5LMUM

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
molecule tags Ribosome
source organism Thermus thermophilus hb8
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmuM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmuM02
4LF9M 3SBJA 3U6EA 3J81S 1L2CA 4MB7A 2OQ4A 4LFCM 1N34M 2UXBM 4DV6M 3U6PA 3J7AS 4X65M 1L1TA 4PDIA 1HNZM 4DR1M 2UXCM 4KHPM 1K3XA 4G4OA 1L2DA 4G4QA 4CISA 2ZBKB 4YHHM 4DR4M 1PM5A 2ZM6M 1TDHA 3GPPA 4LF8M 1Q3BA 3VK8A 4GKJM 1EE8A 3A42A 3A46A 4DR2M 1XMQM 4NRWA 3GPUA 4NXNM 3GO8A 4K0KM 5IWAM 4X62M 4NRVA 4LF5M 3U6MA 4PCZA 3U6LA 4DV3M 3SAVA 2Q2EB 3JR4A 5ITXA 1Q3CA 4DUYM 2F5QA 5LMNM 1HNXM 2UUBM 4ITQA 2UXDM 1L2BA 2F4VM 3GPYA 4DV1M 3GQ5A 1N33M 4JI6M 2EA0A 1FJGM 1Z5CA 3GQ4A 1R2ZA 1XNRM 4LFBM 5BR8M 3U6QA 4DUZM 4DR3M 1XNQM 4LF4M 5ITUA 2VQFM 1NNJA 1HR0M 4JI7M 4JI3M 4JV5M 1N32M 5LMUM 4DV2M 4PD2A 3GP1A 4OX9M 2OPFA 3SARA 2HHHM 4DV7M 4JI8M 4X66M 4B3TM 4JI0M 4DV0M 4NXMM 5A2QS 2UU9M 3T1YM 2F5OA 1IBMM 2E5LM 3SASA 1IBLM 4DV5M 1K82A 4JI4M 4JI5M 4JI1M 1N36M 4G4NA 3GPXA 1Q39A 1K3WA 3DOAA 5ITTA 1PJIA 4DV4M 2F5PA 1Z5BA 2XZFA 4B3MM 4LFAM 1XC8A 3U6CA 4G4RA 5IT9S 4LF7M 3JR5A 3W0FA 1TDZA 3U6OA 3SAUA 1Z59A 3VK7A 3OTOM 1HNWM 3A45A 1R2YA 4YY3M 4DR7M 1XMOM 1IBKM 4JYAM 4X64M 3U6SA 2F5NA 1KFVA 2UUAM 5ITRA 4GKKM 4B3RM 5FLXS 4B3SM 1L1ZA 1Z5AA 5ITYA 4AQYM 3U6DA 4LF6M 3TWKA 3C58A 2VQEM 1I94M 1MX0A 3SAWA 3GQ3A 3TWLA 4DR6M 1PJJA 2UUCM 5ITXE 2F5SA 3JAMS 3TWMA 1J5EM 3SATA 4DR5M 3T1HM 3J80S 4PDGA 5ITQA 1MU5A 4JI2M 2HKJA 2XZUA
chains in the Genus database with same CATH superfamily
1MJGM 2CE7A 2D7HA 2LVNC 2C9CA 5EP2A 1NV8A 1G71A 3BOSA 1OAIA 3GLFB 2BNKA 3U6EA 3LCUA 1J7KA 2V1UA 4MB7A 3V76A 1WR1B 4L78A 3SMPA 1E9SA 2Y0TA 4LFCM 2UXBM 1DGBA 1WHCA 2XFTA 2DKLA 4B7GA 3AKZA 2FE8A 2MROB 3E9SA 3KXEC 4CISA 2XGNA 2ZM6M 3ZC7B 4Y28F 1R6BX 4M0DA 1TDHA 1UFZA 4NRWA 2XSZD 4I5SA 3GPUA 2QNJA 2L4EA 4L4UA 1NY5A 4X62M 4NRVA 1XXHA 2JY8A 2RRUA 1QANA 4GEWA 5EP4A 2R62A 1ZAEA 2Y0QA 3HGIA 2C5RA 3FTEA 4UN2B 4R7GA 2CRUA 2XH9A 2QQ8A 2DI0A 2ZAMA 2DXIA 3DA1A 1XB2B 2FS1A 2L7IA 5FTMA 5IREB 3FRHA 4OU7A 1IY0A 1TF0B 5FTJA 3KP0E 3W0LB 4FCWA 1Z5CA 3ZQJA 2VF8A 4IJFA 1QUSA 1N78A 3AOEC 5FSWA 1OQYA 4QOZC 5BR8M 4DUZM 2DHRA 1DO2A 2Z4SA 3C3DA 3HU3A 3U60B 2DAEA 3LQRA 2G8LA 3FUWA 2MR9A 4JI7M 2HAKA 1N32M 4DBGB 2K0BX 2DVWB 2OPFA 3MMPA 5EXTA 4HLQA 4LJ4A 3I04M 4CIZA 2CV1A 4AZFA 1R5LA 2FOIC 2MJ5B 1HQYE 2KA6B 4JI8M 1SXJA 1WGNA 4LJ6A 2BWBA 1GJSA 4QNRA 3T1YM 2F5OA 4REZA 5DYIA 2XEPA 2FFJA 4OVZA 2QSFX 4DV5M 3KS8A 3GLHA 3TQSA 4IJEA 4JXJA 4G4NA 1PJQA 2R46A 3H4MA 3KSXA 4LRTA 1K3WA 1Z5BA 2RKOA 1TH4A 4MGKE 3RGSA 2WZJA 4LFAM 1JQJC 3UK6A 4GC5A 3FE3A 3JR5A 4KO8A 1Z6TA 2JXNA 4IBFA 3U6OA 3GLGA 4GMQA 3U5ZB 2Y20A 2OO9A 3K8ZA 2Z7JA 1QVRA 1VEGA 1IBKM 2AHMA 4X64M 1KFVA 2UUAM 1NNUC 4GKKM 3LMMA 5H37D 4B3SM 4QOSA 1IY2A 1FNNA 2KZSA 4GC9A 2EO2A 3LVVA 4II7A 1BVSA 2R65A 3L25A 5FTKA 3TWKA 4S12A 4I81A 1QZEA 1I94M 4FVMA 3CF6E 3GLIB 1G41A 4DR6M 2UUCM 5ITXE 3SATA 1J5EM 2X8AA 2JA2A 5JI2E 1QUTA 2RGHA 4FCTA 1QDRA 2N35A 3K9PA 3HHYA 3A98B 2C96A 4A3VB 4DR5M 1V33A 2QP9X 3J80S 2QENA 4LJAA 2VF7A 1VEKA 1Q02A 4KODA 5DNYA 1NHGC 1IXSB 4L15A 3TPZA 1CUKA 4EIWA 5KPRA 2ZTDA 3SBJA 1N77A 1N75A 2JZ1A 3K2LA 3J81S 3KW6A 4LJ8A 1L2CA 2EUCA 2V1CA 2EKKA 2OQ4A 5C18A 1DGGA 2OOAA 2J5YA 1S3SA 4LJ7A 2I7NA 4LJ9A 1IM2A 5E26A 4PDIA 4X65M 3U5ZA 3J7AS 3KOXE 3J2PB 3KSJA 4G4QA 4G4OA 3KFUG 4YHHM 1D2NA 5JI3E 3L29A 3FUXA 3FTCA 4LF8M 2OOBA 4FWHA 1Q3BA 2KNZA 3A46A 1XMQM 3U61B 1HT2E 1W5SA 3FUVA 1L8QA 3QAUA 1HT1E 3BXWA 3CF2A 5EXSA 5FTNA 3VLFB 4K0KM 3D8LA 5KQ8A 4GKJM 3VKHA 3MHVC 3U6LA 1NJGA 2LHCA 3SYKA 3PNVA 4NSOB 1GABA 4RKUF 2VIIA 2L4FA 1QAQA 4GHLA 4IBJA 3C3EA 1DO0A 3GLHB 1QQWA 2LVQD 3GRYA 4JI6M 1YLAA 1TH3A 3FKEA 1GL6A 4P16A 1PRBA 7CATA 4LFBM 3WHKA 2LHGA 3GLFA 4JN6A 3W67A 2CHGA 5ITUA 1NVMA 3L27A 1NNJA 4JI3M 4JV5M 2LTUA 4ZPXA 1ZMUA 5LMUM 4DV2M 1J09A 2Z8YM 4Q7JA 2KRKA 1LTMA 2HHHM 4DV7M 3AOEA 4B7FA 2X4AA 