5LMUM

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmuM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmuM02
4KHPM 3SASA 4DV3M 4X62M 1PJIA 4JV5M 1Z5AA 4X65M 1K3WA 5LMUM 3SAWA 1L2BA 1L1ZA 4DV1M 3OTOM 3SAUA 2HKJA 1Q3CA 1IBMM 3U6SA 3GQ4A 2F5PA 4LF8M 3U6EA 1XNQM 1HR0M 4DR4M 1L1TA 4JYAM 4DR1M 1Z5CA 4JI0M 3U6OA 4LFBM 3U6MA 2F4VM 1EE8A 4DV2M 2F5OA 2F5QA 1N32M 1Q39A 4G4RA 3GPYA 3SATA 1L2CA 3GQ5A 3C58A 3W0FA 3A46A 1XC8A 2UXBM 4JI3M 1Z59A 5IT9S 4X66M 4JI2M 2XZFA 3A45A 4JI5M 1N34M 3JR4A 2VQEM 2UUBM 2UUCM 1HNZM 4DR6M 5ITTA 3U6DA 3VK7A 5A2QS 2VQFM 4PCZA 5ITQA 2OPFA 3U6LA 1HNWM 1IBKM 2UU9M 4DV6M 4LF5M 1N33M 2Q2EB 1K3XA 1I94M 1PJJA 3SBJA 3GPUA 1N36M 2F5SA 4DR2M 1K82A 1Q3BA 2XZUA 4YY3M 2UXDM 4LF6M 3SAVA 1MU5A 4DUYM 3U6PA 2E5LM 1XNRM 4B3SM 1Z5BA 4X64M 4G4NA 4PDGA 4DUZM 3J80S 4DR7M 4ITQA 4MB7A 3SARA 4NXMM 1MX0A 4JI8M 3VK8A 3T1HM 4JI7M 1L2DA 3JAMS 4DV0M 4NRWA 2EA0A 4CISA 4YHHM 4B3RM 5ITRA 1FJGM 4GKJM 1XMQM 1PM5A 5ITYA 4PDIA 3U6CA 1TDHA 2HHHM 5ITXA 2ZM6M 2UXCM 4NRVA 4NXNM 4GKKM 4B3TM 1R2YA 3GP1A 3TWKA 5FLXS 4DR5M 4LFCM 5BR8M 3GPPA 3U6QA 3DOAA 3J81S 5ITXE 1NNJA 3TWMA 4PD2A 5LMNM 1IBLM 3T1YM 2UUAM 4G4OA 4LFAM 4JI1M 3J7AS 4DR3M 4LF7M 3GQ3A 1TDZA 1KFVA 1R2ZA 5ITUA 2OQ4A 4JI4M 5IWAM 1J5EM 3TWLA 2F5NA 4LF9M 4B3MM 3A42A 4DV5M 4OX9M 1XMOM 4DV7M 3GPXA 1HNXM 4K0KM 2ZBKB 4JI6M 3JR5A 4G4QA 4LF4M 3GO8A 4AQYM 4DV4M
chains in the Genus database with same CATH superfamily
5EXXA 4IBFA 2KNVA 4RKUF 4R71A 1QANA 3CF6E 4I81A 4MGKE 8CATA 1PJIA 3I04M 1XWIA 4AW4A 2G5GX 1GL6A 5LMUM 1K3WA 5FTNA 1ZQ9A 3Q8GA 4DV1M 3VDPA 3R8FA 3SAUA 2EUCA 3FE3A 1IY1A 1ORYB 2QQ8A 4CJ6A 1IBMM 1VDDA 3HU3A 4KT0F 2K0BX 4B7GA 3J2PB 4M9XA 3T6PA 3U6EA 1QZEA 1OIZA 3CTWB 4UN2B 1IY2A 2V6ZM 4W5WA 2RGOA 1Z5CA 1WXQA 2LVNC 2VIIA 3J27B 4JI0M 3VLFB 2F4VM 4LFBM 2X4AA 3MK6A 1HQCA 3HU1A 4LJ6A 4AG6A 1VEGA 3PNYA 1QAMA 4ZPXA 2CWBA 3M6AA 1XC8A 2UXBM 3BXWA 3UJNA 1BVSA 2LVQD 3AKZA 2XFTA 1LV7A 4QNRA 2XZFA 3A45A 1R6BX 4BLCA 2LH0A 4JXJA 1N34M 3L25A 1WGLA 2LTUA 2VQEM 4AKGA 2P5TA 2UUBM 4QHTA 1IN5A 1WHCA 1PJTA 7CATA 3GLGB 3AOGA 3KP0E 2UUCM 5ITTA 3VK7A 1SXJB 4DR6M 2OPFA 5EP4A 4LJ5A 4Z6YA 1HNWM 4IJEA 1GKIA 3ZCBB 1IBKM 1QQWA 4DV6M 5C18A 2Q2EB 2Y21A 3DFZA 3SBJA 1OAIA 3GPUA 4EIWA 1N77A 1TF0B 3K1JA 2OOBA 2B3TA 1TH3A 3B89A 2E5LM 3TQSA 2DAGA 2KEBA 3B74A 4X64M 1DO2A 4G4NA 5C1BA 3U5ZA 3U61A 5FTLA 1HT2E 2I7PA 4ITQA 4MB7A 1EFUB 2EJSA 5JI3E 3KOYE 4M0DA 3VK8A 1G4AE 1WJ7A 2MH8A 3B9PA 3TL4X 4CIZA 1L2DA 1W5TA 1X37A 4JI7M 3KFUG 5DFLA 1Z6TA 4DV0M 4NRWA 1HT1E 2DKLA 3AL0C 3L27A 3LW5F 2EA0A 4YHHM 2FE8A 3H4JA 1FJGM 2ZTDA 1XMQM 3U6CA 1TDHA 1PJQA 1QZMA 2RKOA 3FUUA 3GRVA 2ZM6M 1FNNA 1OQYA 1IN4A 4NRVA 3SHFA 1VEJA 3W0LB 1R2YA 2XFSA 2N35A 1NHGC 5FLXS 4DR5M 1DGHB 2R46A 5BR8M 1QYRA 2BJWA 4XK8F 1YUBA 3FUWA 3KOXE 4M9ZA 1UM8A 1S3SA 5EQTA 2JXNA 2ZAMA 3DZDA 4DR3M 3J7AS 3E4RA 5IZ7D 3MJ5A 1TDZA 2DHRA 2XSZD 4XBOA 4BB9A 3KXEC 4JI4M 2DWLA 1J5EM 3TWLA 5F3WA 4L16A 2F5NA 4LF9M 3L2AA 3A42A 4IBIA 1C7YA 1QUSA 1W5SA 3KSJA 4WP2A 1PJSA 3TPZA 4F2LA 2Y0TA 3GPXA 1D0MA 1LTMA 2WSFF 2EKKA 3CGWA 3I4YA 1TR8A 4DV4M 4KHPM 5FSWA 2C96A 4X62M 1ZMUA 2VDBB 3SMSA 3E46A 1IFYA 4II7A 3F92A 4NL4H 1L1ZA 3PXGA 1GL7A 4TUWA 4Z8XA 2Z4SA 3GRYA 2BWEA 1CUKA 1NY6A 1T43A 2DHYA 3BBZA 4L4UA 4P17A 4B7HA 2F5PA 1XNQM 3C3DA 4DR4M 1L1TA 1YE9A 3L29A 2DWZB 2XLJA 3QWLA 4MGYE 3GLGA 2KNAA 1MJGM 3AV0A 4IJFA 4L15A 4Y28F 4D80A 5KPTA 2DAIA 4DV2M 2F5QA 1D2NA 2O01F 2DENA 2DNAA 1Q39A 2XEPA 2XGNA 5EXPA 4LJ4A 5DYIA 1DO0A 1Z59A 4AG5A 3EIHA 3ZQJA 5KQ8A 1D0KA 4MH0E 3Q8XA 3EIEA 3RE8A 1HNZM 3GLHB 3U6DA 2L4FA 2LWXA 3UZUA 2Z3XA 2L7HA 4OU7A 4AKIA 4GEWA 1OKSA 2JWSA 3NWLA 1OAOC 4D82A 1E9RA 5FTJA 3GLFE 3KDSE 2D7EA 3FTFA 4LCBA 3KS4A 1Q3BA 1ZV1A 2JY6B 2JZ0A 3T38A 2WZJA 3FYCA 2OO9A 4LF6M 1H6UA 3KP1E 2VF8A 2KZUA 2LNHC 4NSRA 3E21A 4DUYM 1HJPA 3E9SA 4B3SM 1TH4A 1VEKA 2LHGA 4WURA 5FTMA 3FTEA 3AJIB 1G41A 5DYGA 3J80S 1QAOA 2HAKA 4AKHA 4ANRA 