5LMNK

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
120
structure length
120
Chain Sequence
VKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 27
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 5lmnK00
4DR6K 4JI5K 4GKJK 5BR8K 1N33K 4DV7K 4X64K 4DV6K 1XMOK 4LF9K 4B3MK 2UXCK 4DR3K 4NXNK 4DV4K 4LF8K 2UUAK 1J5EK 1XMQK 1XNQK 4DV5K 4JI8K 1HNXK 4JI0K 4JI7K 5FLXO 2UXBK 4X65K 4LF6K 4LFBK 2HHHK 4JI3K 2F4VK 4DV2K 3J81O 4JI6K 4V19S 4YY3K 4DR5K 1HR0K 1N32K 5LL6Z 4JI4K 2VQFK 3T1YK 5LMUK 4YHHK 1I94K 2UXDK 3OTOK 4JI1K 3J80O 2UU9K 4AQYK 4OX9K 3J7YP 2E5LK 4JYAK 4NXMK 4LF7K 4DR2K 1FJGK 4DR4K 5LMNK 4X62K 4B3TK 1IBKK 4DV1K 4K0KK 5A2QO 3T1HK 4GKKK 2UUBK 2VQEK 4DV0K 4LFAK 5IT9O 1IBLK 4DUZK 4X66K 4JV5K 2ZM6K 4LFCK 1IBMK 4CVNE 4CW7B 3JAMO 4B3SK 4DUYK 4DR1K 4B3RK 2UUCK 4DR7K 4LF5K 1N34K 5AJ3K 4JI2K 4KHPK 1N36K 1HNWK 1XNRK 4DV3K 5IWAK 4LF4K 3J7AP 1HNZK
chains in the Genus database with same CATH superfamily
3SAGA 4BACA 4DR6K 4CFBA 2HBKA 3LPTA 3HPHA 3FZKA 4B3OA 3L0QA 1DTQA 2QWLA 1UA1A 1Q7YO 2HHTA 4M63C 4FLTA 1TGOA 5BPMA 2DFHA 5BRDA 4IDKA 5M1NA 1BL3A 1J6ZA 4CZEA 4F4KA 4JS5A 4XH4A 3AA5X 1P8ZA 5F2RA 4I7FA 4B1VA 4B9TA 4FLUA 3WNEA 4F2SA 2G8FA 3VENA 3QB0A 3EN9A 5GAEP 2F4VK 1JKHA 3OBYA 4E1NA 2ZWHA 5FPEA 3NVMA 2YV0X 3PO4A 3D2EA 4IXCA 4K25A 3T1YK 1RT2A 5GADP 3C95A 4GVEA 3AA2A 3LANA 4CD3A 3ZX0A 4FW1A 3O3GA 3QICA 2VG6A 3CFPA 1XHXA 3J7YP 4GV9A 4JYAK 2V7YA 4IO9L 1NNEA 4FJXA 1U04A 1RBUA 3AO1A 5ADXH 3DM2A 1VQNN 3VEVA 3ZSZA 4DR4K 5AQRA 3NF6A 4BRMA 1TKDA 3THYB 2NRXA 3T1HK 3RTVA 3UB5A 3SK3A 3C6HA 5I9EB 4DU3A 3DXKB 5J1EA 4LFAK 4YOWA 3SUOA 5AZJA 1L3SA 4DSIA 3SPZA 2V52B 1C0TA 2PZSA 1NGFA 5KRTA 2HBMA 1G15A 4AH9A 5KPZA 1BDGA 1U49A 2YNGA 1XNRK 1RDCA 3JSMA 2QK9A 2DTUA 5FPNA 2P9NA 2YHXA 4GY2B 3RRHA 4OKKA 1B9DA 5GAHP 4FOEA 3QESA 1NJYA 2ZJRL 3CQYA 3KIOA 4JAXA 2HB5A 3EZWA 3H08A 3VQ8A 2R7YA 2Q0UA 1FKOA 3LWMA 1BQNA 1LWEA 1JL1A 3QIPA 4FSVA 3AARA 3PLAA 4B1XB 1J5EK 4JKBA 4BR7A 4JI8K 4CF9A 3A2FA 2NRRA 4BVPA 3UKRA 5SWMA 4FJ7A 4CZFA 3C65A 4N56A 1NG9A 1DEJA 2A1SA 3LDLA 4JKFA 2D0AA 5JVHL 2O8BA 4O8UA 3SAFA 4EHUA 1VQ9N 2I7NA 5I3UA 3OYCA 2P9IA 4YDUA 1A5WA 2HNZA 3TAEA 3ATUA 1C1AA 1TVRA 3WXIA 3SQ4A 3VEOA 4ELTA 5JMVA 3TWHA 4CCHA 4N76A 1TYQA 3HP6A 3O9TA 3DOLA 1P90A 3NGIA 5LMNK 2Q97A 1A5XA 1WSFA 1IBKK 4MLEA 1U4BA 3L6QA 2X6NA 2V51B 4O0JA 3OY9A 4RW9A 3RSEB 3OBWA 4O8KA 4KO0A 4Z4GA 4EP4A 1ASUA 2F7TA 4MLHA 4IZ9A 3MN9A 3SLCA 4BWMA 5J2NA 4I9LA 4GV6A 2I5JA 2B5JA 3CMEN 4IG3A 3E1YA 4DFMA 4LY7A 4DR7K 3OYLA 2YKMA 4N5SA 4DTUA 3PSFA 4BRPA 1C1BA 5KQ8A 3V9SA 3D45A 3R9PA 4ISFA 3RWUA 4BQZA 3K59A 2XY7A 3KKSA 2CGJA 1HRHA 1NGDA 4HTLA 3LWLA 5HLFA 4CFAA 5BREA 4CJVA 1ATNA 4CEDA 4ELUA 3BZCA 4DV7K 1RBRA 1XI1A 5JLFA 2F9TA 4MQ3A 2KZZA 3NBPA 1HYVA 3C94A 3SYZA 2KQ2A 2A5XA 4U7BA 1XMQK 3C7NB 3QINA 5AQWA 3SQ2A 1FK9A 3VA0A 4X65K 3AO4A 4LF6K 1JL2A 4LFBK 1Z25A 2KHOA 2FBXA 4H03B 4JI6K 2E1YA 2KKZA 3QEIA 4H5TA 1VQ4N 1W97L 4Z94A 3D7EO 5HROA 3LDSA 1JLFA 3OYKA 2UXDK 4CZIA 3NVKA 4F2RA 3VQDA 4CGHA 4FJ9A 1F21A 4BRKA 4BQLA 4M42A 3CCEN 3TARA 4DQPA 1SKSA 1HJRA 4XH1A 4UQGA 3NF9A 4DR2K 3TAFA 2D4WA 2GEMA 4B9SA 1K8KA 1L3TA 4CECA 2XRIA 4BY9C 1RTDA 3KLIA 3ZETA 3HRGA 4JNEA 1ILYA 2FSNA 3TR8A 2VQEK 3EKSA 4MDBA 5KRSA 4B9UA 1S1UA 4M3TA 4IEIA 4XH5A 4CF1A 4CZLA 3ENHA 1T44A 4WCEL 4I2QA 3CCVN 3O80A 5EOYA 5BR9A 3QEPA 4ZTFA 5AQNA 3AVHA 4DR1K 1ZBSA 1TV6A 4QS8A 5EX5A 4J2EA 2BTFA 3P5JA 4H5VA 3PIOL 4BRCA 2O8DB 4FK4A 1YTUA 3F2KA 3QERA 1N36K 2NRWA 4DQIA 3V9WA 3B6OA 4NYFA 3FE1A 4MDAA 2Z1JA 4JKCA 2JGUA 1VQ6N 3L2WA 2YX6A 4QS7A 3ZSWA 3DXKA 4WFBL 4H0PA 2Z1IA 3WXLA 4DG1A 4GNIA 4MO5A 5HRNA 4FZYA 4CJTA 3HSTB 4H0TB 2JLEA 1HKGA 4H4MA 3A5MC 2YHWA 3LM9A 3IFRA 4DV4K 4CZGA 3VQ4A 3M8QA 3LAKA 4JKHA 2XO7A 2EHGA 1YXQA 1HLUA 4B1YB 4ID5A 1Z05A 1JLCA 1LOTB 2UXBK 3DLLL 3MECA 3VF2A 2D0CA 3D2EB 3MWTA 2FBYA 4K43A 3CM6A 3K0SA 5LL6Z 1SQKA 3KHYA 5FRMA 4CJSA 1I3AA 1MDUB 1BISA 3E9LA 3KWIA 1W9HA 4N41A 4JI1K 4K8XA 3O3FA 1D4XA 3ENBA 3HZ6A 2UU9K 5JS2A 4OX9K 1NGGA 1D8YA 3AVAA 2JWKA 4G1QA 1V4TA 2FLOA 2QWOA 4CHZA 3J8AA 1BA0A 4CEFA 5JVGL 1Y97A 3CXCM 3S3NA 1T7PA 3IUCA 1HPMA 1ASWA 1LAVA 3MWPA 2E8AA 3HI0A 1VRTA 3H3OB 1I39A 3VQ6A 1RDAA 4KH4A 2E2PA 1NMNA 1HYZA 4CW7B 4EP5A 3ZT1A 3K9JA 4RTFD 4FVMA 4BRHA 2RHKA 3TABA 3RMAA 3SAHA 2YHYA 2QM1A 1HQEA 1NGAA 1BO5O 2P9NB 4FLYA 1NGJA 1KTQA 1RT4A 1VSDA 4LH5A 3EO3A 4Z4CA 3ATVA 3DYAA 3CYMA 3MEGA 1JJ2M 1NK5A 4HCBA 4CJ4A 4DFJA 4OKJA 4JI5K 5HOOA 4N47A 2VWBA 4DQRA 4JN4A 3CF5L 4CEBA 3AGRA 3CPWM 3P31A 1NGHA 5I42A 1NK4A 3BZKA 1KCFA 3KVGA 3G6EN 5HRPA 3K2PA 1BQMA 2VCPA 5M1QA 1QZ5A 1X1PA 2Q31A 3O4WA 4BRDA 3MXIA 3UKRB 3QEVA 1U2VA 1KFDA 2W40A 4H8KA 4M41A 3SMSA 1UA0A 3QEXA 4ILGB 2QXLA 3SJJA 2LSNA 5MLCQ 2CGLA 5F0XA 1DKGD 4IFEA 2O8BB 5GAGP 3AVGA 2BUPA 3ZSYA 1WAJA 4C8LA 2P9IB 4E7HA 2FBTA 2WC9A 2YI1A 3WEEA 4E7JA 4B8CA 4FPBA 3LP2A 4B9QA 3HOTA 1IJJA 1TYQB 4C8NA 3MAQA 3WQTA 2PY5A 4LSNA 3SMPA 4CHQA 