3I01M 4LGMA 4AI6A 4X66M 3RFWA 2WSCF 4MM3B 3WHLA 2GQFA 5A2QS 2QCUA 4AKGA 1OAOC 3SASA 1IBLM 1E32A 1K82A 4JI4M 5EP3A 1ORYB 3IG5A 2FNAA 3M7GA 1C1KA 2Z4RA 2W82A 5ITTA 4DV4M 2F5PA 3AV0A 2QBYB 2LH0A 3KOZE 2BJWA 1IN6A 1OJLA 1XC8A 4NC6A 5IT9S 3GLIA 1SXJE 3EIEA 3IECA 3EIHA 1DGHA 2JP7A 5EQTA 2WSFF 1GKIA 1VDDA 2XSZA 4Z6YA 1QDTA 1HNWM 2DWZB 2LNHC 3MJ5A 1XMOM 2O25A 4BB9A 4JYAM 1UM8A 3CF0A 4LY6A 2DNAA 2G3QA 3I51A 3M0EA 1L1ZA 3NBIA 3R8FA 5ITYA 4TUWA 1LV7A 5FTLA 3U60A 4AKHA 3HX3A 2I7PA 3C58A 4M9XA 2KNAA 3LW5F 4MGYE 3TWLA 4FW9A 3HY5A 4NSRA 2F5SA 3KOWE 2J7NA 2WSEF 4AG5A 3HU1A 3E4RA 3GLFE 5DYGA 2EJSA 5KO3A 1T43A 2LVPC 3B7NA 4LGYA 2B3TA 1NY6A 3KDSE 2R4JA 2YR0A 3FYCA 3K9OA 4XGIA 3UMMA 3GRVA 1QZMA 2APLA 2CUZA 5EXPA 2HL7A 1SXJD 2CV0A 3VKGA 4IBCA 4WURA 3KS4A 1ZQ9A 1HJPA 2QZ4A 1I4WA 3U6PA 2DAGA 1L1TA 1HNZM 4DR1M 3E46A 2JY5A 4AG6A 4B7HA 2UXCM 1DV0A 3FTFA 3KOYE 1XHBA 2YFQA 2ZBKB 1AUAA 1TR8A 4Z8XA 3I4VA 1JR3E 4GITA 1F4IA 2BJVA 2JWSA 2KHHA 1GJTA 2K9DA 1G3IA 3LQQA 4XK8F 3T6PA 1G8PA 2JNHA 1EE8A 3QYEA 3VK8A 1T6OA 2DWLA 1E94E 1NV9A 2DHYA 1PJTA 1YE9A 3GO8A 2DZNB 3GLGE 3L2AA 2DZLA 3Q8GA 4D80A 5IWAM 4LF5M 5L8RF 2H5XA 3FRIA 3U6MA 3GRRA 4DV3M 5GKNA 3ILKA 3JR4A 3UJNA 5ITXA 1Q3CA 5C1BA 1QAMA 2DZOB 2V6ZM 5LMNM 2L09A 3C9PA 3HWSA 3NWLA 2JZ0A 1HNXM 2CFOA 2YQZA 3ZCBB 2R4EA 2UUBM 4ITQA 2UXDM 4LCBA 1L2BA 3RE8A 2F4VM 3L26A 3HHWA 1PGYA 1WGLA 2L7HA 3TL4X 2O01F 3PFIA 4KT0F 2HCBA 2EA0A 2LWXA 4XBOA 1R2ZA 4IBEA 4R3DA 4OW0A 3U6QA 2ZAOA 3IHPA 4DR3M 3R9XB 3J27B 4KLNA 1XNQM 2DENA 4MGZE 3FYDA 2K47A 5EJCA 4IBBA 1AIPC 1XXHB 3GLGB 1GLNA 2CWBA 1HQCA 3J7BA 1PJSA 4MGIE 3SARA 2L6OA 1G59A 1VG5A 1WIVA 4B3TM 4JI0M 2EKFA 3LVWA 3B89A 3H4JA 1RU3A 1ZV1A 4MGHA 1QAOA 2Y21A 3K92A 2X49A 3HJ8A 3NBXX 4JI1M 1EFUB 1N36M 3B9PA 2ZTCA 2D7GA 1Q39A 4GIPA 1JB0F 2BWEA 4P17A 3HU2A 1OKSA 1X37A 2R45A 3U6CA 5BPVA 4G4RA 4LF7M 3HKPA 4BBAA 3FD9A 5KPTA 4HL4A 1TDZA 4L8RC 4PT5A 3VK7A 4I4LA 4B08A 4DR7M 3A45A 3B74A 1R2YA 2XF3A 1OFHA 2R18A 2QHOB 3MK6A 2K6BA 3KP1E 4B3RM 1IXRC 2CP8A 1IXSA 2KW0A 1Z5AA 3T15A 1C7YA 8CATA 1T3TA 2GNOA 3U6DA 1IN4A 4F2LA 1XXHE 3IG8A 1XWIA 5KQDA 2JY6B 4WW0A 3E21A 4IBGA 4QHSA 3GQ3A 3SAWA 1PJJA 2NQ8C 1TH2A 5KPZA 3JAMS 1IFYA 3QYBA 3TWMA 2LVOC 1JR3D 1MN3A 2MGWA 3LCVB 3HHZA 1KYIA 1JR3A 1GVNA 3TE6A 2P5TA 2CV2A 4PDGA 2H1RA 1D0MA 1Y8GA 3SMSA 4JI2M 3AJIB 2XZUA 1TGUA 4CHTB 1TTEA 4I8OA 1ZMWA 1QYRA 1W5TA 3W68A 2KXEA 4HEOA 1N34M 4L6V6 4FCVA 2Z3XA 4DV6M 1DGFA 2A5YB 2LXEA 3AOGA 4IBKA 1SXJB 1K3XA 2DAIA 1L2DA 4GRIA 4KHPM 1IXZA 4NOOB 4LJ5A 4DR4M 1PM5A 3PVSA 4OVZB 3RGPA 4FWDA 2O5RA 3GPPA 3D8BA 2DWMA 3A42A 1OTRA 2D7EA 4AW4A 4DR2M 1NJFA 3SC3A 4NXNM 1VQ1A 3Q8XA 4W5WA 3FUUA 3PNYA 3CGWA 2JUJA 3B7ZA 2XLJA 1D0LA 1NHWC 4PCZA 1OIZA 1KSFX 4ANRA 3SAVA 5F3WA 4LF9M 4LZJA 2Q2EB 3F92A 2VDBB 1WJ7A 4IBDA 3ZH9B 4DUYM 2F5QA 5IZ7D 1H6UA 4CGYB 4QNMA 3GRUA 4WP2A 2LBCA 4D82A 2RGOA 3GPYA 4DV1M 3GQ5A 1N33M 1FJGM 2KEBA 3KVWA 3M6AA 3HJSA 3GQ4A 2HWJA 2ERCA 4D81A 1XNRM 2J7OA 1IN8A 4F1IA 1NO1A 1YUBA 1SXJC 1OFIA 1VEJA 2M60A 4MH0E 2ZANA 3GLHE 3GLIE 4LF4M 2VQFM 1HR0M 5EP1A 4RNAA 3UZUA 4PD2A 3GP1A 4OX9M 3SYLA 4LG2A 4IIWA 3PXGA 1ZMVA 2QPAA 2DAMA 1NSFA 1IQPA 1A5TA 3SFZA 3L28A 4DV0M 1G4AE 3HZJA 2UU9M 4NXMM 3CTWB 1GO5A 1IBMM 2E5LM 2CEAA 3VFDA 1EIJA 4G6ZA 4JI5M 3BBZA 1WXQA 1V34A 2M5ZA 3B7QA 2XFSA 3GPXA 3SHGB 3I4YA 2JY7A 3AFHA 3DOAA 1PJIA 2L2DA 2XZFA 1IY1A 4B3MM 2FH0A 4LRSA 2C98A 3VDPA 2C9OA 4M9ZA 2DAKA 1R4GA 1E9RA 3DZDA 1OIPA 3W0FA 2DWNA 1SG9A 1YSYA 4G3OA 3SAUA 4GH9A 2KZUA 1Z59A 3OTOM 3AL0C 4YY3M 4RF0A 4AKIA 2CHVA 1IN7A 2KNVA 4FD2A 3VDUA 3U6SA 2F5NA 4LZZA 2LVAA 5E6JA 5ITRA 3THGA 5FLXS 3HHXA 1D0KA 3DFZA 3UGJA 4IBIA 3QWLA 3U61A 1V92A 4M9SA 3K1JA 1R7RA 4AQYM 2QBYA 4LF6M 5DFLA 2YNMD 2R44A 2CHQA 2G5GX 2MH8A 5EXXA 1MX0A 2VQEM 2R0IA 4NL4H 4BLCA 1IN5A 4GHAA 2R6FA 1GL7A 2KRUA 3HJQA 4FWGA 4M0WA 1DGHB 3SHFA 4CJ6A 2KDLA 3T38A 2C99A 3T1HM 3FUTA 4QHTA 5ITQA 4RF1A 1P3QQ 4L16A 1MU5A 3FTDA 2HKJA 1VDLA 4R71A