4B08A 3FTCA 3GLIB 2VF7A 3QYBA 4IIWA 1DGHA 1ZMVA 2BWBA 4LJ9A 4LZJA 4JI8M 3HJ8A 3GLFA 2G3QA 2DWMA 2LBCA 2R44A 2BJVA 3VKHA 3UK6A 3JAMS 1IY0A 1IN6A 2QCUA 3HHXA 3HY5A 5ITRA 2JZ1A 3LMMA 2CEAA 1JR3A 2Z7JA 4GH9A 3RGSA 2LVAA 4DBGB 2HHHM 2KXEA 2L4EA 2CUZA 3KW6A 4KLNA 3FYDA 4P16A 2DAMA 2UXCM 1NJGA 2HWJA 4GKKM 3A98B 2FS1A 1OIPA 3VFDA 3TWKA 4RNAA 4HEOA 4LFCM 3B7NA 1Q02A 1Y8GA 3AFHA 3VDUA 3U6QA 2KNZA 2W82A 3J81S 3TWMA 4PD2A 1IBLM 1IXSB 2UUAM 3IG5A 1E9SA 3IHPA 4M9SA 4FWHA 4D81A 1XXHB 3GQ3A 1GJSA 3SC3A 1NY5A 3L26A 1NJFA 2FH0A 3ILKA 4FWDA 2YFQA 5ITUA 1VG5A 1R2ZA 3C3EA 3QAUA 3M7GA 2XF3A 3K92A 1DGBA 4LG2A 2K9DA 4IBKA 4B3MM 3H4MA 1OJLA 3HU2A 4QNMA 4F1IA 4AI6A 5EXSA 3KVWA 1C1KA 2JY7A 1RU3A 1HNXM 4JI6M 3LCUA 4LF4M 1TGUA 1KYIA 1XB2B 3GRRA 4FCVA 4BBAA 1GJTA 3GO8A 3ZH9B 4AQYM 2J7NA 4LJ8A 2O5RA 3SASA 4DV3M 2O25A 4JV5M 3K9OA 2H5XA 4IBGA 3HJSA 5KPRA 3BOSA 2X8AA 2Z4RA 4OVZB 1L2BA 2KW0A 2CP8A 1I4WA 1IN7A 1OFIA 2HKJA 4NSOB 1Q3CA 2A5YB 3SYKA 2RGHA 1VDLA 3HHZA 1SXJC 4DR1M 3HHYA 1HQYE 3LVVA 2DVWB 3QYEA 3U6MA 3GLHA 1EE8A 1NSFA 4A3VB 1N32M 2XH9A 2CV2A 3WHLA 3SHGB 4WW0A 4MGHA 4RF0A 1IXZA 4I4LA 4L6V6 1N78A 5IT9S 4LGYA 2ZAOA 4MGZE 3GLGE 2QP9X 4GIPA 4R3DA 1SXJE 2KDLA 1SXJD 1NV8A 3JR4A 3FD9A 3W68A 2C5RA 2APLA 4NOOB 2JUJA 2KHHA 2WSCF 4QHSA 2R62A 5GKNA 2KZSA 3U6LA 2VQFM 4PCZA 5ITQA 3FUXA 2DZLA 4I5SA 3C9PA 3FRHA 2R18A 3ZC7B 3GLIA 4LF5M 2CV1A 1N33M 3V76A 2D7GA 3KS8A 1DGGA 1PJJA 2GNOA 2ERCA 3NBIA 4FW9A 5DNYA 1SXJA 4IBJA 4B7FA 1K82A 4OW0A 2XZUA 4YY3M 5EJCA 1UFZA 1E32A 1XXHE 1MU5A 3IECA 4FCWA 2HCBA 3HGIA 4FD2A 3SMPA 1IN8A 1Z5BA 3I4VA 2QSFX 3K9PA 2EKFA 2FFJA 4PDGA 2M60A 3D8BA 2CHVA 3HX3A 1R7RA 4KO8A 4IBBA 3SARA 4LRSA 3RFWA 2V1CA 5KO3A 2M5ZA 3VKGA 2L6OA 2QPAA 3T1HM 4GC5A 3R9XB 3MMPA 3MHVC 1IXSA 1G71A 1KSFX 2KA6B 2CHGA 4LRTA 1V92A 2JP7A 1XXHA 4REZA 5EP3A 3U60B 3T15A 4GKJM 3PNVA 1PRBA 1ZMWA 1PM5A 1QDRA 2YNMD 5ITYA 3DA1A 1R4GA 3PVSA 4PDIA 5ITXA 1YSYA 3KOWE 3FUVA 1G8PA 4NXNM 2KRKA 4HL4A 2LVPC 1GO5A 2LXEA 4B3TM 1JB0F 4KODA 1AUAA 1QUTA 1V34A 1D0LA 1JR3E 2DAEA 4AZFA 1JR3D 2R6FA 3DOAA 3FKEA 1JQJC 2LHCA 1QDTA 2R0IA 2ZANA 4G4OA 4LFAM 4JI1M 1P3QQ 4LF7M 2JA2A 2QENA 1E94E 2MGWA 2Y20A 4LY6A 3HWSA 4OVZA 5IWAM 4FWGA 3CF0A 1TH2A 1OFHA 5EP2A 2J7OA 2QBYB 2QHOB 2YR0A 1XMOM 4DV7M 2MJ5B 2C9CA 2R65A 2I7NA 3SFZA 3JR5A 4RF1A 4LGMA 1G59A 1DV0A 1IXRC 2QNJA 4LJAA 1F4IA 4XGIA 2R4JA 3I51A 4LJ7A 1Z5AA 2CFOA 3CF2A 1PGYA 3K8ZA 5KQDA 3UGJA 1NNUC 2J5YA 4X65M 2L7IA 2Y0QA 2ZTCA 3SAWA 2QZ4A 1WGNA 5BPVA 3OTOM 2DZNB 5E6JA 1NO1A 3UMMA 1QVRA 3GQ4A 3U6SA 4LF8M 5FTKA 2BNKA 1HR0M 1N75A 2CHQA 4NC6A 4JYAM 4G3OA 1YLAA 3L28A 4FVMA 3U6OA 2F5OA 1G3IA 1AIPC 2C99A 1GVNA 1T3TA 4G4RA 1NV9A 3GPYA 2DXIA 1J09A 3HKPA 3THGA 3GQ5A 3C58A 1L2CA 3SATA 4L78A 3W0FA 3A46A 4S12A 4PT5A 4JI3M 2C9OA 4GMQA 3GLHE 4X66M 4JI2M 4QOZC 5EP1A 1V33A 3LQQA 3M0EA 5E26A 1WR1B 3SYLA 4JI5M 3HJQA 3GRUA 1EIJA 1TTEA 3AOEC 3FUTA 1NHWC 3FTDA 2JNHA 5EXTA 1NVMA 1XHBA 2CV0A 3K2LA 5A2QS 3WHKA 1GLNA 5L8RF 3B7QA 4FCTA 2UU9M 3B7ZA 4L8RC 2FNAA 4MM3B 1K3XA 1I94M 2GQFA 5JI2E 1GABA 1N36M 2G8LA 3TE6A 2R45A 2F5SA 4DR2M 4M0WA 2UXDM 4QOSA 4CHTB 3GLIE 2Z8YM 3SAVA 1DGFA 2D7HA 3U60A 3U6PA 4GC9A 3GLFB 1XNRM 2JY5A 2R4EA 1L8QA 2DZOB 2X49A 4DUZM 2FOIC 4DR7M 3LVWA 4GHAA 4I8OA 2K6BA 2LVOC 4NXMM 4GHLA 2OOAA 4IBCA 1MX0A 1ZAEA 2DWNA 1R5LA 3LCVB 3I01M 3W67A 3AOEA 3KOZE 2NQ8C 3IG8A 1SG9A 2RRUA 1IQPA 3J7BA 4CISA 3FRIA 4B3RM 1VQ1A 4LZZA 4R7GA 2MROB 3HZJA 2V1UA 2K47A 4Q7JA 1QAQA 3PFIA 3U61B 3U5ZB 1IM2A 3KSXA 2AHMA 2XSZA 3GP1A 2L2DA 4HLQA 4GRIA 2QBYA 3GPPA 4GITA 4MGIE 1MN3A 5ITXE 1NNJA 5LMNM 3T1YM 1T6OA 2CRUA 1A5TA 2YQZA 2DI0A 4CGYB 4JN6A 1KFVA 2KRUA 2L09A 5KPZA 2OQ4A 4IBDA 3RGPA 2DAKA 5H37D 2CE7A 3NBXX 1WIVA 2HL7A 2MR9A 2EO2A 1OTRA 2H1RA 2JY8A 3D8LA 4G6ZA 4DV5M 3LQRA 4IBEA 4OX9M 4K0KM 2ZBKB 4G4QA 2C98A 2WSEF 3HHWA 1J7KA 5IREB
chains in the Genus database with same CATH topology