3DWLA 4DS5A 3SUNA 3C7NA 4CJ3A 5TKWA 4OPJA 3CJ1A 1X9JA 4O0IA 4B9MA 4BR5A 3ID8A 1QE1A 3O9QA 3HJFA 5SZTA 3L4QA 1KXPA 1EWQA 1D5AA 2HOEA 4H5WA 4QS9A 1W7AA 1IBLK 3C6UA 1SKWA 3PV8A 1VQ8N 4YORA 3I56N 1BG3A 1VSFA 4B3SK 4DCHA 1S6PA 1WSIA 3HXMA 3RMCA 4OPKA 4BE2A 1XWLA 1BIZA 4CK1A 4RWTA 1XUPO 2YNIA 4CEQA 1HQUA 1YT3A 3QBXA 3RR8A 2VGMA 3BY5A 3LAMA 4F3OA 1JLAA 5KTQA 4AF1A 1DT9A 5LJWA 1UWBA 4H0VB 4CJEA 3AVLA 3A5LC 3CCSN 3NGYA 2HF3A 3FFIA 1OVYA 5EVZA 5C2DA 4HCCA 3AAPA 4I2PA 1K73O 2HVHA 3CCMN 4E0DA 3WNHA 4ILJA 3BEXA 3MXMA 1YAGA 2P5GA 1Y64A 2E88A 4PA1A 1X3MA 4CIEA 4GV3A 3DLBA 3GE1A 5FLXO 5BPNA 3HM9A 2XHBA 1BU6O 2P9PB 4BRIA 2YNFA 1O1WA 4RW8A 3SCXA 5C12A 3ISNC 3I55N 3OS1A 3HOSA 3O1WA 3VTIA 1NK0A 3ASMA 4ISEA 4WQ4C 2FXUA 1LCUA 2OA8A 3Q7CA 5FRNA 4F9OA 1K8KB 3VOVA 3OYEA 1N5YA 4I6MB 3V1QA 2P9LA 4CI6A 2Y1IA 5EY4A 1SUQA 1VSJA 4DS4A 2HF4A 3ZETB 5J2PA 3THVA 4M3WA 1VQLN 1Q18A 4FYDA 4QCLA 4CHOA 2HHUA 4CFCA 3AVFA 1MU2A 3SUQA 4A62A 3L3UA 1RBVA 4B9NA 1NMDA 3WNGA 4O55A 1QS4A 3H1VX 3T69A 1TKZA 4CESA 4BE0A 1FW6A 3BDPA 5IT9O 3GG4A 1HPZA 3TSUA 2QWPA 2W6KA 3FZHA 3CJCA 2O4IA 3U3YA 2GWJA 2HHWA 2OPSA 4DLGA 2NRHA 4XIUA 3I33A 4FLZA 4TSXA 5AQKA 3QETA 3ITHA 4DFPA 4LC9B 4KHPK 4OPAA 4DU4A 5CZ2A 2P1JA 2Q0RA 4DV3K 1VSMA 3CG7A 2IIRA 3M8PA 1CZBA 1ZBLA 4IFYA 3CJ9A 3R3LA 1Z26A 4BWJA 3V1RA 4A61A 4WQ4A 3PY8A 4G9ZA 3G25A 5AFUA 1NGCA 3DLRA 5AQXA 3VEZA 4FJLA 2RN2A 4FO0A 5BRFA 4ZHRA 1M1KO 3VQPA 4FWMA 3IAYA 4BDYA 3EYZA 3OVNA 3SBTA 4YDUC 4NCGA 1X9MA 3PO5A 4K8ZA 5E41A 4EHTA 3LZJA 5DM7L 3SNNA 3D2FA 4AHRA 2QW9A 3U3GA 3VQ9A 1IG9A 4V19S 1J54A 1HR0K 4KB1A 1Q8IA 3ZSRA 4IKFA 2Z1GA 1VQON 3ZYYX 4KAZA 4JKGB 3QNNA 2QWNA 2WTUA 2IVOA 3NF7A 2BDPA 5DM6L 1K9MO 4PY5A 3LL3A 1EETA 3NF8A 4CERA 1HKCA 3AVJA 2P9UA 4DQSA 2YCHA 2VG7A 3M8RA 1CLQA 3R8EA 3QO9A 4FWOA 4WF9L 4GKKK 5J2MA 4PL8A 5M1FA 1LV5A 4DKWA 3T3FA 3JS6A 2YJFA 1GLEG 4DTSA 3S41A 1NKCA 3OJUA 4GVMA 4JKEA 1LW2A 4CVNE 4RG8A 3P38A 4BR0A 1RTIA 2QEXN 3SQ1A 1DLOA 3EE9A 1MWKA 3IDHA 5DK5A 4BRNA 1J5OA 1RNHA 2IGIA 3ULDA 4B3RK 1W2BM 4FJJA 1ATRA 3VF6A 2BH1A 4A5AA 1N8RO 2QKBA 4FJNA 1C0MA 5CHIA 1C1CA 4BRLA 1RTHA 1JCGA 4CD1A 3MEDA 3M8SA 3QBWA 4O44A 3DRPA 2Q2RA 3RR7A 3AA3A 3WT0A 4JRQA 4RW7A 1N6QA 4E3SA 4DSJA 4JHDB 3A0IX 3LP1A 4BRQA 4CGGA 3CC4N 3A8YA 1RBTA 5CE3A 4JK9A 4X64K 4CE9A 1U2VB 4LF9K 1NK8A 1LWCA 2B4JA 3I0SA 3IRXA 3CQXA 3H6EA 3HPGA 4DV5K 4FK0A 3FZFA 4ELVA 3NMUA 4WQ5A 4NLCA 4CZMA 1LW0A 2P9KA 1E4FT 3G4SN 2YHBA 5KGWA 3GL1A 3VGLA 4JI3K 2NRZA 2FF6A 3AVKA 4DV2K 4B8AB 2HVIA 3AVNA 1VSLA 2Z1HA 3WEEB 2O4GA 4A57A 5AQOA 4ID1A 2P5OA 3V9UA 4CBXA 3VGKA 4Z4FA 4FWNA 2IS3A 1JLBA 1NM1A 5CYQA 4BG8A 4CGJA 3EEQA 2GUPA 3DLHA 5AQVA 3ULEB 4A2AA 1QZ6A 1KLNA 4U67L 3CC7N 4NXMK 2VWKA 5BN9A 4DMNA 4CJ7A 1YJWN 2E2QA 1T03A 4AHVA 4C8KA 3AGKA 1GOCA 3LM2A 3O08A 4X62K 5AFUH 1JLQA 1NOZA 3RVCA 2RKIA 5KI6A 1BCOA 4ILHA 4E1JA 2P9PA 4RW6A 4KTQA 2W41A 3DRSA 4R5PA 2HHVA 4DV0K 3KD1E 3ZT4A 4DWIA 3GBTA 2VWJA 4X66K 1WSEA 1EP4A 1IBMK 3DJCA 3Q7BA 3IKMA 2CGKA 3GDQA 1JLEA 2HHSA 1SKRA 2YJEA 1T6CA 3AY9A 3CM5A 4I6MA 2F9WA 2FSJA 1O13A 2NLXA 4CGFA 3NCIA 2UUCK 2ITMA 4DLEA 1KVAA 4BRFA 2J4RA 1XHZA 4DQ8A 3SZ2A 4CHYA 2B6AA 4O4GA 3QFUA 1DGKN 2Q3SA 4W5OA 4FXDA 3THWA 4FZXC 3OYJA 5AQFA 3DLKA 4AHCA 3AO2A 4B08A 3K9KA 5K14A 4CEEA 1IKWA 1RDBA 5HRSA 3CMAN 1SZ2A 2QXFA 2WFBA 3VF4A 4AHTA 1KSPA 4FVUA 3TTFA 4B3MK 4AHSA 3ZSXA 5E84A 3G10A 3U8XA 1YJNN 4PWDA 3KWGA 4H4OA 3CCRN 4M45A 3C6TA 3MXJA 3SUPA 4FJIA 3QMLA 2Q1NA 4K42A 4JI0K 4DF4A 1NKBA 4WFNL 1S6QA 2QWMA 3R6MA 1YF5L 1Q81O 5DMRA 5C42A 1NGEA 1V4SA 3B8AX 4PHTX 2PYJA 3HTVA 3ZCMA 5JICA 5AQQA 4RW4A 1ZBFA 2G8KA 2E1ZA 5AZIA 1EWRA 3H45C 2OTLN 2F8TA 4CBUA 5LMUK 1SL2A 3HM8A 3L4IA 3MN6A 4W5QA 4YOVA 3AO5A 4WE1A 1RBSA 1QTMA 3H1QA 3UKUA 2HW3A 3ALYA 2P9LB 2ZGYA 3DLGA 4OPHA 1NBWA 4QAGA 3P1GA 1QQNA 1WN7A 1RTJA 3CFOA 4YOXA 3VQ5A 3F5TA 1IKVA 4NO7A 1WNSA 1WSHA 1JXEA 2UUBK 1TKXA 3CQ8A 1X9SA 5KQDA 3BUZB 4FM2A 2A40A 3VETA 5FPMA 3CCUN 4JKGA 4DUZK 3FFKB 3G0ZA 4LFCK 3VEWA 2F8SA 1MA9B 4O5FA 3VA3A 3P39A 2KFNA 4E1MA 4IG0A 1G99A 2KFZA 1U47A 3IS9A 3A5NC 1KLMA 1K6YA 1TUYA 3VPZA 3SI6A 3K5LA 4LF5K 1WOQA 1N34K 2EWSA 1YJ9N 2G8VA 1OH5A 3ZSOA 2JWLA 4CK3A 3E9PA 2ZD1A 5IWAK 3J7AP 3CJAA 2ITGA 4C23A 3VQQA 1Q86O 3W3DA 2BE2A 2ATQA 5AQYA 1KQSM 1VQ7N 2VG5A 4B1ZA 4KHWA 2GTDA 4JEPA 3CJ7A 3R1XA 3HL8A 4FWRA 3O9SA 1IV0A 3F73A 5HBMA 4BVOA 3CI5A 3PSIA 4F8RA 4FWLA 3GOIA 3MMVA 3CFRA 3CETA 3D2FB 1SL0A 1EO1A 3ZT2A 2O8CA 4H0YB 3V9XA 1RGIA 1CZ9A 1RT3A 5BRHA 1QHTA 1IG8A 3AA4A 1N32K 4J2DA 4JHDA 4KHUA 4E7KA 3U6FA 1TL3A 4CZHA 1KAZA 4IBNA 1RT1A 5KPRA 2BANA 4FJKA 3FGUA 3O3HA 3KJVA 2UYTA 4BRGA 3EY1A 1NJZA 2EX3A 1FKPA 4AQYK 2P9UB 2ZJPL 4Z0UA 4CEZA 4FWPA 2E2NA 1VSKA 2FBVA 1RFQA 1BI4B 3WQUA 3I0RA 3B6PA 1WB9A 1BA1A 3HVRA 3S9HA 2HHQA 4ICLA 3MX2A 2GBZA 5ELZA 4JKAA 3M1FA 4CFDA 2OTJN 3MCPA 4M3UA 4CZJA 4J2AA 1RDUA 2ZM6K 3K5OA 3D0PA 4JD2A 4Q0BA 3T7ZA 4DSFA 3ULEA 4FW2A 4BC2A 3LDPA 1KFSA 4ISGA 