chains in the Genus database with same CATH topology
2CE7A 2D7HA 4LF9M 2C9CA 5EP2A 3GLFB 3BOSA 2BNKA 3U6EA 1J7KA 2V1UA 4MB7A 4L78A 3SMPA 1E9SA 2Y0TA 4LFCM 2UXBM 1DGBA 2XFTA 4B7GA 3AKZA 2FE8A 3E9SA 3KXEC 4CISA 2XGNA 2ZM6M 3ZC7B 1R6BX 4M0DA 1TDHA 4NRWA 2XSZD 4I5SA 3GPUA 4L4UA 1NY5A 4X62M 4NRVA 1XXHA 1QANA 5EP4A 2R62A 1ZAEA 2Y0QA 3HGIA 2C5RA 3FTEA 4R7GA 2XH9A 2ZAMA 2DXIA 3DA1A 2L7IA 5FTMA 5IREB 4OU7A 1IY0A 5FTJA 3KP0E 3W0LB 4FCWA 1Z5CA 1N78A 4IJFA 3AOEC 5FSWA 4QOZC 5BR8M 4DUZM 2DHRA 1DO2A 2Z4SA 3U60B 3HU3A 3LQRA 2G8LA 3FUWA 4JI7M 1N32M 2DVWB 2OPFA 5EXTA 4HLQA 4LJ4A 2CV1A 4AZFA 2FOIC 2KA6B 4JI8M 1HQYE 1SXJA 4LJ6A 4QNRA 3T1YM 2F5OA 4REZA 5DYIA 2XEPA 2FFJA 4OVZA 4DV5M 3KS8A 3GLHA 3TQSA 4IJEA 4JXJA 4G4NA 2R46A 3H4MA 3KSXA 4LRTA 1K3WA 1Z5BA 2RKOA 1TH4A 4MGKE 3RGSA 4LFAM 1JQJC 3UK6A 4GC5A 3JR5A 4KO8A 1Z6TA 4IBFA 3U6OA 3GLGA 4GMQA 3U5ZB 2Y20A 3K8ZA 2Z7JA 1QVRA 1IBKM 2AHMA 4X64M 1KFVA 2UUAM 1NNUC 4GKKM 3LMMA 5H37D 4B3SM 4QOSA 1IY2A 1FNNA 2KZSA 4GC9A 2EO2A 3LVVA 4II7A 2R65A 3L25A 5FTKA 3TWKA 4S12A 4I81A 1I94M 4FVMA 3CF6E 3GLIB 1G41A 4DR6M 2UUCM 5ITXE 3SATA 1J5EM 2X8AA 2JA2A 5JI2E 4FCTA 2RGHA 3HHYA 4A3VB 3A98B 2C96A 4DR5M 2QP9X 3J80S 2QENA 4LJAA 4KODA 5DNYA 1NHGC 1IXSB 4L15A 3TPZA 4EIWA 5KPRA 1N77A 3SBJA 1N75A 3K2LA 3J81S 3KW6A 4LJ8A 1L2CA 2EUCA 2V1CA 2OQ4A 5C18A 1DGGA 1S3SA 4LJ7A 2I7NA 4LJ9A 1IM2A 5E26A 4PDIA 4X65M 3U5ZA 3J7AS 3KOXE 3J2PB 3KSJA 4G4QA 4G4OA 3KFUG 4YHHM 1D2NA 5JI3E 3L29A 3FUXA 3FTCA 4LF8M 4FWHA 1Q3BA 3A46A 1XMQM 3U61B 1HT2E 1W5SA 3FUVA 1L8QA 3QAUA 1HT1E 3CF2A 5EXSA 5FTNA 3VLFB 4K0KM 3VKHA 3D8LA 5KQ8A 3MHVC 3U6LA 1NJGA 3SYKA 3PNVA 4NSOB 2VIIA 1QAQA 4GHLA 4IBJA 1DO0A 3GLHB 1QQWA 3GRYA 4JI6M 4P16A 1TH3A 3FKEA 1GL6A 7CATA 4LFBM 3WHKA 3GLFA 4JN6A 2CHGA 5ITUA 1NVMA 3L27A 1NNJA 4JI3M 4JV5M 4ZPXA 5LMUM 4DV2M 1J09A 2KRKA 2HHHM 4DV7M 3AOEA 4B7FA 2X4AA 4LGMA 4AI6A 4X66M 3RFWA 4MM3B 3WHLA 5A2QS 2QCUA 4AKGA 3SASA 1IBLM 1E32A 1K82A 4JI4M 5EP3A 1ORYB 3IG5A 2FNAA 3M7GA 1C1KA 2Z4RA 2W82A 5ITTA 4DV4M 2F5PA 3AV0A 2QBYB 2LH0A 3KOZE 2BJWA 1IN6A 1OJLA 1XC8A 5IT9S 3GLIA 1SXJE 3EIEA 3EIHA 1DGHA 5EQTA 4Z6YA 1GKIA 1VDDA 2XSZA 1HNWM 2DWZB 2LNHC 3MJ5A 1XMOM 4BB9A 4JYAM 1UM8A 3CF0A 4LY6A 3I51A 3M0EA 1L1ZA 3NBIA 3R8FA 5ITYA 4TUWA 1LV7A 5FTLA 3U60A 4AKHA 2I7PA 3C58A 4M9XA 4MGYE 3TWLA 4FW9A 4NSRA 2F5SA 3KOWE 2J7NA 4AG5A 3HU1A 3E4RA 5DYGA 5KO3A 4LGYA 1NY6A 3KDSE 2YR0A 2R4JA 3FYCA 4XGIA 3UMMA 3GRVA 1QZMA 2CUZA 3VKGA 5EXPA 2HL7A 1SXJD 2CV0A 4IBCA 4WURA 3KS4A 1ZQ9A 2QZ4A 1I4WA 3U6PA 1L1TA 1HNZM 4DR1M 4AG6A 4B7HA 2UXCM 3FTFA 3KOYE 1XHBA 2YFQA 2ZBKB 4Z8XA 3I4VA 4GITA 2BJVA 1G3IA 3LQQA 2DWLA 3VK8A 1G8PA 4GKJM 1EE8A 1E94E 1YE9A 3GO8A 2DZNB 3L2AA 5IWAM 4D80A 4LF5M 3U6MA 3GRRA 4DV3M 5GKNA 3ILKA 3JR4A 3UJNA 5ITXA 1Q3CA 5C1BA 1QAMA 2DZOB 2V6ZM 5LMNM 2L09A 3HWSA 3NWLA 1HNXM 2UUBM 2CFOA 2YQZA 3ZCBB 2R4EA 4ITQA 2UXDM 4LCBA 1L2BA 3RE8A 2F4VM 3L26A 3HHWA 2EA0A 2L7HA 3TL4X 3PFIA 2HCBA 2LWXA 4XBOA 1R2ZA 4IBEA 4R3DA 4OW0A 3U6QA 2ZAOA 3R9XB 4DR3M 3J27B 4KLNA 1XNQM 4MGZE 3FYDA 2K47A 5EJCA 4IBBA 1XXHB 3GLGB 1GLNA 3J7BA 1HQCA 4MGIE 3SARA 2L6OA 1G59A 4B3TM 4JI0M 3LVWA 4MGHA 1QAOA 2Y21A 3K92A 2X49A 3HJ8A 4JI1M 1N36M 3B9PA 4GIPA 2D7GA 1Q39A 3HU2A 1X37A 2R45A 3U6CA 5BPVA 4G4RA 4LF7M 3HKPA 4BBAA 3FD9A 5KPTA 4HL4A 1TDZA 4L8RC 4PT5A 3VK7A 4I4LA 4B08A 4DR7M 3A45A 1R2YA 2XF3A 1OFHA 2R18A 3MK6A 3KP1E 4B3RM 1IXRC 2KW0A 1Z5AA 3T15A 8CATA 1T3TA 3U6DA 1IN4A 3IG8A 1XWIA 5KQDA 4WW0A 4IBGA 4QHSA 3GQ3A 3SAWA 1PJJA 2NQ8C 1TH2A 5KPZA 3JAMS 3TWMA 3HHZA 1JR3D 1KYIA 1JR3A 1GVNA 3TE6A 2P5TA 2CV2A 4PDGA 2H1RA 3SMSA 4JI2M 3AJIB 2XZUA 1TGUA 4CHTB 4I8OA 1QYRA 1W5TA 2KXEA 1N34M 4FCVA 2Z3XA 4DV6M 1DGFA 2A5YB 2LXEA 3AOGA 4IBKA 1SXJB 1K3XA 4KHPM 1L2DA 4GRIA 1IXZA 4NOOB 4LJ5A 4DR4M 1PM5A 3PVSA 4OVZB 3RGPA 4FWDA 2O5RA 3GPPA 3D8BA 2DWMA 3A42A 2D7EA 4AW4A 4DR2M 1NJFA 3SC3A 4NXNM 3Q8XA 4W5WA 3FUUA 3PNYA 2XLJA 1NHWC 4PCZA 1KSFX 3SAVA 5F3WA 