5LMNK

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
VKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmnK00
2ZM6K 4JI7K 1HNXK 4DR6K 1XNQK 5A2QO 4K0KK 1IBLK 4GKKK 4DV3K 1J5EK 4DUYK 2UXBK 4JV5K 1N33K 1HNWK 4YY3K 3OTOK 1FJGK 2UXCK 4DR7K 1N36K 4LFCK 2E5LK 4JI2K 4DV4K 1N32K 5FLXO 4JI0K 4LF6K 5IWAK 4B3MK 4DV6K 1IBMK 1HR0K 2UUAK 4DR1K 5LMUK 4KHPK 4CW7B 2VQFK 4LF9K 4JI4K 2UUCK 4DR5K 1XMOK 4CVNE 4X66K 2F4VK 1XMQK 4JI3K 1N34K 4NXMK 2HHHK 4X62K 4LF8K 4DR3K 4V19S 4B3SK 4B3RK 4YHHK 4LF5K 5LL6Z 2UU9K 4DV7K 3J7YP 5LMNK 4AQYK 4JI8K 4JI5K 4LFBK 4B3TK 3J80O 1I94K 3JAMO 5IT9O 3T1HK 5AJ3K 4LFAK 4DV2K 4DR2K 5BR8K 4JYAK 3J81O 4JI1K 4NXNK 4DV5K 4X65K 4DUZK 1XNRK 4JI6K 4OX9K 4X64K 4LF7K 3J7AP 4DV1K 3T1YK 4DV0K 2VQEK 2UUBK 4DR4K 1HNZK 2UXDK 4GKJK 1IBKK 4LF4K
chains in the Genus database with same CATH superfamily
1KAXA 3VQ7A 1P8ZA 2HNZA 3BDPA 3K9JA 1ASWA 4EZ6A 2IVPA 3D6RA 2PYLA 3QNNA 4IO8A 3CFPA 3RTVA 4KB1A 1RDUA 2ETJA 3AVFA 1EP4A 1U04A 2I5JA 3VQEA 1J54A 5DM7L 3OS0A 4XH1A 1WB9A 2OYQA 2O8BA 2NLXA 2Q2RA 1NK9A 5SZTA 4DFPA 2BGGA 1NJIO 1JL2A 4FO0A 4B3MK 5AQVA 3M8RA 4DKWA 3U8XA 3I55N 3Q7CA 4DTOA 4HCCA 4JKEA 4BREA 4IBNA 4JI4K 3KWIA 4CJUA 4U67L 2G8UA 3ZSZA 2P9SA 3VGLA 4CVNE 3OYEA 4J2BA 4FJMA 1K6YA 1V4SA 2G8HA 5FPDA 4M3UA 3B6OA 1SL0A 3AO4A 4BRIA 3L4QA 3MN5A 5AQLA 5LJWA 2HHHK 2O8BB 3ZSYA 5GINA 3SJHA 4OLAA 4FWSA 4M3YA 3GE1A 1DTTA 3VQ9A 3S3MA 4BROA 3LP3A 3WQTA 4B9VA 3CFOA 5J2MA 4FJNA 1NNEA 1RT4A 3QETA 4FJJA 3KKSA 4O55A 3HVTA 2A5XA 4E1NA 4JS5A 3GG4A 4WQ4A 1HUXA 5AZIB 1BUPA 1HKGA 3O3HA 2E6LA 4HUGA 3ZSQA 1NG9A 1TKDA 1EWRA 2WFBA 3BGRA 3RMDA 4JI6K 3TAEA 2WC9A 2HHVA 2HNDA 4CZJA 2D0AA 1LW0A 2AJQA 5ADXH 3DXKB 3AA2A 2QWOA 4QS7A 3VERA 1TAUA 5HRPA 3THWB 4MLEA 3LL3A 1RTHA 3GDQA 4OPKA 2UXDK 1VAZA 3SMPA 5D3GA 3SK3A 4KTWA 1NK0A 4JKAA 4BC4A 1KVCA 2F9TA 2ZD1A 4JK8A 5AQYA 1NGFA 3SI6A 3O08A 4CGFA 3AA4A 1VQ4N 1L3UA 2XY8A 4BWMA 1BDGA 4A59A 2P9PB 1QSYA 3DXKA 4CGDA 4DTUA 4PKGA 1RDCA 4FWKA 4BRDA 3D2EB 5E26A 4Z4EA 4CW7B 4FJ7A 4A2AA 1NK6A 4B9SA 5EVZA 3MXJA 1BWFO 3RVCA 2XHBA 2J4RA 1C6VA 1SQKA 1TUUA 1VK0A 5BPLA 2QKBA 3TSUA 3L8BA 5BR9A 1RBUA 3LM2A 2FF3B 4BR9A 4KKOA 3EZ5A 5EU7A 3T3FA 3BUZB 1SZ2A 3CQ8A 2P9PA 4C8LA 1X3NA 3V1QA 4CF8A 1S1XA 3BP8A 3NVKA 2NRRA 2AA4A 1QVFM 1SV5A 3HPHA 4E0DA 3MN9A 3CD6N 5TKYA 2PFUA 3O9SA 4AHUA 1E4FT 3H6EA 4Z4HA 3HP6A 3LALA 3D2EA 4RTFD 3WQUA 3OYJA 4H0TB 2QI2A 1KAYA 1L3SA 1LWFA 3ZSVA 1RT7A 1WLJA 4GVMA 4FWMA 3ZSOA 4B1YB 3T1AA 3MN6A 3C6HA 3HSCA 2WTUA 3PIOL 5AQNA 3VEZA 1VQLN 3ZX2A 4C1NK 2VQEK 2ZGZA 3U6FA 3I0RA 3ZETA 4LC9B 3TSPA 3L3VA 1KVAA 2VG6A 2ZM6K 1O13A 3LPUA 1HPMA 4FLYA 4DTXA 1XNQK 4OO1J 3KZBA 1N6QA 5FRNA 3I56N 3GBTA 5I42A 2HSTA 4PL8A 3CC7N 4GKKK 1LAVA 3RRHA 3ATUA 3HYFA 3V9SA 4E7HA 1NMDA 5E84A 5LY3A 3VQ8A 1TKZA 3J7ZO 3W3DA 3NH0A 1O1WA 4JKDA 2O8CB 1B9DA 1RBTA 3M8QA 4A61A 4KTZA 3KKRA 3BF1A 3ZETB 1XI1A 1KC8O 2HHQA 2BUPA 5BN9A 4ID5A 3CJ1A 5T7BA 4FK0A 1MWKA 5DM6L 3QERA 1GOAA 2Q31A 3NDKA 2V52B 5KPTA 3F9KA 1BGXT 3SV3A 4FZZA 2ZE2A 4B1XB 1KQSM 4O5FA 3O9TA 4EHTA 4E7LA 3WXIA 3SNNA 1P90A 2OTJN 3MN7A 4H0XB 4ILGB 4V19S 3CCVN 1J6ZA 3EKUA 2IVNA 3I8BA 3ULEB 1X3MA 1OVQA 2G8FA 2R7YA 3OYFA 2O8CA 4N56A 1HKBA 4FJKA 4BRHA 3AVKA 5CZ1A 2OPPA 1BA1A 3RRGA 3O9UA 3ZX0A 4DS5A 1NGCA 1YVNA 3N4PA 3V9WA 3I33A 4NYNA 4H0VB 5DMRA 3H3OB 1I39A 2P9IA 1WN7A 4CECA 1FKPA 4A5AA 3UKUA 3J8AA 2ZJQL 3S9HA 4Y1CA 4DU3A 4DQIA 4PHTX 3IFRA 2IGIA 4CHOA 4JKGA 1RT5A 2P9KA 4ILJA 3I0SA 4CJWA 2OZMA 1NGJA 3CC2N 3ULEA 3AGKA 2GEMA 1IBKK 5AQGA 3TAFA 1JLEA 1NWKA 1U4BA 4AM6A 4RW4A 1KRPA 4Z4CA 1DKGD 1LAWA 3IG1A 1X9SA 2W6KA 3IKMA 4FJ8A 4KHSA 1SAZA 3A5MC 2VCPA 3NGIA 4DLEA 3BZCA 1WSEA 3ZYYX 5GIOA 4E7JA 3U9ZA 3C6AA 3L2WA 4MO4A 5M1QA 4RCHA 1GLAG 1L5UA 3R9PA 3VEYA 3ENOA 1IBMK 1RILA 3SMSA 3DI6A 5KPRA 2GELA 2QXLA 4CFBA 2HBLA 1TGOA 2FLOA 3TARA 1HKCA 3MMVA 4FL9A 4ID1A 4AHTA 5TKWA 5AQFA 3V9XA 3WXMB 3FZKA 2QXFA 4RW6A 4BVOA 3ATVA 3PY8A 4DFMA 1NK8A 4NXMK 1KAZA 4FOIA 3DOKA 1YJ9N 2G8KA 5KI6A 3CQXA 4BRKA 3NVMA 1RDWX 3OYMA 1IG8A 4H5RA 1BIUA 4CHQA 1L3VA 1ZBHA 1X9MA 3AO5A 4K42A 3J80O 1Q81O 1I94K 3ZT3A 1RBRA 4M3WA 1TV6A 1D8YA 1XHXA 2KFNA 5BPMA 4CJLA 4FPBA 5CZ2A 1VQ6N 3PX4A 4ZTJA 3K5NA 4DR2K 3IS9A 3OYCA 1J5OA 3R6MA 4B9QA 3J81O 4N47A 2KW4A 2X6NA 2P9NB 2ITMA 1VSIA 3H08A 2XY7A 4OX9K 1S1TA 2EWSA 2KQ2A 3QFPA 4CEOA 1QZ6A 4GY2B 4O44A 4BRPA 2VG7A 1VQKN 5JLFA 1KFSA 4DQRA 1TK5A 4TSXA 2XY5A 3KHYA 4BGBA 2VGNA 3UIQA 4KRFA 1WBDA 4MQ3A 1CXQA 1VQON 1C1CA 1BQNA 4FLZA 4KH5A 1IKWA 4CJFA 1VQ5N 2P9NA 3ENBA 4M7YA 4IFYA 1N32K 1TYQB 1HYSA 1JCEA 2P9UB 1RTDA 4KTQA 4BE2A 2HVHA 4FWPA 3WNFA 3HO1A 1EXQA 1ATSA 4KHPK 2PAVA 2WOMA 3K5OA 2WBNA 1NBWA 1H1VA 4IJAA 1YTUA 3TI0A 1JXEA 3L2RA 4DTSA 3O9RA 3MWPA 1C0TA 1WAJA 5KQ8A 3BEXA 2G8IA 2QEXN 4Q0BA 4CJKA 2ZQBA 4CIGA 2BE2A 4YORA 4JAXA 1J9AA 4DSJA 3WXJA 4DR3K 4B3SK 1NGIA 3EN9A 3EL2A 1DEJA 1TYQA 4CEFA 4YFUA 4Z4IA 4NO7A 3CXCM 3HM8A 4XH5A 4CFCA 