5EXXA 4IBFA 1PJIA 1QANA 3CF6E 4I81A 4MGKE 8CATA 1XWIA 4AW4A 2G5GX 1GL6A 5LMUM 1K3WA 5FTNA 1ZQ9A 4DV1M 3VDPA 3R8FA 3SAUA 2EUCA 1IY1A 1ORYB 1IBMM 1VDDA 3HU3A 4B7GA 3U6EA 3J2PB 4M9XA 3CTWB 1IY2A 2V6ZM 4W5WA 2RGOA 1Z5CA 1WXQA 2VIIA 3J27B 4JI0M 3VLFB 2F4VM 4LFBM 2X4AA 3MK6A 1HQCA 3HU1A 4LJ6A 4AG6A 3PNYA 1QAMA 4ZPXA 3M6AA 2UXBM 1XC8A 3UJNA 3AKZA 2XFTA 1LV7A 4QNRA 2XZFA 3A45A 1R6BX 4BLCA 2LH0A 4JXJA 1N34M 3L25A 2VQEM 4AKGA 2P5TA 2UUBM 4QHTA 1IN5A 7CATA 2UUCM 3GLGB 3AOGA 3KP0E 4DR6M 5ITTA 3VK7A 1SXJB 2OPFA 5EP4A 4LJ5A 4Z6YA 1HNWM 4IJEA 1GKIA 3ZCBB 1IBKM 1QQWA 4DV6M 5C18A 2Q2EB 2Y21A 3DFZA 3SBJA 3GPUA 4EIWA 1N77A 3K1JA 1TH3A 2E5LM 3TQSA 2KEBA 4X64M 1DO2A 4G4NA 5C1BA 3U5ZA 3U61A 5FTLA 1HT2E 2I7PA 4ITQA 4MB7A 5JI3E 3KOYE 4M0DA 3VK8A 1G4AE 3TL4X 3B9PA 4JI7M 1L2DA 3KFUG 1W5TA 1X37A 1Z6TA 4DV0M 4NRWA 1HT1E 3AL0C 3L27A 2EA0A 4YHHM 2FE8A 1FJGM 1XMQM 3U6CA 1TDHA 1QZMA 2RKOA 3FUUA 3GRVA 2ZM6M 1FNNA 4NRVA 1IN4A 3SHFA 3W0LB 1R2YA 2XFSA 1NHGC 5FLXS 4DR5M 1DGHB 2R46A 5BR8M 1QYRA 2BJWA 1YUBA 3FUWA 3KOXE 4M9ZA 1UM8A 1S3SA 5EQTA 2ZAMA 3DZDA 4DR3M 3J7AS 3E4RA 5IZ7D 3MJ5A 1TDZA 2DHRA 2XSZD 4XBOA 4BB9A 3KXEC 4JI4M 2DWLA 1J5EM 3TWLA 5F3WA 4L16A 2F5NA 4LF9M 3L2AA 3A42A 4IBIA 1W5SA 3KSJA 3TPZA 3GPXA 2Y0TA 3I4YA 4DV4M 4KHPM 5FSWA 2C96A 4X62M 3SMSA 4II7A 4NL4H 1L1ZA 3PXGA 1GL7A 4TUWA 4Z8XA 2Z4SA 3GRYA 1NY6A 4L4UA 4B7HA 2F5PA 1XNQM 4DR4M 1L1TA 1YE9A 3L29A 2DWZB 2XLJA 3QWLA 4MGYE 3GLGA 3AV0A 4IJFA 4L15A 4DV2M 2F5QA 4D80A 5KPTA 1D2NA 2XGNA 1Q39A 2XEPA 5EXPA 4LJ4A 5DYIA 1DO0A 1Z59A 4AG5A 3EIHA 5KQ8A 4MH0E 3Q8XA 3EIEA 3RE8A 1HNZM 3GLHB 3U6DA 2LWXA 3UZUA 2Z3XA 2L7HA 4OU7A 4AKIA 3NWLA 4D82A 1E9RA 5FTJA 3KDSE 2D7EA 3FTFA 4LCBA 3KS4A 1Q3BA 3T38A 3FYCA 4LF6M 1H6UA 3KP1E 4NSRA 2KZUA 2LNHC 4DUYM 3E9SA 4B3SM 1TH4A 4WURA 5FTMA 3FTEA 3AJIB 1G41A 5DYGA 3J80S 1QAOA 4AKHA 4B08A 3FTCA 3GLIB 4IIWA 1DGHA 4LJ9A 4LZJA 4JI8M 3HJ8A 3GLFA 2DWMA 2BJVA 3VKHA 3UK6A 3JAMS 1IY0A 1IN6A 2QCUA 3HHXA 5ITRA 3LMMA 3RGSA 2CEAA 1JR3A 2Z7JA 4GH9A 2HHHM 2KXEA 3KW6A 2CUZA 4KLNA 4P16A 3FYDA 2UXCM 1NJGA 4GKKM 3A98B 3VFDA 3TWKA 4RNAA 4LFCM 3AFHA 3U6QA 3VDUA 2W82A 3J81S 3TWMA 4PD2A 1IBLM 1IXSB 2UUAM 1E9SA 4M9SA 4FWHA 4D81A 1XXHB 3GQ3A 3SC3A 1NY5A 3L26A 1NJFA 3ILKA 4FWDA 2YFQA 5ITUA 1R2ZA 3QAUA 3M7GA 2XF3A 3K92A 1DGBA 4LG2A 4B3MM 4IBKA 3H4MA 1OJLA 3HU2A 4QNMA 4AI6A 5EXSA 3KVWA 1C1KA 1HNXM 4JI6M 4LF4M 1TGUA 1KYIA 3GRRA 4FCVA 4BBAA 3GO8A 3ZH9B 4AQYM 2J7NA 4LJ8A 2O5RA 3SASA 4DV3M 4JV5M 4IBGA 3HJSA 5KPRA 3BOSA 2X8AA 2Z4RA 4OVZB 1L2BA 2KW0A 1I4WA 1IN7A 1OFIA 2HKJA 4NSOB 1Q3CA 2A5YB 3SYKA 2RGHA 3HHZA 1SXJC 4DR1M 3HHYA 1HQYE 3LVVA 2DVWB 3U6MA 3GLHA 1EE8A 1NSFA 4A3VB 1N32M 2XH9A 2CV2A 3WHLA 3SHGB 4WW0A 4MGHA 4RF0A 1IXZA 4I4LA 1N78A 5IT9S 4LGYA 2ZAOA 4MGZE 2QP9X 4GIPA 4R3DA 1SXJE 1SXJD 3JR4A 3FD9A 2C5RA 4NOOB 4QHSA 2R62A 5GKNA 2KZSA 3U6LA 2VQFM 4PCZA 5ITQA 3FUXA 4I5SA 2R18A 3ZC7B 3GLIA 4LF5M 2CV1A 1N33M 2D7GA 3KS8A 1DGGA 1PJJA 2ERCA 3NBIA 4FW9A 5DNYA 1SXJA 4IBJA 4B7FA 1K82A 4OW0A 2XZUA 4YY3M 5EJCA 1E32A 4FCWA 1MU5A 2HCBA 3HGIA 4FD2A 3SMPA 1IN8A 1Z5BA 3I4VA 4PDGA 2FFJA 2M60A 3D8BA 2CHVA 1R7RA 3HHWA 4IBBA 4KO8A 3SARA 4LRSA 3RFWA 2V1CA 5KO3A 2M5ZA 3VKGA 2L6OA 2QPAA 3T1HM 4GC5A 3R9XB 3MHVC 1KSFX 2KA6B 2CHGA 4LRTA 1XXHA 4REZA 5EP3A 3U60B 3T15A 4GKJM 3PNVA 1PM5A 2YNMD 5ITYA 3DA1A 3PVSA 4PDIA 5ITXA 1YSYA 3KOWE 3FUVA 1G8PA 4NXNM 2KRKA 4HL4A 2LXEA 4B3TM 4KODA 4AZFA 1JR3D 3FKEA 3DOAA 1JQJC 2ZANA 4G4OA 4LFAM 4JI1M 4LF7M 2JA2A 2QENA 1E94E 2Y20A 4LY6A 3HWSA 4OVZA 5IWAM 4FWGA 3CF0A 1TH2A 1OFHA 5EP2A 2J7OA 2QBYB 2YR0A 1XMOM 4DV7M 2C9CA 2R65A 2I7NA 3SFZA 3JR5A 4RF1A 4LGMA 1G59A 1IXRC 4LJAA 4XGIA 2R4JA 3I51A 4LJ7A 1Z5AA 2CFOA 3CF2A 3K8ZA 5KQDA 3UGJA 4X65M 1NNUC 3SAWA 2L7IA 2Y0QA 2QZ4A 5BPVA 3OTOM 2DZNB 5E6JA 3UMMA 1QVRA 3GQ4A 3U6SA 4LF8M 5FTKA 2BNKA 1HR0M 1N75A 2CHQA 4JYAM 3L28A 4FVMA 3U6OA 2F5OA 1G3IA 2C99A 1GVNA 1T3TA 4G4RA 3GPYA 3SATA 2DXIA 1J09A 3HKPA 3THGA 3GQ5A 3C58A 