4LZJA 2Q2EB 4IBDA 3ZH9B 4DUYM 2F5QA 5IZ7D 1H6UA 4CGYB 4QNMA 3GRUA 4D82A 2RGOA 3GPYA 4DV1M 3GQ5A 1N33M 1FJGM 2KEBA 3KVWA 3M6AA 3HJSA 3GQ4A 4D81A 2ERCA 1XNRM 2J7OA 1IN8A 1YUBA 2M60A 1SXJC 1OFIA 4MH0E 2ZANA 4LF4M 2VQFM 1HR0M 5EP1A 4RNAA 3UZUA 4PD2A 3GP1A 4OX9M 3SYLA 4LG2A 4IIWA 3PXGA 2QPAA 1NSFA 1IQPA 3SFZA 4DV0M 3L28A 2UU9M 1G4AE 4NXMM 3CTWB 1IBMM 2E5LM 2CEAA 3VFDA 4G6ZA 4JI5M 1WXQA 2M5ZA 2XFSA 3GPXA 3SHGB 3I4YA 3AFHA 3DOAA 1PJIA 2XZFA 1IY1A 4B3MM 4LRSA 2C98A 3VDPA 2C9OA 4M9ZA 3DZDA 1E9RA 2DWNA 3W0FA 1YSYA 3SAUA 4GH9A 2KZUA 1Z59A 3OTOM 3AL0C 4YY3M 4RF0A 4AKIA 2CHVA 1IN7A 4FD2A 3VDUA 3U6SA 2F5NA 4LZZA 5E6JA 5ITRA 3THGA 5FLXS 3HHXA 3DFZA 3UGJA 4IBIA 3QWLA 3U61A 4M9SA 3K1JA 1R7RA 4AQYM 2QBYA 4LF6M 2YNMD 2VQEM 2CHQA 2G5GX 5EXXA 1MX0A 4NL4H 4BLCA 1IN5A 4GHAA 1GL7A 2KRUA 3HJQA 4FWGA 4M0WA 1DGHB 3SHFA 3T38A 2C99A 3T1HM 3FUTA 4QHTA 5ITQA 4RF1A 4L16A 1MU5A 3FTDA 2HKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 M;  3SBJ A;  3U6E A;  3J81 S;  1L2C A;  4MB7 A;  2OQ4 A;  4LFC M;  1N34 M;  2UXB M;  4DV6 M;  3U6P A;  3J7A S;  4X65 M;  1L1T A;  4PDI A;  1HNZ M;  4DR1 M;  2UXC M;  4KHP M;  1K3X A;  4G4O A;  1L2D A;  4G4Q A;  4CIS A;  2ZBK B;  4YHH M;  4DR4 M;  1PM5 A;  2ZM6 M;  1TDH A;  3GPP A;  4LF8 M;  1Q3B A;  3VK8 A;  4GKJ M;  1EE8 A;  3A42 A;  3A46 A;  4DR2 M;  1XMQ M;  4NRW A;  3GPU A;  4NXN M;  3GO8 A;  4K0K M;  5IWA M;  4X62 M;  4NRV A;  4LF5 M;  3U6M A;  4PCZ A;  3U6L A;  4DV3 M;  3SAV A;  2Q2E B;  3JR4 A;  5ITX A;  1Q3C A;  4DUY M;  2F5Q A;  5LMN M;  1HNX M;  2UUB M;  4ITQ A;  2UXD M;  1L2B A;  2F4V M;  3GPY A;  4DV1 M;  3GQ5 A;  1N33 M;  4JI6 M;  2EA0 A;  1FJG M;  1Z5C A;  3GQ4 A;  1R2Z A;  1XNR M;  4LFB M;  5BR8 M;  3U6Q A;  4DUZ M;  4DR3 M;  1XNQ M;  4LF4 M;  5ITU A;  2VQF M;  1NNJ A;  1HR0 M;  4JI7 M;  4JI3 M;  4JV5 M;  1N32 M;  5LMU M;  4DV2 M;  4PD2 A;  3GP1 A;  4OX9 M;  2OPF A;  3SAR A;  2HHH M;  4DV7 M;  4JI8 M;  4X66 M;  4B3T M;  4JI0 M;  4DV0 M;  4NXM M;  5A2Q S;  2UU9 M;  3T1Y M;  2F5O A;  1IBM M;  2E5L M;  3SAS A;  1IBL M;  4DV5 M;  1K82 A;  4JI4 M;  4JI5 M;  4JI1 M;  1N36 M;  4G4N A;  3GPX A;  1Q39 A;  1K3W A;  3DOA A;  5ITT A;  1PJI A;  4DV4 M;  2F5P A;  1Z5B A;  2XZF A;  4B3M M;  4LFA M;  1XC8 A;  3U6C A;  4G4R A;  5IT9 S;  4LF7 M;  3JR5 A;  3W0F A;  1TDZ A;  3U6O A;  3SAU A;  1Z59 A;  3VK7 A;  3OTO M;  1HNW M;  3A45 A;  1R2Y A;  4YY3 M;  4DR7 M;  1XMO M;  1IBK M;  4JYA M;  4X64 M;  3U6S A;  2F5N A;  1KFV A;  2UUA M;  5ITR A;  4GKK M;  4B3R M;  5FLX S;  4B3S M;  1L1Z A;  1Z5A A;  5ITY A;  4AQY M;  3U6D A;  4LF6 M;  3TWK A;  3C58 A;  2VQE M;  1I94 M;  1MX0 A;  3SAW A;  3GQ3 A;  3TWL A;  4DR6 M;  1PJJ A;  2UUC M;  5ITX E;  2F5S A;  3JAM S;  3TWM A;  1J5E M;  3SAT A;  4DR5 M;  3T1H M;  3J80 S;  4PDG A;  5ITQ A;  1MU5 A;  4JI2 M;  2HKJ A;  2XZU A; 
#chains in the Genus database with same CATH topology
 1MJG M;  2CE7 A;  2D7H A;  2LVN C;  2C9C A;  5EP2 A;  1NV8 A;  1G71 A;  3BOS A;  1OAI A;  3GLF B;  2BNK A;  3U6E A;  3LCU A;  1J7K A;  2V1U A;  4MB7 A;  3V76 A;  1WR1 B;  4L78 A;  3SMP A;  1E9S A;  2Y0T A;  4LFC M;  2UXB M;  1DGB A;  1WHC A;  2XFT A;  2DKL A;  4B7G A;  3AKZ A;  2FE8 A;  2MRO B;  3E9S A;  3KXE C;  4CIS A;  2XGN A;  2ZM6 M;  3ZC7 B;  4Y28 F;  1R6B X;  4M0D A;  1TDH A;  1UFZ A;  4NRW A;  2XSZ D;  4I5S A;  3GPU A;  2QNJ A;  2L4E A;  4L4U A;  1NY5 A;  4X62 M;  4NRV A;  1XXH A;  2JY8 A;  2RRU A;  1QAN A;  4GEW A;  5EP4 A;  2R62 A;  1ZAE A;  2Y0Q A;  3HGI A;  2C5R A;  3FTE A;  4UN2 B;  4R7G A;  2CRU A;  2XH9 A;  2QQ8 A;  2DI0 A;  2ZAM A;  2DXI A;  3DA1 A;  1XB2 B;  2FS1 A;  2L7I A;  5FTM A;  5IRE B;  3FRH A;  4OU7 A;  1IY0 A;  1TF0 B;  5FTJ A;  3KP0 E;  3W0L B;  4FCW A;  1Z5C A;  3ZQJ A;  2VF8 A;  4IJF A;  1QUS A;  1N78 A;  3AOE C;  5FSW A;  1OQY A;  4QOZ C;  5BR8 M;  4DUZ M;  2DHR A;  1DO2 A;  2Z4S A;  3C3D A;  3HU3 A;  3U60 B;  2DAE