2KLAA 4IZ9A 4GW6A 4E1JA 2VGMA 1Z25A 4WFNL 4B1VA 3NE6A 1WUAA 2FBYA 4H5VA 3QEWA 3OBYA 1Q9XA 3E01A 3LP2A 3V81A 3E9LA 3LDNA 3QEPA 2Z1GA 4PA1A 1CLQA 3R3LA 3AY9A 1S72N 4M41A 4KBOA 1CXUA 4E1MA 1N5YA 4BE0A 1OH6A 2YJFA 4EZ9A 4NB4A 3F5TA 2GWJA 4I2PA 4FWNA 4Q5VA 3OS2A 2Q97A 3QNOA 1T8EA 2NRVA 1VSDA 3L6QA 3K0SA 4AH9A 3M8SA 4AF1A 4YY3K 2ZJRL 1BG3A 4E89A 1VRUA 4RW8A 3F2KA 1ZYQA 1YUWA 1C0GA 2GX9A 3VF6A 4OGEA 4JN4A 4KI4A 4C8MA 2QWPA 3TTFA 3THXB 1BU6O 2FBVA 3OJUA 5BRHA 3MX5A 5GADP 1ATRA 2RKIA 3VQ5A 4KHYA 2UUAK 4CZHA 4LH5A 1WSGA 4A57A 4LF9K 2DPNA 2UUCK 4BDPA 4CGJA 4XEIA 1QS4A 2YNGA 4NLCA 2QK9A 1OVYA 3MDQA 2F4VK 3KK7A 1IJJA 4AHRA 4M42A 2B6AA 3JS6A 4A62A 3C6UA 1SKSA 3JXUA 4MDAA 4DSLA 4CJPA 4FLXA 1S5JA 1HQEA 4YHHK 1UWBA 4CZKA 4LF5K 4BRAA 2GV9A 3ULDA 2HF3A 4H5TA 1VQNN 1IV0A 5HRRA 1BHLA 5IT9O 5BREA 3CC4N 1D9FA 1U49A 3M6GA 4CCHA 2NNWA 2FSNA 1W2BM 1IKYA 2HHWA 1IKXA 3CM6A 4ICLA 1CZ9A 5BR8K 5AQQA 1NGGA 5CHIA 2Y1JA 3VQ4A 1HJOA 3O1BA 5KRTA 4X65K 3CHWA 3ID6A 3QEXA 4KB0A 3DXMA 4H03B 1W0HA 2FSJA 1ZC6A 5C12A 4BRFA 3THYA 4LSNA 4FZXC 2RF2A 4CK3A 4H5NA 4F3TA 3O3GA 3GL1A 3SYZA 4PKIA 4OPHA 5FRMA 4DQQA 4C8OA 1NLVA 2P9LA 1W7AA 3OYDA 5HOOA 1GLEG 2VWJA 1CZBA 3NGYA 1N33K 3PX0A 2Z1IA 3OTOK 4DR7K 5AQSA 4FJGA 3TPQA 3NF8A 1QE1A 1G15A 1M1KO 4O8KA 4B1ZA 3CQYA 4JI0K 3MXMA 2Q36A 1HX1A 4WQ5C 3LPTA 3THYB 3ASMA 5I3UA 3AVAA 3DRSA 4YOUA 1HPZA 1WSJA 1C0MA 2D0CA 1TAQA 1LWEA 4CGIA 1RT3A 4DR5K 3KLEA 3HZ6A 3DLGA 5AQUA 4FJ9A 3K5LA 4CEEA 1YT3A 5EOYA 3V4IA 3P83D 5HL7L 1YJNN 1NGEA 1ZBLA 4WFBL 4FM1A 4J2DA 3TR8A 3A5OC 4B3RK 1S9GA 1VQ8N 4IG0A 4DTRA 1F21A 4OPAA 4JKFA 4WQ5A 3SUNA 4JI5K 4CIFA 5BN8A 2DY4A 3VPZA 3MECA 3O4WA 5HLFA 2Z1JA 1NGDA 4H8KA 4B9TA 1QTMA 1XC3A 3MCPA 4IEEA 4EIAA 2KTQA 4M3RA 1VQPN 1HQUA 3V1RA 2IAJA 3AARA 3E9PA 3BY5A 1WBBA 2ASMA 3VQDA 4K8XA 5FPEA 4JI1K 3CERA 5J1EA 4NXNK 1RT1A 3K57A 1XNRK 5CY4A 3DRPA 3VQ6A 5AQPA 4WE1A 3AVMA 3THVA 3ENHA 2BTFA 3J7AP 3EKSA 3FFIA 5M1NA 3SJJA 4I6MB 1RDAA 3TTCA 1E4GT 1GOBA 4H5WA 4IDKA 3SCXA 1IO2A 3AO2A 4KH4A 2P51A 1K8KB 4K41A 4BVPA 1Q86O 4BWJA 1NJZA 2D5RA 2NZTA 1RT2A 2FF6A 3U3YA 3PO5A 3ZEUA 2JWKA 5C25A 3H46O 5AQJA 5FPMA 2GUPA 5AQTA 2HHUA 1T03A 3A0IX 4BR7A 3HRGA 1FJGK 2NRXA 3TSQA 3NGZA 4LFCK 4B9LA 3K5MA 3HJFA 1TK8A 4GMJB 1U2VB 2CH6A 1N8RO 2VWBA 3AVGA 4BRQA 3NF9A 3CFRA 4KHUA 1HJRA 4F9OA 4I6MA 4BQLA 4O0IA 1IG9A 1VQ7N 3SQ1A 4FJIA 5K14A 4Z94A 3R1XA 1J53A 2YNFA 3KIOA 1A5VA 1TKXA 3QB0A 3CJCA 3DLEA 4M7XA 4CFDA 1ILYA 4CK1A 4IFEA 3D0PA 1SS6A 3ZEUB 4XH4A 3VGKA 1LOTB 3L4IA 4LF8K 5C0YA 4FYDA 3IDHA 3SAFA 3T7ZA 1VSHA 3DMJA 4O0JA 3BF3A 4F2RA 3IRXA 2W42A 4DV7K 1BO5O 3P5JA 4LH4A 4EP5A 4FLUA 4PQUA 1DTQA 4FM0A 1A5WA 4OKEA 4CJ7A 3WXLA 4JRQA 3SBTA 1NK5A 1S9EA 1S6PA 4CE9A 3CYMA 3C0BA 1MWMA 4BRGA 1JCGA 3CPEA 1LCUA 1NM1A 4BC2A 4JLHA 1BCOA 5AQIA 2ZF5O 3AO3A 1GLBG 4DHYA 4IO9L 1NK4A 3OY9A 3LP0A 3A5NC 3HTVA 4IJNA 2BDPA 1XHZA 4B9MA 4DF4A 5HRSA 1JLBA 2HOEA 4CGHA 3KK1A 2RHKA 4W5TA 1OKJA 4CZEA 1HYVA 1S1VA 4BGAA 2YHWA 4DMNA 1BI4B 4JKCA 1DGKN 3I8DA 4E3SA 2YHXA 2QWNA 2PYJA 1V4TA 5C42A 4JNEA 3HOTA 3WEEB 1M90O 4A2BA 1N36K 4KAZA 4JI2K 4DFJA 3OYIA 3AV9A 2GUIA 4PY5A 4F8RA 3L2UA 1MDUB 4CBUA 2E6MA 3TAQA 3ISNC 4J2AA 4FXDA 1GLDG 1RBVA 3AVBA 3RR8A 4CF9A 4H0YB 4DR1K 4MLHA 4Z0UA 1WAFA 5J2PA 4CZIA 5AZIA 1NGHA 3P4IA 2I7PA 2NRZA 4FK4A 4BR0A 4CJQA 1TKTA 1U6ZA 4R79A 1VRTA 3NCIA 3QO9A 1RGIA 3DRRA 5AFUH 3SZ2A 4WFAL 1VSFA 4CGGA 3G71N 2XY6A 1Q9YA 4YOVA 3B8AX 2Q3SA 1HRHA 5CR4A 4GV9A 1WNSA 3LAKA 4FVUA 3E1YA 2HHTA 5LMNK 2XRIA 4AQYK 3HXMA 4AM7A 1NGAA 3CCSN 4FCYA 1CZAN 3DOLA 4CJEA 4B9UA 2G8VA 3LAMA 2BH1A 3SBGA 4DF8A 3OYGA 3CCUN 2G8WA 2CGLA 5ADXA 3V9UA 3NF6A 4HUFA 4M3TA 3QESA 5GIPA 4CZLA 5JMVA 1KLNA 1KSPA 1NGBA 1ZBFA 3NBPA 5HRNA 4QAGA 4C1NI 1MA9B 3CJ9A 2IIRA 5EY4A 5B8HA 3CCJN 4CBWA 4F3OA 3VETA 4GV3A 4LSLA 4BDYA 4W5OA 3CG7A 4GKJK 4JKBA 3G0ZA 4HTLA 3NH1A 1ZBIA 1NJYA 4DR6K 1L3TA 1Q18A 4Y0WA 3VF4A 1RNHA 1EQYA 3QINA 2GTDA 4IXCA 3QEIA 4DSKA 2JGUA 1SKRA 5CYMA 3NF7A 3W0LA 5E41A 2EHGA 4JHDA 4I9QA 3JSMA 2OANA 3WUHA 2GBZA 2X6SA 3G25A 4B8CA 3OBWA 3WNEA 2A40A 1BL3A 5M1OA 1VSLA 4CZGA 4BG9A 1SL1A 4BR2A 1JCFA 3FR0A 1RTJA 3H1VX 3OS1A 5GAEP 2VG5A 4DLGA 3THWA 3D2FA 5HROA 1NOYA 5JS1A 4Z4GA 2JLEA 3VEWA 3CJ7A 3QBXA 5KGWA 3KLGA 3LDQA 3OW2M 3MWTA 3VTHA 3FZHA 2HF4A 4B08A 5LJVA 3U4LA 3AGRA 1OH5A 4H0PA 3M8PA 2P1JA 1ZBSA 5AQHA 5C2FA 1SKWA 2QKKA 3PO4A 2DFFA 4CEZA 4JI3K 3ITHA 2E1ZA 3DLHA 3DLLL 4FOEA 4UQGA 4JHDB 2KFZA 5GAGP 2FBTA 3QIOA 4DQ8A 3AVNA 3CCMN 3K9KA 4CD1A 4PUOA 3KTQA 4LFBK 3DLKA 3JAMO 4ISEA 3S3NA 2ZJPL 3BZKA 1X1PA 1BCMA 1JLAA 3D2FB 3QDKA 4KHWA 2ITGA 3ZCMA 3OYHA 2P5OA 1BISA 5AZJB 4CESA 4M3ZA 3LZJA 3OYLA 4BC5A 4C8KA 3LZIA 3PSFA 2A1SA 4B3OA 3ZT1A 1RFQA 5F2RA 2W41A 3C94A 4FSVA 3NHGA 4FWLA 4DV1K 2YV0X 3PLAA 5JS2A 2HBJA 3MX2A 3IUCA 2X74A 4ISFA 2O8FA 1S3XA 3PUFA 4KREA 5C15A 1SL2A 2QWLA 4CF0A 1QQOA 3FZFA 3PSIA 2Y1IA 2D0PA 1LW2A 4ISGA 3HPGA 4JI7K 4DQPA 