1L2CA 4L78A 3W0FA 3A46A 4S12A 4PT5A 4JI3M 2C9OA 4GMQA 4X66M 4JI2M 4QOZC 5EP1A 3LQQA 3M0EA 5E26A 3SYLA 4JI5M 3HJQA 3GRUA 3AOEC 3FUTA 1NHWC 3FTDA 5EXTA 1NVMA 1XHBA 2CV0A 3K2LA 5A2QS 3WHKA 1GLNA 4FCTA 2UU9M 4L8RC 2FNAA 4MM3B 1K3XA 1I94M 5JI2E 1N36M 2G8LA 3TE6A 2R45A 2F5SA 4DR2M 4M0WA 2UXDM 4QOSA 4CHTB 3SAVA 1DGFA 2D7HA 3U60A 3U6PA 4GC9A 3GLFB 1XNRM 2R4EA 1L8QA 2DZOB 2X49A 4DUZM 2FOIC 4DR7M 3LVWA 4GHAA 4I8OA 4NXMM 4GHLA 4IBCA 1MX0A 1ZAEA 2DWNA 3AOEA 3KOZE 2NQ8C 3IG8A 1IQPA 3J7BA 4CISA 4B3RM 4LZZA 4R7GA 2V1UA 2K47A 1QAQA 3PFIA 3U61B 3U5ZB 1IM2A 3KSXA 2AHMA 2XSZA 3GP1A 4HLQA 2QBYA 4GRIA 3GPPA 4GITA 4MGIE 5ITXE 1NNJA 5LMNM 3T1YM 2YQZA 4CGYB 4JN6A 1KFVA 2KRUA 2L09A 5KPZA 2OQ4A 4IBDA 3RGPA 5H37D 2CE7A 2HL7A 3D8LA 2EO2A 2H1RA 4G6ZA 4DV5M 4OX9M 3LQRA 4IBEA 4K0KM 2ZBKB 4G4QA 2C98A 3IG5A 1J7KA 5IREB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP M;  3SAS A;  4DV3 M;  4X62 M;  1PJI A;  4JV5 M;  1Z5A A;  4X65 M;  1K3W A;  5LMU M;  3SAW A;  1L2B A;  1L1Z A;  4DV1 M;  3OTO M;  3SAU A;  2HKJ A;  1Q3C A;  1IBM M;  3U6S A;  3GQ4 A;  2F5P A;  4LF8 M;  3U6E A;  1XNQ M;  1HR0 M;  4DR4 M;  1L1T A;  4JYA M;  4DR1 M;  1Z5C A;  4JI0 M;  3U6O A;  4LFB M;  3U6M A;  2F4V M;  1EE8 A;  4DV2 M;  2F5O A;  2F5Q A;  1N32 M;  1Q39 A;  4G4R A;  3GPY A;  3SAT A;  1L2C A;  3GQ5 A;  3C58 A;  3W0F A;  3A46 A;  1XC8 A;  2UXB M;  4JI3 M;  1Z59 A;  5IT9 S;  4X66 M;  4JI2 M;  2XZF A;  3A45 A;  4JI5 M;  1N34 M;  3JR4 A;  2VQE M;  2UUB M;  2UUC M;  1HNZ M;  4DR6 M;  5ITT A;  3U6D A;  3VK7 A;  5A2Q S;  2VQF M;  4PCZ A;  5ITQ A;  2OPF A;  3U6L A;  1HNW M;  1IBK M;  2UU9 M;  4DV6 M;  4LF5 M;  1N33 M;  2Q2E B;  1K3X A;  1I94 M;  1PJJ A;  3SBJ A;  3GPU A;  1N36 M;  2F5S A;  4DR2 M;  1K82 A;  1Q3B A;  2XZU A;  4YY3 M;  2UXD M;  4LF6 M;  3SAV A;  1MU5 A;  4DUY M;  3U6P A;  2E5L M;  1XNR M;  4B3S M;  1Z5B A;  4X64 M;  4G4N A;  4PDG A;  4DUZ M;  3J80 S;  4DR7 M;  4ITQ A;  4MB7 A;  3SAR A;  4NXM M;  1MX0 A;  4JI8 M;  3VK8 A;  3T1H M;  4JI7 M;  1L2D A;  3JAM S;  4DV0 M;  4NRW A;  2EA0 A;  4CIS A;  4YHH M;  4B3R M;  5ITR A;  1FJG M;  4GKJ M;  1XMQ M;  1PM5 A;  5ITY A;  4PDI A;  3U6C A;  1TDH A;  2HHH M;  5ITX A;  2ZM6 M;  2UXC M;  4NRV A;  4NXN M;  4GKK M;  4B3T M;  1R2Y A;  3GP1 A;  3TWK A;  5FLX S;  4DR5 M;  4LFC M;  5BR8 M;  3GPP A;  3U6Q A;  3DOA A;  3J81 S;  5ITX E;  1NNJ A;  3TWM A;  4PD2 A;  5LMN M;  1IBL M;  3T1Y M;  2UUA M;  4G4O A;  4LFA M;  4JI1 M;  3J7A S;  4DR3 M;  4LF7 M;  3GQ3 A;  1TDZ A;  1KFV A;  1R2Z A;  5ITU A;  2OQ4 A;  4JI4 M;  5IWA M;  1J5E M;  3TWL A;  2F5N A;  4LF9 M;  4B3M M;  3A42 A;  4DV5 M;  4OX9 M;  1XMO M;  4DV7 M;  3GPX A;  1HNX M;  4K0K M;  2ZBK B;  4JI6 M;  3JR5 A;  4G4Q A;  4LF4 M;  3GO8 A;  4AQY M;  4DV4 M; 
#chains in the Genus database with same CATH topology
 5EXX A;  4IBF A;  2KNV A;  4RKU F;  4R71 A;  1QAN A;  3CF6 E;  4I81 A;  4MGK E;  8CAT A;  1PJI A;  3I04 M;  1XWI A;  4AW4 A;  2G5G X;  1GL6 A;  5LMU M;  1K3W A;  5FTN A;  1ZQ9 A;  3Q8G A;  4DV1 M;  3VDP A;  3R8F A;  3SAU A;  2EUC A;  3FE3 A;  1IY1 A;  1ORY B;  2QQ8 A;  4CJ6 A;  1IBM M;  1VDD A;  3HU3 A;  4KT0 F;  2K0B X;  4B7G A;  3J2P B;  4M9X A;  3T6P A;  3U6E A;  1QZE A;  1OIZ A;  3CTW B;  4UN2 B;  1IY2 A;  2V6Z M;  4W5W A;  2RGO A;  1Z5C A;  1WXQ A;  2LVN C;  2VII A;  3J27 B;  4JI0 M;  3VLF B;  2F4V M;  4LFB M;  2X4A A;  3MK6 A;  1HQC A;  3HU1 A;  4LJ6 A;  4AG6 A;  1VEG A;  3PNY A;  1QAM A;  4ZPX A;  2CWB A;  3M6A A;  1XC8 A;  2UXB M;  3BXW A;  3UJN A;  1BVS A;  2LVQ D;  3AKZ A;  2XFT A;  1LV7 A;  4QNR A;  2XZF A;  3A45 A;  1R6B X;  4BLC A;  2LH0 A;  4JXJ A;  1N34 M;  3L25 A;  1WGL A;  2LTU A;  2VQE M;  4AKG A;  2P5T A;  2UUB M;  4QHT A;  1IN5 A;  1WHC A;  1PJT A;  7CAT A;  3GLG B;  3AOG A;  3KP0 E;  2UUC M;  5ITT A;  3VK7 A;  1SXJ B;  4DR6 M;  2OPF A;  5EP4 A;  4LJ5 A;  4Z6Y A;  1HNW M;  4IJE A;  