5LMUM

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmuM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmuM02
4X64M 4CISA 1N36M 4JI1M 2UXDM 3U6EA 3GQ4A 3GPYA 2VQFM 3VK8A 4JI5M 2F5PA 3JAMS 4LF4M 3VK7A 4X66M 2UUCM 4LF9M 4JI6M 3U6MA 3U6CA 3SARA 2ZM6M 1FJGM 3GPUA 4G4RA 1EE8A 3J80S 2EA0A 3T1YM 1N32M 4AQYM 3GO8A 4X62M 2HKJA 2F5OA 4JV5M 5ITXA 5ITXE 3GQ5A 3T1HM 4YHHM 4JI4M 4JI8M 3SATA 4JI7M 4PD2A 5IWAM 4JI0M 4B3TM 1HNZM 4DV6M 3J7AS 5ITTA 4DR4M 2F4VM 4LFAM 2UXBM 1XMQM 1Q3CA 1TDHA 4DR2M 4DR3M 4NRVA 3SAWA 1KFVA 1L1TA 4LF8M 4DUZM 3SAVA 3JR4A 5LMUM 1R2YA 3U6SA 1Z5AA 4GKJM 3C58A 4JI2M 3TWLA 3U6QA 5ITRA 4KHPM 5FLXS 4G4OA 1J5EM 4LF7M 4DUYM 5IT9S 3TWKA 1Q3BA 4DR1M 4DV0M 1XNRM 3U6DA 2F5QA 4DR7M 3A42A 3A46A 4JYAM 1Z59A 1L2CA 3GQ3A 4DR5M 1L1ZA 1HNXM 4DR6M 5ITQA 4G4QA 1K3XA 4X65M 1L2BA 2UU9M 1MX0A 1IBKM 4B3SM 1R2ZA 2UUBM 1L2DA 1HR0M 4DV3M 2UUAM 3U6OA 1Q39A 4K0KM 4ITQA 4JI3M 1MU5A 3SAUA 1PJJA 4LFCM 2HHHM 2Q2EB 1HNWM 1IBLM 3W0FA 4G4NA 1XMOM 1PM5A 2F5NA 3U6LA 4PDIA 3JR5A 2OQ4A 3TWMA 3J81S 1XNQM 4OX9M 2OPFA 4YY3M 4B3RM 4PCZA 3GP1A 3GPPA 2XZUA 1TDZA 4B3MM 3SASA 3U6PA 1NNJA 4GKKM 1Z5BA 5ITYA 3OTOM 2E5LM 5LMNM 1Z5CA 3GPXA 2UXCM 3SBJA 2XZFA 4PDGA 4LF6M 4LF5M 1PJIA 4DV1M 4DV4M 3A45A 5BR8M 2ZBKB 2VQEM 4NXMM 1N34M 4DV7M 1N33M 4MB7A 4NRWA 1K82A 1XC8A 2F5SA 4NXNM 4DV5M 5A2QS 1I94M 3DOAA 1IBMM 4LFBM 4DV2M 5ITUA 1K3WA
chains in the Genus database with same CATH superfamily
1MN3A 1D0MA 2HWJA 4JN6A 4W5WA 1NJGA 1CUKA 1SXJA 1N36M 2JY7A 1QDRA 1SXJE 3QYBA 3U6EA 3L27A 4M0WA 3ZQJA 3UJNA 3JAMS 1WGLA 2C9CA 4QHTA 1T43A 1OIPA 5EXTA 2UUCM 4OU7A 4LF9M 1R5LA 1S3SA 3VFDA 2XFTA 4D82A 1FJGM 5C1BA 1N32M 1IXZA 1EFUB 1T6OA 1VDDA 2DAEA 5FTJA 2DHRA 2JY8A 4R71A 1OTRA 3ZCBB 1Y8GA 5EXXA 4XBOA 5JI3E 2CFOA 4JI7M 2R4EA 2R18A 2QHOB 3K9OA 2DAGA 4JI0M 4MGHA 3CTWB 4PD2A 2CUZA 2DWZB 3FD9A 5ITTA 1QAOA 4D80A 3C3EA 3AOGA 3FKEA 3HHWA 1ORYB 2UXBM 3NBXX 2LHCA 3B89A 3KP0E 4ZPXA 4Q7JA 3PNYA 4IIWA 1VEGA 4AG5A 3W68A 4DR2M 1KFVA 4IBDA 1L1TA 1VG5A 4FWHA 4AI6A 1LV7A 1OFIA 3K1JA 3TE6A 2C5RA 1PJTA 1XXHA 3JR4A 3K92A 5L8RF 5LMUM 1XXHE 1Z5AA 3NWLA 1G59A 2DAMA 2G8LA 3C58A 2JY6B 1F4IA 3U6QA 4LJ5A 1NNUC 2K6BA 2XGNA 4GHLA 1Q3BA 4WP2A 1TH3A 4DR1M 2V6ZM 3L2AA 4AKIA 4DR7M 3A42A 1JB0F 1NV8A 4R7GA 4IBCA 3GLIB 4JYAM 1L2CA 2BNKA 1LTMA 1VEKA 3AV0A 3LQQA 1QVRA 3DFZA 1R4GA 1SXJB 1UM8A 3H4MA 2WSCF 3FE3A 3SYKA 5EP4A 1MX0A 4FW9A 4B3SM 1Z6TA 3PNVA 1R2ZA 2UUBM 1IN5A 3DA1A 4XGIA 4NOOB 4OVZA 3KXEC 4JI3M 3FRIA 1IY1A 1VDLA 1YE9A 3KOYE 1GJTA 1HNWM 1IFYA 2KEBA 2L4FA 1XB2B 3E46A 3R8FA 1XMOM 2N35A 1ZMUA 4WW0A 3JR5A 4JXJA 2L7IA 1ZQ9A 4OX9M 2DAIA 4IBIA 4TUWA 4I5SA 1IXRC 3IG8A 2R65A 2R6FA 2JUJA 1IN8A 4GITA 2LVAA 5DNYA 1TDZA 2X49A 4FWGA 1N77A 3PVSA 1V33A 2JXNA 5ITYA 5KPRA 2CHGA 2EO2A 4RKUF 2E5LM 4KODA 3BOSA 3M7GA 3QWLA 1DV0A 2UXCM 1QANA 4DV4M 1NO1A 4HLQA 2XH9A 3THGA 4MH0E 5IZ7D 1OAOC 3RE8A 5BR8M 4M9XA 3R9XB 4NXMM 2MR9A 3GRUA 4DV7M 1N34M 1XXHB 3J27B 2O01F 2KA6B 1XC8A 3UMMA 4FWDA 4DV5M 1E9SA 5A2QS 4LFBM 2MROB 4GKKM 4II7A 8CATA 3FUXA 3U60A 3KFUG 2R0IA 4X64M 1OQYA 3LVVA 4LRTA 3L25A 2KDLA 4CISA 1OIZA 3SMSA 1P3QQ 1GJSA 2JP7A 2P5TA 1IM2A 3ZC7B 3GQ4A 3FYDA 5BPVA 2VQFM 4JI5M 1QUSA 4RNAA 3TL4X 1HQCA 5JI2E 5EXSA 3J7BA 2M5ZA 4IBKA 2D7HA 4RF1A 3U6MA 3U6CA 4LJ8A 1I4WA 3FTCA 1HT2E 4GMQA 5F3WA 3FUUA 3HY5A 4KT0F 3J80S 2FOIC 3KS4A 3HJ8A 3T1YM 5H37D 3AOEC 2B3TA 4OVZB 3RFWA 2DWNA 4X62M 2F5OA 1N75A 2JWSA 1DGHB 2O25A 1H6UA 2R46A 4LZZA 3I4VA 4UN2B 4G3OA 4YHHM 4FD2A 2RGHA 3HZJA 4GH9A 2XSZA 3GLIA 2CHVA 3GLIE 4DR4M 2CV0A 3FTEA 1YSYA 1VEJA 4M9SA 2RGOA 1IN4A 1NY5A 3HX3A 4LGYA 5KQDA 4AKHA 2DNAA 4L8RC 1TDHA 3SMPA 4AKGA 2QSFX 2FE8A 3D8LA 2LH0A 3B7ZA 4B7FA 3SAWA 4LCBA 3EIHA 2FS1A 2DWMA 3RGPA 4LF8M 2K0BX 4DUZM 3E21A 2OOAA 1UFZA 3VKHA 3TWLA 5ITRA 2JY5A 4KHPM 1DO0A 2D7EA 3E4RA 3GRYA 4I4LA 1J5EM 3QYEA 4MGYE 3UGJA 2CEAA 1D2NA 1TH2A 2XLJA 3L26A 1OAIA 3DZDA 4PT5A 4BLCA 3U60B 1E32A 