5BRDA 2IOCA 4CHPA 3A2FA 5A2QO 2YJEA 1C0UA 3DLRA 1IBLK 2YNIA 1WSFA 3LDSA 4B9NA 3P38A 3OHRA 2Q0RA 4FK2A 5AZJA 4HUEA 3L0QA 1XWLA 4DSEA 2A1RA 3U9DA 1IH7A 2OPRA 4MFBA 1YIJN 3O4NA 4FLWA 2OZSA 4K25A 2O8EB 1K8AO 5HBMA 4BRCA 3CETA 2XO7A 1KCFA 1VSJA 4CHYA 4FJHA 4NCBA 3LDLA 2QWRA 4WF9L 4ELTA 2E2NA 2O8FB 4O8UA 3C95A 3V6DA 3KWGA 3TAMA 5KGXA 3MEDA 5LMUK 4KHQA 4YOYA 2CGKA 2VQFK 2PZSA 3HVRA 3C65A 3A5LC 5H1SQ 4FM2A 1R59O 2HBMA 4BE1A 4FJ5A 1QSSA 2P9IB 2A41A 1XMQK 1XUPO 1U48A 4BQZA 4ZTFA 3NMUA 3OYKA 3TAPA 1NOZA 4JKGB 4H0OA 4BG8A 3TABA 1QHAA 4CJ3A 3SV4A 1W9HA 2YHBA 3H45C 4O5BA 3ZSXA 2O8EA 4HTUA 4CD3A 2RN2A 3CJAA 2FBXA 1T3VA 5J2NA 1C1BA 2X78A 3O1WA 4BC3A 3VA0A 3ZT0A 5C2DA 3MXIA 3VGMA 5AQWA 1E3MA 4IOAL 2DFEA 2NRTA 1SUQA 2I7NA 2O4GA 4DV5K 1NK7A 4JD2A 2W6LA 3CPWM 4JKHA 1UA1A 4MDBA 5AQZA 3U3GA 4AHVA 1Y97A 2NRHA 3C7NB 2GWKA 4CIEA 4CJ4A 3PX6A 1VQMN 3UKRB 1LWCA 4DR4K 1GLLO 3OYAA 1ATNA 1BQMA 1FKOA 2JWLA 4CERA 2QM1A 5J2QA 2AP1A 4WYBA 4NLBA 3T19A 1EWQA 1QQNA 3NAEA 1HNXK 4CJSA 1KFDA 1NKBA 2F8TA 3QFUA 3SPZA 5KQDA 5AQOA 3SUQA 2HMIA 5GAHP 3O6WA 1D9DA 4BY9C 4DUYK 1KTQA 1RDDA 4CBXA 1Z6RA 1HNWK 1Z26A 1FW6A 3KJVA 4JD2B 4W5RA 4DS4A 1Q7YO 3UKUB 3AA5X 2E8AA 3RWUA 1XQSC 3HK2A 1BOTO 3C7NA 5F0XA 2KZMA 5JVGL 4M45A 2P9KB 5AQMA 3KLFA 1UAXA 3UKRA 4FWOA 2WUSA 3NH2A 2ZWHA 1OH7A 4FJXA 4G1QA 1I3AA 2D0OA 3H3NO 1S22A 2VYPA 4RG8A 3M3ZA 1YTAA 4OKJA 2QTDA 1EO1A 4CJ5A 3O9QA 1KLMA 3WNHA 4JEPA 2FC0A 2OCEA 2OA8A 1ZBUA 4LD0A 3VQPA 1FXXA 1GLFO 3HPOA 4DTNA 4PKHA 4DTPA 2BANA 1FK9A 1JJ2M 2NUBA 3Q7BA 3TTDA 4B3TK 4EAHD 1YHQN 5FDLA 4YDUC 2YNHA 2NRWA 3H1QA 2B5JA 4CK2A 3E66A 4C8NA 4DSFA 2E2PA 1D4XA 3LDPA 3L2QA 1DT9A 3AVJA 1ZXOA 1KVBA 4AILC 4DUZK 4PL7A 4X64K 3QBWA 5M1KA 1T44A 3K58A 1TUYA 3VQCA 4OLBA 2E4LA 3VQQA 4RWTA 5DK5A 4IKFA 4IFVA 1WSHA 4I7FA 4OPJA 1HNZK 2V7ZA 4BR4A 2YHYA 4DTMA 3MK6A 3OVNA 3N4QA 3VMFB 2B4JA 4A5BA 4K8ZA 4FWRA 5BRFA 1Z05A 3SQ2A 2CH5A 3AVIA 3CJBA 4DV3K 1JXBA 3OJSA 4JV5K 3CCQN 4BRMA 1ASVA 5EXWA 4E19A 1X9WA 4KHNA 4FLVA 2UXCK 3P39A 4DWIA 1T7PA 2HB5A 5FLXO 3RMAA 3WT0A 3EE8A 3DWLA 4DV6K 4XIUA 2KZZA 4G9ZA 3ZSWA 4YDUA 3AVLA 3ID8A 3F9MA 4AHCA 2Q1NA 3LP1A 5AQXA 3IAYA 2V51B 3DLBA 5FPNA 4QOZB 3AO1A 4M63C 3EE9A 1S6QA 1TL3A 3DJCA 3OA9A 2CGJA 2ZGYA 4N76A 2E20A 1QQCA 2F9WA 2E1YA 5JICA 3UB5A 3FLCO 2YCHA 3AAQA 3A8YA 4OVLA 4CF1A 1U47A 1ASUA 3KD5E 1KXPA 3MAQA 5FROA 3FZMA 3LWMA 5KRSA 3QIPA 5CE3A 3MEEA 2UU9K 4IDHA 4JI8K 2ASOA 2P9UA 3F73A 4ZHRA 3HP9A 3T1HK 1LV5A 4FW2A 1NMNA 4CJTA 3EZWA 4ELUA 2YKNA 4DV2K 3M5RA 1HYZA 3G6EN 2YI1A 2HVIA 1D5AA 4EFHA 3S3OA 1QZ5A 5EX5A 3TWHA 4CEBA 3M1FA 2KHOA 3ZX3A 1T6CA 2F8SA 3E9OA 5KPZA 2UUBK 1S1UA 4YNQA 2HBKA 5KTQA 4LY7A 4FWQA 5AR0A 1YJWN 3QICA 3WNGA 3SUPA 1Q82O 1GOCA 3DYAA 1TK0A 3EO3A 1BA0A 1RCHA 3WXKA 5I9EB 1R0AA 4K0KK 1B9FA 4M3XA 1QQMA 1S1WA 2DTUA 2A42A 2RE2A 1QVGM 4FZYA 2E5LK 2F96A 2HHXA 1C0FA 2D4WA 4FLTA 3V1OA 5AQRA 3AA3A 4B8AB 4LF6K 5IWAK 4GVEA 3VEXA 5SWMA 4YOTA 1K9MO 4C23A 1HR0K 1HMVA 4Y1DA 1UA0A 3IMXA 4RW9A 4L3QA 3O3FA 3P1GA 1WOQA 4EHUA 3SAGA 4UY8O 4GV6A 1MU2A 3MEGA 4CHZA 4PWDA 3CIPA 1JL1A 1RBSA 2HHSA 3VENA 4IOCL 4HCBA 4QCLA 1U45A 4WCEL 3DXMB 3PV8A 2HMPA 2EX3A 1YITN 3HL8A 3ZT4A 3OYNA 3CM5A 1Q8IA 2QWMA 1RDBA 3SLCA 3CMEN 4CZFA 4YOXA 1YXQA 4IEIA 4CFAA 2FXUA 4FJLA 1JLGA 3SPYA 4RW7A 1NKCA 4KI6A 1TL1A 3ALYA 3L2VA 3THXA 3KD1E 1VSMA 5F1XA 4O4GA 3JYTA 5CYQA 2P9LB 1ESVA 2YHAA 2QA4N 1VHXA 4LFAK 3FZLA 3HI0A 4OJRA 1JLFA 2E2QA 3SAHA 4KH6A 3VQAA 4K43A 1B92A 2WONA 1Y64A 3CCRN 1TVRA 3AVCA 3RSEB 3VTIA 1WSIA 1ITGA 4CJRA 1GLJO 2O8DA 3EY1A 4LF4K 3VOVA 3CI5A 4AHSA 4N5SA 2IC3A 5AFUA 1YVUA 2F7TA 3AAPA 4CJVA 3VESA 2HNYA 2E88A 4HVJA 3LANA 3CCEN 3QMLA 1VSEA 2RPIA 1NJWA 1J5EK 4F4KA 4NCGA 4DG1A 3T69A 1C1AA 1NKEA 1REVA 2OPQA 2VWKA 3FFKB 3AVHA 2OTLN 4DV4K 4CHNA 2FSKA 2P5GA 4CF2A 4JK9A 5HP1A 3RSEA 1NJXA 2E2OA 4L8RB 1G99A 2O8DB 3RR7A 4CI6A 3HSTB 2IDOA 1W97L 3LWLA 3L3UA 1JLCA 2ASPA 4MO5A 3S41A 4B1WB 1XMOK 3P31A 1EKEA 5C24A 3B6PA 4QS9A 4I2QA 1QHTA 4E7IA 2LSNA 4KO0A 3R8EA 4I9LA 3D7EO 3DM2A 3G10A 1YI2N 4YOWA 3K2PA 3VEVA 5AQKA 4IG3A 4H4OA 4OGCA 4J2EA 1NU0A 4IOXA 2OPSA 1YAGA 4HWIA 4Z4FA 1K8KA 1VQ9N 3HOSA 1X9JA 4KV8A 5AJ3K 3SQ0A 2D1KA 5JVHL 4JYAK 4FW1A 3QEVA 2UYTA 3VF2A 3O80A 3SQ4A 5ELZA 1T05A 1RT6A 1JKHA 2A6AA 3EEQA 3KK3A 4BRNA 1A5XA 4KFBA 5BPNA 4DFKA 4DV0K 5M1PA 4JS4A 4CEDA 4HHTA 3LDOA 3VN5A 3VQBA 3PIPL 4BDZA 3CMAN 3D45A 1DLOA 3HT3A 2PBDA 4CEQA 4W5QA 4DU4A 1JLQA 1QSLA 4JK7A 2UXBK 3V9ZA 4BRLA 3RMBA 4FPAA 4W5NA 2HW3A 3KLIA 4NCAA 4GNIA 1T6DA 3DAWA 3SUOA 1KD1O 4ILHA 4WQ4C 3O5BA 1OH8A 2QWQA 3TU5A 2D0BA 4FVMA 3OYBA 2A3ZA 2H3GX 1XC9A 3C6TA 3CCLN 2V7YA 4H4MA 5JLHA 4J8FA 3FE1A 3K59A 4QS8A 3ZSRA 4U7BA 3FGUA 4X66K 4DSIA 4F2SA 3RMCA 3MCAB 3G4SN 3UE5A 1N34K 4NYFA 3LM9A 4BACA 1VSKA 2QW9A 3HM9A 3QLHA 1HLUA 1IKVA 4X62K 3KK2A 1EX4A 2O4IA 3GOIA 3HBTA 3ZLJA 4CEAA 2Z1HA 1UOCA 5LL6Z 3ZT2A 3KLHA 1U2VA 3J7YP 3KVGA 3O8MA 5M1FA 4DQSA 4B1UB 2PY5A 1HNVA 4DU1A 3O4QA 4KPYA 1GLCG 3NFAA 4BR5A 1BI4A 4E7KA 5MLCQ 3TAGA 1RTIA 2Q0UA 2YKMA 4R5PA 4DB3A 3WEEA 2IVOA 4N41A 1YF5L 4DCHA 4OKKA 2DFHA 2KKZA 3VA3A 4LF7K 2W40A 2YX6A 3TANA 1EETA 4CZMA 3T1YK 4JRPA 2ATQA 3EYZA 2IS3A 4DTJA 1K73O 1HNIA 4EP4A 5C10A 4ELVA 4IWVA 3VEOA 1BIZA 3CF5L 2P9SB
