5LMUM

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmuM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmuM02
2XZUA 4JI6M 1XNQM 3GPXA 4DV0M 5A2QS 3SBJA 4LFAM 3GPUA 1Z59A 1Z5AA 1I94M 3TWLA 4DR3M 4LF5M 1L2DA 4PCZA 1Z5BA 4X64M 3JR5A 4X66M 1HNZM 4PD2A 5BR8M 4B3MM 4LF9M 4B3TM 1XNRM 5IT9S 4NRVA 2EA0A 4DV3M 4LFBM 2UXCM 2VQEM 4DV1M 2ZBKB 4ITQA 3U6DA 1N36M 3SASA 4DR6M 2E5LM 1FJGM 4JI8M 1L1TA 3DOAA 4JI7M 2F5NA 4B3RM 2UUCM 1R2YA 1L2BA 4YY3M 3U6EA 3SATA 2XZFA 4GKKM 4G4RA 4DV6M 2HHHM 4GKJM 4DR1M 1L2CA 1R2ZA 1IBKM 1HNXM 1IBMM 1Q3CA 3VK7A 5FLXS 3U6LA 1Q3BA 3C58A 5ITTA 4B3SM 1NNJA 4LF7M 3U6QA 2UXBM 3U6MA 5ITYA 2UUAM 4JI2M 5IWAM 4G4QA 1KFVA 3GPPA 1J5EM 1XMOM 3SARA 4NRWA 1HNWM 4YHHM 1XC8A 1PM5A 3TWMA 1EE8A 3JAMS 4MB7A 3SAVA 1L1ZA 4CISA 4JI4M 3GP1A 4LF4M 4JI0M 2VQFM 4DV2M 3GQ5A 4JI3M 1K3XA 4DR5M 4JV5M 3U6OA 4LF6M 3A42A 3W0FA 5LMUM 4LF8M 5ITUA 3J7AS 3J80S 3GO8A 5ITXE 2OPFA 1N34M 1Z5CA 4DR7M 1MX0A 4OX9M 4AQYM 4DV7M 4DUYM 4G4OA 4G4NA 3SAUA 1TDHA 3VK8A 5ITXA 4PDGA 4X65M 4DUZM 3U6PA 2F5SA 2UUBM 4NXNM 1N32M 4KHPM 2Q2EB 1K3WA 2F4VM 1N33M 4NXMM 1Q39A 1TDZA 5ITQA 4DR2M 3T1HM 3GPYA 4DR4M 2UXDM 1PJIA 3GQ3A 3U6SA 4JYAM 2F5QA 3U6CA 4X62M 3GQ4A 1K82A 2F5OA 4DV4M 4DV5M 4LFCM 4JI1M 3JR4A 2OQ4A 3OTOM 1IBLM 1PJJA 5ITRA 3A45A 4PDIA 5LMNM 2ZM6M 3SAWA 2UU9M 4K0KM 2HKJA 1XMQM 4JI5M 3A46A 3TWKA 2F5PA 3T1YM 3J81S 1HR0M 1MU5A
chains in the Genus database with same CATH superfamily
3M7GA 1EFUB 4MM3B 1IM2A 2LVAA 1LTMA 1XNQM 1NSFA 2OOBA 1OFIA 1Z5AA 2FFJA 5JI2E 1I94M 1C1KA 4I5SA 4L78A 4M9SA 3BBZA 4HL4A 1L2DA 5EP1A 4KO8A 2DNAA 4LJ4A 2VF7A 4LF9M 4QNRA 2JZ0A 2WSFF 4FCVA 4AG5A 4DV3M 5H37D 4B7GA 1DGGA 2L7HA 1N36M 2B3TA 2RRUA 3NWLA 1IN8A 1LV7A 3R8FA 1JB0F 1SXJE 3DOAA 1L1TA 1T6OA 2DZLA 4NL4H 1J7KA 3U6EA 1GL7A 4OW0A 4AI6A 1UFZA 2YQZA 1XXHB 2I7NA 1R2ZA 1HNXM 3D8LA 1ZV1A 2EKKA 1QAOA 2DAKA 3J27B 4L8RC 3GLIB 1IY1A 1OTRA 3KDSE 4LGMA 2G3QA 1HT2E 3DZDA 3GLHE 4W5WA 5FLXS 2JY8A 2XGNA 3FUUA 4KLNA 1D0LA 1DGBA 4D80A 2ZANA 3TE6A 1NNJA 