1GKI A;  3ZCB B;  1IBK M;  1QQW A;  4DV6 M;  5C18 A;  2Q2E B;  2Y21 A;  3DFZ A;  3SBJ A;  1OAI A;  3GPU A;  4EIW A;  1N77 A;  1TF0 B;  3K1J A;  2OOB A;  2B3T A;  1TH3 A;  3B89 A;  2E5L M;  3TQS A;  2DAG A;  2KEB A;  3B74 A;  4X64 M;  1DO2 A;  4G4N A;  5C1B A;  3U5Z A;  3U61 A;  5FTL A;  1HT2 E;  2I7P A;  4ITQ A;  4MB7 A;  1EFU B;  2EJS A;  5JI3 E;  3KOY E;  4M0D A;  3VK8 A;  1G4A E;  1WJ7 A;  2MH8 A;  3B9P A;  3TL4 X;  4CIZ A;  1L2D A;  1W5T A;  1X37 A;  4JI7 M;  3KFU G;  5DFL A;  1Z6T A;  4DV0 M;  4NRW A;  1HT1 E;  2DKL A;  3AL0 C;  3L27 A;  3LW5 F;  2EA0 A;  4YHH M;  2FE8 A;  3H4J A;  1FJG M;  2ZTD A;  1XMQ M;  3U6C A;  1TDH A;  1PJQ A;  1QZM A;  2RKO A;  3FUU A;  3GRV A;  2ZM6 M;  1FNN A;  1OQY A;  1IN4 A;  4NRV A;  3SHF A;  1VEJ A;  3W0L B;  1R2Y A;  2XFS A;  2N35 A;  1NHG C;  5FLX S;  4DR5 M;  1DGH B;  2R46 A;  5BR8 M;  1QYR A;  2BJW A;  4XK8 F;  1YUB A;  3FUW A;  3KOX E;  4M9Z A;  1UM8 A;  1S3S A;  5EQT A;  2JXN A;  2ZAM A;  3DZD A;  4DR3 M;  3J7A S;  3E4R A;  5IZ7 D;  3MJ5 A;  1TDZ A;  2DHR A;  2XSZ D;  4XBO A;  4BB9 A;  3KXE C;  4JI4 M;  2DWL A;  1J5E M;  3TWL A;  5F3W A;  4L16 A;  2F5N A;  4LF9 M;  3L2A A;  3A42 A;  4IBI A;  1C7Y A;  1QUS A;  1W5S A;  3KSJ A;  4WP2 A;  1PJS A;  3TPZ A;  4F2L A;  2Y0T A;  3GPX A;  1D0M A;  1LTM A;  2WSF F;  2EKK A;  3CGW A;  3I4Y A;  1TR8 A;  4DV4 M;  4KHP M;  5FSW A;  2C96 A;  4X62 M;  1ZMU A;  2VDB B;  3SMS A;  3E46 A;  1IFY A;  4II7 A;  3F92 A;  4NL4 H;  1L1Z A;  3PXG A;  1GL7 A;  4TUW A;  4Z8X A;  2Z4S A;  3GRY A;  2BWE A;  1CUK A;  1NY6 A;  1T43 A;  2DHY A;  3BBZ A;  4L4U A;  4P17 A;  4B7H A;  2F5P A;  1XNQ M;  3C3D A;  4DR4 M;  1L1T A;  1YE9 A;  3L29 A;  2DWZ B;  2XLJ A;  3QWL A;  4MGY E;  3GLG A;  2KNA A;  1MJG M;  3AV0 A;  4IJF A;  4L15 A;  4Y28 F;  4D80 A;  5KPT A;  2DAI A;  4DV2 M;  2F5Q A;  1D2N A;  2O01 F;  2DEN A;  2DNA A;  1Q39 A;  2XEP A;  2XGN A;  5EXP A;  4LJ4 A;  5DYI A;  1DO0 A;  1Z59 A;  4AG5 A;  3EIH A;  3ZQJ A;  5KQ8 A;  1D0K A;  4MH0 E;  3Q8X A;  3EIE A;  3RE8 A;  1HNZ M;  3GLH B;  3U6D A;  2L4F A;  2LWX A;  3UZU A;  2Z3X A;  2L7H A;  4OU7 A;  4AKI A;  4GEW A;  1OKS A;  2JWS A;  3NWL A;  1OAO C;  4D82 A;  1E9R A;  5FTJ A;  3GLF E;  3KDS E;  2D7E A;  3FTF A;  4LCB A;  3KS4 A;  1Q3B A;  1ZV1 A;  2JY6 B;  2JZ0 A;  3T38 A;  2WZJ A;  3FYC A;  2OO9 A;  4LF6 M;  1H6U A;  3KP1 E;  2VF8 A;  2KZU A;  2LNH C;  4NSR A;  3E21 A;  4DUY M;  1HJP A;  3E9S A;  4B3S M;  1TH4 A;  1VEK A;  2LHG A;  4WUR A;  5FTM A;  3FTE A;  3AJI B;  1G41 A;  5DYG A;  3J80 S;  1QAO A;  2HAK A;  4AKH A;  4ANR A;  4B08 A;  3FTC A;  3GLI B;  2VF7 A;  3QYB A;  4IIW A;  1DGH A;  1ZMV A;  2BWB A;  4LJ9 A;  4LZJ A;  4JI8 M;  3HJ8 A;  3GLF A;  2G3Q A;  2DWM A;  2LBC A;  2R44 A;  2BJV A;  3VKH A;  3UK6 A;  3JAM S;  1IY0 A;  1IN6 A;  2QCU A;  3HHX A;  3HY5 A;  5ITR A;  2JZ1 A;  3LMM A;  2CEA A;  1JR3 A;  2Z7J A;  4GH9 A;  3RGS A;  2LVA A;  4DBG B;  2HHH M;  2KXE A;  2L4E A;  2CUZ A;  3KW6 A;  4KLN A;  3FYD A;  4P16 A;  2DAM A;  2UXC M;  1NJG A;  2HWJ A;  4GKK M;  3A98 B;  2FS1 A;  1OIP A;  3VFD A;  3TWK A;  4RNA A;  4HEO A;  4LFC M;  3B7N A;  1Q02 A;  1Y8G A;  3AFH A;  3VDU A;  3U6Q A;  2KNZ A;  2W82 A;  3J81 S;  3TWM A;  4PD2 A;  1IBL M;  1IXS B;  2UUA M;  3IG5 A;  1E9S A;  3IHP A;  4M9S A;  4FWH A;  4D81 A;  1XXH B;  3GQ3 A;  1GJS A;  3SC3 A;  1NY5 A;  3L26 A;  1NJF A;  2FH0 A;  3ILK A;  4FWD A;  2YFQ A;  5ITU A;  1VG5 A;  1R2Z A;  3C3E A;  3QAU A;  3M7G A;  2XF3 A;  3K92 A;  1DGB A;  4LG2 A;  2K9D A;  4IBK A;  4B3M M;  3H4M A;  1OJL A;  3HU2 A;  4QNM A;  4F1I A;  4AI6 A;  5EXS A;  3KVW A;  1C1K A;  2JY7 A;  1RU3 A;  1HNX M;  4JI6 M;  3LCU A;  4LF4 M;  1TGU A;  1KYI A;  1XB2 B;  3GRR A;  4FCV A;  4BBA A;  1GJT A;  3GO8 A;  3ZH9 B;  4AQY M;  2J7N A;  4LJ8 A;  2O5R A;  3SAS A;  4DV3 M;  2O25 A;  4JV5 M;  3K9O A;  2H5X A;  