4AM7A 4H0XB 1WBDA 2GV9A 4W5NA 4DFKA 2E2OA 1VHXA 1YI2N 1ZBHA 3VQCA 1NWKA 2OANA 3PX4A 4FWQA 3TANA 1OH6A 4DSKA 2FC0A 3LDNA 4Y1DA 4IOAL 2E6LA 4IO8A 1JXBA 3FZLA 5GINA 3BF3A 5FROA 4H5RA 1XMOK 3C0BA 3TSPA 1XC3A 1KAYA 3VQBA 5EU7A 2P9KB 5AQZA 1W0HA 4BGAA 2G8HA 4KTWA 4DTXA 1CXUA 1FXXA 3K5MA 4W5RA 3OYFA 1HNXK 4C8OA 3PX0A 2ASMA 4CBWA 2DFEA 4Y0WA 3DXMA 1YVUA 2HMIA 2HHHK 1B9FA 2DFFA 4C1NK 1KAXA 4YY3K 1TK8A 2OPPA 4YFUA 1U48A 2E20A 1S9GA 4IJNA 1EXQA 4CJFA 4KREA 2P9SB 4J2BA 1IKXA 5AQLA 3HVTA 4EFHA 3DOKA 2A42A 1LAWA 3T19A 4BREA 2PYLA 2YHAA 4K41A 4OLBA 3VQAA 4B1WB 3V81A 2A6AA 5M1PA 4B3TK 4EIAA 3KK1A 4DV1K 4BC4A 1X9WA 1WSJA 5A2QO 4Z4IA 2A41A 1VQPN 1KC8O 1QVGM 1QHAA 1YVNA 1RDWX 5GIPA 1GLJO 4CGIA 3LALA 3RMDA 1S9EA 2VYPA 5JS1A 1GLLO 1LWFA 5KPTA 4MFBA 2ETJA 1UAXA 5AJ3K 2OPRA 3VTHA 4EAHD 3NDKA 3K58A 1R0AA 4FJHA 1D9FA 1REVA 3THWB 2WOMA 3UE5A 1HNVA 1NOYA 3ENOA 3ZSQA 1QVFM 4Z4EA 3PX6A 3MX5A 3CHWA 3C6AA 3G71N 4BDZA 4PUOA 3I8BA 2NZTA 1SAZA 2AA4A 1UOCA 3HPOA 4YOUA 5BR8K 2O8EB 2RF2A 4CJWA 2W42A 1T3VA 1C0UA 3CCLN 2XY5A 4AM6A 3WXMB 5LY3A 4EZ9A 4DR3K 2ZE2A 1GLCG 3S3MA 2XY8A 1BHLA 3IMXA 3T1AA 2FF3B 4HUGA 4RCHA 4FJ5A 1OKJA 3EKUA 3HT3A 2HMPA 4QOZB 5BN8A 1GLFO 2PAVA 5AZIB 1KRPA 4IWVA 4PQUA 3VERA 3AVMA 4KBOA 4DTPA 3L2UA 2A3ZA 4DTRA 2G8WA 1ZBIA 4JI4K 3KLFA 3L2RA 2CH6A 1VQMN 4IJAA 3UKUB 4DTOA 3HSCA 3BP8A 4YOTA 4YHHK 4HUEA 2O8FA 1NLVA 1HJOA 2NRTA 4E7IA 5E26A 1BIUA 2ZF5O 3JXUA 2G8UA 3LP3A 4PKHA 3OYIA 3SV4A 3WXJA 4E89A 3LDOA 4JKDA 1L3UA 1C0FA 4UY8O 1L5UA 4FPAA 1K8AO 1QQCA 1SL1A 2IC3A 1S1WA 1QSYA 4JK7A 4BDPA 5AQJA 4CJKA 5C0YA 4GMJB 3M3ZA 4DQQA 3A5OC 3NFAA 4O5BA 3CJBA 3OYGA 3JAMO 2KLAA 3H46O 2ASOA 1ATSA 5FDLA 4LSLA 4DUYK 2HBJA 3KKRA 3VMFB 4E19A 4LH4A 3PUFA 3KTQA 1S1VA 1BI4A 1CXQA 4FCYA 1VSHA 4WQ5C 3DAWA 2D0BA 2QA4N 2D0PA 4CJRA 5M1KA 4WFAL 1M90O 4KH5A 3NGZA 2Q36A 4FLXA 2F96A 1S1XA 2QI2A 3F9KA 2WONA 4GKJK 4LD0A 3FZMA 1EKEA 4C1NI 3QLHA 4F3TA 1VK0A 5JLHA 3W0LA 5AQGA 2HBLA 4OLAA 3TAGA 3CERA 4HWIA 2WUSA 4KI6A 4BR2A 2UXCK 3E66A 4NCBA 3L8BA 3ZEUB 2O8CB 4M7XA 3KK2A 1DTTA 1NK7A 3DMJA 2DY4A 5AQPA 5TKYA 1EX4A 4B1UB 1J53A 3QFPA 4HTUA 5AQUA 3SV3A 1QQOA 2D5RA 5B8HA 1KVCA 4FJGA 1GLAG 1YTAA 2IAJA 2GWKA 4AILC 3N4PA 4DB3A 4L3QA 1VAZA 3L2QA 4CEAA 1HKBA 3K5NA 4IOCL 1U6ZA 1ASVA 1KVBA 2QWRA 3DLEA 3TSQA 3FR0A 5HRRA 4M3ZA 5AQMA 3D6RA 3EZ5A 1SS6A 1C6VA 4JLHA 4CGDA 2VGNA 4FM0A 2OCEA 3OHRA 3THXA 1NJXA 4FLWA 3KK3A 2XY6A 4DU1A 1ZC6A 1WSGA 4Q5VA 3WUHA 5C24A 4K0KK 3HYFA 4GW6A 3L2VA 4KKOA 3HP9A 5C10A 4JRPA 5CZ1A 1S3XA 5EXWA 2IVNA 5M1OA 2D1KA 4BE1A 4OGCA 2X6SA 2KW4A 4JD2B 1TK0A 3AVCA 1QSLA 3QNOA 2OPQA 4BR4A 4DF8A 2OZSA 3HO1A 1A5VA 2P9SA 4EZ6A 4I9QA 4DTNA 2OZMA 1IO2A 1QSSA 2HNYA 3KLEA 1BUPA 3TAQA 4OGEA 3J7ZO 4JI2K 1GOBA 4NCAA 4CK2A 3E01A 4KHYA 2IVPA 2YNHA 3CPEA 4A59A 4PKIA 4LF4K 2NNWA 4HUFA 3U4LA 1H1VA 3NE6A 2KZMA 3M5RA 4KH6A 4NYNA 2QKKA 2FSKA 3KK7A 2A1RA 5AQIA 5AQSA 3I8DA 5J2QA 5C2FA 1RDDA 4E7LA 4DV6K 2GUIA 5KGXA 1OH7A 3AAQA 3SJHA 4NXNK 4FZZA 5CYMA 3O9RA 1S22A 4PL7A 5T7BA 1XNQK 3DXMB 4JI7K 3HBTA 3KZBA 2AJQA 4KRFA 3DI6A 3QIOA 1T8EA 2ZJQL 3J81O 3V4IA 1JCFA 1GLDG 3VGMA 2W6LA 2O8EA 2HSTA 1R59O 3OYMA 4CJPA 4Z4HA 1HNIA 3OTOK 1ZBUA 2HHXA 1GOAA 4DSLA 3F9MA 2X78A 3O1BA 1NJIO 1J9AA 2E4LA 3BGRA 4KHNA 5CR4A 4YNQA 3LP0A 3BF1A 3K57A 5LJVA 3VN5A 3FLCO 4HVJA 3KD5E 3V1OA 4J8FA 2GX9A 4NLBA 3THYA 3H3NO 3VEYA 4L8RB 4CHNA 1BCMA 4CF0A 3P4IA 3M6GA 3TTCA 4JS4A 4JV5K 2I7PA 1YIJN 5H1SQ 3ZT0A 3CIPA 3CCQN 3ZLJA 4M3YA 3CCJN 1GLBG 2QWQA 3ZX3A 5AQTA 4BG9A 3NH0A 3O4NA 3TAMA 1RILA 4NB4A 1HYSA 1XC9A 2ASPA 3MN5A 4CJ5A 1TL1A 4OKEA 5FPDA 4KB0A 3WNFA 1HX1A 3MN7A 3O5BA 3MEEA 3TAPA 1ITGA 3MCAB 4IEEA 1X3NA 5C25A 1SV5A 3OJSA 3TI0A 4OVLA 3HK2A 3RMBA 4CIFA 4FOIA 4FL9A 2WBNA 3JYTA 2UUAK 4CJUA 1RT7A 3IG1A 4H0OA 4BC5A 1BOTO 1E3MA 1TK5A 4B9VA 3VESA 2RE2A 1CZAN 1ESVA 3AO3A 1VSEA 2PFUA 4ZTJA 2E6MA 2O8FB 4KHSA 3O6WA 4FM1A 1Q9YA 3UIQA 1C0GA 4DR5K 3O8MA 4OJRA 4FK2A 1D9DA 3RRGA 1WLJA 4KTZA 5AZJB 1I94K 4CHPA 3CC2N 3LPUA 3SBGA 1RT5A 3KLHA 4DHYA 3O4QA 3J80O 5D3GA 1TUUA 3OYHA 4CJLA 2HNDA 3TU5A 3ZEUA 1TKTA 4OO1J 1OVQA 1FJGK 1MWMA 4YOYA 3N4QA 5AQHA 1KD1O 1NJWA 3NHGA 3OA9A 1NKEA 1T05A 4CJQA 4FWKA 1NK9A 3MK6A 1BGXT 5BPLA 3VQEA 3OYAA 4DTMA 1NGIA 4FWSA 1YUWA 3MDQA 2QTDA 3RSEA 5F1XA 1T6DA 1TAUA 1XQSC 1RCHA 4C8MA 4CF8A 1HUXA 3NAEA 1VRUA 3SPYA 4A2BA 1QQMA 3S3OA 3VQ7A 4KFBA 3OYDA 2RPIA 4IOXA 3SQ0A 1HNZK 4IDHA 3TTDA 3OYBA 5ADXA 3O9UA 4BROA 4KHQA 4FJ8A 1WAFA 1Z6RA 3PIPL 2G8IA 4DTJA 3P83D 3OS2A 1L3VA 1OH8A 3TPQA 3VEXA 1N33K 3AVBA 1VQKN 4R79A 4CF2A 3U9DA 3ID6A 5AR0A 4CZKA 1WBBA 2D0OA 3NH1A 1IH7A 4CIGA 1Q82O 1YHQN 4FJMA 4KI4A 4M7YA 4KV8A 4KPYA 1S5JA 3CD6N 4BRAA 4LF8K 3EE8A 1S72N 4FLVA 1NU0A 1E4GT 5C15A 1B92A 4PKGA 2NUBA 3U9ZA 1HMVA 1ZXOA 2PBDA 4Y1CA 2IOCA 2NRVA 5CY4A 3AV9A 4BC3A 1U45A 4BR9A 3ZSVA 2VQFK 4HHTA 1WUAA 1VQ5N 4IFVA 3NH2A 4AHUA 2IDOA 1NK6A 3ZT3A 3LDQA 4CEOA 1JLGA 1NGBA 2X74A 4XEIA 3THXB 3AVIA 2E5LK 2ZGZA 4LF7K 4B9LA 2KTQA 2GELA 2ZQBA 1IKYA 2BGGA 5HL7L 3WXKA 3OS0A 4M3XA 4WYBA 1VSIA 4MO4A 2CH5A 4JK8A 3EL2A 1JCEA 2AP1A 1RT6A 5GIOA 4W5TA 3KLGA 1TAQA 3OW2M 1Q9XA 2Y1JA 1EQYA 2YKNA 3QEWA 5HP1A 3OYNA 4A5BA 3ZX2A 4H5NA 4DSEA 2DPNA 1BWFO 3QDKA 3L3VA 2H3GX 4M3RA 3E9OA 4BGBA 3LZIA 1S1TA 2P51A 1ZYQA 3V9ZA 3V6DA 1YITN 2OYQA 1HNWK 2O8DA 3DRRA 2V7ZA