3MHVC 1HT1E 5GKNA 1HNXM 3AOEA 5ITQA 2DWLA 2C98A 3WHKA 1K3XA 4L6V6 3SFZA 1L2BA 5E26A 2UU9M 3SHFA 3U61A 1ZV1A 2YQZA 3HU3A 3KVWA 1G8PA 1PJSA 1Q39A 2QNJA 2QP9X 2UUAM 2DHYA 4ITQA 3CF6E 4MM3B 4GHAA 3SAUA 2APLA 2HHHM 2QZ4A 1AIPC 2OO9A 1TTEA 2A5YB 5EXPA 5FTLA 1IBLM 4QOZC 3KS8A 2R45A 4BB9A 3LMMA 3U6LA 4B7HA 2OQ4A 4Y28F 1IXSB 2LVPC 3J81S 2Y21A 1IQPA 1XNQM 2WSFF 2LWXA 4AG6A 2H5XA 4P17A 1X37A 4IBGA 4FCTA 1GABA 1T3TA 3HWSA 2J5YA 2L7HA 3I04M 3GPPA 2XZUA 3KP1E 2JZ1A 3HHYA 3KSXA 4KLNA 5EP3A 3GLFA 5E6JA 2HL7A 3GLFE 3KSJA 3OTOM 3Q8GA 3KOXE 2KHHA 3EIEA 1GO5A 3T15A 1QZMA 3AL0C 3KDSE 4R3DA 2R62A 1DO2A 1A5TA 1C7YA 3HKPA 3M0EA 1DGHA 2L2DA 2Y0QA 1D0LA 2KXEA 2M60A 3CF2A 4KO8A 1K82A 2XEPA 1IBMM 3J2PB 3TQSA 2CRUA 3DOAA 5EP2A 3PXGA 4LJ4A 4DV2M 1K3WA 1QUTA 1QDTA 3H4JA 3L28A 4LJAA 3WHLA 3NBIA 4B7GA 3GRVA 3UZUA 3VK8A 1G4AE 3AKZA 4L4UA 2L6OA 4LF4M 4IJEA 3GRRA 3LCVB 4LJ9A 5DYGA 2Z3XA 4JI6M 2BJWA 3SARA 2ZM6M 4XK8F 3MK6A 1GL6A 1KYIA 3V76A 3ZH9B 3GPUA 1EE8A 4G4RA 3U61B 1OFHA 3B7QA 2QENA 2C96A 2JZ0A 1JR3D 3W0LB 3I51A 2QBYA 4IBFA 2HKJA 2DZLA 1MJGM 1PRBA 1QAQA 5ITXA 4JV5M 2EKFA 5ITXE 3K8ZA 1SG9A 1DGFA 2XF3A 4MGZE 1OKSA 3T38A 4B3TM 1HNZM 4DV6M 1QAMA 2FNAA 4NC6A 4S12A 2C9OA 4RF0A 3HU2A 2F4VM 2R44A 2AHMA 2Z4SA 3W67A 1WHCA 2WZJA 1Q3CA 4I81A 1GKIA 2LVNC 2CE7A 4DR3M 4NRVA 5FTMA 4IBBA 1ZAEA 3GLFB 3IECA 1QYRA 3LCUA 3SAVA 3L29A 1R2YA 5FTNA 3AFHA 4JI2M 4F1IA 1AUAA 1R6BX 3VKGA 5FLXS 4P16A 2WSEF 1IXSA 1WXQA 4G4OA 1G41A 5IT9S 1SXJD 3I4YA 1HQYE 4NSRA 1XNRM 3U6DA 2F5QA 4LJ7A 5EP1A 3A46A 1IY2A 2K9DA 3VDUA 1PJQA 3GQ3A 4DR5M 1L8QA 2K47A 3RGSA 1J09A 2DXIA 4DR6M 2LBCA 2MH8A 3U5ZB 3D8BA 4X65M 3SYLA 4CHTB 5DFLA 5C18A 2KNVA 3LVWA 1HR0M 4QNMA 3U6OA 1MU5A 2Z8YM 2O5RA 1PJJA 2LXEA 2Q2EB 1WJ7A 1IY0A 2QCUA 2VDBB 2XFSA 2ZTDA 1KSFX 3W0FA 2MJ5B 3F92A 1PM5A 3T6PA 2QBYB 2LTUA 2C99A 2OPFA 3HU1A 4LG2A 3K2LA 2V1UA 3HJSA 4B3RM 4LJ6A 4NL4H 2RRUA 2HAKA 4PCZA 4LGMA 1NJFA 4AZFA 4BBAA 1WGNA 2ZTCA 4B3MM 2LHGA 1NNJA 1TR8A 3E9SA 5LMNM 1Z5CA 2L09A 4IJFA 1VQ1A 4PDGA 2LVQD 4M9ZA 1HJPA 4GC9A 3A45A 4G6ZA 2ZBKB 2VQEM 3HGIA 3BXWA 3SHGB 4GRIA 3A98B 1D0KA 3CF0A 4MB7A 3HJQA 4NRWA 2DKLA 4NXNM 1TF0B 3C3DA 3GLGA 5KPZA 1I94M 1C1KA 5ITUA 3GLGE 3Q8XA 3C9PA 2G5GX 3ILKA 1XWIA 4AW4A 4MGIE 4JI1M 1W5SA 4L16A 4CGYB 2UXDM 2G3QA 3GPYA 5EQTA 1NHWC 2RKOA 2F5PA 2Y0TA 2CP8A 3FTDA 3MMPA 2LVOC 4QNRA 3VK7A 1GLNA 4X66M 2DVWB 2YNMD 2CWBA 4B08A 4FCWA 2J7OA 5FSWA 2CHQA 2GQFA 1IN6A 2EKKA 2EA0A 3FUWA 4AQYM 3GO8A 4A3VB 2ZANA 1IN7A 3LW5F 2V1CA 3GQ5A 3T1HM 4JI4M 4JI8M 3HHZA 3SATA 2VF8A 1DGGA 1W5TA 5IWAM 4WURA 1NV9A 2FFJA 2KZSA 2I7NA 2CV2A 2BWBA 4MGKE 3J7AS 3BBZA 1G3IA 4LFAM 4I8OA 3IG5A 3U5ZA 4L15A 1XMQM 3KOWE 3MJ5A 5IREB 1EIJA 4GEWA 2DZOB 2KNAA 1RU3A 3PFIA 2EUCA 5KQ8A 1TH4A 2X8AA 3FUVA 5EJCA 4CJ6A 3UK6A 1XHBA 2LNHC 2NQ8C 2Z4RA 2BWEA 3U6SA 3GLHA 4IBEA 4GKJM 2MGWA 2BJVA 2ERCA 2HCBA 2J7NA 2QQ8A 3GLHE 3FTFA 1OJLA 1YLAA 2KNZA 2JNHA 4L78A 4LF7M 3TPZA 4DUYM 4ANRA 3TWKA 5DYIA 4DV0M 1TGUA 3GLGB 5FTKA 5KPTA 4M0DA 1Z59A 4IBJA 1GL7A 3CGWA 2FH0A 3B7NA 1L1ZA 1QQWA 2EJSA 3VLFB 3AJIB 2R4JA 2VIIA 4G4QA 3KOZE 2ZAMA 2X4AA 2CV1A 1V34A 1IBKM 2DENA 1Q02A 2QPAA 4HEOA 1R7RA 1QZEA 1FNNA 3VDPA 4DV3M 1L2DA 1SXJC 2Y20A 4K0KM 1N78A 2L4EA 1G71A 4LFCM 3FRHA 1YUBA 3SC3A 4EIWA 4F2LA 4Z8XA 2JA2A 2Z7JA 4G4NA 2DAKA 2F5NA 1BVSA 3B74A 5KO3A 1JR3A 3B9PA 4PDIA 3TWMA 1ZMWA 1JR3E 2XSZD 2YFQA 2W82A 1WR1B 2KRUA 1DGBA 3FYCA 1GVNA 2GNOA 3K9PA 3QAUA 4FCVA 4OW0A 2YR0A 1J7KA 4QOSA 2OOBA 2VF7A 4CIZA 4YY3M 4D81A 3LQRA 2KRKA 3GP1A 1V92A 1NSFA 4GC5A 3SASA 3U6PA 3FUTA 1Z5BA 1WIVA 2I7PA 2ZAOA 4LY6A 4HL4A 4Z6YA 4REZA 3GPXA 3SBJA 2D7GA 2XZFA 4LF6M 1E9RA 3IHPA 1NY6A 1PGYA 7CATA 4DV1M 1PJIA 4NSOB 4LF5M 3KW6A 2DZNB 4LZJA 2H1RA 1N33M 1NVMA 4QHSA 1E94E 2DI0A 4DBGB 1NHGC 1ZMVA 3GLHB 2F5SA 3M6AA 1JQJC 2KZUA 4GIPA 4LRSA 2KW0A 3I01M 4FVMA 3HHXA
chains in the Genus database with same CATH topology