chains in the Genus database with same CATH topology
2ZM6K 4JI7K 1HNXK 4DR6K 1XNQK 5A2QO 4K0KK 1IBLK 4GKKK 4DV3K 1J5EK 4DUYK 2UXBK 4JV5K 1N33K 1HNWK 4YY3K 3OTOK 1FJGK 2UXCK 4DR7K 1N36K 4LFCK 2E5LK 4JI2K 4DV4K 1N32K 5FLXO 4JI0K 4LF6K 5IWAK 4B3MK 4DV6K 1IBMK 1HR0K 2UUAK 4DR1K 5LMUK 4KHPK 4CW7B 2VQFK 4LF9K 4JI4K 2UUCK 4DR5K 1XMOK 4CVNE 4X66K 2F4VK 1XMQK 4JI3K 1N34K 4NXMK 2HHHK 4X62K 4LF8K 4DR3K 4V19S 4B3SK 4B3RK 4YHHK 4LF5K 5LL6Z 2UU9K 4DV7K 3J7YP 5LMNK 4AQYK 4JI8K 4JI5K 4LFBK 4B3TK 3J80O 1I94K 3JAMO 5IT9O 3T1HK 5AJ3K 4LFAK 4DV2K 4DR2K 5BR8K 4JYAK 3J81O 4JI1K 4NXNK 4DV5K 4X65K 4DUZK 1XNRK 4JI6K 4OX9K 4X64K 4LF7K 3J7AP 4DV1K 3T1YK 4DV0K 2VQEK 2UUBK 4DR4K 1HNZK 2UXDK 4GKJK 1IBKK 4LF4K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 K;  4JI7 K;  1HNX K;  4DR6 K;  1XNQ K;  5A2Q O;  4K0K K;  1IBL K;  4GKK K;  4DV3 K;  1J5E K;  4DUY K;  2UXB K;  4JV5 K;  1N33 K;  1HNW K;  4YY3 K;  3OTO K;  1FJG K;  2UXC K;  4DR7 K;  1N36 K;  4LFC K;  2E5L K;  4JI2 K;  4DV4 K;  1N32 K;  5FLX O;  4JI0 K;  4LF6 K;  5IWA K;  4B3M K;  4DV6 K;  1IBM K;  1HR0 K;  2UUA K;  4DR1 K;  5LMU K;  4KHP K;  4CW7 B;  2VQF K;  4LF9 K;  4JI4 K;  2UUC K;  4DR5 K;  1XMO K;  4CVN E;  4X66 K;  2F4V K;  1XMQ K;  4JI3 K;  1N34 K;  4NXM K;  2HHH K;  4X62 K;  4LF8 K;  4DR3 K;  4V19 S;  4B3S K;  4B3R K;  4YHH K;  4LF5 K;  5LL6 Z;  2UU9 K;  4DV7 K;  3J7Y P;  5LMN K;  4AQY K;  4JI8 K;  4JI5 K;  4LFB K;  4B3T K;  3J80 O;  1I94 K;  3JAM O;  5IT9 O;  3T1H K;  5AJ3 K;  4LFA K;  4DV2 K;  4DR2 K;  5BR8 K;  4JYA K;  3J81 O;  4JI1 K;  4NXN K;  4DV5 K;  4X65 K;  4DUZ K;  1XNR K;  4JI6 K;  4OX9 K;  4X64 K;  4LF7 K;  3J7A P;  4DV1 K;  3T1Y K;  4DV0 K;  2VQE K;  2UUB K;  4DR4 K;  1HNZ K;  2UXD K;  4GKJ K;  1IBK K;  4LF4 K; 
#chains in the Genus database with same CATH topology
 1KAX A;  3VQ7 A;  1P8Z A;  2HNZ A;  3BDP A;  3K9J A;  1ASW A;  4EZ6 A;  2IVP A;  3D6R A;  2PYL A;  3QNN A;  4IO8 A;  3CFP A;  3RTV A;  4KB1 A;  1RDU A;  2ETJ A;  3AVF A;  1EP4 A;  1U04 A;  2I5J A;  3VQE A;  1J54 A;  5DM7 L;  3OS0 A;  4XH1 A;  1WB9 A;  2OYQ A;  2O8B A;  2NLX A;  2Q2R A;  1NK9 A;  5SZT A;  4DFP A;  2BGG A;  1NJI O;  1JL2 A;  4FO0 A;  4B3M K;  5AQV A;  3M8R A;  4DKW A;  3U8X A;  3I55 N;  3Q7C A;  4DTO A;  4HCC A;  4JKE A;  4BRE A;  4IBN A;  4JI4 K;  3KWI A;  4CJU A;  4U67 L;  2G8U A;  3ZSZ A;  2P9S A;  3VGL A;  4CVN E;  3OYE A;  4J2B A;  4FJM A;  1K6Y A;  1V4S A;  2G8H A;  5FPD A;  4M3U A;  3B6O A;  1SL0 A;  3AO4 A;  4BRI A;  3L4Q A;  3MN5 A;  5AQL A;  5LJW A;  2HHH K;  2O8B B;  3ZSY A;  5GIN A;  3SJH A;  4OLA A;  4FWS A;  4M3Y A;  3GE1 A;  1DTT A;  3VQ9 A;  3S3M A;  4BRO A;  3LP3 A;  3WQT A;  4B9V A;  3CFO A;  5J2M A;  4FJN A;  1NNE A;  1RT4 A;  3QET A;  4FJJ A;  3KKS A;  4O55 A;  3HVT A;  2A5X A;  4E1N A;  4JS5 A;  3GG4 A;  4WQ4 A;  1HUX A;  5AZI B;  1BUP A;  1HKG A;  3O3H A;  2E6L A;  4HUG A;  3ZSQ A;  1NG9 A;  1TKD A;  1EWR A;  2WFB A;  3BGR A;  3RMD A;  4JI6 K;  3TAE A;  2WC9 A;  2HHV A;  2HND A;  4CZJ A;  2D0A A;  1LW0 A;  2AJQ A;  5ADX H;  3DXK B;  3AA2 A;  2QWO A;  4QS7 A;  3VER A;  1TAU A;  5HRP A;  3THW B;  4MLE A;  3LL3 A;  1RTH A;  3GDQ A;  4OPK A;  2UXD K;  1VAZ A;  3SMP A;  5D3G A;  3SK3 A;  4KTW A;  1NK0 A;  4JKA A;  4BC4 A;  1KVC A;  2F9T A;  2ZD1 A;  4JK8 A;  5AQY A;  1NGF A;  3SI6 A;  3O08 A;  4CGF A;  3AA4 A;  1VQ4 N;  1L3U A;  2XY8 A;  4BWM A;  1BDG A;  4A59 A;  2P9P B;  1QSY A;  3DXK A;  4CGD A;  4DTU A;  4PKG A;  1RDC A;  4FWK A;  4BRD A;  3D2E B;  5E26 A;  4Z4E A;  4CW7 B;  4FJ7 A;  4A2A A;  1NK6 A;  4B9S A;  5EVZ A;  3MXJ A;  1BWF O;  3RVC A;  2XHB A;  2J4R A;  1C6V A;  1SQK A;  1TUU A;  1VK0 A;  5BPL A;  2QKB A;  3TSU A;  3L8B A;  5BR9 A;  1RBU A;  3LM2 A;  2FF3 B;  4BR9 A;  4KKO A;  3EZ5 A;  5EU7 A;  3T3F A;  3BUZ B;  1SZ2 A;  3CQ8 A;  2P9P A;  4C8L A;  1X3N A;  3V1Q A;  4CF8 A;  1S1X A;  3BP8 A;  3NVK A;  2NRR A;  2AA4 A;  1QVF M;  1SV5 A;  3HPH A;  4E0D A;  3MN9 A;  3CD6 N;  5TKY A;  2PFU A;  3O9S A;  4AHU A;  1E4F T;  3H6E A;  4Z4H A;  3HP6 A;  3LAL A;  3D2E A;  4RTF D;  3WQU A;  3OYJ A;  4H0T B;  2QI2 A;  1KAY A;  1L3S A;  1LWF A;  3ZSV A;  1RT7 A;  1WLJ A;  4GVM A;  4FWM A;  3ZSO A;  4B1Y B;  3T1A A;  3MN6 A;  3C6H A;  3HSC A;  2WTU A;  3PIO L;  5AQN A;  3VEZ A;  1VQL N;  3ZX2 A;  4C1N K;  2VQE K;  2ZGZ A;  3U6F A;  3I0R A;  3ZET A;  4LC9 B;  3TSP A;  3L3V A;  1KVA A;  2VG6 A;  2ZM6 K;  1O13 A;  3LPU A;  1HPM A;  4FLY A;  4DTX A;  1XNQ K;  4OO1 J;  3KZB A;  1N6Q A;  5FRN A;  3I56 N;  3GBT A;  5I42 