A;  3LQR A;  2G8L A;  3FUW A;  2MR9 A;  4JI7 M;  2HAK A;  1N32 M;  4DBG B;  2K0B X;  2DVW B;  2OPF A;  3MMP A;  5EXT A;  4HLQ A;  4LJ4 A;  3I04 M;  4CIZ A;  2CV1 A;  4AZF A;  1R5L A;  2FOI C;  2MJ5 B;  1HQY E;  2KA6 B;  4JI8 M;  1SXJ A;  1WGN A;  4LJ6 A;  2BWB A;  1GJS A;  4QNR A;  3T1Y M;  2F5O A;  4REZ A;  5DYI A;  2XEP A;  2FFJ A;  4OVZ A;  2QSF X;  4DV5 M;  3KS8 A;  3GLH A;  3TQS A;  4IJE A;  4JXJ A;  4G4N A;  1PJQ A;  2R46 A;  3H4M A;  3KSX A;  4LRT A;  1K3W A;  1Z5B A;  2RKO A;  1TH4 A;  4MGK E;  3RGS A;  2WZJ A;  4LFA M;  1JQJ C;  3UK6 A;  4GC5 A;  3FE3 A;  3JR5 A;  4KO8 A;  1Z6T A;  2JXN A;  4IBF A;  3U6O A;  3GLG A;  4GMQ A;  3U5Z B;  2Y20 A;  2OO9 A;  3K8Z A;  2Z7J A;  1QVR A;  1VEG A;  1IBK M;  2AHM A;  4X64 M;  1KFV A;  2UUA M;  1NNU C;  4GKK M;  3LMM A;  5H37 D;  4B3S M;  4QOS A;  1IY2 A;  1FNN A;  2KZS A;  4GC9 A;  2EO2 A;  3LVV A;  4II7 A;  1BVS A;  2R65 A;  3L25 A;  5FTK A;  3TWK A;  4S12 A;  4I81 A;  1QZE A;  1I94 M;  4FVM A;  3CF6 E;  3GLI B;  1G41 A;  4DR6 M;  2UUC M;  5ITX E;  3SAT A;  1J5E M;  2X8A A;  2JA2 A;  5JI2 E;  1QUT A;  2RGH A;  4FCT A;  1QDR A;  2N35 A;  3K9P A;  3HHY A;  3A98 B;  2C96 A;  4A3V B;  4DR5 M;  1V33 A;  2QP9 X;  3J80 S;  2QEN A;  4LJA A;  2VF7 A;  1VEK A;  1Q02 A;  4KOD A;  5DNY A;  1NHG C;  1IXS B;  4L15 A;  3TPZ A;  1CUK A;  4EIW A;  5KPR A;  2ZTD A;  3SBJ A;  1N77 A;  1N75 A;  2JZ1 A;  3K2L A;  3J81 S;  3KW6 A;  4LJ8 A;  1L2C A;  2EUC A;  2V1C A;  2EKK A;  2OQ4 A;  5C18 A;  1DGG A;  2OOA A;  2J5Y A;  1S3S A;  4LJ7 A;  2I7N A;  4LJ9 A;  1IM2 A;  5E26 A;  4PDI A;  4X65 M;  3U5Z A;  3J7A S;  3KOX E;  3J2P B;  3KSJ A;  4G4Q A;  4G4O A;  3KFU G;  4YHH M;  1D2N A;  5JI3 E;  3L29 A;  3FUX A;  3FTC A;  4LF8 M;  2OOB A;  4FWH A;  1Q3B A;  2KNZ A;  3A46 A;  1XMQ M;  3U61 B;  1HT2 E;  1W5S A;  3FUV A;  1L8Q A;  3QAU A;  1HT1 E;  3BXW A;  3CF2 A;  5EXS A;  5FTN A;  3VLF B;  4K0K M;  3D8L A;  5KQ8 A;  4GKJ M;  3VKH A;  3MHV C;  3U6L A;  1NJG A;  2LHC A;  3SYK A;  3PNV A;  4NSO B;  1GAB A;  4RKU F;  2VII A;  2L4F A;  1QAQ A;  4GHL A;  4IBJ A;  3C3E A;  1DO0 A;  3GLH B;  1QQW A;  2LVQ D;  3GRY A;  4JI6 M;  1YLA A;  1TH3 A;  3FKE A;  1GL6 A;  4P16 A;  1PRB A;  7CAT A;  4LFB M;  3WHK A;  2LHG A;  3GLF A;  4JN6 A;  3W67 A;  2CHG A;  5ITU A;  1NVM A;  3L27 A;  1NNJ A;  4JI3 M;  4JV5 M;  2LTU A;  4ZPX A;  1ZMU A;  5LMU M;  4DV2 M;  1J09 A;  2Z8Y M;  4Q7J A;  2KRK A;  1LTM A;  2HHH M;  4DV7 M;  3AOE A;  4B7F A;  2X4A A;  3I01 M;  4LGM A;  4AI6 A;  4X66 M;  3RFW A;  2WSC F;  4MM3 B;  3WHL A;  2GQF A;  5A2Q S;  2QCU A;  4AKG A;  1OAO C;  3SAS A;  1IBL M;  1E32 A;  1K82 A;  4JI4 M;  5EP3 A;  1ORY B;  3IG5 A;  2FNA A;  3M7G A;  1C1K A;  2Z4R A;  2W82 A;  5ITT A;  4DV4 M;  2F5P A;  3AV0 A;  2QBY B;  2LH0 A;  3KOZ E;  2BJW A;  1IN6 A;  1OJL A;  1XC8 A;  4NC6 A;  5IT9 S;  3GLI A;  1SXJ E;  3EIE A;  3IEC A;  3EIH A;  1DGH A;  2JP7 A;  5EQT A;  2WSF F;  1GKI A;  1VDD A;  2XSZ A;  4Z6Y A;  1QDT A;  1HNW M;  2DWZ B;  2LNH C;  3MJ5 A;  1XMO M;  2O25 A;  4BB9 A;  4JYA M;  1UM8 A;  3CF0 A;  4LY6 A;  2DNA A;  2G3Q A;  3I51 A;  3M0E A;  1L1Z A;  3NBI A;  3R8F A;  5ITY A;  4TUW A;  1LV7 A;  5FTL A;  3U60 A;  4AKH A;  3HX3 A;  2I7P A;  3C58 A;  4M9X A;  2KNA A;  3LW5 F;  4MGY E;  3TWL A;  4FW9 A;  3HY5 A;  4NSR A;  2F5S A;  3KOW E;  2J7N A;  2WSE F;  4AG5 A;  3HU1 A;  3E4R A;  3GLF E;  5DYG A;  2EJS A;  5KO3 A;  1T43 A;  2LVP C;  3B7N A;  4LGY A;  2B3T A;  1NY6 A;  3KDS E;  2R4J A;  2YR0 A;  3FYC A;  3K9O A;  4XGI A;  3UMM A;  3GRV A;  1QZM A;  2APL A;  2CUZ A;  5EXP A;  2HL7 A;  1SXJ D;  2CV0 A;  3VKG A;  4IBC A;  4WUR A;  3KS4 A;  1ZQ9 A;  1HJP A;  2QZ4 A;  1I4W A;  3U6P A;  2DAG A;  1L1T A;  1HNZ M;  4DR1 M;  3E46 A;  2JY5 A;  4AG6 A;  4B7H A;  2UXC M;  1DV0 A;  3FTF A;  3KOY E;  1XHB A;  2YFQ A;  2ZBK B;  1AUA A;  1TR8 A;  4Z8X A;  3I4V A;  