4W5WA 4JN6A 1NJGA 1SXJA 1N36M 3U6EA 1SXJE 3L27A 4M0WA 3UJNA 3JAMS 4QHTA 2C9CA 5EXTA 2UUCM 4OU7A 4LF9M 1S3SA 3VFDA 2XFTA 4D82A 1FJGM 5C1BA 1N32M 1IXZA 1VDDA 5FTJA 2DHRA 3ZCBB 5EXXA 4XBOA 5JI3E 2CFOA 4JI7M 2R4EA 2R18A 4PD2A 4JI0M 4MGHA 3CTWB 2CUZA 2DWZB 3FD9A 5ITTA 1QAOA 4D80A 3AOGA 3FKEA 3HHWA 1ORYB 2UXBM 3KP0E 4ZPXA 3PNYA 4IIWA 4AG5A 4DR2M 1KFVA 4IBDA 1L1TA 4FWHA 4AI6A 1LV7A 1OFIA 3K1JA 3TE6A 2C5RA 1XXHA 3JR4A 3K92A 5LMUM 1G59A 1Z5AA 3NWLA 2G8LA 3C58A 3U6QA 4LJ5A 1NNUC 2XGNA 4GHLA 1Q3BA 1TH3A 4DR1M 2V6ZM 3L2AA 4AKIA 4DR7M 3A42A 4R7GA 4IBCA 3GLIB 4JYAM 1L2CA 2BNKA 3AV0A 3LQQA 1QVRA 3DFZA 1SXJB 1UM8A 3H4MA 3SYKA 5EP4A 1MX0A 4FW9A 4B3SM 1Z6TA 3PNVA 1R2ZA 2UUBM 1IN5A 3DA1A 4XGIA 4NOOB 4OVZA 3KXEC 4JI3M 1IY1A 1YE9A 3KOYE 1HNWM 2KEBA 3R8FA 1XMOM 4WW0A 3JR5A 4JXJA 2L7IA 1ZQ9A 4OX9M 4IBIA 4TUWA 4I5SA 1IXRC 3IG8A 2R65A 4GITA 1IN8A 5DNYA 1TDZA 2X49A 4FWGA 1N77A 3PVSA 5ITYA 5KPRA 2CHGA 2EO2A 2E5LM 4KODA 3BOSA 3M7GA 3QWLA 2UXCM 1QANA 4DV4M 4HLQA 2XH9A 3THGA 4MH0E 5IZ7D 3RE8A 5BR8M 4M9XA 3R9XB 4NXMM 3GRUA 1N34M 4DV7M 1XXHB 3J27B 2KA6B 1XC8A 3UMMA 4FWDA 4DV5M 1E9SA 5A2QS 4LFBM 4GKKM 4II7A 8CATA 3FUXA 3U60A 3KFUG 4X64M 3LVVA 4LRTA 3L25A 4CISA 3SMSA 2P5TA 1IM2A 3ZC7B 3GQ4A 3FYDA 5BPVA 2VQFM 4JI5M 4RNAA 3TL4X 1HQCA 5JI2E 5EXSA 3J7BA 2M5ZA 4IBKA 2D7HA 4RF1A 3U6MA 3U6CA 4LJ8A 1I4WA 3FTCA 1HT2E 4GMQA 5F3WA 3FUUA 3J80S 2FOIC 3KS4A 3HJ8A 3T1YM 5H37D 3AOEC 4OVZB 3RFWA 2DWNA 4X62M 2F5OA 1N75A 1DGHB 2R46A 1H6UA 4LZZA 4YHHM 3I4VA 4FD2A 2RGHA 4GH9A 2XSZA 3GLIA 2CHVA 4DR4M 2CV0A 3FTEA 1YSYA 4M9SA 2RGOA 1IN4A 1NY5A 4LGYA 5KQDA 4AKHA 4L8RC 1TDHA 3SMPA 4AKGA 3D8LA 2FE8A 3SAWA 2LH0A 4B7FA 4LCBA 3EIHA 2DWMA 3RGPA 4LF8M 4DUZM 3VKHA 3TWLA 5ITRA 4KHPM 1DO0A 2D7EA 3E4RA 3GRYA 4I4LA 1J5EM 4MGYE 3UGJA 2CEAA 1D2NA 1TH2A 2XLJA 3L26A 3DZDA 4PT5A 4BLCA 3U60B 1E32A 3MHVC 1HT1E 5GKNA 1HNXM 3AOEA 5ITQA 2DWLA 2C98A 3WHKA 1K3XA 3SFZA 1L2BA 5E26A 2UU9M 3SHFA 3U61A 2YQZA 3HU3A 3KVWA 1G8PA 2QP9X 1Q39A 2UUAM 4GHAA 4ITQA 3CF6E 4MM3B 3SAUA 2HHHM 2QZ4A 4QOZC 2A5YB 5EXPA 5FTLA 1IBLM 3KS8A 2R45A 4BB9A 3LMMA 3U6LA 4B7HA 2OQ4A 1IXSB 3J81S 2Y21A 1IQPA 1XNQM 2LWXA 4AG6A 1X37A 4IBGA 4FCTA 1T3TA 3HWSA 2L7HA 3GPPA 2XZUA 3KP1E 3HHYA 3KSXA 4KLNA 5EP3A 3GLFA 5E6JA 2HL7A 3KSJA 3OTOM 3KOXE 3EIEA 3T15A 1QZMA 3AL0C 3KDSE 4R3DA 2R62A 1DO2A 3HKPA 3M0EA 1DGHA 2Y0QA 2KXEA 2M60A 3CF2A 4KO8A 1K82A 2XEPA 1IBMM 3J2PB 3TQSA 3DOAA 5EP2A 3PXGA 4DV2M 4LJ4A 1K3WA 3L28A 4LJAA 3WHLA 3NBIA 4B7GA 3GRVA 3UZUA 3VK8A 1G4AE 3AKZA 4L4UA 2L6OA 4LF4M 4IJEA 3GRRA 4LJ9A 5DYGA 2Z3XA 4JI6M 2BJWA 3SARA 2ZM6M 3MK6A 1GL6A 1KYIA 3U61B 3ZH9B 3GPUA 1EE8A 4G4RA 1OFHA 2QENA 2C96A 1JR3D 3W0LB 3I51A 2QBYA 4IBFA 2HKJA 4JV5M 1QAQA 5ITXA 5ITXE 3K8ZA 1DGFA 2XF3A 4MGZE 3T38A 4B3TM 1HNZM 4DV6M 1QAMA 2FNAA 4S12A 2C9OA 4RF0A 3HU2A 2F4VM 2AHMA 2Z4SA 1Q3CA 4I81A 1GKIA 2CE7A 4DR3M 4NRVA 5FTMA 4IBBA 1ZAEA 3GLFB 1QYRA 3SAVA 3L29A 1R2YA 5FTNA 3AFHA 4JI2M 1R6BX 3VKGA 5FLXS 4P16A 1WXQA 4G4OA 1G41A 5IT9S 1SXJD 3I4YA 1HQYE 4NSRA 1XNRM 3U6DA 2F5QA 4LJ7A 5EP1A 3A46A 1IY2A 3VDUA 3GQ3A 4DR5M 1L8QA 2K47A 3RGSA 1J09A 2DXIA 4DR6M 3U5ZB 3D8BA 4X65M 3SYLA 4CHTB 5C18A 3LVWA 1HR0M 4QNMA 3U6OA 1MU5A 1PJJA 2O5RA 2LXEA 2Q2EB 1IY0A 2QCUA 2XFSA 1KSFX 3W0FA 1PM5A 2QBYB 2C99A 2OPFA 3HU1A 4LG2A 3K2LA 2V1UA 3HJSA 4B3RM 4LJ6A 4NL4H 4PCZA 4LGMA 1NJFA 4AZFA 4BBAA 4B3MM 1NNJA 3E9SA 5LMNM 1Z5CA 2L09A 4IJFA 4PDGA 4M9ZA 4GC9A 3A45A 4G6ZA 2ZBKB 2VQEM 3HGIA 3SHGB 4GRIA 3A98B 3CF0A 4MB7A 3HJQA 4NRWA 4NXNM 1I94M 3GLGA 5KPZA 1C1KA 5ITUA 3Q8XA 2G5GX 3ILKA 1XWIA 4AW4A 4MGIE 4JI1M 1W5SA 4L16A 4CGYB 2UXDM 3GPYA 5EQTA 1NHWC 2RKOA 2F5PA 2Y0TA 3FTDA 4QNRA 3VK7A 1GLNA 4X66M 2DVWB 2YNMD 4B08A 4FCWA 2J7OA 5FSWA 2CHQA 1IN6A 2EA0A 3FUWA 4AQYM 3GO8A 4A3VB 2ZANA 1IN7A 2V1CA 3GQ5A 3T1HM 4JI4M 4JI8M 3HHZA 3SATA 1DGGA 1W5TA 5IWAM 4WURA 2FFJA 2KZSA 2I7NA 2CV2A 4MGKE 3J7AS 1G3IA 4LFAM 4I8OA 3IG5A 3U5ZA 4L15A 1XMQM 3KOWE 3MJ5A 5IREB 2DZOB 3PFIA 