A;  2HST A;  4PL8 A;  3CC7 N;  4GKK K;  1LAV A;  3RRH A;  3ATU A;  3HYF A;  3V9S A;  4E7H A;  1NMD A;  5E84 A;  5LY3 A;  3VQ8 A;  1TKZ A;  3J7Z O;  3W3D A;  3NH0 A;  1O1W A;  4JKD A;  2O8C B;  1B9D A;  1RBT A;  3M8Q A;  4A61 A;  4KTZ A;  3KKR A;  3BF1 A;  3ZET B;  1XI1 A;  1KC8 O;  2HHQ A;  2BUP A;  5BN9 A;  4ID5 A;  3CJ1 A;  5T7B A;  4FK0 A;  1MWK A;  5DM6 L;  3QER A;  1GOA A;  2Q31 A;  3NDK A;  2V52 B;  5KPT A;  3F9K A;  1BGX T;  3SV3 A;  4FZZ A;  2ZE2 A;  4B1X B;  1KQS M;  4O5F A;  3O9T A;  4EHT A;  4E7L A;  3WXI A;  3SNN A;  1P90 A;  2OTJ N;  3MN7 A;  4H0X B;  4ILG B;  4V19 S;  3CCV N;  1J6Z A;  3EKU A;  2IVN A;  3I8B A;  3ULE B;  1X3M A;  1OVQ A;  2G8F A;  2R7Y A;  3OYF A;  2O8C A;  4N56 A;  1HKB A;  4FJK A;  4BRH A;  3AVK A;  5CZ1 A;  2OPP A;  1BA1 A;  3RRG A;  3O9U A;  3ZX0 A;  4DS5 A;  1NGC A;  1YVN A;  3N4P A;  3V9W A;  3I33 A;  4NYN A;  4H0V B;  5DMR A;  3H3O B;  1I39 A;  2P9I A;  1WN7 A;  4CEC A;  1FKP A;  4A5A A;  3UKU A;  3J8A A;  2ZJQ L;  3S9H A;  4Y1C A;  4DU3 A;  4DQI A;  4PHT X;  3IFR A;  2IGI A;  4CHO A;  4JKG A;  1RT5 A;  2P9K A;  4ILJ A;  3I0S A;  4CJW A;  2OZM A;  1NGJ A;  3CC2 N;  3ULE A;  3AGK A;  2GEM A;  1IBK K;  5AQG A;  3TAF A;  1JLE A;  1NWK A;  1U4B A;  4AM6 A;  4RW4 A;  1KRP A;  4Z4C A;  1DKG D;  1LAW A;  3IG1 A;  1X9S A;  2W6K A;  3IKM A;  4FJ8 A;  4KHS A;  1SAZ A;  3A5M C;  2VCP A;  3NGI A;  4DLE A;  3BZC A;  1WSE A;  3ZYY X;  5GIO A;  4E7J A;  3U9Z A;  3C6A A;  3L2W A;  4MO4 A;  5M1Q A;  4RCH A;  1GLA G;  1L5U A;  3R9P A;  3VEY A;  3ENO A;  1IBM K;  1RIL A;  3SMS A;  3DI6 A;  5KPR A;  2GEL A;  2QXL A;  4CFB A;  2HBL A;  1TGO A;  2FLO A;  3TAR A;  1HKC A;  3MMV A;  4FL9 A;  4ID1 A;  4AHT A;  5TKW A;  5AQF A;  3V9X A;  3WXM B;  3FZK A;  2QXF A;  4RW6 A;  4BVO A;  3ATV A;  3PY8 A;  4DFM A;  1NK8 A;  4NXM K;  1KAZ A;  4FOI A;  3DOK A;  1YJ9 N;  2G8K A;  5KI6 A;  3CQX A;  4BRK A;  3NVM A;  1RDW X;  3OYM A;  1IG8 A;  4H5R A;  1BIU A;  4CHQ A;  1L3V A;  1ZBH A;  1X9M A;  3AO5 A;  4K42 A;  3J80 O;  1Q81 O;  1I94 K;  3ZT3 A;  1RBR A;  4M3W A;  1TV6 A;  1D8Y A;  1XHX A;  2KFN A;  5BPM A;  4CJL A;  4FPB A;  5CZ2 A;  1VQ6 N;  3PX4 A;  4ZTJ A;  3K5N A;  4DR2 K;  3IS9 A;  3OYC A;  1J5O A;  3R6M A;  4B9Q A;  3J81 O;  4N47 A;  2KW4 A;  2X6N A;  2P9N B;  2ITM A;  1VSI A;  3H08 A;  2XY7 A;  4OX9 K;  1S1T A;  2EWS A;  2KQ2 A;  3QFP A;  4CEO A;  1QZ6 A;  4GY2 B;  4O44 A;  4BRP A;  2VG7 A;  1VQK N;  5JLF A;  1KFS A;  4DQR A;  1TK5 A;  4TSX A;  2XY5 A;  3KHY A;  4BGB A;  2VGN A;  3UIQ A;  4KRF A;  1WBD A;  4MQ3 A;  1CXQ A;  1VQO N;  1C1C A;  1BQN A;  4FLZ A;  4KH5 A;  1IKW A;  4CJF A;  1VQ5 N;  2P9N A;  3ENB A;  4M7Y A;  4IFY A;  1N32 K;  1TYQ B;  1HYS A;  1JCE A;  2P9U B;  1RTD A;  4KTQ A;  4BE2 A;  2HVH A;  4FWP A;  3WNF A;  3HO1 A;  1EXQ A;  1ATS A;  4KHP K;  2PAV A;  2WOM A;  3K5O A;  2WBN A;  1NBW A;  1H1V A;  4IJA A;  1YTU A;  3TI0 A;  1JXE A;  3L2R A;  4DTS A;  3O9R A;  3MWP A;  1C0T A;  1WAJ A;  5KQ8 A;  3BEX A;  2G8I A;  2QEX N;  4Q0B A;  4CJK A;  2ZQB A;  4CIG A;  2BE2 A;  4YOR A;  4JAX A;  1J9A A;  4DSJ A;  3WXJ A;  4DR3 K;  4B3S K;  1NGI A;  3EN9 A;  3EL2 A;  1DEJ A;  1TYQ A;  4CEF A;  4YFU A;  4Z4I A;  4NO7 A;  3CXC M;  3HM8 A;  4XH5 A;  4CFC A;  2KLA A;  4IZ9 A;  4GW6 A;  4E1J A;  2VGM A;  1Z25 A;  4WFN L;  4B1V A;  3NE6 A;  1WUA A;  2FBY A;  4H5V A;  3QEW A;  3OBY A;  1Q9X A;  3E01 A;  3LP2 A;  3V81 A;  3E9L A;  3LDN A;  3QEP A;  2Z1G A;  4PA1 A;  1CLQ A;  3R3L A;  3AY9 A;  1S72 N;  4M41 A;  4KBO A;  1CXU A;  4E1M A;  1N5Y A;  4BE0 A;  1OH6 A;  2YJF A;  4EZ9 A;  4NB4 A;  3F5T A;  2GWJ A;  4I2P A;  4FWN A;  4Q5V A;  3OS2 A;  2Q97 A;  3QNO A;  1T8E A;  2NRV A;  1VSD A;  3L6Q A;  3K0S A;  4AH9 A;  3M8S A;  4AF1 A;  4YY3 K;  2ZJR L;  1BG3 A;  4E89 A;  1VRU A;  4RW8 A;  3F2K A;  1ZYQ A;  1YUW A;  1C0G A;  2GX9 A;  3VF6 A;  4OGE A;  4JN4 A;  4KI4 A;  4C8M A;  2QWP A;  3TTF A;  3THX B;  1BU6 O;  2FBV A;  3OJU A;  5BRH A;  3MX5 A;  5GAD P;  1ATR A;  2RKI A;  3VQ5 A;  4KHY A;  2UUA K;  4CZH A;  4LH5 A;  1WSG A;  4A57 A;  4LF9 K;  2DPN A;  2UUC K;  4BDP A;  4CGJ A;  4XEI A;  1QS4 A;  2YNG A;  4NLC A;  2QK9 A;  1OVY A;  3MDQ A;  2F4V K;  3KK7 A;  1IJJ A;  4AHR A;  4M42 A;  2B6A A;  3JS6 A;  4A62 A;  3C6U A;  1SKS A;  3JXU A;  4MDA A;  4DSL A;  4CJP A;  4FLX A;  1S5J A;  1HQE A;  4YHH K;  1UWB A;  4CZK A;  4LF5 K;  4BRA A;  2GV9 A;  3ULD A;  2HF3 A;  4H5T A;  1VQN N;  1IV0 A;  5HRR A;  1BHL A;  5IT9 O;  5BRE A;  3CC4 N;  1D9F A;  1U49 A;  3M6G A;  4CCH A;  2NNW A;  2FSN A;  1W2B M;  1IKY A;  2HHW A;  1IKX A;  3CM6 A;  4ICL A;  1CZ9 A;  5BR8 K;  5AQQ A;  1NGG A;  5CHI A;  2Y1J A;  3VQ4 A;  1HJO A;  3O1B A;  5KRT A;  4X65 K;  3CHW A;  3ID6 A;  3QEX A;  4KB0 A;  3DXM A;  4H03 B;  1W0H A;  2FSJ A;  1ZC6 A;  5C12 A;  4BRF A;  