4IBG A;  3HJS A;  5KPR A;  3BOS A;  2X8A A;  2Z4R A;  4OVZ B;  1L2B A;  2KW0 A;  2CP8 A;  1I4W A;  1IN7 A;  1OFI A;  2HKJ A;  4NSO B;  1Q3C A;  2A5Y B;  3SYK A;  2RGH A;  1VDL A;  3HHZ A;  1SXJ C;  4DR1 M;  3HHY A;  1HQY E;  3LVV A;  2DVW B;  3QYE A;  3U6M A;  3GLH A;  1EE8 A;  1NSF A;  4A3V B;  1N32 M;  2XH9 A;  2CV2 A;  3WHL A;  3SHG B;  4WW0 A;  4MGH A;  4RF0 A;  1IXZ A;  4I4L A;  4L6V 6;  1N78 A;  5IT9 S;  4LGY A;  2ZAO A;  4MGZ E;  3GLG E;  2QP9 X;  4GIP A;  4R3D A;  1SXJ E;  2KDL A;  1SXJ D;  1NV8 A;  3JR4 A;  3FD9 A;  3W68 A;  2C5R A;  2APL A;  4NOO B;  2JUJ A;  2KHH A;  2WSC F;  4QHS A;  2R62 A;  5GKN A;  2KZS A;  3U6L A;  2VQF M;  4PCZ A;  5ITQ A;  3FUX A;  2DZL A;  4I5S A;  3C9P A;  3FRH A;  2R18 A;  3ZC7 B;  3GLI A;  4LF5 M;  2CV1 A;  1N33 M;  3V76 A;  2D7G A;  3KS8 A;  1DGG A;  1PJJ A;  2GNO A;  2ERC A;  3NBI A;  4FW9 A;  5DNY A;  1SXJ A;  4IBJ A;  4B7F A;  1K82 A;  4OW0 A;  2XZU A;  4YY3 M;  5EJC A;  1UFZ A;  1E32 A;  1XXH E;  1MU5 A;  3IEC A;  4FCW A;  2HCB A;  3HGI A;  4FD2 A;  3SMP A;  1IN8 A;  1Z5B A;  3I4V A;  2QSF X;  3K9P A;  2EKF A;  2FFJ A;  4PDG A;  2M60 A;  3D8B A;  2CHV A;  3HX3 A;  1R7R A;  4KO8 A;  4IBB A;  3SAR A;  4LRS A;  3RFW A;  2V1C A;  5KO3 A;  2M5Z A;  3VKG A;  2L6O A;  2QPA A;  3T1H M;  4GC5 A;  3R9X B;  3MMP A;  3MHV C;  1IXS A;  1G71 A;  1KSF X;  2KA6 B;  2CHG A;  4LRT A;  1V92 A;  2JP7 A;  1XXH A;  4REZ A;  5EP3 A;  3U60 B;  3T15 A;  4GKJ M;  3PNV A;  1PRB A;  1ZMW A;  1PM5 A;  1QDR A;  2YNM D;  5ITY A;  3DA1 A;  1R4G A;  3PVS A;  4PDI A;  5ITX A;  1YSY A;  3KOW E;  3FUV A;  1G8P A;  4NXN M;  2KRK A;  4HL4 A;  2LVP C;  1GO5 A;  2LXE A;  4B3T M;  1JB0 F;  4KOD A;  1AUA A;  1QUT A;  1V34 A;  1D0L A;  1JR3 E;  2DAE A;  4AZF A;  1JR3 D;  2R6F A;  3DOA A;  3FKE A;  1JQJ C;  2LHC A;  1QDT A;  2R0I A;  2ZAN A;  4G4O A;  4LFA M;  4JI1 M;  1P3Q Q;  4LF7 M;  2JA2 A;  2QEN A;  1E94 E;  2MGW A;  2Y20 A;  4LY6 A;  3HWS A;  4OVZ A;  5IWA M;  4FWG A;  3CF0 A;  1TH2 A;  1OFH A;  5EP2 A;  2J7O A;  2QBY B;  2QHO B;  2YR0 A;  1XMO M;  4DV7 M;  2MJ5 B;  2C9C A;  2R65 A;  2I7N A;  3SFZ A;  3JR5 A;  4RF1 A;  4LGM A;  1G59 A;  1DV0 A;  1IXR C;  2QNJ A;  4LJA A;  1F4I A;  4XGI A;  2R4J A;  3I51 A;  4LJ7 A;  1Z5A A;  2CFO A;  3CF2 A;  1PGY A;  3K8Z A;  5KQD A;  3UGJ A;  1NNU C;  2J5Y A;  4X65 M;  2L7I A;  2Y0Q A;  2ZTC A;  3SAW A;  2QZ4 A;  1WGN A;  5BPV A;  3OTO M;  2DZN B;  5E6J A;  1NO1 A;  3UMM A;  1QVR A;  3GQ4 A;  3U6S A;  4LF8 M;  5FTK A;  2BNK A;  1HR0 M;  1N75 A;  2CHQ A;  4NC6 A;  4JYA M;  4G3O A;  1YLA A;  3L28 A;  4FVM A;  3U6O A;  2F5O A;  1G3I A;  1AIP C;  2C99 A;  1GVN A;  1T3T A;  4G4R A;  1NV9 A;  3GPY A;  2DXI A;  1J09 A;  3HKP A;  3THG A;  3GQ5 A;  3C58 A;  1L2C A;  3SAT A;  4L78 A;  3W0F A;  3A46 A;  4S12 A;  4PT5 A;  4JI3 M;  2C9O A;  4GMQ A;  3GLH E;  4X66 M;  4JI2 M;  4QOZ C;  5EP1 A;  1V33 A;  3LQQ A;  3M0E A;  5E26 A;  1WR1 B;  3SYL A;  4JI5 M;  3HJQ A;  3GRU A;  1EIJ A;  1TTE A;  3AOE C;  3FUT A;  1NHW C;  3FTD A;  2JNH A;  5EXT A;  1NVM A;  1XHB A;  2CV0 A;  3K2L A;  5A2Q S;  3WHK A;  1GLN A;  5L8R F;  3B7Q A;  4FCT A;  2UU9 M;  3B7Z A;  4L8R C;  2FNA A;  4MM3 B;  1K3X A;  1I94 M;  2GQF A;  5JI2 E;  1GAB A;  1N36 M;  2G8L A;  3TE6 A;  2R45 A;  2F5S A;  4DR2 M;  4M0W A;  2UXD M;  4QOS A;  4CHT B;  3GLI E;  2Z8Y M;  3SAV A;  1DGF A;  2D7H A;  3U60 A;  3U6P A;  4GC9 A;  3GLF B;  1XNR M;  2JY5 A;  2R4E A;  1L8Q A;  2DZO B;  2X49 A;  4DUZ M;  2FOI C;  4DR7 M;  3LVW A;  4GHA A;  4I8O A;  2K6B A;  2LVO C;  4NXM M;  4GHL A;  2OOA A;  4IBC A;  1MX0 A;  1ZAE A;  2DWN A;  1R5L A;  3LCV B;  3I01 M;  3W67 A;  3AOE A;  3KOZ E;  2NQ8 C;  3IG8 A;  1SG9 A;  2RRU A;  1IQP A;  3J7B A;  4CIS A;  3FRI A;  4B3R M;  1VQ1 A;  4LZZ A;  4R7G A;  2MRO B;  3HZJ A;  2V1U A;  2K47 A;  4Q7J A;  1QAQ A;  3PFI A;  3U61 B;  3U5Z B;  1IM2 A;  3KSX A;  2AHM A;  2XSZ A;  3GP1 A;  2L2D A;  4HLQ A;  4GRI A;  2QBY A;  3GPP A;  4GIT A;  4MGI E;  1MN3 A;  5ITX E;  1NNJ A;  5LMN M;  3T1Y M;  1T6O A;  2CRU A;  1A5T A;  2YQZ A;  2DI0 A;  4CGY B;  4JN6 A;  1KFV A;  2KRU A;  2L09 A;  5KPZ A;  2OQ4 A;  4IBD A;  3RGP A;  2DAK A;  5H37 D;  2CE7 A;  3NBX X;  1WIV A;  2HL7 A;  2MR9 A;  2EO2 A;  1OTR A;  2H1R A;  2JY8 A;  3D8L A;  4G6Z A;  4DV5 M;  3LQR A;  4IBE A;  4OX9 M;  4K0K M;  2ZBK B;  4G4Q A;  2C98 A;  2WSE F;  3HHW A;  1J7K A;  5IRE B; 