2EUCA 5KQ8A 1TH4A 2X8AA 3FUVA 5EJCA 3UK6A 1XHBA 2LNHC 2NQ8C 2Z4RA 3U6SA 3GLHA 4IBEA 4GKJM 2J7NA 2BJVA 2ERCA 2HCBA 3FTFA 1OJLA 4L78A 4LF7M 3TPZA 4DUYM 3TWKA 5DYIA 4DV0M 1TGUA 3GLGB 5FTKA 5KPTA 4M0DA 1Z59A 4IBJA 1GL7A 1L1ZA 1QQWA 3VLFB 3AJIB 2R4JA 2VIIA 4G4QA 3KOZE 2ZAMA 2X4AA 2CV1A 1IBKM 2QPAA 1R7RA 3VDPA 1FNNA 1L2DA 4DV3M 4K0KM 1SXJC 2Y20A 1N78A 4LFCM 1YUBA 3SC3A 4EIWA 4Z8XA 2JA2A 2Z7JA 4G4NA 2F5NA 5KO3A 1JR3A 3B9PA 4PDIA 3TWMA 2XSZD 2YFQA 2W82A 2KRUA 1DGBA 3FYCA 1GVNA 3QAUA 4OW0A 4QOSA 4FCVA 2YR0A 1J7KA 4YY3M 4D81A 3LQRA 2KRKA 3GP1A 1NSFA 4GC5A 3SASA 3U6PA 3FUTA 1Z5BA 2I7PA 2ZAOA 4LY6A 4HL4A 4Z6YA 4REZA 3GPXA 3SBJA 2D7GA 2XZFA 4LF6M 1E9RA 4LF5M 1NY6A 1PJIA 7CATA 4DV1M 4NSOB 3KW6A 2DZNB 4LZJA 2H1RA 1N33M 1NVMA 4QHSA 1E94E 1NHGC 3GLHB 2F5SA 3M6AA 1JQJC 2KZUA 4GIPA 4LRSA 2KW0A 4FVMA 3HHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 M;  4CIS A;  1N36 M;  4JI1 M;  2UXD M;  3U6E A;  3GQ4 A;  3GPY A;  2VQF M;  3VK8 A;  4JI5 M;  2F5P A;  3JAM S;  4LF4 M;  3VK7 A;  4X66 M;  2UUC M;  4LF9 M;  4JI6 M;  3U6M A;  3U6C A;  3SAR A;  2ZM6 M;  1FJG M;  3GPU A;  4G4R A;  1EE8 A;  3J80 S;  2EA0 A;  3T1Y M;  1N32 M;  4AQY M;  3GO8 A;  4X62 M;  2HKJ A;  2F5O A;  4JV5 M;  5ITX A;  5ITX E;  3GQ5 A;  3T1H M;  4YHH M;  4JI4 M;  4JI8 M;  3SAT A;  4JI7 M;  4PD2 A;  5IWA M;  4JI0 M;  4B3T M;  1HNZ M;  4DV6 M;  3J7A S;  5ITT A;  4DR4 M;  2F4V M;  4LFA M;  2UXB M;  1XMQ M;  1Q3C A;  1TDH A;  4DR2 M;  4DR3 M;  4NRV A;  3SAW A;  1KFV A;  1L1T A;  4LF8 M;  4DUZ M;  3SAV A;  3JR4 A;  5LMU M;  1R2Y A;  3U6S A;  1Z5A A;  4GKJ M;  3C58 A;  4JI2 M;  3TWL A;  3U6Q A;  5ITR A;  4KHP M;  5FLX S;  4G4O A;  1J5E M;  4LF7 M;  4DUY M;  5IT9 S;  3TWK A;  1Q3B A;  4DR1 M;  4DV0 M;  1XNR M;  3U6D A;  2F5Q A;  4DR7 M;  3A42 A;  3A46 A;  4JYA M;  1Z59 A;  1L2C A;  3GQ3 A;  4DR5 M;  1L1Z A;  1HNX M;  4DR6 M;  5ITQ A;  4G4Q A;  1K3X A;  4X65 M;  1L2B A;  2UU9 M;  1MX0 A;  1IBK M;  4B3S M;  1R2Z A;  2UUB M;  1L2D A;  1HR0 M;  4DV3 M;  2UUA M;  3U6O A;  1Q39 A;  4K0K M;  4ITQ A;  4JI3 M;  1MU5 A;  3SAU A;  1PJJ A;  4LFC M;  2HHH M;  2Q2E B;  1HNW M;  1IBL M;  3W0F A;  4G4N A;  1XMO M;  1PM5 A;  2F5N A;  3U6L A;  4PDI A;  3JR5 A;  2OQ4 A;  3TWM A;  3J81 S;  1XNQ M;  4OX9 M;  2OPF A;  4YY3 M;  4B3R M;  4PCZ A;  3GP1 A;  3GPP A;  2XZU A;  1TDZ A;  4B3M M;  3SAS A;  3U6P A;  1NNJ A;  4GKK M;  1Z5B A;  5ITY A;  3OTO M;  2E5L M;  5LMN M;  1Z5C A;  3GPX A;  2UXC M;  3SBJ A;  2XZF A;  4PDG A;  4LF6 M;  4LF5 M;  1PJI A;  4DV1 M;  4DV4 M;  3A45 A;  5BR8 M;  2ZBK B;  2VQE M;  4NXM M;  1N34 M;  4DV7 M;  1N33 M;  4MB7 A;  4NRW A;  1K82 A;  1XC8 A;  2F5S A;  4NXN M;  4DV5 M;  5A2Q S;  1I94 M;  3DOA A;  1IBM M;  4LFB M;  4DV2 M;  5ITU A;  1K3W A; 
#chains in the Genus database with same CATH topology
 1MN3 A;  1D0M A;  2HWJ A;  4JN6 A;  4W5W A;  1NJG A;  1CUK A;  1SXJ A;  1N36 M;  2JY7 A;  1QDR A;  1SXJ E;  3QYB A;  3U6E A;  3L27 A;  4M0W A;  3ZQJ A;  3UJN A;  3JAM S;  1WGL A;  2C9C A;  4QHT A;  1T43 A;  1OIP A;  5EXT A;  2UUC M;  4OU7 A;  4LF9 M;  1R5L A;  1S3S A;  3VFD A;  2XFT A;  4D82 A;  1FJG M;  5C1B A;  1N32 M;  1IXZ A;  1EFU B;  1T6O A;  1VDD A;  2DAE A;  5FTJ A;  2DHR A;  2JY8 A;  4R71 A;  1OTR A;  3ZCB B;  1Y8G A;  5EXX A;  4XBO A;  5JI3 E;  2CFO A;  4JI7 M;  2R4E A;  2R18 A;  2QHO B;  3K9O A;  2DAG A;  4JI0 M;  4MGH A;  3CTW B;  4PD2 A;  2CUZ A;  2DWZ B;  3FD9 A;  5ITT A;  1QAO A;  4D80 A;  3C3E A;  3AOG A;  3FKE A;  3HHW A;  1ORY B;  2UXB M;  3NBX X;  2LHC A;  3B89 A;  3KP0 E;  4ZPX A;  4Q7J A;  3PNY A;  4IIW A;  1VEG A;  4AG5 A;  3W68 A;  4DR2 M;  1KFV A;  4IBD A;  1L1T A;  1VG5 A;  4FWH A;  4AI6 A;  1LV7 A;  1OFI A;  3K1J A;  3TE6 A;  2C5R A;  1PJT A;  1XXH A;  3JR4 A;  3K92 A;  5L8R F;  5LMU M;  1XXH E;  1Z5A A;  3NWL A;  1G59 A;  2DAM A;  2G8L A;  3C58 A;  2JY6 B;  1F4I A;  3U6Q A;  