3THY A;  4LSN A;  4FZX C;  2RF2 A;  4CK3 A;  4H5N A;  4F3T A;  3O3G A;  3GL1 A;  3SYZ A;  4PKI A;  4OPH A;  5FRM A;  4DQQ A;  4C8O A;  1NLV A;  2P9L A;  1W7A A;  3OYD A;  5HOO A;  1GLE G;  2VWJ A;  1CZB A;  3NGY A;  1N33 K;  3PX0 A;  2Z1I A;  3OTO K;  4DR7 K;  5AQS A;  4FJG A;  3TPQ A;  3NF8 A;  1QE1 A;  1G15 A;  1M1K O;  4O8K A;  4B1Z A;  3CQY A;  4JI0 K;  3MXM A;  2Q36 A;  1HX1 A;  4WQ5 C;  3LPT A;  3THY B;  3ASM A;  5I3U A;  3AVA A;  3DRS A;  4YOU A;  1HPZ A;  1WSJ A;  1C0M A;  2D0C A;  1TAQ A;  1LWE A;  4CGI A;  1RT3 A;  4DR5 K;  3KLE A;  3HZ6 A;  3DLG A;  5AQU A;  4FJ9 A;  3K5L A;  4CEE A;  1YT3 A;  5EOY A;  3V4I A;  3P83 D;  5HL7 L;  1YJN N;  1NGE A;  1ZBL A;  4WFB L;  4FM1 A;  4J2D A;  3TR8 A;  3A5O C;  4B3R K;  1S9G A;  1VQ8 N;  4IG0 A;  4DTR A;  1F21 A;  4OPA A;  4JKF A;  4WQ5 A;  3SUN A;  4JI5 K;  4CIF A;  5BN8 A;  2DY4 A;  3VPZ A;  3MEC A;  3O4W A;  5HLF A;  2Z1J A;  1NGD A;  4H8K A;  4B9T A;  1QTM A;  1XC3 A;  3MCP A;  4IEE A;  4EIA A;  2KTQ A;  4M3R A;  1VQP N;  1HQU A;  3V1R A;  2IAJ A;  3AAR A;  3E9P A;  3BY5 A;  1WBB A;  2ASM A;  3VQD A;  4K8X A;  5FPE A;  4JI1 K;  3CER A;  5J1E A;  4NXN K;  1RT1 A;  3K57 A;  1XNR K;  5CY4 A;  3DRP A;  3VQ6 A;  5AQP A;  4WE1 A;  3AVM A;  3THV A;  3ENH A;  2BTF A;  3J7A P;  3EKS A;  3FFI A;  5M1N A;  3SJJ A;  4I6M B;  1RDA A;  3TTC A;  1E4G T;  1GOB A;  4H5W A;  4IDK A;  3SCX A;  1IO2 A;  3AO2 A;  4KH4 A;  2P51 A;  1K8K B;  4K41 A;  4BVP A;  1Q86 O;  4BWJ A;  1NJZ A;  2D5R A;  2NZT A;  1RT2 A;  2FF6 A;  3U3Y A;  3PO5 A;  3ZEU A;  2JWK A;  5C25 A;  3H46 O;  5AQJ A;  5FPM A;  2GUP A;  5AQT A;  2HHU A;  1T03 A;  3A0I X;  4BR7 A;  3HRG A;  1FJG K;  2NRX A;  3TSQ A;  3NGZ A;  4LFC K;  4B9L A;  3K5M A;  3HJF A;  1TK8 A;  4GMJ B;  1U2V B;  2CH6 A;  1N8R O;  2VWB A;  3AVG A;  4BRQ A;  3NF9 A;  3CFR A;  4KHU A;  1HJR A;  4F9O A;  4I6M A;  4BQL A;  4O0I A;  1IG9 A;  1VQ7 N;  3SQ1 A;  4FJI A;  5K14 A;  4Z94 A;  3R1X A;  1J53 A;  2YNF A;  3KIO A;  1A5V A;  1TKX A;  3QB0 A;  3CJC A;  3DLE A;  4M7X A;  4CFD A;  1ILY A;  4CK1 A;  4IFE A;  3D0P A;  1SS6 A;  3ZEU B;  4XH4 A;  3VGK A;  1LOT B;  3L4I A;  4LF8 K;  5C0Y A;  4FYD A;  3IDH A;  3SAF A;  3T7Z A;  1VSH A;  3DMJ A;  4O0J A;  3BF3 A;  4F2R A;  3IRX A;  2W42 A;  4DV7 K;  1BO5 O;  3P5J A;  4LH4 A;  4EP5 A;  4FLU A;  4PQU A;  1DTQ A;  4FM0 A;  1A5W A;  4OKE A;  4CJ7 A;  3WXL A;  4JRQ A;  3SBT A;  1NK5 A;  1S9E A;  1S6P A;  4CE9 A;  3CYM A;  3C0B A;  1MWM A;  4BRG A;  1JCG A;  3CPE A;  1LCU A;  1NM1 A;  4BC2 A;  4JLH A;  1BCO A;  5AQI A;  2ZF5 O;  3AO3 A;  1GLB G;  4DHY A;  4IO9 L;  1NK4 A;  3OY9 A;  3LP0 A;  3A5N C;  3HTV A;  4IJN A;  2BDP A;  1XHZ A;  4B9M A;  4DF4 A;  5HRS A;  1JLB A;  2HOE A;  4CGH A;  3KK1 A;  2RHK A;  4W5T A;  1OKJ A;  4CZE A;  1HYV A;  1S1V A;  4BGA A;  2YHW A;  4DMN A;  1BI4 B;  4JKC A;  1DGK N;  3I8D A;  4E3S A;  2YHX A;  2QWN A;  2PYJ A;  1V4T A;  5C42 A;  4JNE A;  3HOT A;  3WEE B;  1M90 O;  4A2B A;  1N36 K;  4KAZ A;  4JI2 K;  4DFJ A;  3OYI A;  3AV9 A;  2GUI A;  4PY5 A;  4F8R A;  3L2U A;  1MDU B;  4CBU A;  2E6M A;  3TAQ A;  3ISN C;  4J2A A;  4FXD A;  1GLD G;  1RBV A;  3AVB A;  3RR8 A;  4CF9 A;  4H0Y B;  4DR1 K;  4MLH A;  4Z0U A;  1WAF A;  5J2P A;  4CZI A;  5AZI A;  1NGH A;  3P4I A;  2I7P A;  2NRZ A;  4FK4 A;  4BR0 A;  4CJQ A;  1TKT A;  1U6Z A;  4R79 A;  1VRT A;  3NCI A;  3QO9 A;  1RGI A;  3DRR A;  5AFU H;  3SZ2 A;  4WFA L;  1VSF A;  4CGG A;  3G71 N;  2XY6 A;  1Q9Y A;  4YOV A;  3B8A X;  2Q3S A;  1HRH A;  5CR4 A;  4GV9 A;  1WNS A;  3LAK A;  4FVU A;  3E1Y A;  2HHT A;  5LMN K;  2XRI A;  4AQY K;  3HXM A;  4AM7 A;  1NGA A;  3CCS N;  4FCY A;  1CZA N;  3DOL A;  4CJE A;  4B9U A;  2G8V A;  3LAM A;  2BH1 A;  3SBG A;  4DF8 A;  3OYG A;  3CCU N;  2G8W A;  2CGL A;  5ADX A;  3V9U A;  3NF6 A;  4HUF A;  4M3T A;  3QES A;  5GIP A;  4CZL A;  5JMV A;  1KLN A;  1KSP A;  1NGB A;  1ZBF A;  3NBP A;  5HRN A;  4QAG A;  4C1N I;  1MA9 B;  3CJ9 A;  2IIR A;  5EY4 A;  5B8H A;  3CCJ N;  4CBW A;  4F3O A;  3VET A;  4GV3 A;  4LSL A;  4BDY A;  4W5O A;  3CG7 A;  4GKJ K;  4JKB A;  3G0Z A;  4HTL A;  3NH1 A;  1ZBI A;  1NJY A;  4DR6 K;  1L3T A;  1Q18 A;  4Y0W A;  3VF4 A;  1RNH A;  1EQY A;  3QIN A;  2GTD A;  4IXC A;  3QEI A;  4DSK A;  2JGU A;  1SKR A;  5CYM A;  3NF7 A;  3W0L A;  5E41 A;  2EHG A;  4JHD A;  4I9Q A;  3JSM A;  2OAN A;  3WUH A;  2GBZ A;  2X6S A;  3G25 A;  4B8C A;  3OBW A;  3WNE A;  2A40 A;  1BL3 A;  5M1O A;  1VSL A;  4CZG A;  4BG9 A;  1SL1 A;  4BR2 A;  1JCF A;  3FR0 A;  1RTJ A;  3H1V X;  3OS1 A;  5GAE P;  2VG5 A;  4DLG A;  3THW A;  3D2F A;  5HRO A;  1NOY A;  5JS1 A;  4Z4G A;  2JLE A;  3VEW A;  3CJ7 A;  3QBX A;  5KGW A;  3KLG A;  3LDQ A;  3OW2 M;  3MWT A;  3VTH A;  3FZH A;  2HF4 A;  4B08 A;  5LJV A;  3U4L A;  3AGR A;  1OH5 A;  4H0P A;  3M8P A;  2P1J A;  1ZBS