1HQCA 2RGOA 4IBGA 3C3EA 2UXBM 4RF0A 1YLAA 3GRUA 2UUAM 3UZUA 2H5XA 3GPPA 1XMOM 1HNWM 4LZZA 4YHHM 1PM5A 1G3IA 3QAUA 1WGLA 3WHLA 4MGYE 3PNYA 2M5ZA 2X49A 2L4FA 4Y28F 2KHHA 2P5TA 3GLIA 4QHSA 3B9PA 4AKIA 1IN7A 1XXHA 2LVOC 2R45A 3FUVA 4RF1A 4QOSA 4F1IA 4DR5M 3H4MA 2LHCA 3MMPA 1SXJD 3SC3A 2BJWA 1XWIA 4JV5M 3U6OA 5DYIA 4LF6M 3ILKA 3A42A 4FD2A 2O25A 3W0FA 2JP7A 4GRIA 2R44A 5ITUA 4QNMA 4LF8M 3J7AS 3E9SA 4F2LA 2C9CA 4GC9A 3GRVA 4LCBA 2XFTA 5FTKA 1OFHA 2EO2A 2OPFA 1G71A 1Z5CA 1OIZA 1MX0A 2BNKA 2XH9A 2EUCA 1E9RA 3KXEC 3M0EA 5IZ7D 2V1UA 2MROB 1X37A 2QNJA 3RGSA 2JWSA 4G4OA 2F5SA 4RNAA 2N35A 2L2DA 4X65M 4DUZM 3U6PA 2A5YB 2GNOA 2XFSA 3AKZA 1QUTA 4NXNM 4B7HA 2HAKA 2K0BX 3L28A 1DO2A 3CGWA 3KOWE 3QYBA 3ZH9B 4G6ZA 3FTFA 5C1BA 3GLGE 2QZ4A 4FWGA 3KVWA 4I4LA 2O5RA 4DR4M 1IXZA 1PJIA 2OO9A 4LY6A 4JYAM 1JR3E 4MH0E 3GQ4A 4AKGA 2KNVA 1IY0A 4GEWA 3RE8A 1IN4A 3B7ZA 3SMPA 3U60A 4JI1M 2C98A 1HQYE 3CTWB 3R9XB 2EKFA 3J7BA 2BWEA 3GRRA 5DNYA 3H4JA 4JI5M 3VKHA 3FYCA 3FRIA 4OVZA 5IREB 2KRUA 3FKEA 2XZUA 1PJSA 4JI6M 5KQ8A 4NSOB 5A2QS 4FCTA 3SBJA 4ANRA 1QVRA 3HU3A 1KYIA 3VDUA 2C99A 3GLGA 3AOEA 4G3OA 4M0WA 3TWLA 4WW0A 1IN5A 4PCZA 1Z5BA 4X64M 4X66M 1NV9A 5EQTA 5FSWA 4Z8XA 1TF0B 2K9DA 2EA0A 3KS8A 2DKLA 1V92A 2JNHA 4LFBM 4DV1M 2ZBKB 3HX3A 2D7HA 2CEAA 3KOZE 3UK6A 4HEOA 3KW6A 2FOIC 2HWJA 3CF2A 1E94E 1V33A 4I8OA 3K1JA 2M60A 1Y8GA 4B3RM 1VG5A 2MH8A 2Y0TA 2LWXA 2RGHA 5DYGA 1AIPC 1WIVA 1ZAEA 3W0LB 1L8QA 4YY3M 3FYDA 2AHMA 1IXSB 2L6OA 4IBJA 2XZFA 1GO5A 1D2NA 4DV6M 1DO0A 2HHHM 3FUXA 4M0DA 1XXHE 3FRHA 3B89A 3VK7A 2CP8A 4B7FA 3FUTA 1S3SA 3IG5A 3HWSA 3VKGA 2DHYA 2FNAA 1OAIA 2LVNC 1TH4A 1SXJC 1T43A 3U6MA 5ITYA 2MR9A 1VDDA 4QOZC 4JI2M 5IWAM 5EXTA 4WP2A 4NRWA 3KSXA 1IFYA 1XC8A 3LVWA 4EIWA 3ZQJA 3JAMS 3SAVA 5DFLA 3HKPA 4HLQA 4JI0M 2VQFM 5FTJA 2CE7A 3AFHA 1P3QQ 2Z4RA 4D82A 4DV2M 5EXSA 1SXJB 3AL0C 1V34A 4NSRA 4GHAA 3K9OA 4LJ5A 5JI3E 2R6FA 1VDLA 2W82A 3LQQA 1J09A 1GL6A 2KNZA 3U5ZA 3AV0A 2DZNB 5LMUM 3TPZA 3SYKA 4AZFA 2LNHC 3J80S 2O01F 2EJSA 2L09A 