chains in the Genus database with same CATH topology
4DR6K 4JI5K 4GKJK 5BR8K 1N33K 4DV7K 4X64K 4DV6K 1XMOK 4LF9K 4B3MK 2UXCK 4DR3K 4NXNK 4DV4K 4LF8K 2UUAK 1J5EK 1XMQK 1XNQK 4DV5K 4JI8K 1HNXK 4JI0K 4JI7K 5FLXO 2UXBK 4X65K 4LF6K 4LFBK 2HHHK 4JI3K 2F4VK 4DV2K 3J81O 4JI6K 4V19S 4YY3K 4DR5K 1HR0K 1N32K 5LL6Z 4JI4K 2VQFK 3T1YK 5LMUK 4YHHK 1I94K 2UXDK 3OTOK 4JI1K 3J80O 2UU9K 4AQYK 4OX9K 3J7YP 2E5LK 4JYAK 4NXMK 4LF7K 4DR2K 1FJGK 4DR4K 5LMNK 4X62K 4B3TK 1IBKK 4DV1K 4K0KK 5A2QO 3T1HK 4GKKK 2UUBK 2VQEK 4DV0K 4LFAK 5IT9O 1IBLK 4DUZK 4X66K 4JV5K 2ZM6K 4LFCK 1IBMK 4CVNE 4CW7B 3JAMO 4B3SK 4DUYK 4DR1K 4B3RK 2UUCK 4DR7K 4LF5K 1N34K 5AJ3K 4JI2K 4KHPK 1N36K 1HNWK 1XNRK 4DV3K 5IWAK 4LF4K 3J7AP 1HNZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR6 K;  4JI5 K;  4GKJ K;  5BR8 K;  1N33 K;  4DV7 K;  4X64 K;  4DV6 K;  1XMO K;  4LF9 K;  4B3M K;  2UXC K;  4DR3 K;  4NXN K;  4DV4 K;  4LF8 K;  2UUA K;  1J5E K;  1XMQ K;  1XNQ K;  4DV5 K;  4JI8 K;  1HNX K;  4JI0 K;  4JI7 K;  5FLX O;  2UXB K;  4X65 K;  4LF6 K;  4LFB K;  2HHH K;  4JI3 K;  2F4V K;  4DV2 K;  3J81 O;  4JI6 K;  4V19 S;  4YY3 K;  4DR5 K;  1HR0 K;  1N32 K;  5LL6 Z;  4JI4 K;  2VQF K;  3T1Y K;  5LMU K;  4YHH K;  1I94 K;  2UXD K;  3OTO K;  4JI1 K;  3J80 O;  2UU9 K;  4AQY K;  4OX9 K;  3J7Y P;  2E5L K;  4JYA K;  4NXM K;  4LF7 K;  4DR2 K;  1FJG K;  4DR4 K;  5LMN K;  4X62 K;  4B3T K;  1IBK K;  4DV1 K;  4K0K K;  5A2Q O;  3T1H K;  4GKK K;  2UUB K;  2VQE K;  4DV0 K;  4LFA K;  5IT9 O;  1IBL K;  4DUZ K;  4X66 K;  4JV5 K;  2ZM6 K;  4LFC K;  1IBM K;  4CVN E;  4CW7 B;  3JAM O;  4B3S K;  4DUY K;  4DR1 K;  4B3R K;  2UUC K;  4DR7 K;  4LF5 K;  1N34 K;  5AJ3 K;  4JI2 K;  4KHP K;  1N36 K;  1HNW K;  1XNR K;  4DV3 K;  5IWA K;  4LF4 K;  3J7A P;  1HNZ K; 
#chains in the Genus database with same CATH topology
 3SAG A;  4BAC A;  4DR6 K;  4CFB A;  2HBK A;  3LPT A;  3HPH A;  3FZK A;  4B3O A;  3L0Q A;  1DTQ A;  2QWL A;  1UA1 A;  1Q7Y O;  2HHT A;  4M63 C;  4FLT A;  1TGO A;  5BPM A;  2DFH A;  5BRD A;  4IDK A;  5M1N A;  1BL3 A;  1J6Z A;  4CZE A;  4F4K A;  4JS5 A;  4XH4 A;  3AA5 X;  1P8Z A;  5F2R A;  4I7F A;  4B1V A;  4B9T A;  4FLU A;  3WNE A;  4F2S A;  2G8F A;  3VEN A;  3QB0 A;  3EN9 A;  5GAE P;  2F4V K;  1JKH A;  3OBY A;  4E1N A;  2ZWH A;  5FPE A;  3NVM A;  2YV0 X;  3PO4 A;  3D2E A;  4IXC A;  4K25 A;  3T1Y K;  1RT2 A;  5GAD P;  3C95 A;  4GVE A;  3AA2 A;  3LAN A;  4CD3 A;  3ZX0 A;  4FW1 A;  3O3G A;  3QIC A;  2VG6 A;  3CFP A;  1XHX A;  3J7Y P;  4GV9 A;  4JYA K;  2V7Y A;  4IO9 L;  1NNE A;  4FJX A;  1U04 A;  1RBU A;  3AO1 A;  5ADX H;  3DM2 A;  1VQN N;  3VEV A;  3ZSZ A;  4DR4 K;  5AQR A;  3NF6 A;  4BRM A;  1TKD A;  3THY B;  2NRX A;  3T1H K;  3RTV A;  3UB5 A;  3SK3 A;  3C6H A;  5I9E B;  4DU3 A;  3DXK B;  5J1E A;  4LFA K;  4YOW A;  3SUO A;  5AZJ A;  1L3S A;  4DSI A;  3SPZ A;  2V52 B;  1C0T A;  2PZS A;  1NGF A;  5KRT A;  2HBM A;  1G15 A;  4AH9 A;  5KPZ A;  1BDG A;  1U49 A;  2YNG A;  1XNR K;  1RDC A;  3JSM A;  2QK9 A;  2DTU A;  5FPN A;  2P9N A;  2YHX A;  4GY2 B;  3RRH A;  4OKK A;  1B9D A;  5GAH P;  4FOE A;  3QES A;  1NJY A;  2ZJR L;  3CQY A;  3KIO A;  4JAX A;  2HB5 A;  3EZW A;  3H08 A;  3VQ8 A;  2R7Y A;  2Q0U A;  1FKO A;  3LWM A;  1BQN A;  1LWE A;  1JL1 A;  3QIP A;  4FSV A;  3AAR A;  3PLA A;  4B1X B;  1J5E K;  4JKB A;  4BR7 A;  4JI8 K;  4CF9 A;  3A2F A;  2NRR A;  4BVP A;  3UKR A;  5SWM A;  4FJ7 A;  4CZF A;  3C65 A;  4N56 A;  1NG9 A;  1DEJ A;  2A1S A;  3LDL A;  4JKF A;  2D0A A;  5JVH L;  2O8B A;  4O8U A;  3SAF A;  4EHU A;  1VQ9 N;  2I7N A;  5I3U A;  3OYC A;  2P9I A;  4YDU A;  1A5W A;  2HNZ A;  3TAE A;  3ATU A;  1C1A A;  1TVR A;  3WXI A;  3SQ4 A;  3VEO A;  4ELT A;  5JMV A;  3TWH A;  4CCH A;  4N76 A;  1TYQ A;  3HP6 A;  3O9T A;  3DOL A;  1P90 A;  3NGI A;  5LMN K;  2Q97 A;  1A5X A;  1WSF A;  1IBK K;  4MLE A;  1U4B A;  3L6Q A;  2X6N A;  2V51 B;  4O0J A;  3OY9 A;  4RW9 A;  3RSE B;  3OBW A;  4O8K A;  4KO0 A;  4Z4G A;  4EP4 A;  1ASU A;  2F7T A;  4MLH A;  4IZ9 A;  3MN9 A;  3SLC A;  4BWM A;  5J2N A;  4I9L A;  4GV6 A;  2I5J A;  2B5J A;  3CME N;  4IG3 A;  3E1Y A;  4DFM A;  4LY7 A;  4DR7 K;  3OYL A;  2YKM A;  4N5S A;  4DTU A;  3PSF A;  4BRP A;  1C1B A;  5KQ8 A;  3V9S A;  3D45 A;  3R9P A;  4ISF A;  3RWU A;  4BQZ A;  3K59 A;  2XY7 A;  3KKS A;  2CGJ A;  1HRH A;  1NGD A;  4HTL A;  3LWL A;  5HLF A;  4CFA A;  5BRE A;  4CJV A;  1ATN A;  4CED A;  4ELU A;  3BZC A;  4DV7 K;  1RBR A;  1XI1 A;  5JLF A;  2F9T A;  4MQ3 A;  2KZZ A;  3NBP A;  