#chains in the Genus database with same CATH homology
 5EXX A;  4IBF A;  1PJI A;  1QAN A;  3CF6 E;  4I81 A;  4MGK E;  8CAT A;  1XWI A;  4AW4 A;  2G5G X;  1GL6 A;  5LMU M;  1K3W A;  5FTN A;  1ZQ9 A;  4DV1 M;  3VDP A;  3R8F A;  3SAU A;  2EUC A;  1IY1 A;  1ORY B;  1IBM M;  1VDD A;  3HU3 A;  4B7G A;  3U6E A;  3J2P B;  4M9X A;  3CTW B;  1IY2 A;  2V6Z M;  4W5W A;  2RGO A;  1Z5C A;  1WXQ A;  2VII A;  3J27 B;  4JI0 M;  3VLF B;  2F4V M;  4LFB M;  2X4A A;  3MK6 A;  1HQC A;  3HU1 A;  4LJ6 A;  4AG6 A;  3PNY A;  1QAM A;  4ZPX A;  3M6A A;  2UXB M;  1XC8 A;  3UJN A;  3AKZ A;  2XFT A;  1LV7 A;  4QNR A;  2XZF A;  3A45 A;  1R6B X;  4BLC A;  2LH0 A;  4JXJ A;  1N34 M;  3L25 A;  2VQE M;  4AKG A;  2P5T A;  2UUB M;  4QHT A;  1IN5 A;  7CAT A;  2UUC M;  3GLG B;  3AOG A;  3KP0 E;  4DR6 M;  5ITT A;  3VK7 A;  1SXJ B;  2OPF A;  5EP4 A;  4LJ5 A;  4Z6Y A;  1HNW M;  4IJE A;  1GKI A;  3ZCB B;  1IBK M;  1QQW A;  4DV6 M;  5C18 A;  2Q2E B;  2Y21 A;  3DFZ A;  3SBJ A;  3GPU A;  4EIW A;  1N77 A;  3K1J A;  1TH3 A;  2E5L M;  3TQS A;  2KEB A;  4X64 M;  1DO2 A;  4G4N A;  5C1B A;  3U5Z A;  3U61 A;  5FTL A;  1HT2 E;  2I7P A;  4ITQ A;  4MB7 A;  5JI3 E;  3KOY E;  4M0D A;  3VK8 A;  1G4A E;  3TL4 X;  3B9P A;  4JI7 M;  1L2D A;  3KFU G;  1W5T A;  1X37 A;  1Z6T A;  4DV0 M;  4NRW A;  1HT1 E;  3AL0 C;  3L27 A;  2EA0 A;  4YHH M;  2FE8 A;  1FJG M;  1XMQ M;  3U6C A;  1TDH A;  1QZM A;  2RKO A;  3FUU A;  3GRV A;  2ZM6 M;  1FNN A;  4NRV A;  1IN4 A;  3SHF A;  3W0L B;  1R2Y A;  2XFS A;  1NHG C;  5FLX S;  4DR5 M;  1DGH B;  2R46 A;  5BR8 M;  1QYR A;  2BJW A;  1YUB A;  3FUW A;  3KOX E;  4M9Z A;  1UM8 A;  1S3S A;  5EQT A;  2ZAM A;  3DZD A;  4DR3 M;  3J7A S;  3E4R A;  5IZ7 D;  3MJ5 A;  1TDZ A;  2DHR A;  2XSZ D;  4XBO A;  4BB9 A;  3KXE C;  4JI4 M;  2DWL A;  1J5E M;  3TWL A;  5F3W A;  4L16 A;  2F5N A;  4LF9 M;  3L2A A;  3A42 A;  4IBI A;  1W5S A;  3KSJ A;  3TPZ A;  3GPX A;  2Y0T A;  3I4Y A;  4DV4 M;  4KHP M;  5FSW A;  2C96 A;  4X62 M;  3SMS A;  4II7 A;  4NL4 H;  1L1Z A;  3PXG A;  1GL7 A;  4TUW A;  4Z8X A;  2Z4S A;  3GRY A;  1NY6 A;  4L4U A;  4B7H A;  2F5P A;  1XNQ M;  4DR4 M;  1L1T A;  1YE9 A;  3L29 A;  2DWZ B;  2XLJ A;  3QWL A;  4MGY E;  3GLG A;  3AV0 A;  4IJF A;  4L15 A;  4DV2 M;  2F5Q A;  4D80 A;  5KPT A;  1D2N A;  2XGN A;  1Q39 A;  2XEP A;  5EXP A;  4LJ4 A;  5DYI A;  1DO0 A;  1Z59 A;  4AG5 A;  3EIH A;  5KQ8 A;  4MH0 E;  3Q8X A;  3EIE A;  3RE8 A;  1HNZ M;  3GLH B;  3U6D A;  2LWX A;  3UZU A;  2Z3X A;  2L7H A;  4OU7 A;  4AKI A;  3NWL A;  4D82 A;  1E9R A;  5FTJ A;  3KDS E;  2D7E A;  3FTF A;  4LCB A;  3KS4 A;  1Q3B A;  3T38 A;  3FYC A;  4LF6 M;  1H6U A;  3KP1 E;  4NSR A;  2KZU A;  2LNH C;  4DUY M;  3E9S A;  4B3S M;  1TH4 A;  4WUR A;  5FTM A;  3FTE A;  3AJI B;  1G41 A;  5DYG A;  3J80 S;  1QAO A;  4AKH A;  4B08 A;  3FTC A;  3GLI B;  4IIW A;  1DGH A;  4LJ9 A;  4LZJ A;  4JI8 M;  3HJ8 A;  3GLF A;  2DWM A;  2BJV A;  3VKH A;  3UK6 A;  3JAM S;  1IY0 A;  1IN6 A;  2QCU A;  3HHX A;  5ITR A;  3LMM A;  3RGS A;  2CEA A;  1JR3 A;  2Z7J A;  4GH9 A;  2HHH M;  2KXE A;  3KW6 A;  2CUZ A;  4KLN A;  4P16 A;  3FYD A;  2UXC M;  1NJG A;  4GKK M;  3A98 B;  3VFD A;  3TWK A;  4RNA A;  4LFC M;  3AFH A;  3U6Q A;  3VDU A;  2W82 A;  3J81 S;  3TWM A;  4PD2 A;  1IBL M;  1IXS B;  2UUA M;  1E9S A;  4M9S A;  4FWH A;  4D81 A;  1XXH B;  3GQ3 A;  3SC3 