4LJ5 A;  1NNU C;  2K6B A;  2XGN A;  4GHL A;  1Q3B A;  4WP2 A;  1TH3 A;  4DR1 M;  2V6Z M;  3L2A A;  4AKI A;  4DR7 M;  3A42 A;  1JB0 F;  1NV8 A;  4R7G A;  4IBC A;  3GLI B;  4JYA M;  1L2C A;  2BNK A;  1LTM A;  1VEK A;  3AV0 A;  3LQQ A;  1QVR A;  3DFZ A;  1R4G A;  1SXJ B;  1UM8 A;  3H4M A;  2WSC F;  3FE3 A;  3SYK A;  5EP4 A;  1MX0 A;  4FW9 A;  4B3S M;  1Z6T A;  3PNV A;  1R2Z A;  2UUB M;  1IN5 A;  3DA1 A;  4XGI A;  4NOO B;  4OVZ A;  3KXE C;  4JI3 M;  3FRI A;  1IY1 A;  1VDL A;  1YE9 A;  3KOY E;  1GJT A;  1HNW M;  1IFY A;  2KEB A;  2L4F A;  1XB2 B;  3E46 A;  3R8F A;  1XMO M;  2N35 A;  1ZMU A;  4WW0 A;  3JR5 A;  4JXJ A;  2L7I A;  1ZQ9 A;  4OX9 M;  2DAI A;  4IBI A;  4TUW A;  4I5S A;  1IXR C;  3IG8 A;  2R65 A;  2R6F A;  2JUJ A;  1IN8 A;  4GIT A;  2LVA A;  5DNY A;  1TDZ A;  2X49 A;  4FWG A;  1N77 A;  3PVS A;  1V33 A;  2JXN A;  5ITY A;  5KPR A;  2CHG A;  2EO2 A;  4RKU F;  2E5L M;  4KOD A;  3BOS A;  3M7G A;  3QWL A;  1DV0 A;  2UXC M;  1QAN A;  4DV4 M;  1NO1 A;  4HLQ A;  2XH9 A;  3THG A;  4MH0 E;  5IZ7 D;  1OAO C;  3RE8 A;  5BR8 M;  4M9X A;  3R9X B;  4NXM M;  2MR9 A;  3GRU A;  4DV7 M;  1N34 M;  1XXH B;  3J27 B;  2O01 F;  2KA6 B;  1XC8 A;  3UMM A;  4FWD A;  4DV5 M;  1E9S A;  5A2Q S;  4LFB M;  2MRO B;  4GKK M;  4II7 A;  8CAT A;  3FUX A;  3U60 A;  3KFU G;  2R0I A;  4X64 M;  1OQY A;  3LVV A;  4LRT A;  3L25 A;  2KDL A;  4CIS A;  1OIZ A;  3SMS A;  1P3Q Q;  1GJS A;  2JP7 A;  2P5T A;  1IM2 A;  3ZC7 B;  3GQ4 A;  3FYD A;  5BPV A;  2VQF M;  4JI5 M;  1QUS A;  4RNA A;  3TL4 X;  1HQC A;  5JI2 E;  5EXS A;  3J7B A;  2M5Z A;  4IBK A;  2D7H A;  4RF1 A;  3U6M A;  3U6C A;  4LJ8 A;  1I4W A;  3FTC A;  1HT2 E;  4GMQ A;  5F3W A;  3FUU A;  3HY5 A;  4KT0 F;  3J80 S;  2FOI C;  3KS4 A;  3HJ8 A;  3T1Y M;  5H37 D;  3AOE C;  2B3T A;  4OVZ B;  3RFW A;  2DWN A;  4X62 M;  2F5O A;  1N75 A;  2JWS A;  1DGH B;  2O25 A;  1H6U A;  2R46 A;  4LZZ A;  3I4V A;  4UN2 B;  4G3O A;  4YHH M;  4FD2 A;  2RGH A;  3HZJ A;  4GH9 A;  2XSZ A;  3GLI A;  2CHV A;  3GLI E;  4DR4 M;  2CV0 A;  3FTE A;  1YSY A;  1VEJ A;  4M9S A;  2RGO A;  1IN4 A;  1NY5 A;  3HX3 A;  4LGY A;  5KQD A;  4AKH A;  2DNA A;  4L8R C;  1TDH A;  3SMP A;  4AKG A;  2QSF X;  2FE8 A;  3D8L A;  2LH0 A;  3B7Z A;  4B7F A;  3SAW A;  4LCB A;  3EIH A;  2FS1 A;  2DWM A;  3RGP A;  4LF8 M;  2K0B X;  4DUZ M;  3E21 A;  2OOA A;  1UFZ A;  3VKH A;  3TWL A;  5ITR A;  2JY5 A;  4KHP M;  1DO0 A;  2D7E A;  3E4R A;  3GRY A;  4I4L A;  1J5E M;  3QYE A;  4MGY E;  3UGJ A;  2CEA A;  1D2N A;  1TH2 A;  2XLJ A;  3L26 A;  1OAI A;  3DZD A;  4PT5 A;  4BLC A;  3U60 B;  1E32 A;  3MHV C;  1HT1 E;  5GKN A;  1HNX M;  3AOE A;  5ITQ A;  2DWL A;  2C98 A;  3WHK A;  1K3X A;  4L6V 6;  3SFZ A;  1L2B A;  5E26 A;  2UU9 M;  3SHF A;  3U61 A;  1ZV1 A;  2YQZ A;  3HU3 A;  3KVW A;  1G8P A;  1PJS A;  1Q39 A;  2QNJ A;  2QP9 X;  2UUA M;  2DHY A;  4ITQ A;  3CF6 E;  4MM3 B;  4GHA A;  3SAU A;  2APL A;  2HHH M;  2QZ4 A;  1AIP C;  2OO9 A;  1TTE A;  2A5Y B;  5EXP A;  5FTL A;  1IBL M;  4QOZ C;  3KS8 A;  2R45 A;  4BB9 A;  3LMM A;  3U6L A;  4B7H A;  2OQ4 A;  4Y28 F;  1IXS B;  2LVP C;  3J81 S;  2Y21 A;  1IQP A;  1XNQ M;  2WSF F;  2LWX A;  4AG6 A;  2H5X A;  4P17 A;  1X37 A;  4IBG A;  4FCT A;  1GAB A;  1T3T A;  3HWS A;  2J5Y A;  2L7H A;  3I04 M;  3GPP A;  2XZU A;  3KP1 E;  2JZ1 A;  3HHY A;  3KSX A;  4KLN A;  5EP3 A;  3GLF A;  5E6J A;  2HL7 A;  3GLF E;  3KSJ A;  3OTO M;  3Q8G A;  3KOX E;  2KHH A;  3EIE A;  1GO5 A;  3T15 A;  1QZM A;  3AL0 C;  3KDS E;  4R3D A;  2R62 A;  1DO2 A;  1A5T A;  1C7Y A;  3HKP A;  3M0E A;  1DGH A;  2L2D A;  2Y0Q A;  1D0L A;  2KXE A;  2M60 A;  3CF2 A;  4KO8 A;  1K82 A;  2XEP A;  1IBM M;  3J2P B;  3TQS A;  2CRU A;  3DOA A;  5EP2 A;  3PXG A;  4LJ4 A;  4DV2 M;  1K3W A;  1QUT A;  1QDT A;  3H4J A;  3L28 A;  4LJA A;  3WHL A;  3NBI A;  4B7G A;  3GRV A;  3UZU A;  3VK8 A;  1G4A E;  3AKZ A;  4L4U A;  