1HYV A;  3C94 A;  3SYZ A;  2KQ2 A;  2A5X A;  4U7B A;  1XMQ K;  3C7N B;  3QIN A;  5AQW A;  3SQ2 A;  1FK9 A;  3VA0 A;  4X65 K;  3AO4 A;  4LF6 K;  1JL2 A;  4LFB K;  1Z25 A;  2KHO A;  2FBX A;  4H03 B;  4JI6 K;  2E1Y A;  2KKZ A;  3QEI A;  4H5T A;  1VQ4 N;  1W97 L;  4Z94 A;  3D7E O;  5HRO A;  3LDS A;  1JLF A;  3OYK A;  2UXD K;  4CZI A;  3NVK A;  4F2R A;  3VQD A;  4CGH A;  4FJ9 A;  1F21 A;  4BRK A;  4BQL A;  4M42 A;  3CCE N;  3TAR A;  4DQP A;  1SKS A;  1HJR A;  4XH1 A;  4UQG A;  3NF9 A;  4DR2 K;  3TAF A;  2D4W A;  2GEM A;  4B9S A;  1K8K A;  1L3T A;  4CEC A;  2XRI A;  4BY9 C;  1RTD A;  3KLI A;  3ZET A;  3HRG A;  4JNE A;  1ILY A;  2FSN A;  3TR8 A;  2VQE K;  3EKS A;  4MDB A;  5KRS A;  4B9U A;  1S1U A;  4M3T A;  4IEI A;  4XH5 A;  4CF1 A;  4CZL A;  3ENH A;  1T44 A;  4WCE L;  4I2Q A;  3CCV N;  3O80 A;  5EOY A;  5BR9 A;  3QEP A;  4ZTF A;  5AQN A;  3AVH A;  4DR1 K;  1ZBS A;  1TV6 A;  4QS8 A;  5EX5 A;  4J2E A;  2BTF A;  3P5J A;  4H5V A;  3PIO L;  4BRC A;  2O8D B;  4FK4 A;  1YTU A;  3F2K A;  3QER A;  1N36 K;  2NRW A;  4DQI A;  3V9W A;  3B6O A;  4NYF A;  3FE1 A;  4MDA A;  2Z1J A;  4JKC A;  2JGU A;  1VQ6 N;  3L2W A;  2YX6 A;  4QS7 A;  3ZSW A;  3DXK A;  4WFB L;  4H0P A;  2Z1I A;  3WXL A;  4DG1 A;  4GNI A;  4MO5 A;  5HRN A;  4FZY A;  4CJT A;  3HST B;  4H0T B;  2JLE A;  1HKG A;  4H4M A;  3A5M C;  2YHW A;  3LM9 A;  3IFR A;  4DV4 K;  4CZG A;  3VQ4 A;  3M8Q A;  3LAK A;  4JKH A;  2XO7 A;  2EHG A;  1YXQ A;  1HLU A;  4B1Y B;  4ID5 A;  1Z05 A;  1JLC A;  1LOT B;  2UXB K;  3DLL L;  3MEC A;  3VF2 A;  2D0C A;  3D2E B;  3MWT A;  2FBY A;  4K43 A;  3CM6 A;  3K0S A;  5LL6 Z;  1SQK A;  3KHY A;  5FRM A;  4CJS A;  1I3A A;  1MDU B;  1BIS A;  3E9L A;  3KWI A;  1W9H A;  4N41 A;  4JI1 K;  4K8X A;  3O3F A;  1D4X A;  3ENB A;  3HZ6 A;  2UU9 K;  5JS2 A;  4OX9 K;  1NGG A;  1D8Y A;  3AVA A;  2JWK A;  4G1Q A;  1V4T A;  2FLO A;  2QWO A;  4CHZ A;  3J8A A;  1BA0 A;  4CEF A;  5JVG L;  1Y97 A;  3CXC M;  3S3N A;  1T7P A;  3IUC A;  1HPM A;  1ASW A;  1LAV A;  3MWP A;  2E8A A;  3HI0 A;  1VRT A;  3H3O B;  1I39 A;  3VQ6 A;  1RDA A;  4KH4 A;  2E2P A;  1NMN A;  1HYZ A;  4CW7 B;  4EP5 A;  3ZT1 A;  3K9J A;  4RTF D;  4FVM A;  4BRH A;  2RHK A;  3TAB A;  3RMA A;  3SAH A;  2YHY A;  2QM1 A;  1HQE A;  1NGA A;  1BO5 O;  2P9N B;  4FLY A;  1NGJ A;  1KTQ A;  1RT4 A;  1VSD A;  4LH5 A;  3EO3 A;  4Z4C A;  3ATV A;  3DYA A;  3CYM A;  3MEG A;  1JJ2 M;  1NK5 A;  4HCB A;  4CJ4 A;  4DFJ A;  4OKJ A;  4JI5 K;  5HOO A;  4N47 A;  2VWB A;  4DQR A;  4JN4 A;  3CF5 L;  4CEB A;  3AGR A;  3CPW M;  3P31 A;  1NGH A;  5I42 A;  1NK4 A;  3BZK A;  1KCF A;  3KVG A;  3G6E N;  5HRP A;  3K2P A;  1BQM A;  2VCP A;  5M1Q A;  1QZ5 A;  1X1P A;  2Q31 A;  3O4W A;  4BRD A;  3MXI A;  3UKR B;  3QEV A;  1U2V A;  1KFD A;  2W40 A;  4H8K A;  4M41 A;  3SMS A;  1UA0 A;  3QEX A;  4ILG B;  2QXL A;  3SJJ A;  2LSN A;  5MLC Q;  2CGL A;  5F0X A;  1DKG D;  4IFE A;  2O8B B;  5GAG P;  3AVG A;  2BUP A;  3ZSY A;  1WAJ A;  4C8L A;  2P9I B;  4E7H A;  2FBT A;  2WC9 A;  2YI1 A;  3WEE A;  4E7J A;  4B8C A;  4FPB A;  3LP2 A;  4B9Q A;  3HOT A;  1IJJ A;  1TYQ B;  4C8N A;  3MAQ A;  3WQT A;  2PY5 A;  4LSN A;  3SMP A;  4CHQ A;  3DWL A;  4DS5 A;  3SUN A;  3C7N A;  4CJ3 A;  5TKW A;  4OPJ A;  3CJ1 A;  1X9J A;  4O0I A;  4B9M A;  4BR5 A;  3ID8 A;  1QE1 A;  3O9Q A;  3HJF A;  5SZT A;  3L4Q A;  1KXP A;  1EWQ A;  1D5A A;  2HOE A;  4H5W A;  4QS9 A;  1W7A A;  1IBL K;  3C6U A;  1SKW A;  3PV8 A;  1VQ8 N;  4YOR A;  3I56 N;  1BG3 A;  1VSF A;  4B3S K;  4DCH A;  1S6P A;  1WSI A;  3HXM A;  3RMC A;  4OPK A;  4BE2 A;  1XWL A;  1BIZ A;  4CK1 A;  4RWT A;  1XUP O;  2YNI A;  4CEQ A;  1HQU A;  1YT3 A;  3QBX A;  3RR8 A;  2VGM A;  3BY5 A;  3LAM A;  4F3O A;  1JLA A;  5KTQ A;  4AF1 A;  1DT9 A;  5LJW A;  1UWB A;  4H0V B;  4CJE A;  3AVL A;  3A5L C;  3CCS N;  3NGY A;  2HF3 A;  3FFI A;  1OVY A;  5EVZ A;  5C2D A;  4HCC A;  3AAP A;  4I2P A;  1K73 O;  2HVH A;  3CCM N;  4E0D A;  3WNH A;  4ILJ A;  3BEX A;  3MXM A;  1YAG A;  2P5G A;  1Y64 A;  2E88 A;  4PA1 A;  1X3M A;  4CIE A;  4GV3 A;  3DLB A;  3GE1 A;  5FLX O;  5BPN A;  3HM9 A;  2XHB A;  1BU6 O;  2P9P B;  4BRI A;  2YNF A;  1O1W A;  4RW8 A;  3SCX A;  5C12 A;  3ISN C;  3I55 N;  3OS1 A;  3HOS A;  3O1W A;  3VTI A;  1NK0 A;  3ASM A;  4ISE A;  4WQ4 C;  2FXU A;  1LCU A;  2OA8 A;  3Q7C A;  5FRN A;  4F9O A;  1K8K B;  3VOV A;  3OYE A;  1N5Y A;  4I6M B;  3V1Q A;  2P9L A;  4CI6 A;  2Y1I A;  5EY4 A;  1SUQ A;  1VSJ A;  4DS4 A;  2HF4 A;  3ZET B;  5J2P A;  3THV A;  4M3W A;  1VQL N;  1Q18 A;  4FYD A;  4QCL A;  4CHO A;  2HHU A;  4CFC A;  3AVF A;  1MU2 A;  3SUQ A;  4A62 A;  3L3U A;  1RBV A;  4B9N A;  1NMD A;  3WNG A;  4O55 A;  1QS4 A;  3H1V X;  3T69 A;  1TKZ A;  4CES A;  4BE0 A;  1FW6 A;  3BDP A;  5IT9 O;  3GG4 A;  1HPZ A;  3TSU A;  2QWP A;  2W6K A;  3FZH A;  3CJC A;  2O4I A;  3U3Y A;  2GWJ A;  