1JR3 E;  4GIT A;  1F4I A;  2BJV A;  2JWS A;  2KHH A;  1GJT A;  2K9D A;  1G3I A;  3LQQ A;  4XK8 F;  3T6P A;  1G8P A;  2JNH A;  1EE8 A;  3QYE A;  3VK8 A;  1T6O A;  2DWL A;  1E94 E;  1NV9 A;  2DHY A;  1PJT A;  1YE9 A;  3GO8 A;  2DZN B;  3GLG E;  3L2A A;  2DZL A;  3Q8G A;  4D80 A;  5IWA M;  4LF5 M;  5L8R F;  2H5X A;  3FRI A;  3U6M A;  3GRR A;  4DV3 M;  5GKN A;  3ILK A;  3JR4 A;  3UJN A;  5ITX A;  1Q3C A;  5C1B A;  1QAM A;  2DZO B;  2V6Z M;  5LMN M;  2L09 A;  3C9P A;  3HWS A;  3NWL A;  2JZ0 A;  1HNX M;  2CFO A;  2YQZ A;  3ZCB B;  2R4E A;  2UUB M;  4ITQ A;  2UXD M;  4LCB A;  1L2B A;  3RE8 A;  2F4V M;  3L26 A;  3HHW A;  1PGY A;  1WGL A;  2L7H A;  3TL4 X;  2O01 F;  3PFI A;  4KT0 F;  2HCB A;  2EA0 A;  2LWX A;  4XBO A;  1R2Z A;  4IBE A;  4R3D A;  4OW0 A;  3U6Q A;  2ZAO A;  3IHP A;  4DR3 M;  3R9X B;  3J27 B;  4KLN A;  1XNQ M;  2DEN A;  4MGZ E;  3FYD A;  2K47 A;  5EJC A;  4IBB A;  1AIP C;  1XXH B;  3GLG B;  1GLN A;  2CWB A;  1HQC A;  3J7B A;  1PJS A;  4MGI E;  3SAR A;  2L6O A;  1G59 A;  1VG5 A;  1WIV A;  4B3T M;  4JI0 M;  2EKF A;  3LVW A;  3B89 A;  3H4J A;  1RU3 A;  1ZV1 A;  4MGH A;  1QAO A;  2Y21 A;  3K92 A;  2X49 A;  3HJ8 A;  3NBX X;  4JI1 M;  1EFU B;  1N36 M;  3B9P A;  2ZTC A;  2D7G A;  1Q39 A;  4GIP A;  1JB0 F;  2BWE A;  4P17 A;  3HU2 A;  1OKS A;  1X37 A;  2R45 A;  3U6C A;  5BPV A;  4G4R A;  4LF7 M;  3HKP A;  4BBA A;  3FD9 A;  5KPT A;  4HL4 A;  1TDZ A;  4L8R C;  4PT5 A;  3VK7 A;  4I4L A;  4B08 A;  4DR7 M;  3A45 A;  3B74 A;  1R2Y A;  2XF3 A;  1OFH A;  2R18 A;  2QHO B;  3MK6 A;  2K6B A;  3KP1 E;  4B3R M;  1IXR C;  2CP8 A;  1IXS A;  2KW0 A;  1Z5A A;  3T15 A;  1C7Y A;  8CAT A;  1T3T A;  2GNO A;  3U6D A;  1IN4 A;  4F2L A;  1XXH E;  3IG8 A;  1XWI A;  5KQD A;  2JY6 B;  4WW0 A;  3E21 A;  4IBG A;  4QHS A;  3GQ3 A;  3SAW A;  1PJJ A;  2NQ8 C;  1TH2 A;  5KPZ A;  3JAM S;  1IFY A;  3QYB A;  3TWM A;  2LVO C;  1JR3 D;  1MN3 A;  2MGW A;  3LCV B;  3HHZ A;  1KYI A;  1JR3 A;  1GVN A;  3TE6 A;  2P5T A;  2CV2 A;  4PDG A;  2H1R A;  1D0M A;  1Y8G A;  3SMS A;  4JI2 M;  3AJI B;  2XZU A;  1TGU A;  4CHT B;  1TTE A;  4I8O A;  1ZMW A;  1QYR A;  1W5T A;  3W68 A;  2KXE A;  4HEO A;  1N34 M;  4L6V 6;  4FCV A;  2Z3X A;  4DV6 M;  1DGF A;  2A5Y B;  2LXE A;  3AOG A;  4IBK A;  1SXJ B;  1K3X A;  2DAI A;  1L2D A;  4GRI A;  4KHP M;  1IXZ A;  4NOO B;  4LJ5 A;  4DR4 M;  1PM5 A;  3PVS A;  4OVZ B;  3RGP A;  4FWD A;  2O5R A;  3GPP A;  3D8B A;  2DWM A;  3A42 A;  1OTR A;  2D7E A;  4AW4 A;  4DR2 M;  1NJF A;  3SC3 A;  4NXN M;  1VQ1 A;  3Q8X A;  4W5W A;  3FUU A;  3PNY A;  3CGW A;  2JUJ A;  3B7Z A;  2XLJ A;  1D0L A;  1NHW C;  4PCZ A;  1OIZ A;  1KSF X;  4ANR A;  3SAV A;  5F3W A;  4LF9 M;  4LZJ A;  2Q2E B;  3F92 A;  2VDB B;  1WJ7 A;  4IBD A;  3ZH9 B;  4DUY M;  2F5Q A;  5IZ7 D;  1H6U A;  4CGY B;  4QNM A;  3GRU A;  4WP2 A;  2LBC A;  4D82 A;  2RGO A;  3GPY A;  4DV1 M;  3GQ5 A;  1N33 M;  1FJG M;  2KEB A;  3KVW A;  3M6A A;  3HJS A;  3GQ4 A;  2HWJ A;  2ERC A;  4D81 A;  1XNR M;  2J7O A;  1IN8 A;  4F1I A;  1NO1 A;  1YUB A;  1SXJ C;  1OFI A;  1VEJ A;  2M60 A;  4MH0 E;  2ZAN A;  3GLH E;  3GLI E;  4LF4 M;  2VQF M;  1HR0 M;  5EP1 A;  4RNA A;  3UZU A;  4PD2 A;  3GP1 A;  4OX9 M;  3SYL A;  4LG2 A;  4IIW A;  3PXG A;  1ZMV A;  2QPA A;  2DAM A;  1NSF A;  1IQP A;  1A5T A;  3SFZ A;  3L28 A;  4DV0 M;  1G4A E;  3HZJ A;  2UU9 M;  4NXM M;  3CTW B;  1GO5 A;  1IBM M;  2E5L M;  2CEA A;  3VFD A;  1EIJ A;  4G6Z A;  4JI5 M;  3BBZ A;  1WXQ A;  1V34 A;  2M5Z A;  3B7Q A;  2XFS A;  3GPX A;  3SHG B;  3I4Y A;  2JY7 A;  3AFH A;  3DOA A;  1PJI A;  2L2D A;  2XZF A;  1IY1 A;  4B3M M;  2FH0 A;  4LRS A;  2C98 A;  3VDP A;  2C9O A;  4M9Z A;  2DAK A;  1R4G A;  1E9R A;  3DZD A;  1OIP A;  3W0F A;  2DWN A;  1SG9 A;  1YSY A;  4G3O A;  3SAU A;  4GH9 A;  2KZU A;  1Z59 A;  3OTO M;  3AL0 C;  4YY3 M;  4RF0 A;  4AKI A;  2CHV A;  1IN7 A;  2KNV A;  4FD2 A;  3VDU A;  3U6S A;  2F5N A;  4LZZ A;  2LVA A;  5E6J A;  5ITR A;  3THG A;  5FLX S;  3HHX A;  1D0K A;  3DFZ A;  3UGJ A;  4IBI A;  3QWL A;  3U61 A;  1V92 A;  4M9S A;  3K1J A;  1R7R A;  4AQY M;  2QBY A;  4LF6 M;  5DFL A;  2YNM D;  2R44 A;  2CHQ A;  2G5G X;  2MH8 A;  5EXX A;  1MX0 A;  2VQE M;  2R0I A;  4NL4 H;  4BLC A;  1IN5 A;  4GHA A;  2R6F A;  1GL7 A;  2KRU A;  3HJQ A;  4FWG A;  4M0W A;  1DGH B;  3SHF A;  4CJ6 A;  2KDL A;  3T38 A;  2C99 A;  3T1H M;  3FUT A;  4QHT A;  5ITQ A;  4RF1 A;  1P3Q Q;  4L16 A;  1MU5 A;  3FTD A;  2HKJ A;  1VDL A;  4R71 A; 