2L6O A;  4LF4 M;  4IJE A;  3GRR A;  3LCV B;  4LJ9 A;  5DYG A;  2Z3X A;  4JI6 M;  2BJW A;  3SAR A;  2ZM6 M;  4XK8 F;  3MK6 A;  1GL6 A;  1KYI A;  3V76 A;  3ZH9 B;  3GPU A;  1EE8 A;  4G4R A;  3U61 B;  1OFH A;  3B7Q A;  2QEN A;  2C96 A;  2JZ0 A;  1JR3 D;  3W0L B;  3I51 A;  2QBY A;  4IBF A;  2HKJ A;  2DZL A;  1MJG M;  1PRB A;  1QAQ A;  5ITX A;  4JV5 M;  2EKF A;  5ITX E;  3K8Z A;  1SG9 A;  1DGF A;  2XF3 A;  4MGZ E;  1OKS A;  3T38 A;  4B3T M;  1HNZ M;  4DV6 M;  1QAM A;  2FNA A;  4NC6 A;  4S12 A;  2C9O A;  4RF0 A;  3HU2 A;  2F4V M;  2R44 A;  2AHM A;  2Z4S A;  3W67 A;  1WHC A;  2WZJ A;  1Q3C A;  4I81 A;  1GKI A;  2LVN C;  2CE7 A;  4DR3 M;  4NRV A;  5FTM A;  4IBB A;  1ZAE A;  3GLF B;  3IEC A;  1QYR A;  3LCU A;  3SAV A;  3L29 A;  1R2Y A;  5FTN A;  3AFH A;  4JI2 M;  4F1I A;  1AUA A;  1R6B X;  3VKG A;  5FLX S;  4P16 A;  2WSE F;  1IXS A;  1WXQ A;  4G4O A;  1G41 A;  5IT9 S;  1SXJ D;  3I4Y A;  1HQY E;  4NSR A;  1XNR M;  3U6D A;  2F5Q A;  4LJ7 A;  5EP1 A;  3A46 A;  1IY2 A;  2K9D A;  3VDU A;  1PJQ A;  3GQ3 A;  4DR5 M;  1L8Q A;  2K47 A;  3RGS A;  1J09 A;  2DXI A;  4DR6 M;  2LBC A;  2MH8 A;  3U5Z B;  3D8B A;  4X65 M;  3SYL A;  4CHT B;  5DFL A;  5C18 A;  2KNV A;  3LVW A;  1HR0 M;  4QNM A;  3U6O A;  1MU5 A;  2Z8Y M;  2O5R A;  1PJJ A;  2LXE A;  2Q2E B;  1WJ7 A;  1IY0 A;  2QCU A;  2VDB B;  2XFS A;  2ZTD A;  1KSF X;  3W0F A;  2MJ5 B;  3F92 A;  1PM5 A;  3T6P A;  2QBY B;  2LTU A;  2C99 A;  2OPF A;  3HU1 A;  4LG2 A;  3K2L A;  2V1U A;  3HJS A;  4B3R M;  4LJ6 A;  4NL4 H;  2RRU A;  2HAK A;  4PCZ A;  4LGM A;  1NJF A;  4AZF A;  4BBA A;  1WGN A;  2ZTC A;  4B3M M;  2LHG A;  1NNJ A;  1TR8 A;  3E9S A;  5LMN M;  1Z5C A;  2L09 A;  4IJF A;  1VQ1 A;  4PDG A;  2LVQ D;  4M9Z A;  1HJP A;  4GC9 A;  3A45 A;  4G6Z A;  2ZBK B;  2VQE M;  3HGI A;  3BXW A;  3SHG B;  4GRI A;  3A98 B;  1D0K A;  3CF0 A;  4MB7 A;  3HJQ A;  4NRW A;  2DKL A;  4NXN M;  1TF0 B;  3C3D A;  3GLG A;  5KPZ A;  1I94 M;  1C1K A;  5ITU A;  3GLG E;  3Q8X A;  3C9P A;  2G5G X;  3ILK A;  1XWI A;  4AW4 A;  4MGI E;  4JI1 M;  1W5S A;  4L16 A;  4CGY B;  2UXD M;  2G3Q A;  3GPY A;  5EQT A;  1NHW C;  2RKO A;  2F5P A;  2Y0T A;  2CP8 A;  3FTD A;  3MMP A;  2LVO C;  4QNR A;  3VK7 A;  1GLN A;  4X66 M;  2DVW B;  2YNM D;  2CWB A;  4B08 A;  4FCW A;  2J7O A;  5FSW A;  2CHQ A;  2GQF A;  1IN6 A;  2EKK A;  2EA0 A;  3FUW A;  4AQY M;  3GO8 A;  4A3V B;  2ZAN A;  1IN7 A;  3LW5 F;  2V1C A;  3GQ5 A;  3T1H M;  4JI4 M;  4JI8 M;  3HHZ A;  3SAT A;  2VF8 A;  1DGG A;  1W5T A;  5IWA M;  4WUR A;  1NV9 A;  2FFJ A;  2KZS A;  2I7N A;  2CV2 A;  2BWB A;  4MGK E;  3J7A S;  3BBZ A;  1G3I A;  4LFA M;  4I8O A;  3IG5 A;  3U5Z A;  4L15 A;  1XMQ M;  3KOW E;  3MJ5 A;  5IRE B;  1EIJ A;  4GEW A;  2DZO B;  2KNA A;  1RU3 A;  3PFI A;  2EUC A;  5KQ8 A;  1TH4 A;  2X8A A;  3FUV A;  5EJC A;  4CJ6 A;  3UK6 A;  1XHB A;  2LNH C;  2NQ8 C;  2Z4R A;  2BWE A;  3U6S A;  3GLH A;  4IBE A;  4GKJ M;  2MGW A;  2BJV A;  2ERC A;  2HCB A;  2J7N A;  2QQ8 A;  3GLH E;  3FTF A;  1OJL A;  1YLA A;  2KNZ A;  2JNH A;  4L78 A;  4LF7 M;  3TPZ A;  4DUY M;  4ANR A;  3TWK A;  5DYI A;  4DV0 M;  1TGU A;  3GLG B;  5FTK A;  5KPT A;  4M0D A;  1Z59 A;  4IBJ A;  1GL7 A;  3CGW A;  2FH0 A;  3B7N A;  1L1Z A;  1QQW A;  2EJS A;  3VLF B;  3AJI B;  2R4J A;  2VII A;  4G4Q A;  3KOZ E;  2ZAM A;  2X4A A;  2CV1 A;  1V34 A;  1IBK M;  2DEN A;  1Q02 A;  2QPA A;  4HEO A;  1R7R A;  1QZE A;  1FNN A;  3VDP A;  4DV3 M;  1L2D A;  1SXJ C;  2Y20 A;  4K0K M;  1N78 A;  2L4E A;  1G71 A;  4LFC M;  3FRH A;  1YUB A;  3SC3 A;  4EIW A;  4F2L A;  4Z8X A;  2JA2 A;  2Z7J A;  4G4N A;  2DAK A;  2F5N A;  1BVS A;  3B74 A;  5KO3 A;  1JR3 A;  3B9P A;  4PDI A;  3TWM A;  1ZMW A;  1JR3 E;  2XSZ D;  2YFQ A;  2W82 A;  1WR1 B;  2KRU A;  1DGB A;  3FYC A;  1GVN A;  2GNO A;  3K9P A;  3QAU A;  4FCV A;  4OW0 A;  2YR0 A;  1J7K A;  4QOS A;  2OOB A;  2VF7 A;  4CIZ A;  4YY3 M;  4D81 A;  3LQR A;  2KRK A;  3GP1 A;  1V92 A;  1NSF A;  4GC5 A;  3SAS A;  3U6P A;  3FUT A;  1Z5B A;  1WIV A;  2I7P A;  2ZAO A;  4LY6 A;  4HL4 A;  4Z6Y A;  4REZ A;  3GPX A;  3SBJ A;  2D7G A;  2XZF A;  4LF6 M;  1E9R A;  3IHP A;  1NY6 A;  1PGY A;  7CAT A;  4DV1 M;  1PJI A;  4NSO B;  4LF5 M;  3KW6 A;  2DZN B;  4LZJ A;  2H1R A;  1N33 M;  1NVM A;  4QHS A;  1E94 E;  2DI0 A;  4DBG B;  1NHG C;  1ZMV A;  3GLH B;  2F5S A;  3M6A A;  1JQJ C;  2KZU A;  4GIP A;  4LRS A;  2KW0 A;  3I01 M;  4FVM A;  3HHX A; 