5ITXE 1W5SA 3L26A 4CJ6A 3GRYA 4Q7JA 2DAIA 4OX9M 4IJEA 4FWHA 3FE3A 4L16A 3W67A 4DUYM 4DV7M 5ITXA 3L27A 1QDTA 3SHGB 2R46A 3L25A 3LW5F 1N32M 1A5TA 1D0KA 1K3WA 3KFUG 3VFDA 5KPRA 1MN3A 2Y20A 4KODA 4LRSA 4NXMM 4MGZE 2J7OA 1OQYA 1QYRA 2QBYB 3Q8XA 5ITQA 1H6UA 3T1HM 4MGIE 1AUAA 3GLHB 1RU3A 2BJVA 2KNAA 3U6SA 2DXIA 2F5QA 2CV1A 3PNVA 3U6CA 5FTNA 4X62M 2L4EA 3I04M 3KOXE 3ZC7B 3K92A 4DV5M 4IBKA 3E4RA 1E9SA 1JR3A 1XHBA 3TQSA 3V76A 3U61A 5LMNM 2FE8A 3HJSA 1KSFX 4IJFA 2CV2A 2HKJA 4A3VB 2DWMA 3TWKA 3T1YM 4GH9A 1QAMA 2JZ1A 1WR1B 3EIEA 1SG9A 4DV0M 4LJ6A 3UMMA 2CWBA 4DBGB 5EP2A 3MHVC 3VDPA 2D7GA 4R7GA 4PT5A 3FTDA 4IBFA 4DR3M 1FNNA 1DGHA 2C96A 2CHQA 4GHLA 3HJ8A 3QYEA 3LMMA 4PD2A 4B3TM 1XNRM 3SFZA 4IBEA 3HJQA 1TGUA 3LCVB 2VQEM 1G59A 2D7EA 3L2AA 2XSZD 3C3DA 3VLFB 4ITQA 3CF6E 2MJ5B 1XB2B 1GKIA 5EP3A 3AOGA 3SHFA 1NVMA 2H1RA 2KRKA 4AW4A 4LJ9A 2E5LM 1FJGM 2XF3A 4JI7M 4JI8M 2F5NA 1GJSA 1MJGM 3NBXX 2UUCM 2DAGA 8CATA 1L2BA 4GITA 4JN6A 3B7QA 1UM8A 4RKUF 1C7YA 4IBBA 1ORYB 2LVQD 4R3DA 4GKKM 4LJ7A 1N77A 2R4JA 4GKJM 4DR1M 1L2CA 2V1CA 5EXXA 1IBKM 2G5GX 1R6BX 4AKHA 3U6LA 1Q3BA 2WSEF 3I01M 4XGIA 3C58A 3NBIA 3MJ5A 4B3SM 2Z8YM 3GLFB 2MGWA 3U6QA 2WSCF 2K6BA 3PFIA 4FW9A 1T3TA 1TTEA 4FVMA 3SMSA 4BLCA 1KFVA 1J5EM 2Y21A 5FTMA 5KO3A 3KP1E 1EE8A 2DI0A 3TWMA 2ZTDA 3BOSA 2XSZA 4LJ8A 2R18A 3FUWA 4MB7A 3KSJA 4LGYA 1L1ZA 4CISA 1G41A 4JI4M 3GP1A 4LF4M 1ZMVA 5EXPA 3ZCBB 3GQ5A 4L15A 3HU2A 1BVSA 4LG2A 2CHGA 2L7IA 4Z6YA 2KA6B 2VDBB 5EJCA 4BBAA 4OU7A 3UGJA 4MGHA 3RFWA 4IIWA 3GO8A 1NHGC 1NNUC 3B74A 1YE9A 2LBCA 2DAMA 3E21A 3HGIA 1N34M 4DR7M 4IBCA 3Q8GA 4AQYM 4TUWA 1QDRA 1NJGA 4G4NA 2HL7A 3VK8A 1JR3D 3KOYE 4PDGA 1G4AE 2ZTCA 2UUBM 4NOOB 1NO1A 2Q2EB 1Z6TA 1DGHB 2R62A 3BXWA 4FWDA 1DV0A 1ZMUA 1HT1E 4IBIA 2KZSA 4NC6A 1NV8A 2DHRA 1Q39A 3IG8A 2R65A 4DR2M 2UXDM 2QP9X 1TR8A 3GLIE 2J7NA 3GQ3A 3I4YA 2Z4SA 1GVNA 1GLNA 2YNMD 1TH2A 1K82A 2F5OA 3HZJA 3THGA 4DV4M 1QUSA 2XLJA 5BPVA 5L8RF 4L4UA 3JR4A 2XEPA 2OQ4A 3U5ZB 3W68A 3U61B 1IBLM 2CV0A 1PGYA 1ZMWA 