2HHW A;  2OPS A;  4DLG A;  2NRH A;  4XIU A;  3I33 A;  4FLZ A;  4TSX A;  5AQK A;  3QET A;  3ITH A;  4DFP A;  4LC9 B;  4KHP K;  4OPA A;  4DU4 A;  5CZ2 A;  2P1J A;  2Q0R A;  4DV3 K;  1VSM A;  3CG7 A;  2IIR A;  3M8P A;  1CZB A;  1ZBL A;  4IFY A;  3CJ9 A;  3R3L A;  1Z26 A;  4BWJ A;  3V1R A;  4A61 A;  4WQ4 A;  3PY8 A;  4G9Z A;  3G25 A;  5AFU A;  1NGC A;  3DLR A;  5AQX A;  3VEZ A;  4FJL A;  2RN2 A;  4FO0 A;  5BRF A;  4ZHR A;  1M1K O;  3VQP A;  4FWM A;  3IAY A;  4BDY A;  3EYZ A;  3OVN A;  3SBT A;  4YDU C;  4NCG A;  1X9M A;  3PO5 A;  4K8Z A;  5E41 A;  4EHT A;  3LZJ A;  5DM7 L;  3SNN A;  3D2F A;  4AHR A;  2QW9 A;  3U3G A;  3VQ9 A;  1IG9 A;  4V19 S;  1J54 A;  1HR0 K;  4KB1 A;  1Q8I A;  3ZSR A;  4IKF A;  2Z1G A;  1VQO N;  3ZYY X;  4KAZ A;  4JKG B;  3QNN A;  2QWN A;  2WTU A;  2IVO A;  3NF7 A;  2BDP A;  5DM6 L;  1K9M O;  4PY5 A;  3LL3 A;  1EET A;  3NF8 A;  4CER A;  1HKC A;  3AVJ A;  2P9U A;  4DQS A;  2YCH A;  2VG7 A;  3M8R A;  1CLQ A;  3R8E A;  3QO9 A;  4FWO A;  4WF9 L;  4GKK K;  5J2M A;  4PL8 A;  5M1F A;  1LV5 A;  4DKW A;  3T3F A;  3JS6 A;  2YJF A;  1GLE G;  4DTS A;  3S41 A;  1NKC A;  3OJU A;  4GVM A;  4JKE A;  1LW2 A;  4CVN E;  4RG8 A;  3P38 A;  4BR0 A;  1RTI A;  2QEX N;  3SQ1 A;  1DLO A;  3EE9 A;  1MWK A;  3IDH A;  5DK5 A;  4BRN A;  1J5O A;  1RNH A;  2IGI A;  3ULD A;  4B3R K;  1W2B M;  4FJJ A;  1ATR A;  3VF6 A;  2BH1 A;  4A5A A;  1N8R O;  2QKB A;  4FJN A;  1C0M A;  5CHI A;  1C1C A;  4BRL A;  1RTH A;  1JCG A;  4CD1 A;  3MED A;  3M8S A;  3QBW A;  4O44 A;  3DRP A;  2Q2R A;  3RR7 A;  3AA3 A;  3WT0 A;  4JRQ A;  4RW7 A;  1N6Q A;  4E3S A;  4DSJ A;  4JHD B;  3A0I X;  3LP1 A;  4BRQ A;  4CGG A;  3CC4 N;  3A8Y A;  1RBT A;  5CE3 A;  4JK9 A;  4X64 K;  4CE9 A;  1U2V B;  4LF9 K;  1NK8 A;  1LWC A;  2B4J A;  3I0S A;  3IRX A;  3CQX A;  3H6E A;  3HPG A;  4DV5 K;  4FK0 A;  3FZF A;  4ELV A;  3NMU A;  4WQ5 A;  4NLC A;  4CZM A;  1LW0 A;  2P9K A;  1E4F T;  3G4S N;  2YHB A;  5KGW A;  3GL1 A;  3VGL A;  4JI3 K;  2NRZ A;  2FF6 A;  3AVK A;  4DV2 K;  4B8A B;  2HVI A;  3AVN A;  1VSL A;  2Z1H A;  3WEE B;  2O4G A;  4A57 A;  5AQO A;  4ID1 A;  2P5O A;  3V9U A;  4CBX A;  3VGK A;  4Z4F A;  4FWN A;  2IS3 A;  1JLB A;  1NM1 A;  5CYQ A;  4BG8 A;  4CGJ A;  3EEQ A;  2GUP A;  3DLH A;  5AQV A;  3ULE B;  4A2A A;  1QZ6 A;  1KLN A;  4U67 L;  3CC7 N;  4NXM K;  2VWK A;  5BN9 A;  4DMN A;  4CJ7 A;  1YJW N;  2E2Q A;  1T03 A;  4AHV A;  4C8K A;  3AGK A;  1GOC A;  3LM2 A;  3O08 A;  4X62 K;  5AFU H;  1JLQ A;  1NOZ A;  3RVC A;  2RKI A;  5KI6 A;  1BCO A;  4ILH A;  4E1J A;  2P9P A;  4RW6 A;  4KTQ A;  2W41 A;  3DRS A;  4R5P A;  2HHV A;  4DV0 K;  3KD1 E;  3ZT4 A;  4DWI A;  3GBT A;  2VWJ A;  4X66 K;  1WSE A;  1EP4 A;  1IBM K;  3DJC A;  3Q7B A;  3IKM A;  2CGK A;  3GDQ A;  1JLE A;  2HHS A;  1SKR A;  2YJE A;  1T6C A;  3AY9 A;  3CM5 A;  4I6M A;  2F9W A;  2FSJ A;  1O13 A;  2NLX A;  4CGF A;  3NCI A;  2UUC K;  2ITM A;  4DLE A;  1KVA A;  4BRF A;  2J4R A;  1XHZ A;  4DQ8 A;  3SZ2 A;  4CHY A;  2B6A A;  4O4G A;  3QFU A;  1DGK N;  2Q3S A;  4W5O A;  4FXD A;  3THW A;  4FZX C;  3OYJ A;  5AQF A;  3DLK A;  4AHC A;  3AO2 A;  4B08 A;  3K9K A;  5K14 A;  4CEE A;  1IKW A;  1RDB A;  5HRS A;  3CMA N;  1SZ2 A;  2QXF A;  2WFB A;  3VF4 A;  4AHT A;  1KSP A;  4FVU A;  3TTF A;  4B3M K;  4AHS A;  3ZSX A;  5E84 A;  3G10 A;  3U8X A;  1YJN N;  4PWD A;  3KWG A;  4H4O A;  3CCR N;  4M45 A;  3C6T A;  3MXJ A;  3SUP A;  4FJI A;  3QML A;  2Q1N A;  4K42 A;  4JI0 K;  4DF4 A;  1NKB A;  4WFN L;  1S6Q A;  2QWM A;  3R6M A;  1YF5 L;  1Q81 O;  5DMR A;  5C42 A;  1NGE A;  1V4S A;  3B8A X;  4PHT X;  2PYJ A;  3HTV A;  3ZCM A;  5JIC A;  5AQQ A;  4RW4 A;  1ZBF A;  2G8K A;  2E1Z A;  5AZI A;  1EWR A;  3H45 C;  2OTL N;  2F8T A;  4CBU A;  5LMU K;  1SL2 A;  3HM8 A;  3L4I A;  3MN6 A;  4W5Q A;  4YOV A;  3AO5 A;  4WE1 A;  1RBS A;  1QTM A;  3H1Q A;  3UKU A;  2HW3 A;  3ALY A;  2P9L B;  2ZGY A;  3DLG A;  4OPH A;  1NBW A;  4QAG A;  3P1G A;  1QQN A;  1WN7 A;  1RTJ A;  3CFO A;  4YOX A;  3VQ5 A;  3F5T A;  1IKV A;  4NO7 A;  1WNS A;  1WSH A;  1JXE A;  2UUB K;  1TKX A;  3CQ8 A;  1X9S A;  5KQD A;  3BUZ B;  4FM2 A;  2A40 A;  3VET A;  5FPM A;  3CCU N;  4JKG A;  4DUZ K;  3FFK B;  3G0Z A;  4LFC K;  3VEW A;  2F8S A;  1MA9 B;  4O5F A;  3VA3 A;  3P39 A;  2KFN A;  4E1M A;  4IG0 A;  1G99 A;  2KFZ A;  1U47 A;  3IS9 A;  3A5N C;  1KLM A;  1K6Y A;  1TUY A;  3VPZ A;  3SI6 A;  3K5L A;  4LF5 K;  1WOQ A;  1N34 K;  2EWS A;  1YJ9 N;  2G8V A;  1OH5 A;  3ZSO A;  2JWL A;  4CK3 A;  3E9P A;  2ZD1 A;  5IWA K;  3J7A P;  3CJA A;  2ITG A;  4C23 A;  3VQQ A;  1Q86 O;  3W3D A;  2BE2 A;  2ATQ A;  5AQY A;  1KQS M;  1VQ7 N;  2VG5 A;  4B1Z A;  4KHW A;  2GTD A;  4JEP A;  3CJ7 A;  3R1X A;  3HL8 A;  4FWR A;  3O9S A;  1IV0 A;  3F73 A;  5HBM A;  4BVO A;  3CI5 A;  3PSI A;  4F8R A;  4FWL A;  3GOI A;  3MMV A;  3CFR A;  3CET A;  3D2F B;  