#chains in the Genus database with same CATH homology
 4W5W A;  4JN6 A;  1NJG A;  1SXJ A;  1N36 M;  3U6E A;  1SXJ E;  3L27 A;  4M0W A;  3UJN A;  3JAM S;  4QHT A;  2C9C A;  5EXT A;  2UUC M;  4OU7 A;  4LF9 M;  1S3S A;  3VFD A;  2XFT A;  4D82 A;  1FJG M;  5C1B A;  1N32 M;  1IXZ A;  1VDD A;  5FTJ A;  2DHR A;  3ZCB B;  5EXX A;  4XBO A;  5JI3 E;  2CFO A;  4JI7 M;  2R4E A;  2R18 A;  4PD2 A;  4JI0 M;  4MGH A;  3CTW B;  2CUZ A;  2DWZ B;  3FD9 A;  5ITT A;  1QAO A;  4D80 A;  3AOG A;  3FKE A;  3HHW A;  1ORY B;  2UXB M;  3KP0 E;  4ZPX A;  3PNY A;  4IIW A;  4AG5 A;  4DR2 M;  1KFV A;  4IBD A;  1L1T A;  4FWH A;  4AI6 A;  1LV7 A;  1OFI A;  3K1J A;  3TE6 A;  2C5R A;  1XXH A;  3JR4 A;  3K92 A;  5LMU M;  1G59 A;  1Z5A A;  3NWL A;  2G8L A;  3C58 A;  3U6Q A;  4LJ5 A;  1NNU C;  2XGN A;  4GHL A;  1Q3B A;  1TH3 A;  4DR1 M;  2V6Z M;  3L2A A;  4AKI A;  4DR7 M;  3A42 A;  4R7G A;  4IBC A;  3GLI B;  4JYA M;  1L2C A;  2BNK A;  3AV0 A;  3LQQ A;  1QVR A;  3DFZ A;  1SXJ B;  1UM8 A;  3H4M A;  3SYK A;  5EP4 A;  1MX0 A;  4FW9 A;  4B3S M;  1Z6T A;  3PNV A;  1R2Z A;  2UUB M;  1IN5 A;  3DA1 A;  4XGI A;  4NOO B;  4OVZ A;  3KXE C;  4JI3 M;  1IY1 A;  1YE9 A;  3KOY E;  1HNW M;  2KEB A;  3R8F A;  1XMO M;  4WW0 A;  3JR5 A;  4JXJ A;  2L7I A;  1ZQ9 A;  4OX9 M;  4IBI A;  4TUW A;  4I5S A;  1IXR C;  3IG8 A;  2R65 A;  4GIT A;  1IN8 A;  5DNY A;  1TDZ A;  2X49 A;  4FWG A;  1N77 A;  3PVS A;  5ITY A;  5KPR A;  2CHG A;  2EO2 A;  2E5L M;  4KOD A;  3BOS A;  3M7G A;  3QWL A;  2UXC M;  1QAN A;  4DV4 M;  4HLQ A;  2XH9 A;  3THG A;  4MH0 E;  5IZ7 D;  3RE8 A;  5BR8 M;  4M9X A;  3R9X B;  4NXM M;  3GRU A;  1N34 M;  4DV7 M;  1XXH B;  3J27 B;  2KA6 B;  1XC8 A;  3UMM A;  4FWD A;  4DV5 M;  1E9S A;  5A2Q S;  4LFB M;  4GKK M;  4II7 A;  8CAT A;  3FUX A;  3U60 A;  3KFU G;  4X64 M;  3LVV A;  4LRT A;  3L25 A;  4CIS A;  3SMS A;  2P5T A;  1IM2 A;  3ZC7 B;  3GQ4 A;  3FYD A;  5BPV A;  2VQF M;  4JI5 M;  4RNA A;  3TL4 X;  1HQC A;  5JI2 E;  5EXS A;  3J7B A;  2M5Z A;  4IBK A;  2D7H A;  4RF1 A;  3U6M A;  3U6C A;  4LJ8 A;  1I4W A;  3FTC A;  1HT2 E;  4GMQ A;  5F3W A;  3FUU A;  3J80 S;  2FOI C;  3KS4 A;  3HJ8 A;  3T1Y M;  5H37 D;  3AOE C;  4OVZ B;  3RFW A;  2DWN A;  4X62 M;  2F5O A;  1N75 A;  1DGH B;  2R46 A;  1H6U A;  4LZZ A;  4YHH M;  3I4V A;  4FD2 A;  2RGH A;  4GH9 A;  2XSZ A;  3GLI A;  2CHV A;  4DR4 M;  2CV0 A;  3FTE A;  1YSY A;  4M9S A;  2RGO A;  1IN4 A;  1NY5 A;  4LGY A;  5KQD A;  4AKH A;  4L8R C;  1TDH A;  3SMP A;  4AKG A;  3D8L A;  2FE8 A;  3SAW A;  2LH0 A;  4B7F A;  4LCB A;  3EIH A;  2DWM A;  3RGP A;  4LF8 M;  4DUZ M;  3VKH A;  3TWL A;  5ITR A;  4KHP M;  1DO0 A;  2D7E A;  3E4R A;  3GRY A;  4I4L A;  1J5E M;  4MGY E;  3UGJ A;  2CEA A;  1D2N A;  1TH2 A;  2XLJ A;  3L26 A;  3DZD A;  4PT5 A;  4BLC A;  3U60 B;  1E32 A;  3MHV C;  1HT1 E;  5GKN A;  1HNX M;  3AOE A;  5ITQ A;  2DWL A;  2C98 A;  3WHK A;  1K3X A;  3SFZ A;  1L2B A;  5E26 A;  2UU9 M;  3SHF A;  3U61 A;  2YQZ A;  3HU3 A;  3KVW A;  1G8P A;  2QP9 X;  1Q39 A;  2UUA M;  4GHA A;  4ITQ A;  3CF6 E;  4MM3 B;  3SAU A;  2HHH M;  2QZ4 A;  4QOZ C;  2A5Y B;  5EXP A;  5FTL A;  1IBL M;  3KS8 A;  2R45 A;  4BB9 A;  3LMM A;  3U6L A;  4B7H A;  2OQ4 A;  1IXS B;  3J81 S;  2Y21 A;  1IQP A;  1XNQ M;  2LWX A;  4AG6 A;  1X37 A;  4IBG A;  4FCT A;  1T3T A;  3HWS A;  2L7H A;  3GPP A;  2XZU A;  3KP1 