A;  5AQH A;  5C2F A;  1SKW A;  2QKK A;  3PO4 A;  2DFF A;  4CEZ A;  4JI3 K;  3ITH A;  2E1Z A;  3DLH A;  3DLL L;  4FOE A;  4UQG A;  4JHD B;  2KFZ A;  5GAG P;  2FBT A;  3QIO A;  4DQ8 A;  3AVN A;  3CCM N;  3K9K A;  4CD1 A;  4PUO A;  3KTQ A;  4LFB K;  3DLK A;  3JAM O;  4ISE A;  3S3N A;  2ZJP L;  3BZK A;  1X1P A;  1BCM A;  1JLA A;  3D2F B;  3QDK A;  4KHW A;  2ITG A;  3ZCM A;  3OYH A;  2P5O A;  1BIS A;  5AZJ B;  4CES A;  4M3Z A;  3LZJ A;  3OYL A;  4BC5 A;  4C8K A;  3LZI A;  3PSF A;  2A1S A;  4B3O A;  3ZT1 A;  1RFQ A;  5F2R A;  2W41 A;  3C94 A;  4FSV A;  3NHG A;  4FWL A;  4DV1 K;  2YV0 X;  3PLA A;  5JS2 A;  2HBJ A;  3MX2 A;  3IUC A;  2X74 A;  4ISF A;  2O8F A;  1S3X A;  3PUF A;  4KRE A;  5C15 A;  1SL2 A;  2QWL A;  4CF0 A;  1QQO A;  3FZF A;  3PSI A;  2Y1I A;  2D0P A;  1LW2 A;  4ISG A;  3HPG A;  4JI7 K;  4DQP A;  5BRD A;  2IOC A;  4CHP A;  3A2F A;  5A2Q O;  2YJE A;  1C0U A;  3DLR A;  1IBL K;  2YNI A;  1WSF A;  3LDS A;  4B9N A;  3P38 A;  3OHR A;  2Q0R A;  4FK2 A;  5AZJ A;  4HUE A;  3L0Q A;  1XWL A;  4DSE A;  2A1R A;  3U9D A;  1IH7 A;  2OPR A;  4MFB A;  1YIJ N;  3O4N A;  4FLW A;  2OZS A;  4K25 A;  2O8E B;  1K8A O;  5HBM A;  4BRC A;  3CET A;  2XO7 A;  1KCF A;  1VSJ A;  4CHY A;  4FJH A;  4NCB A;  3LDL A;  2QWR A;  4WF9 L;  4ELT A;  2E2N A;  2O8F B;  4O8U A;  3C95 A;  3V6D A;  3KWG A;  3TAM A;  5KGX A;  3MED A;  5LMU K;  4KHQ A;  4YOY A;  2CGK A;  2VQF K;  2PZS A;  3HVR A;  3C65 A;  3A5L C;  5H1S Q;  4FM2 A;  1R59 O;  2HBM A;  4BE1 A;  4FJ5 A;  1QSS A;  2P9I B;  2A41 A;  1XMQ K;  1XUP O;  1U48 A;  4BQZ A;  4ZTF A;  3NMU A;  3OYK A;  3TAP A;  1NOZ A;  4JKG B;  4H0O A;  4BG8 A;  3TAB A;  1QHA A;  4CJ3 A;  3SV4 A;  1W9H A;  2YHB A;  3H45 C;  4O5B A;  3ZSX A;  2O8E A;  4HTU A;  4CD3 A;  2RN2 A;  3CJA A;  2FBX A;  1T3V A;  5J2N A;  1C1B A;  2X78 A;  3O1W A;  4BC3 A;  3VA0 A;  3ZT0 A;  5C2D A;  3MXI A;  3VGM A;  5AQW A;  1E3M A;  4IOA L;  2DFE A;  2NRT A;  1SUQ A;  2I7N A;  2O4G A;  4DV5 K;  1NK7 A;  4JD2 A;  2W6L A;  3CPW M;  4JKH A;  1UA1 A;  4MDB A;  5AQZ A;  3U3G A;  4AHV A;  1Y97 A;  2NRH A;  3C7N B;  2GWK A;  4CIE A;  4CJ4 A;  3PX6 A;  1VQM N;  3UKR B;  1LWC A;  4DR4 K;  1GLL O;  3OYA A;  1ATN A;  1BQM A;  1FKO A;  2JWL A;  4CER A;  2QM1 A;  5J2Q A;  2AP1 A;  4WYB A;  4NLB A;  3T19 A;  1EWQ A;  1QQN A;  3NAE A;  1HNX K;  4CJS A;  1KFD A;  1NKB A;  2F8T A;  3QFU A;  3SPZ A;  5KQD A;  5AQO A;  3SUQ A;  2HMI A;  5GAH P;  3O6W A;  1D9D A;  4BY9 C;  4DUY K;  1KTQ A;  1RDD A;  4CBX A;  1Z6R A;  1HNW K;  1Z26 A;  1FW6 A;  3KJV A;  4JD2 B;  4W5R A;  4DS4 A;  1Q7Y O;  3UKU B;  3AA5 X;  2E8A A;  3RWU A;  1XQS C;  3HK2 A;  1BOT O;  3C7N A;  5F0X A;  2KZM A;  5JVG L;  4M45 A;  2P9K B;  5AQM A;  3KLF A;  1UAX A;  3UKR A;  4FWO A;  2WUS A;  3NH2 A;  2ZWH A;  1OH7 A;  4FJX A;  4G1Q A;  1I3A A;  2D0O A;  3H3N O;  1S22 A;  2VYP A;  4RG8 A;  3M3Z A;  1YTA A;  4OKJ A;  2QTD A;  1EO1 A;  4CJ5 A;  3O9Q A;  1KLM A;  3WNH A;  4JEP A;  2FC0 A;  2OCE A;  2OA8 A;  1ZBU A;  4LD0 A;  3VQP A;  1FXX A;  1GLF O;  3HPO A;  4DTN A;  4PKH A;  4DTP A;  2BAN A;  1FK9 A;  1JJ2 M;  2NUB A;  3Q7B A;  3TTD A;  4B3T K;  4EAH D;  1YHQ N;  5FDL A;  4YDU C;  2YNH A;  2NRW A;  3H1Q A;  2B5J A;  4CK2 A;  3E66 A;  4C8N A;  4DSF A;  2E2P A;  1D4X A;  3LDP A;  3L2Q A;  1DT9 A;  3AVJ A;  1ZXO A;  1KVB A;  4AIL C;  4DUZ K;  4PL7 A;  4X64 K;  3QBW A;  5M1K A;  1T44 A;  3K58 A;  1TUY A;  3VQC A;  4OLB A;  2E4L A;  3VQQ A;  4RWT A;  5DK5 A;  4IKF A;  4IFV A;  1WSH A;  4I7F A;  4OPJ A;  1HNZ K;  2V7Z A;  4BR4 A;  2YHY A;  4DTM A;  3MK6 A;  3OVN A;  3N4Q A;  3VMF B;  2B4J A;  4A5B A;  4K8Z A;  4FWR A;  5BRF A;  1Z05 A;  3SQ2 A;  2CH5 A;  3AVI A;  3CJB A;  4DV3 K;  1JXB A;  3OJS A;  4JV5 K;  3CCQ N;  4BRM A;  1ASV A;  5EXW A;  4E19 A;  1X9W A;  4KHN A;  4FLV A;  2UXC K;  3P39 A;  4DWI A;  1T7P A;  2HB5 A;  5FLX O;  3RMA A;  3WT0 A;  3EE8 A;  3DWL A;  4DV6 K;  4XIU A;  2KZZ A;  4G9Z A;  3ZSW A;  4YDU A;  3AVL A;  3ID8 A;  3F9M A;  4AHC A;  2Q1N A;  3LP1 A;  5AQX A;  3IAY A;  2V51 B;  3DLB A;  5FPN A;  4QOZ B;  3AO1 A;  4M63 C;  3EE9 A;  1S6Q A;  1TL3 A;  3DJC A;  3OA9 A;  2CGJ A;  2ZGY A;  4N76 A;  2E20 A;  1QQC A;  2F9W A;  2E1Y A;  5JIC A;  3UB5 A;  3FLC O;  2YCH A;  3AAQ A;  3A8Y A;  4OVL A;  4CF1 A;  1U47 A;  1ASU A;  3KD5 E;  1KXP A;  3MAQ A;  5FRO A;  3FZM A;  3LWM A;  5KRS A;  3QIP A;  5CE3 A;  3MEE A;  2UU9 K;  4IDH A;  4JI8 K;  2ASO A;  2P9U A;  3F73 A;  4ZHR A;  3HP9 A;  3T1H K;  1LV5 A;  4FW2 A;  1NMN A;  4CJT A;  3EZW A;  4ELU A;  2YKN A;  4DV2 K;  3M5R A;  1HYZ A;  3G6E N;  2YI1 A;  2HVI A;  1D5A A;  4EFH A;  3S3O A;  1QZ5 A;  5EX5 A;  3TWH A;  4CEB A;  3M1F A;  2KHO A;  3ZX3 A;  1T6C A;  2F8S A;  3E9O A;  5KPZ A;  2UUB K;  1S1U A;  4YNQ A;  2HBK A;  5KTQ A;  4LY7 A;  4FWQ A;  5AR0 A;  1YJW N;  