1SL0 A;  1EO1 A;  3ZT2 A;  2O8C A;  4H0Y B;  3V9X A;  1RGI A;  1CZ9 A;  1RT3 A;  5BRH A;  1QHT A;  1IG8 A;  3AA4 A;  1N32 K;  4J2D A;  4JHD A;  4KHU A;  4E7K A;  3U6F A;  1TL3 A;  4CZH A;  1KAZ A;  4IBN A;  1RT1 A;  5KPR A;  2BAN A;  4FJK A;  3FGU A;  3O3H A;  3KJV A;  2UYT A;  4BRG A;  3EY1 A;  1NJZ A;  2EX3 A;  1FKP A;  4AQY K;  2P9U B;  2ZJP L;  4Z0U A;  4CEZ A;  4FWP A;  2E2N A;  1VSK A;  2FBV A;  1RFQ A;  1BI4 B;  3WQU A;  3I0R A;  3B6P A;  1WB9 A;  1BA1 A;  3HVR A;  3S9H A;  2HHQ A;  4ICL A;  3MX2 A;  2GBZ A;  5ELZ A;  4JKA A;  3M1F A;  4CFD A;  2OTJ N;  3MCP A;  4M3U A;  4CZJ A;  4J2A A;  1RDU A;  2ZM6 K;  3K5O A;  3D0P A;  4JD2 A;  4Q0B A;  3T7Z A;  4DSF A;  3ULE A;  4FW2 A;  4BC2 A;  3LDP A;  1KFS A;  4ISG A;  4AM7 A;  4H0X B;  1WBD A;  2GV9 A;  4W5N A;  4DFK A;  2E2O A;  1VHX A;  1YI2 N;  1ZBH A;  3VQC A;  1NWK A;  2OAN A;  3PX4 A;  4FWQ A;  3TAN A;  1OH6 A;  4DSK A;  2FC0 A;  3LDN A;  4Y1D A;  4IOA L;  2E6L A;  4IO8 A;  1JXB A;  3FZL A;  5GIN A;  3BF3 A;  5FRO A;  4H5R A;  1XMO K;  3C0B A;  3TSP A;  1XC3 A;  1KAY A;  3VQB A;  5EU7 A;  2P9K B;  5AQZ A;  1W0H A;  4BGA A;  2G8H A;  4KTW A;  4DTX A;  1CXU A;  1FXX A;  3K5M A;  4W5R A;  3OYF A;  1HNX K;  4C8O A;  3PX0 A;  2ASM A;  4CBW A;  2DFE A;  4Y0W A;  3DXM A;  1YVU A;  2HMI A;  2HHH K;  1B9F A;  2DFF A;  4C1N K;  1KAX A;  4YY3 K;  1TK8 A;  2OPP A;  4YFU A;  1U48 A;  2E20 A;  1S9G A;  4IJN A;  1EXQ A;  4CJF A;  4KRE A;  2P9S B;  4J2B A;  1IKX A;  5AQL A;  3HVT A;  4EFH A;  3DOK A;  2A42 A;  1LAW A;  3T19 A;  4BRE A;  2PYL A;  2YHA A;  4K41 A;  4OLB A;  3VQA A;  4B1W B;  3V81 A;  2A6A A;  5M1P A;  4B3T K;  4EIA A;  3KK1 A;  4DV1 K;  4BC4 A;  1X9W A;  1WSJ A;  5A2Q O;  4Z4I A;  2A41 A;  1VQP N;  1KC8 O;  1QVG M;  1QHA A;  1YVN A;  1RDW X;  5GIP A;  1GLJ O;  4CGI A;  3LAL A;  3RMD A;  1S9E A;  2VYP A;  5JS1 A;  1GLL O;  1LWF A;  5KPT A;  4MFB A;  2ETJ A;  1UAX A;  5AJ3 K;  2OPR A;  3VTH A;  4EAH D;  3NDK A;  3K58 A;  1R0A A;  4FJH A;  1D9F A;  1REV A;  3THW B;  2WOM A;  3UE5 A;  1HNV A;  1NOY A;  3ENO A;  3ZSQ A;  1QVF M;  4Z4E A;  3PX6 A;  3MX5 A;  3CHW A;  3C6A A;  3G71 N;  4BDZ A;  4PUO A;  3I8B A;  2NZT A;  1SAZ A;  2AA4 A;  1UOC A;  3HPO A;  4YOU A;  5BR8 K;  2O8E B;  2RF2 A;  4CJW A;  2W42 A;  1T3V A;  1C0U A;  3CCL N;  2XY5 A;  4AM6 A;  3WXM B;  5LY3 A;  4EZ9 A;  4DR3 K;  2ZE2 A;  1GLC G;  3S3M A;  2XY8 A;  1BHL A;  3IMX A;  3T1A A;  2FF3 B;  4HUG A;  4RCH A;  4FJ5 A;  1OKJ A;  3EKU A;  3HT3 A;  2HMP A;  4QOZ B;  5BN8 A;  1GLF O;  2PAV A;  5AZI B;  1KRP A;  4IWV A;  4PQU A;  3VER A;  3AVM A;  4KBO A;  4DTP A;  3L2U A;  2A3Z A;  4DTR A;  2G8W A;  1ZBI A;  4JI4 K;  3KLF A;  3L2R A;  2CH6 A;  1VQM N;  4IJA A;  3UKU B;  4DTO A;  3HSC A;  3BP8 A;  4YOT A;  4YHH K;  4HUE A;  2O8F A;  1NLV A;  1HJO A;  2NRT A;  4E7I A;  5E26 A;  1BIU A;  2ZF5 O;  3JXU A;  2G8U A;  3LP3 A;  4PKH A;  3OYI A;  3SV4 A;  3WXJ A;  4E89 A;  3LDO A;  4JKD A;  1L3U A;  1C0F A;  4UY8 O;  1L5U A;  4FPA A;  1K8A O;  1QQC A;  1SL1 A;  2IC3 A;  1S1W A;  1QSY A;  4JK7 A;  4BDP A;  5AQJ A;  4CJK A;  5C0Y A;  4GMJ B;  3M3Z A;  4DQQ A;  3A5O C;  3NFA A;  4O5B A;  3CJB A;  3OYG A;  3JAM O;  2KLA A;  3H46 O;  2ASO A;  1ATS A;  5FDL A;  4LSL A;  4DUY K;  2HBJ A;  3KKR A;  3VMF B;  4E19 A;  4LH4 A;  3PUF A;  3KTQ A;  1S1V A;  1BI4 A;  1CXQ A;  4FCY A;  1VSH A;  4WQ5 C;  3DAW A;  2D0B A;  2QA4 N;  2D0P A;  4CJR A;  5M1K A;  4WFA L;  1M90 O;  4KH5 A;  3NGZ A;  2Q36 A;  4FLX A;  2F96 A;  1S1X A;  2QI2 A;  3F9K A;  2WON A;  4GKJ K;  4LD0 A;  3FZM A;  1EKE A;  4C1N I;  3QLH A;  4F3T A;  1VK0 A;  5JLH A;  3W0L A;  5AQG A;  2HBL A;  4OLA A;  3TAG A;  3CER A;  4HWI A;  2WUS A;  4KI6 A;  4BR2 A;  2UXC K;  3E66 A;  4NCB A;  3L8B A;  3ZEU B;  2O8C B;  4M7X A;  3KK2 A;  1DTT A;  1NK7 A;  3DMJ A;  2DY4 A;  5AQP A;  5TKY A;  1EX4 A;  4B1U B;  1J53 A;  3QFP A;  4HTU A;  5AQU A;  3SV3 A;  1QQO A;  2D5R A;  5B8H A;  1KVC A;  4FJG A;  1GLA G;  1YTA A;  2IAJ A;  2GWK A;  4AIL C;  3N4P A;  4DB3 A;  4L3Q A;  1VAZ A;  3L2Q A;  4CEA A;  1HKB A;  3K5N A;  4IOC L;  1U6Z A;  1ASV A;  1KVB A;  2QWR A;  3DLE A;  3TSQ A;  3FR0 A;  5HRR A;  4M3Z A;  5AQM A;  3D6R A;  3EZ5 A;  1SS6 A;  1C6V A;  4JLH A;  4CGD A;  2VGN A;  4FM0 A;  2OCE A;  3OHR A;  3THX A;  1NJX A;  4FLW A;  3KK3 A;  2XY6 A;  4DU1 A;  1ZC6 A;  1WSG A;  4Q5V A;  3WUH A;  5C24 A;  4K0K K;  3HYF A;  4GW6 A;  3L2V A;  4KKO A;  3HP9 A;  5C10 A;  4JRP A;  5CZ1 A;  1S3X A;  5EXW A;  2IVN A;  5M1O A;  2D1K A;  4BE1 A;  4OGC A;  2X6S A;  2KW4 A;  4JD2 B;  1TK0 A;  3AVC A;  1QSL A;  3QNO A;  2OPQ A;  4BR4 A;  4DF8 A;  2OZS A;  3HO1 A;  1A5V A;  2P9S A;  4EZ6 A;  4I9Q A;  4DTN A;  2OZM A;  1IO2 A;  1QSS A;  2HNY A;  3KLE A;  1BUP A;  3TAQ A;  4OGE A;  3J7Z O;  4JI2 K;  1GOB A;  4NCA A;  4CK2 A;  3E01 A;  