E;  3HHY A;  3KSX A;  4KLN A;  5EP3 A;  3GLF A;  5E6J A;  2HL7 A;  3KSJ A;  3OTO M;  3KOX E;  3EIE A;  3T15 A;  1QZM A;  3AL0 C;  3KDS E;  4R3D A;  2R62 A;  1DO2 A;  3HKP A;  3M0E A;  1DGH A;  2Y0Q A;  2KXE A;  2M60 A;  3CF2 A;  4KO8 A;  1K82 A;  2XEP A;  1IBM M;  3J2P B;  3TQS A;  3DOA A;  5EP2 A;  3PXG A;  4DV2 M;  4LJ4 A;  1K3W A;  3L28 A;  4LJA A;  3WHL A;  3NBI A;  4B7G A;  3GRV A;  3UZU A;  3VK8 A;  1G4A E;  3AKZ A;  4L4U A;  2L6O A;  4LF4 M;  4IJE A;  3GRR A;  4LJ9 A;  5DYG A;  2Z3X A;  4JI6 M;  2BJW A;  3SAR A;  2ZM6 M;  3MK6 A;  1GL6 A;  1KYI A;  3U61 B;  3ZH9 B;  3GPU A;  1EE8 A;  4G4R A;  1OFH A;  2QEN A;  2C96 A;  1JR3 D;  3W0L B;  3I51 A;  2QBY A;  4IBF A;  2HKJ A;  4JV5 M;  1QAQ A;  5ITX A;  5ITX E;  3K8Z A;  1DGF A;  2XF3 A;  4MGZ E;  3T38 A;  4B3T M;  1HNZ M;  4DV6 M;  1QAM A;  2FNA A;  4S12 A;  2C9O A;  4RF0 A;  3HU2 A;  2F4V M;  2AHM A;  2Z4S A;  1Q3C A;  4I81 A;  1GKI A;  2CE7 A;  4DR3 M;  4NRV A;  5FTM A;  4IBB A;  1ZAE A;  3GLF B;  1QYR A;  3SAV A;  3L29 A;  1R2Y A;  5FTN A;  3AFH A;  4JI2 M;  1R6B X;  3VKG A;  5FLX S;  4P16 A;  1WXQ A;  4G4O A;  1G41 A;  5IT9 S;  1SXJ D;  3I4Y A;  1HQY E;  4NSR A;  1XNR M;  3U6D A;  2F5Q A;  4LJ7 A;  5EP1 A;  3A46 A;  1IY2 A;  3VDU A;  3GQ3 A;  4DR5 M;  1L8Q A;  2K47 A;  3RGS A;  1J09 A;  2DXI A;  4DR6 M;  3U5Z B;  3D8B A;  4X65 M;  3SYL A;  4CHT B;  5C18 A;  3LVW A;  1HR0 M;  4QNM A;  3U6O A;  1MU5 A;  1PJJ A;  2O5R A;  2LXE A;  2Q2E B;  1IY0 A;  2QCU A;  2XFS A;  1KSF X;  3W0F A;  1PM5 A;  2QBY B;  2C99 A;  2OPF A;  3HU1 A;  4LG2 A;  3K2L A;  2V1U A;  3HJS A;  4B3R M;  4LJ6 A;  4NL4 H;  4PCZ A;  4LGM A;  1NJF A;  4AZF A;  4BBA A;  4B3M M;  1NNJ A;  3E9S A;  5LMN M;  1Z5C A;  2L09 A;  4IJF A;  4PDG A;  4M9Z A;  4GC9 A;  3A45 A;  4G6Z A;  2ZBK B;  2VQE M;  3HGI A;  3SHG B;  4GRI A;  3A98 B;  3CF0 A;  4MB7 A;  3HJQ A;  4NRW A;  4NXN M;  1I94 M;  3GLG A;  5KPZ A;  1C1K A;  5ITU A;  3Q8X A;  2G5G X;  3ILK A;  1XWI A;  4AW4 A;  4MGI E;  4JI1 M;  1W5S A;  4L16 A;  4CGY B;  2UXD M;  3GPY A;  5EQT A;  1NHW C;  2RKO A;  2F5P A;  2Y0T A;  3FTD A;  4QNR A;  3VK7 A;  1GLN A;  4X66 M;  2DVW B;  2YNM D;  4B08 A;  4FCW A;  2J7O A;  5FSW A;  2CHQ A;  1IN6 A;  2EA0 A;  3FUW A;  4AQY M;  3GO8 A;  4A3V B;  2ZAN A;  1IN7 A;  2V1C A;  3GQ5 A;  3T1H M;  4JI4 M;  4JI8 M;  3HHZ A;  3SAT A;  1DGG A;  1W5T A;  5IWA M;  4WUR A;  2FFJ A;  2KZS A;  2I7N A;  2CV2 A;  4MGK E;  3J7A S;  1G3I A;  4LFA M;  4I8O A;  3IG5 A;  3U5Z A;  4L15 A;  1XMQ M;  3KOW E;  3MJ5 A;  5IRE B;  2DZO B;  3PFI A;  2EUC A;  5KQ8 A;  1TH4 A;  2X8A A;  3FUV A;  5EJC A;  3UK6 A;  1XHB A;  2LNH C;  2NQ8 C;  2Z4R A;  3U6S A;  3GLH A;  4IBE A;  4GKJ M;  2J7N A;  2BJV A;  2ERC A;  2HCB A;  3FTF A;  1OJL A;  4L78 A;  4LF7 M;  3TPZ A;  4DUY M;  3TWK A;  5DYI A;  4DV0 M;  1TGU A;  3GLG B;  5FTK A;  5KPT A;  4M0D A;  1Z59 A;  4IBJ A;  1GL7 A;  1L1Z A;  1QQW A;  3VLF B;  3AJI B;  2R4J A;  2VII A;  4G4Q A;  3KOZ E;  2ZAM A;  2X4A A;  2CV1 A;  1IBK M;  2QPA A;  1R7R A;  3VDP A;  1FNN A;  1L2D A;  4DV3 M;  4K0K M;  1SXJ C;  2Y20 A;  1N78 A;  4LFC M;  1YUB A;  3SC3 A;  4EIW A;  4Z8X A;  2JA2 A;  2Z7J A;  4G4N A;  2F5N A;  5KO3 A;  1JR3 A;  3B9P A;  4PDI A;  3TWM A;  2XSZ D;  2YFQ A;  2W82 A;  2KRU A;  1DGB A;  3FYC A;  1GVN A;  3QAU A;  4OW0 A;  4QOS A;  4FCV A;  2YR0 A;  1J7K A;  4YY3 M;  4D81 A;  3LQR A;  2KRK A;  3GP1 A;  1NSF A;  4GC5 A;  3SAS A;  3U6P A;  3FUT A;  1Z5B A;  2I7P A;  2ZAO A;  4LY6 A;  4HL4 A;  4Z6Y A;  4REZ A;  3GPX A;  3SBJ A;  2D7G A;  2XZF A;  4LF6 M;  1E9R A;  4LF5 M;  1NY6 A;  1PJI A;  7CAT A;  4DV1 M;  4NSO B;  3KW6 A;  2DZN B;  4LZJ A;  2H1R A;  1N33 M;  1NVM A;  4QHS A;  1E94 E;  1NHG C;  3GLH B;  2F5S A;  3M6A A;  1JQJ C;  2KZU A;  4GIP A;  4LRS A;  2KW0 A;  4FVM A;  3HHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...