#chains in the Genus database with same CATH homology
 2CE7 A;  2D7H A;  4LF9 M;  2C9C A;  5EP2 A;  3GLF B;  3BOS A;  2BNK A;  3U6E A;  1J7K A;  2V1U A;  4MB7 A;  4L78 A;  3SMP A;  1E9S A;  2Y0T A;  4LFC M;  2UXB M;  1DGB A;  2XFT A;  4B7G A;  3AKZ A;  2FE8 A;  3E9S A;  3KXE C;  4CIS A;  2XGN A;  2ZM6 M;  3ZC7 B;  1R6B X;  4M0D A;  1TDH A;  4NRW A;  2XSZ D;  4I5S A;  3GPU A;  4L4U A;  1NY5 A;  4X62 M;  4NRV A;  1XXH A;  1QAN A;  5EP4 A;  2R62 A;  1ZAE A;  2Y0Q A;  3HGI A;  2C5R A;  3FTE A;  4R7G A;  2XH9 A;  2ZAM A;  2DXI A;  3DA1 A;  2L7I A;  5FTM A;  5IRE B;  4OU7 A;  1IY0 A;  5FTJ A;  3KP0 E;  3W0L B;  4FCW A;  1Z5C A;  1N78 A;  4IJF A;  3AOE C;  5FSW A;  4QOZ C;  5BR8 M;  4DUZ M;  2DHR A;  1DO2 A;  2Z4S A;  3U60 B;  3HU3 A;  3LQR A;  2G8L A;  3FUW A;  4JI7 M;  1N32 M;  2DVW B;  2OPF A;  5EXT A;  4HLQ A;  4LJ4 A;  2CV1 A;  4AZF A;  2FOI C;  2KA6 B;  4JI8 M;  1HQY E;  1SXJ A;  4LJ6 A;  4QNR A;  3T1Y M;  2F5O A;  4REZ A;  5DYI A;  2XEP A;  2FFJ A;  4OVZ A;  4DV5 M;  3KS8 A;  3GLH A;  3TQS A;  4IJE A;  4JXJ A;  4G4N A;  2R46 A;  3H4M A;  3KSX A;  4LRT A;  1K3W A;  1Z5B A;  2RKO A;  1TH4 A;  4MGK E;  3RGS A;  4LFA M;  1JQJ C;  3UK6 A;  4GC5 A;  3JR5 A;  4KO8 A;  1Z6T A;  4IBF A;  3U6O A;  3GLG A;  4GMQ A;  3U5Z B;  2Y20 A;  3K8Z A;  2Z7J A;  1QVR A;  1IBK M;  2AHM A;  4X64 M;  1KFV A;  2UUA M;  1NNU C;  4GKK M;  3LMM A;  5H37 D;  4B3S M;  4QOS A;  1IY2 A;  1FNN A;  2KZS A;  4GC9 A;  2EO2 A;  3LVV A;  4II7 A;  2R65 A;  3L25 A;  5FTK A;  3TWK A;  4S12 A;  4I81 A;  1I94 M;  4FVM A;  3CF6 E;  3GLI B;  1G41 A;  4DR6 M;  2UUC M;  5ITX E;  3SAT A;  1J5E M;  2X8A A;  2JA2 A;  5JI2 E;  4FCT A;  2RGH A;  3HHY A;  4A3V B;  3A98 B;  2C96 A;  4DR5 M;  2QP9 X;  3J80 S;  2QEN A;  4LJA A;  4KOD A;  5DNY A;  1NHG C;  1IXS B;  4L15 A;  3TPZ A;  4EIW A;  5KPR A;  1N77 A;  3SBJ A;  1N75 A;  3K2L A;  3J81 S;  3KW6 A;  4LJ8 A;  1L2C A;  2EUC A;  2V1C A;  2OQ4 A;  5C18 A;  1DGG A;  1S3S A;  4LJ7 A;  2I7N A;  4LJ9 A;  1IM2 A;  5E26 A;  4PDI A;  4X65 M;  3U5Z A;  3J7A S;  3KOX E;  3J2P B;  3KSJ A;  4G4Q A;  4G4O A;  3KFU G;  4YHH M;  1D2N A;  5JI3 E;  3L29 A;  3FUX A;  3FTC A;  4LF8 M;  4FWH A;  1Q3B A;  3A46 A;  1XMQ M;  3U61 B;  1HT2 E;  1W5S A;  3FUV A;  1L8Q A;  3QAU A;  1HT1 E;  3CF2 A;  5EXS A;  5FTN A;  3VLF B;  4K0K M;  3VKH A;  3D8L A;  5KQ8 A;  3MHV C;  3U6L A;  1NJG A;  3SYK A;  3PNV A;  4NSO B;  2VII A;  1QAQ A;  4GHL A;  4IBJ A;  1DO0 A;  3GLH B;  1QQW A;  3GRY A;  4JI6 M;  4P16 A;  1TH3 A;  3FKE A;  1GL6 A;  7CAT A;  4LFB M;  3WHK A;  3GLF A;  4JN6 A;  2CHG A;  5ITU A;  1NVM A;  3L27 A;  1NNJ A;  4JI3 M;  4JV5 M;  4ZPX A;  5LMU M;  4DV2 M;  1J09 A;  2KRK A;  2HHH M;  4DV7 M;  3AOE A;  4B7F A;  2X4A A;  4LGM A;  4AI6 A;  4X66 M;  3RFW A;  4MM3 B;  3WHL A;  5A2Q S;  2QCU A;  4AKG A;  3SAS A;  1IBL M;  1E32 A;  1K82 A;  4JI4 M;  5EP3 A;  1ORY B;  3IG5 A;  2FNA A;  3M7G A;  1C1K A;  2Z4R A;  2W82 A;  5ITT A;  4DV4 M;  2F5P A;  3AV0 A;  2QBY B;  2LH0 A;  3KOZ E;  2BJW A;  1IN6 A;  1OJL A;  1XC8 A;  5IT9 S;  3GLI A;  1SXJ E;  3EIE A;  3EIH A;  1DGH A;  5EQT A;  4Z6Y A;  1GKI A;  1VDD A;  2XSZ A;  1HNW M;  2DWZ B;  2LNH C;  3MJ5 A;  1XMO M;  4BB9 A;  4JYA M;  1UM8 A;  3CF0 A;  4LY6 A;  3I51 A;  3M0E A;  1L1Z A;  3NBI A;  3R8F A;  5ITY A;  4TUW A;  