3QIC A;  3WNG A;  3SUP A;  1Q82 O;  1GOC A;  3DYA A;  1TK0 A;  3EO3 A;  1BA0 A;  1RCH A;  3WXK A;  5I9E B;  1R0A A;  4K0K K;  1B9F A;  4M3X A;  1QQM A;  1S1W A;  2DTU A;  2A42 A;  2RE2 A;  1QVG M;  4FZY A;  2E5L K;  2F96 A;  2HHX A;  1C0F A;  2D4W A;  4FLT A;  3V1O A;  5AQR A;  3AA3 A;  4B8A B;  4LF6 K;  5IWA K;  4GVE A;  3VEX A;  5SWM A;  4YOT A;  1K9M O;  4C23 A;  1HR0 K;  1HMV A;  4Y1D A;  1UA0 A;  3IMX A;  4RW9 A;  4L3Q A;  3O3F A;  3P1G A;  1WOQ A;  4EHU A;  3SAG A;  4UY8 O;  4GV6 A;  1MU2 A;  3MEG A;  4CHZ A;  4PWD A;  3CIP A;  1JL1 A;  1RBS A;  2HHS A;  3VEN A;  4IOC L;  4HCB A;  4QCL A;  1U45 A;  4WCE L;  3DXM B;  3PV8 A;  2HMP A;  2EX3 A;  1YIT N;  3HL8 A;  3ZT4 A;  3OYN A;  3CM5 A;  1Q8I A;  2QWM A;  1RDB A;  3SLC A;  3CME N;  4CZF A;  4YOX A;  1YXQ A;  4IEI A;  4CFA A;  2FXU A;  4FJL A;  1JLG A;  3SPY A;  4RW7 A;  1NKC A;  4KI6 A;  1TL1 A;  3ALY A;  3L2V A;  3THX A;  3KD1 E;  1VSM A;  5F1X A;  4O4G A;  3JYT A;  5CYQ A;  2P9L B;  1ESV A;  2YHA A;  2QA4 N;  1VHX A;  4LFA K;  3FZL A;  3HI0 A;  4OJR A;  1JLF A;  2E2Q A;  3SAH A;  4KH6 A;  3VQA A;  4K43 A;  1B92 A;  2WON A;  1Y64 A;  3CCR N;  1TVR A;  3AVC A;  3RSE B;  3VTI A;  1WSI A;  1ITG A;  4CJR A;  1GLJ O;  2O8D A;  3EY1 A;  4LF4 K;  3VOV A;  3CI5 A;  4AHS A;  4N5S A;  2IC3 A;  5AFU A;  1YVU A;  2F7T A;  3AAP A;  4CJV A;  3VES A;  2HNY A;  2E88 A;  4HVJ A;  3LAN A;  3CCE N;  3QML A;  1VSE A;  2RPI A;  1NJW A;  1J5E K;  4F4K A;  4NCG A;  4DG1 A;  3T69 A;  1C1A A;  1NKE A;  1REV A;  2OPQ A;  2VWK A;  3FFK B;  3AVH A;  2OTL N;  4DV4 K;  4CHN A;  2FSK A;  2P5G A;  4CF2 A;  4JK9 A;  5HP1 A;  3RSE A;  1NJX A;  2E2O A;  4L8R B;  1G99 A;  2O8D B;  3RR7 A;  4CI6 A;  3HST B;  2IDO A;  1W97 L;  3LWL A;  3L3U A;  1JLC A;  2ASP A;  4MO5 A;  3S41 A;  4B1W B;  1XMO K;  3P31 A;  1EKE A;  5C24 A;  3B6P A;  4QS9 A;  4I2Q A;  1QHT A;  4E7I A;  2LSN A;  4KO0 A;  3R8E A;  4I9L A;  3D7E O;  3DM2 A;  3G10 A;  1YI2 N;  4YOW A;  3K2P A;  3VEV A;  5AQK A;  4IG3 A;  4H4O A;  4OGC A;  4J2E A;  1NU0 A;  4IOX A;  2OPS A;  1YAG A;  4HWI A;  4Z4F A;  1K8K A;  1VQ9 N;  3HOS A;  1X9J A;  4KV8 A;  5AJ3 K;  3SQ0 A;  2D1K A;  5JVH L;  4JYA K;  4FW1 A;  3QEV A;  2UYT A;  3VF2 A;  3O80 A;  3SQ4 A;  5ELZ A;  1T05 A;  1RT6 A;  1JKH A;  2A6A A;  3EEQ A;  3KK3 A;  4BRN A;  1A5X A;  4KFB A;  5BPN A;  4DFK A;  4DV0 K;  5M1P A;  4JS4 A;  4CED A;  4HHT A;  3LDO A;  3VN5 A;  3VQB A;  3PIP L;  4BDZ A;  3CMA N;  3D45 A;  1DLO A;  3HT3 A;  2PBD A;  4CEQ A;  4W5Q A;  4DU4 A;  1JLQ A;  1QSL A;  4JK7 A;  2UXB K;  3V9Z A;  4BRL A;  3RMB A;  4FPA A;  4W5N A;  2HW3 A;  3KLI A;  4NCA A;  4GNI A;  1T6D A;  3DAW A;  3SUO A;  1KD1 O;  4ILH A;  4WQ4 C;  3O5B A;  1OH8 A;  2QWQ A;  3TU5 A;  2D0B A;  4FVM A;  3OYB A;  2A3Z A;  2H3G X;  1XC9 A;  3C6T A;  3CCL N;  2V7Y A;  4H4M A;  5JLH A;  4J8F A;  3FE1 A;  3K59 A;  4QS8 A;  3ZSR A;  4U7B A;  3FGU A;  4X66 K;  4DSI A;  4F2S A;  3RMC A;  3MCA B;  3G4S N;  3UE5 A;  1N34 K;  4NYF A;  3LM9 A;  4BAC A;  1VSK A;  2QW9 A;  3HM9 A;  3QLH A;  1HLU A;  1IKV A;  4X62 K;  3KK2 A;  1EX4 A;  2O4I A;  3GOI A;  3HBT A;  3ZLJ A;  4CEA A;  2Z1H A;  1UOC A;  5LL6 Z;  3ZT2 A;  3KLH A;  1U2V A;  3J7Y P;  3KVG A;  3O8M A;  5M1F A;  4DQS A;  4B1U B;  2PY5 A;  1HNV A;  4DU1 A;  3O4Q A;  4KPY A;  1GLC G;  3NFA A;  4BR5 A;  1BI4 A;  4E7K A;  5MLC Q;  3TAG A;  1RTI A;  2Q0U A;  2YKM A;  4R5P A;  4DB3 A;  3WEE A;  2IVO A;  4N41 A;  1YF5 L;  4DCH A;  4OKK A;  2DFH A;  2KKZ A;  3VA3 A;  4LF7 K;  2W40 A;  2YX6 A;  3TAN A;  1EET A;  4CZM A;  3T1Y K;  4JRP A;  2ATQ A;  3EYZ A;  2IS3 A;  4DTJ A;  1K73 O;  1HNI A;  4EP4 A;  5C10 A;  4ELV A;  4IWV A;  3VEO A;  1BIZ A;  3CF5 L;  2P9S B; 
#chains in the Genus database with same CATH homology
 2ZM6 K;  4JI7 K;  1HNX K;  4DR6 K;  1XNQ K;  5A2Q O;  4K0K K;  1IBL K;  4GKK K;  4DV3 K;  1J5E K;  4DUY K;  2UXB K;  4JV5 K;  1N33 K;  1HNW K;  4YY3 K;  3OTO K;  1FJG K;  2UXC K;  4DR7 K;  1N36 K;  4LFC K;  2E5L K;  4JI2 K;  4DV4 K;  1N32 K;  5FLX O;  4JI0 K;  4LF6 K;  5IWA K;  4B3M K;  4DV6 K;  1IBM K;  1HR0 K;  2UUA K;  4DR1 K;  5LMU K;  4KHP K;  4CW7 B;  2VQF K;  4LF9 K;  4JI4 K;  2UUC K;  4DR5 K;  1XMO K;  4CVN E;  4X66 K;  2F4V K;  1XMQ K;  4JI3 K;  1N34 K;  4NXM K;  2HHH K;  4X62 K;  4LF8 K;  4DR3 K;  4V19 S;  4B3S K;  4B3R K;  4YHH K;  4LF5 K;  5LL6 Z;  2UU9 K;  4DV7 K;  3J7Y P;  5LMN K;  4AQY K;  4JI8 K;  4JI5 K;  4LFB K;  4B3T K;  3J80 O;  1I94 K;  3JAM O;  5IT9 O;  3T1H K;  5AJ3 K;  4LFA K;  4DV2 K;  4DR2 K;  5BR8 K;  4JYA K;  3J81 O;  4JI1 K;  4NXN K;  4DV5 K;  4X65 K;  4DUZ K;  1XNR K;  4JI6 K;  4OX9 K;  4X64 K;  4LF7 K;  3J7A P;  4DV1 K;  3T1Y K;  4DV0 K;  2VQE K;  2UUB K;  4DR4 K;  1HNZ K;  2UXD K;  4GKJ K;  1IBK K;  4LF4 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...