4KHY A;  2IVP A;  2YNH A;  3CPE A;  4A59 A;  4PKI A;  4LF4 K;  2NNW A;  4HUF A;  3U4L A;  1H1V A;  3NE6 A;  2KZM A;  3M5R A;  4KH6 A;  4NYN A;  2QKK A;  2FSK A;  3KK7 A;  2A1R A;  5AQI A;  5AQS A;  3I8D A;  5J2Q A;  5C2F A;  1RDD A;  4E7L A;  4DV6 K;  2GUI A;  5KGX A;  1OH7 A;  3AAQ A;  3SJH A;  4NXN K;  4FZZ A;  5CYM A;  3O9R A;  1S22 A;  4PL7 A;  5T7B A;  1XNQ K;  3DXM B;  4JI7 K;  3HBT A;  3KZB A;  2AJQ A;  4KRF A;  3DI6 A;  3QIO A;  1T8E A;  2ZJQ L;  3J81 O;  3V4I A;  1JCF A;  1GLD G;  3VGM A;  2W6L A;  2O8E A;  2HST A;  1R59 O;  3OYM A;  4CJP A;  4Z4H A;  1HNI A;  3OTO K;  1ZBU A;  2HHX A;  1GOA A;  4DSL A;  3F9M A;  2X78 A;  3O1B A;  1NJI O;  1J9A A;  2E4L A;  3BGR A;  4KHN A;  5CR4 A;  4YNQ A;  3LP0 A;  3BF1 A;  3K57 A;  5LJV A;  3VN5 A;  3FLC O;  4HVJ A;  3KD5 E;  3V1O A;  4J8F A;  2GX9 A;  4NLB A;  3THY A;  3H3N O;  3VEY A;  4L8R B;  4CHN A;  1BCM A;  4CF0 A;  3P4I A;  3M6G A;  3TTC A;  4JS4 A;  4JV5 K;  2I7P A;  1YIJ N;  5H1S Q;  3ZT0 A;  3CIP A;  3CCQ N;  3ZLJ A;  4M3Y A;  3CCJ N;  1GLB G;  2QWQ A;  3ZX3 A;  5AQT A;  4BG9 A;  3NH0 A;  3O4N A;  3TAM A;  1RIL A;  4NB4 A;  1HYS A;  1XC9 A;  2ASP A;  3MN5 A;  4CJ5 A;  1TL1 A;  4OKE A;  5FPD A;  4KB0 A;  3WNF A;  1HX1 A;  3MN7 A;  3O5B A;  3MEE A;  3TAP A;  1ITG A;  3MCA B;  4IEE A;  1X3N A;  5C25 A;  1SV5 A;  3OJS A;  3TI0 A;  4OVL A;  3HK2 A;  3RMB A;  4CIF A;  4FOI A;  4FL9 A;  2WBN A;  3JYT A;  2UUA K;  4CJU A;  1RT7 A;  3IG1 A;  4H0O A;  4BC5 A;  1BOT O;  1E3M A;  1TK5 A;  4B9V A;  3VES A;  2RE2 A;  1CZA N;  1ESV A;  3AO3 A;  1VSE A;  2PFU A;  4ZTJ A;  2E6M A;  2O8F B;  4KHS A;  3O6W A;  4FM1 A;  1Q9Y A;  3UIQ A;  1C0G A;  4DR5 K;  3O8M A;  4OJR A;  4FK2 A;  1D9D A;  3RRG A;  1WLJ A;  4KTZ A;  5AZJ B;  1I94 K;  4CHP A;  3CC2 N;  3LPU A;  3SBG A;  1RT5 A;  3KLH A;  4DHY A;  3O4Q A;  3J80 O;  5D3G A;  1TUU A;  3OYH A;  4CJL A;  2HND A;  3TU5 A;  3ZEU A;  1TKT A;  4OO1 J;  1OVQ A;  1FJG K;  1MWM A;  4YOY A;  3N4Q A;  5AQH A;  1KD1 O;  1NJW A;  3NHG A;  3OA9 A;  1NKE A;  1T05 A;  4CJQ A;  4FWK A;  1NK9 A;  3MK6 A;  1BGX T;  5BPL A;  3VQE A;  3OYA A;  4DTM A;  1NGI A;  4FWS A;  1YUW A;  3MDQ A;  2QTD A;  3RSE A;  5F1X A;  1T6D A;  1TAU A;  1XQS C;  1RCH A;  4C8M A;  4CF8 A;  1HUX A;  3NAE A;  1VRU A;  3SPY A;  4A2B A;  1QQM A;  3S3O A;  3VQ7 A;  4KFB A;  3OYD A;  2RPI A;  4IOX A;  3SQ0 A;  1HNZ K;  4IDH A;  3TTD A;  3OYB A;  5ADX A;  3O9U A;  4BRO A;  4KHQ A;  4FJ8 A;  1WAF A;  1Z6R A;  3PIP L;  2G8I A;  4DTJ A;  3P83 D;  3OS2 A;  1L3V A;  1OH8 A;  3TPQ A;  3VEX A;  1N33 K;  3AVB A;  1VQK N;  4R79 A;  4CF2 A;  3U9D A;  3ID6 A;  5AR0 A;  4CZK A;  1WBB A;  2D0O A;  3NH1 A;  1IH7 A;  4CIG A;  1Q82 O;  1YHQ N;  4FJM A;  4KI4 A;  4M7Y A;  4KV8 A;  4KPY A;  1S5J A;  3CD6 N;  4BRA A;  4LF8 K;  3EE8 A;  1S72 N;  4FLV A;  1NU0 A;  1E4G T;  5C15 A;  1B92 A;  4PKG A;  2NUB A;  3U9Z A;  1HMV A;  1ZXO A;  2PBD A;  4Y1C A;  2IOC A;  2NRV A;  5CY4 A;  3AV9 A;  4BC3 A;  1U45 A;  4BR9 A;  3ZSV A;  2VQF K;  4HHT A;  1WUA A;  1VQ5 N;  4IFV A;  3NH2 A;  4AHU A;  2IDO A;  1NK6 A;  3ZT3 A;  3LDQ A;  4CEO A;  1JLG A;  1NGB A;  2X74 A;  4XEI A;  3THX B;  3AVI A;  2E5L K;  2ZGZ A;  4LF7 K;  4B9L A;  2KTQ A;  2GEL A;  2ZQB A;  1IKY A;  2BGG A;  5HL7 L;  3WXK A;  3OS0 A;  4M3X A;  4WYB A;  1VSI A;  4MO4 A;  2CH5 A;  4JK8 A;  3EL2 A;  1JCE A;  2AP1 A;  1RT6 A;  5GIO A;  4W5T A;  3KLG A;  1TAQ A;  3OW2 M;  1Q9X A;  2Y1J A;  1EQY A;  2YKN A;  3QEW A;  5HP1 A;  3OYN A;  4A5B A;  3ZX2 A;  4H5N A;  4DSE A;  2DPN A;  1BWF O;  3QDK A;  3L3V A;  2H3G X;  4M3R A;  3E9O A;  4BGB A;  3LZI A;  1S1T A;  2P51 A;  1ZYQ A;  3V9Z A;  3V6D A;  1YIT N;  2OYQ A;  1HNW K;  2O8D A;  3DRR A;  2V7Z A; 
#chains in the Genus database with same CATH homology
 4DR6 K;  4JI5 K;  4GKJ K;  5BR8 K;  1N33 K;  4DV7 K;  4X64 K;  4DV6 K;  1XMO K;  4LF9 K;  4B3M K;  2UXC K;  4DR3 K;  4NXN K;  4DV4 K;  4LF8 K;  2UUA K;  1J5E K;  1XMQ K;  1XNQ K;  4DV5 K;  4JI8 K;  1HNX K;  4JI0 K;  4JI7 K;  5FLX O;  2UXB K;  4X65 K;  4LF6 K;  4LFB K;  2HHH K;  4JI3 K;  2F4V K;  4DV2 K;  3J81 O;  4JI6 K;  4V19 S;  4YY3 K;  4DR5 K;  1HR0 K;  1N32 K;  5LL6 Z;  4JI4 K;  2VQF K;  3T1Y K;  5LMU K;  4YHH K;  1I94 K;  2UXD K;  3OTO K;  4JI1 K;  3J80 O;  2UU9 K;  4AQY K;  4OX9 K;  3J7Y P;  2E5L K;  4JYA K;  4NXM K;  4LF7 K;  4DR2 K;  1FJG K;  4DR4 K;  5LMN K;  4X62 K;  4B3T K;  1IBK K;  4DV1 K;  4K0K K;  5A2Q O;  3T1H K;  4GKK K;  2UUB K;  2VQE K;  4DV0 K;  4LFA K;  5IT9 O;  1IBL K;  4DUZ K;  4X66 K;  4JV5 K;  2ZM6 K;  4LFC K;  1IBM K;  4CVN E;  4CW7 B;  3JAM O;  4B3S K;  4DUY K;  4DR1 K;  4B3R K;  2UUC K;  4DR7 K;  4LF5 K;  1N34 K;  5AJ3 K;  4JI2 K;  4KHP K;  1N36 K;  1HNW K;  1XNR K;  4DV3 K;  5IWA K;  4LF4 K;  3J7A P;  1HNZ K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...