A;  4GMJ B;  5GIO A;  1HNW K;  1VSI A;  1RFQ A;  4JHD B;  3DLH A;  1LWE A;  4E7J A;  4FW2 A;  3VA3 A;  3MX2 A;  1ATR A;  1WSI A;  2E6M A;  2Q31 A;  5JMV A;  3U3Y A;  3NGZ A;  3BF3 A;  2ZJQ L;  4QS7 A;  1I3A A;  4IWV A;  3OVN A;  5C12 A;  2XO7 A;  4PL8 A;  1DT9 A;  4E1N A;  4QOZ B;  4DUZ K;  1N5Y A;  4AHV A;  4B9V A;  4NXM K;  1RTH A;  2E1Z A;  4BR9 A;  3OYK A;  2IGI A;  3PSI A;  3J81 O;  1U45 A;  2OA8 A;  5FRN A;  3D45 A;  2GWJ A;  4BRA A;  1JXB A;  2EX3 A;  4IFE A;  3ZSW A;  2I7N A;  5BPM A;  3CMA N;  3AO4 A;  1EX4 A;  3MXM A;  2UUA K;  3LL3 A;  4CGJ A;  4LFA K;  4JS5 A;  4RG8 A;  3TU5 A;  1UAX A;  3RSE A;  4CFC A;  4E1M A;  3MEE A;  1NKE A;  4CBW A;  3RMB A;  4CER A;  3PIP L;  4DUY K;  1RBV A;  3SYZ A;  3CFR A;  1R0A A;  4K0K K;  5H1S Q;  2Q36 A;  2KQ2 A;  2RPI A;  1C0U A;  4N76 A;  4KO0 A;  3R3L A;  4DU4 A;  4CZF A;  4WQ5 C;  4DR7 K;  3D0P A;  1KRP A;  4PWD A;  2RHK A;  3HPG A;  1T6C A;  4JI4 K;  3WNE A;  3AGK A;  4QS9 A;  1KSP A;  3CQY A;  2PFU A;  3HST B;  5LJW A;  1KAY A;  3H3N O;  2FF3 B;  2O8E A;  3QFU A;  3DOL A;  3VGL A;  4CHO A;  3B8A X;  5AFU A;  5BPL A;  4BC2 A;  3CJ9 A;  3UKU A;  2E88 A;  2Q1N A;  2B4J A;  3T7Z A;  4O8K A;  1RGI A;  3J7Z O;  4YOX A;  5JVH L;  3ULD A;  1BA1 A;  2NRZ A;  4JAX A;  3VEZ A;  3MXI A;  1C1B A;  3DJC A;  3RRG A;  2G8I A;  2FSK A;  1JLG A;  4AH9 A;  4I6M A;  3HM8 A;  4XH5 A;  4Z4I A;  1D5A A;  3SUQ A;  2UXB K;  4FWK A;  3D6R A;  3QES A;  3CYM A;  3DM2 A;  3DXM B;  2A41 A;  3OBW A;  3WNF A;  4E1J A;  4B3S K;  3E9O A;  2P9S A;  1XHZ A;  1SKW A;  1YJ9 N;  4CJE A;  3IG1 A;  4BRP A;  3M6G A;  5BRE A;  4FK2 A;  2IDO A;  1Q82 O;  3KKR A;  2OTL N;  1CXQ A;  3L2Q A;  3L3V A;  4ILJ A;  4Z4G A; 
#chains in the Genus database with same CATH homology
 1XNR K;  4DV5 K;  4X65 K;  2UUA K;  1N33 K;  4LFA K;  4JI0 K;  4DR2 K;  4OX9 K;  4DV7 K;  3T1H K;  4YHH K;  1IBM K;  4LF6 K;  1FJG K;  2UU9 K;  4DUY K;  2F4V K;  2ZM6 K;  4B3M K;  3J80 O;  4K0K K;  4CW7 B;  4JI1 K;  2VQE K;  4LF9 K;  4DR3 K;  4DR7 K;  4X64 K;  1N32 K;  1N34 K;  3J7A P;  4JI4 K;  4JI2 K;  4V19 S;  4LFC K;  1HNX K;  1IBL K;  4DR1 K;  4JI6 K;  5LMN K;  4DV4 K;  2HHH K;  4DR4 K;  2UXC K;  4DV1 K;  4YY3 K;  2UXD K;  2UUB K;  4LF8 K;  4JI8 K;  4DV0 K;  1J5E K;  5AJ3 K;  5IWA K;  4JI5 K;  4DR6 K;  4X62 K;  4B3T K;  4AQY K;  4KHP K;  5FLX O;  2VQF K;  4JI7 K;  2UUC K;  4B3R K;  4JYA K;  4CVN E;  2E5L K;  5IT9 O;  1N36 K;  5A2Q O;  4LFB K;  4NXN K;  3J7Y P;  5LMU K;  4JV5 K;  1HNW K;  4DR5 K;  4X66 K;  4LF7 K;  2UXB K;  4DV6 K;  5BR8 K;  1I94 K;  1XNQ K;  4DV2 K;  1HR0 K;  4B3S K;  3T1Y K;  1XMO K;  4JI3 K;  1HNZ K;  4GKK K;  4LF4 K;  4DUZ K;  3JAM O;  4NXM K;  4LF5 K;  3J81 O;  4DV3 K;  1IBK K;  1XMQ K;  4GKJ K;  3OTO K;  5LL6 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...