A;  1NY5 A;  3L26 A;  1NJF A;  3ILK A;  4FWD A;  2YFQ A;  5ITU A;  1R2Z A;  3QAU A;  3M7G A;  2XF3 A;  3K92 A;  1DGB A;  4LG2 A;  4B3M M;  4IBK A;  3H4M A;  1OJL A;  3HU2 A;  4QNM A;  4AI6 A;  5EXS A;  3KVW A;  1C1K A;  1HNX M;  4JI6 M;  4LF4 M;  1TGU A;  1KYI A;  3GRR A;  4FCV A;  4BBA A;  3GO8 A;  3ZH9 B;  4AQY M;  2J7N A;  4LJ8 A;  2O5R A;  3SAS A;  4DV3 M;  4JV5 M;  4IBG A;  3HJS A;  5KPR A;  3BOS A;  2X8A A;  2Z4R A;  4OVZ B;  1L2B A;  2KW0 A;  1I4W A;  1IN7 A;  1OFI A;  2HKJ A;  4NSO B;  1Q3C A;  2A5Y B;  3SYK A;  2RGH A;  3HHZ A;  1SXJ C;  4DR1 M;  3HHY A;  1HQY E;  3LVV A;  2DVW B;  3U6M A;  3GLH A;  1EE8 A;  1NSF A;  4A3V B;  1N32 M;  2XH9 A;  2CV2 A;  3WHL A;  3SHG B;  4WW0 A;  4MGH A;  4RF0 A;  1IXZ A;  4I4L A;  1N78 A;  5IT9 S;  4LGY A;  2ZAO A;  4MGZ E;  2QP9 X;  4GIP A;  4R3D A;  1SXJ E;  1SXJ D;  3JR4 A;  3FD9 A;  2C5R A;  4NOO B;  4QHS A;  2R62 A;  5GKN A;  2KZS A;  3U6L A;  2VQF M;  4PCZ A;  5ITQ A;  3FUX A;  4I5S A;  2R18 A;  3ZC7 B;  3GLI A;  4LF5 M;  2CV1 A;  1N33 M;  2D7G A;  3KS8 A;  1DGG A;  1PJJ A;  2ERC A;  3NBI A;  4FW9 A;  5DNY A;  1SXJ A;  4IBJ A;  4B7F A;  1K82 A;  4OW0 A;  2XZU A;  4YY3 M;  5EJC A;  1E32 A;  4FCW A;  1MU5 A;  2HCB A;  3HGI A;  4FD2 A;  3SMP A;  1IN8 A;  1Z5B A;  3I4V A;  4PDG A;  2FFJ A;  2M60 A;  3D8B A;  2CHV A;  1R7R A;  3HHW A;  4IBB A;  4KO8 A;  3SAR A;  4LRS A;  3RFW A;  2V1C A;  5KO3 A;  2M5Z A;  3VKG A;  2L6O A;  2QPA A;  3T1H M;  4GC5 A;  3R9X B;  3MHV C;  1KSF X;  2KA6 B;  2CHG A;  4LRT A;  1XXH A;  4REZ A;  5EP3 A;  3U60 B;  3T15 A;  4GKJ M;  3PNV A;  1PM5 A;  2YNM D;  5ITY A;  3DA1 A;  3PVS A;  4PDI A;  5ITX A;  1YSY A;  3KOW E;  3FUV A;  1G8P A;  4NXN M;  2KRK A;  4HL4 A;  2LXE A;  4B3T M;  4KOD A;  4AZF A;  1JR3 D;  3FKE A;  3DOA A;  1JQJ C;  2ZAN A;  4G4O A;  4LFA M;  4JI1 M;  4LF7 M;  2JA2 A;  2QEN A;  1E94 E;  2Y20 A;  4LY6 A;  3HWS A;  4OVZ A;  5IWA M;  4FWG A;  3CF0 A;  1TH2 A;  1OFH A;  5EP2 A;  2J7O A;  2QBY B;  2YR0 A;  1XMO M;  4DV7 M;  2C9C A;  2R65 A;  2I7N A;  3SFZ A;  3JR5 A;  4RF1 A;  4LGM A;  1G59 A;  1IXR C;  4LJA A;  4XGI A;  2R4J A;  3I51 A;  4LJ7 A;  1Z5A A;  2CFO A;  3CF2 A;  3K8Z A;  5KQD A;  3UGJ A;  4X65 M;  1NNU C;  3SAW A;  2L7I A;  2Y0Q A;  2QZ4 A;  5BPV A;  3OTO M;  2DZN B;  5E6J A;  3UMM A;  1QVR A;  3GQ4 A;  3U6S A;  4LF8 M;  5FTK A;  2BNK A;  1HR0 M;  1N75 A;  2CHQ A;  4JYA M;  3L28 A;  4FVM A;  3U6O A;  2F5O A;  1G3I A;  2C99 A;  1GVN A;  1T3T A;  4G4R A;  3GPY A;  3SAT A;  2DXI A;  1J09 A;  3HKP A;  3THG A;  3GQ5 A;  3C58 A;  1L2C A;  4L78 A;  3W0F A;  3A46 A;  4S12 A;  4PT5 A;  4JI3 M;  2C9O A;  4GMQ A;  4X66 M;  4JI2 M;  4QOZ C;  5EP1 A;  3LQQ A;  3M0E A;  5E26 A;  3SYL A;  4JI5 M;  3HJQ A;  3GRU A;  3AOE C;  3FUT A;  1NHW C;  3FTD A;  5EXT A;  1NVM A;  1XHB A;  2CV0 A;  3K2L A;  5A2Q S;  3WHK A;  1GLN A;  4FCT A;  2UU9 M;  4L8R C;  2FNA A;  4MM3 B;  1K3X A;  1I94 M;  5JI2 E;  1N36 M;  2G8L A;  3TE6 A;  2R45 A;  2F5S A;  4DR2 M;  4M0W A;  2UXD M;  4QOS A;  4CHT B;  3SAV A;  1DGF A;  2D7H A;  3U60 A;  3U6P A;  4GC9 A;  3GLF B;  1XNR M;  2R4E A;  1L8Q A;  2DZO B;  2X49 A;  4DUZ M;  2FOI C;  4DR7 M;  3LVW A;  4GHA A;  4I8O A;  4NXM M;  4GHL A;  4IBC A;  1MX0 A;  1ZAE A;  2DWN A;  3AOE A;  3KOZ E;  2NQ8 C;  3IG8 A;  1IQP A;  3J7B A;  4CIS A;  4B3R M;  4LZZ A;  4R7G A;  2V1U A;  2K47 A;  1QAQ A;  3PFI A;  3U61 B;  3U5Z B;  1IM2 A;  3KSX A;  2AHM A;  2XSZ A;  3GP1 A;  4HLQ A;  2QBY A;  4GRI A;  3GPP A;  4GIT A;  4MGI E;  5ITX E;  1NNJ A;  5LMN M;  3T1Y M;  2YQZ A;  4CGY B;  4JN6 A;  1KFV A;  2KRU A;  2L09 A;  5KPZ A;  2OQ4 A;  4IBD A;  3RGP A;  5H37 D;  2CE7 A;  2HL7 A;  3D8L A;  2EO2 A;  2H1R A;  4G6Z A;  4DV5 M;  4OX9 M;  3LQR A;  4IBE A;  4K0K M;  2ZBK B;  4G4Q A;  2C98 A;  3IG5 A;  1J7K A;  5IRE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...