1LV7 A;  5FTL A;  3U60 A;  4AKH A;  2I7P A;  3C58 A;  4M9X A;  4MGY E;  3TWL A;  4FW9 A;  4NSR A;  2F5S A;  3KOW E;  2J7N A;  4AG5 A;  3HU1 A;  3E4R A;  5DYG A;  5KO3 A;  4LGY A;  1NY6 A;  3KDS E;  2YR0 A;  2R4J A;  3FYC A;  4XGI A;  3UMM A;  3GRV A;  1QZM A;  2CUZ A;  3VKG A;  5EXP A;  2HL7 A;  1SXJ D;  2CV0 A;  4IBC A;  4WUR A;  3KS4 A;  1ZQ9 A;  2QZ4 A;  1I4W A;  3U6P A;  1L1T A;  1HNZ M;  4DR1 M;  4AG6 A;  4B7H A;  2UXC M;  3FTF A;  3KOY E;  1XHB A;  2YFQ A;  2ZBK B;  4Z8X A;  3I4V A;  4GIT A;  2BJV A;  1G3I A;  3LQQ A;  2DWL A;  3VK8 A;  1G8P A;  4GKJ M;  1EE8 A;  1E94 E;  1YE9 A;  3GO8 A;  2DZN B;  3L2A A;  5IWA M;  4D80 A;  4LF5 M;  3U6M A;  3GRR A;  4DV3 M;  5GKN A;  3ILK A;  3JR4 A;  3UJN A;  5ITX A;  1Q3C A;  5C1B A;  1QAM A;  2DZO B;  2V6Z M;  5LMN M;  2L09 A;  3HWS A;  3NWL A;  1HNX M;  2UUB M;  2CFO A;  2YQZ A;  3ZCB B;  2R4E A;  4ITQ A;  2UXD M;  4LCB A;  1L2B A;  3RE8 A;  2F4V M;  3L26 A;  3HHW A;  2EA0 A;  2L7H A;  3TL4 X;  3PFI A;  2HCB A;  2LWX A;  4XBO A;  1R2Z A;  4IBE A;  4R3D A;  4OW0 A;  3U6Q A;  2ZAO A;  3R9X B;  4DR3 M;  3J27 B;  4KLN A;  1XNQ M;  4MGZ E;  3FYD A;  2K47 A;  5EJC A;  4IBB A;  1XXH B;  3GLG B;  1GLN A;  3J7B A;  1HQC A;  4MGI E;  3SAR A;  2L6O A;  1G59 A;  4B3T M;  4JI0 M;  3LVW A;  4MGH A;  1QAO A;  2Y21 A;  3K92 A;  2X49 A;  3HJ8 A;  4JI1 M;  1N36 M;  3B9P A;  4GIP A;  2D7G A;  1Q39 A;  3HU2 A;  1X37 A;  2R45 A;  3U6C A;  5BPV A;  4G4R A;  4LF7 M;  3HKP A;  4BBA A;  3FD9 A;  5KPT A;  4HL4 A;  1TDZ A;  4L8R C;  4PT5 A;  3VK7 A;  4I4L A;  4B08 A;  4DR7 M;  3A45 A;  1R2Y A;  2XF3 A;  1OFH A;  2R18 A;  3MK6 A;  3KP1 E;  4B3R M;  1IXR C;  2KW0 A;  1Z5A A;  3T15 A;  8CAT A;  1T3T A;  3U6D A;  1IN4 A;  3IG8 A;  1XWI A;  5KQD A;  4WW0 A;  4IBG A;  4QHS A;  3GQ3 A;  3SAW A;  1PJJ A;  2NQ8 C;  1TH2 A;  5KPZ A;  3JAM S;  3TWM A;  3HHZ A;  1JR3 D;  1KYI A;  1JR3 A;  1GVN A;  3TE6 A;  2P5T A;  2CV2 A;  4PDG A;  2H1R A;  3SMS A;  4JI2 M;  3AJI B;  2XZU A;  1TGU A;  4CHT B;  4I8O A;  1QYR A;  1W5T A;  2KXE A;  1N34 M;  4FCV A;  2Z3X A;  4DV6 M;  1DGF A;  2A5Y B;  2LXE A;  3AOG A;  4IBK A;  1SXJ B;  1K3X A;  4KHP M;  1L2D A;  4GRI A;  1IXZ A;  4NOO B;  4LJ5 A;  4DR4 M;  1PM5 A;  3PVS A;  4OVZ B;  3RGP A;  4FWD A;  2O5R A;  3GPP A;  3D8B A;  2DWM A;  3A42 A;  2D7E A;  4AW4 A;  4DR2 M;  1NJF A;  3SC3 A;  4NXN M;  3Q8X A;  4W5W A;  3FUU A;  3PNY A;  2XLJ A;  1NHW C;  4PCZ A;  1KSF X;  3SAV A;  5F3W A;  4LZJ A;  2Q2E B;  4IBD A;  3ZH9 B;  4DUY M;  2F5Q A;  5IZ7 D;  1H6U A;  4CGY B;  4QNM A;  3GRU A;  4D82 A;  2RGO A;  3GPY A;  4DV1 M;  3GQ5 A;  1N33 M;  1FJG M;  2KEB A;  3KVW A;  3M6A A;  3HJS A;  3GQ4 A;  4D81 A;  2ERC A;  1XNR M;  2J7O A;  1IN8 A;  1YUB A;  2M60 A;  1SXJ C;  1OFI A;  4MH0 E;  2ZAN A;  4LF4 M;  2VQF M;  1HR0 M;  5EP1 A;  4RNA A;  3UZU A;  4PD2 A;  3GP1 A;  4OX9 M;  3SYL A;  4LG2 A;  4IIW A;  3PXG A;  2QPA A;  1NSF A;  1IQP A;  3SFZ A;  4DV0 M;  3L28 A;  2UU9 M;  1G4A E;  4NXM M;  3CTW B;  1IBM M;  2E5L M;  2CEA A;  3VFD A;  4G6Z A;  4JI5 M;  1WXQ A;  2M5Z A;  2XFS A;  3GPX A;  3SHG B;  3I4Y A;  3AFH A;  3DOA A;  1PJI A;  2XZF A;  1IY1 A;  4B3M M;  4LRS A;  2C98 A;  3VDP A;  2C9O A;  4M9Z A;  3DZD A;  1E9R A;  2DWN A;  3W0F A;  1YSY A;  3SAU A;  4GH9 A;  2KZU A;  1Z59 A;  3OTO M;  3AL0 C;  4YY3 M;  4RF0 A;  4AKI A;  2CHV A;  1IN7 A;  4FD2 A;  3VDU A;  3U6S A;  2F5N A;  4LZZ A;  5E6J A;  5ITR A;  3THG A;  5FLX S;  3HHX A;  3DFZ A;  3UGJ A;  4IBI A;  3QWL A;  3U61 A;  4M9S A;  3K1J A;  1R7R A;  4AQY M;  2QBY A;  4LF6 M;  2YNM D;  2VQE M;  2CHQ A;  2G5G X;  5EXX A;  1MX0 A;  4NL4 H;  4BLC A;  1IN5 A;  4GHA A;  1GL7 A;  2KRU A;  3HJQ A;  4FWG A;  4M0W A;  1DGH B;  3SHF A;  3T38 A;  2C99 A;  3T1H M;  3FUT A;  4QHT A;  5ITQ A;  4RF1 A;  4L16 A;  1MU5 A;  3FTD A;  2HKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...