1QAQA 5ITRA 1CUKA 1ZQ9A 4K0KM 1E32A 2DWNA 1F4IA 1WJ7A 3A46A 4S12A 4LZJA 2RKOA 4I81A 1HR0M 1EIJA 1MU5A 7CATA 2JUJA 3GLHA 2QQ8A 3GPXA 3AOEC 2C5RA 2KEBA 3PXGA 4ZPXA 4LFAM 4AG6A 1Z59A 2V6ZM 1GJTA 4M9XA 3GPUA 2QBYA 2JXNA 2QPAA 4BB9A 3LCUA 4LF5M 2X8AA 3QWLA 2QHOB 3JR5A 2LXEA 1R5LA 1GABA 2HCBA 1HNZM 5BR8M 4B3MM 2R4EA 1OIPA 2DAEA 3HHYA 2FS1A 4NRVA 5F3WA 3FTEA 2G8LA 5IT9S 3T38A 2DZOB 1WGNA 2UXCM 2APLA 2Y0QA 3U6DA 3FTCA 1NHWC 4P16A 3SASA 4DR6M 2Z7JA 4GC5A 2K47A 2VF8A 4GIPA 1VEKA 2GQFA 3EIHA 4KT0F 1D0MA 1R2YA 3M6AA 2KW0A 3SATA 5KPTA 4G4RA 1OJLA 1SXJA 3B7NA 3SYLA 1IBMM 1Q3CA 5C18A 2KDLA 2LVPC 2JA2A 1YSYA 3A98B 1DGFA 2CRUA 1PJTA 5ITTA 4LF7M 1YUBA 2ERCA 3WHKA 1JQJC 3L29A 3PVSA 4QHTA 4XBOA 4R71A 2LTUA 3FD9A 2YR0A 3HU1A 3I4VA 2LHGA 3J2PB 4LRTA 3AJIB 3HHWA 4G4QA 3SARA 2DWZB 2KZUA 4LJAA 2YFQA 1I4WA 4II7A 4JXJA 4GMQA 4REZA 1R4GA 2QCUA 1IQPA 2LH0A 2KXEA 5E6JA 4OVZB 1QZEA 3K9PA 1NY6A 4JI3M 1K3XA 5E26A 1IXSA 3J81S 2ZAMA 1HJPA 3E46A 3F92A 1NY5A 3K8ZA 1OKSA 4FCWA 3TL4X 4CIZA 3KP0E 1QQWA 1R7RA 1VQ1A 3UJNA 3MK6A 2OOAA 2DVWB 5EP4A 1VEGA 1IY2A 4B08A 2QENA 3T6PA 2QSFX 2WZJA 4P17A 2NQ8C 3GLFA 2BWBA 4UN2B 1XMQM 3SAUA 1TDHA 3IHPA 2ZAOA 2JY5A 3IECA 2FH0A 3C9PA 3K2LA 3LQRA 1VEJA 1G8PA 4IBDA 4KHPM 4CGYB 2JY7A 2C9OA 3DFZA 2F4VM 1WHCA 3HY5A 4XK8F 1N75A 1N33M 5KPZA 2I7PA 4D81A 5FTLA 3GLGB 3HHZA 1TDZA 3GPYA 2DENA 3I51A 3GLFE 2X4AA 4WURA 4CHTB 3RGPA 1NJFA 5GKNA 1QANA 1TH3A 3T15A 1IN6A 3DA1A 4LFCM 2JY6B 4MGKE 1PJQA 2CFOA 1Q02A 3OTOM 2Z3XA 1QZMA 1OAOC 2R0IA 1PJJA 2VIIA 1IXRC 3HHXA 1N78A 3A45A 4PDIA 3SAWA 1W5TA 2ZM6M 3U60B 2UU9M 3KS4A 2J5YA 4M9ZA 5KQDA 2DWLA 1WXQA 3D8BA 1PRBA 2CHVA 4L6V6 3LVVA 2F5PA 2CUZA 3CF0A
chains in the Genus database with same CATH topology
3M7GA 4MM3B 1IM2A 1XNQM 1NSFA 1OFIA 1Z5AA 2FFJA 5JI2E 1I94M 1C1KA 4I5SA 4L78A 4M9SA 4HL4A 1L2DA 5EP1A 4KO8A 4LJ4A 4LF9M 4QNRA 4FCVA 4AG5A 4DV3M 5H37D 4B7GA 1DGGA 2L7HA 1N36M 3NWLA 1IN8A 1LV7A 3R8FA 1L1TA 1SXJE 3DOAA 4NL4H 1J7KA 3U6EA 1GL7A 4OW0A 4AI6A 2YQZA 1XXHB 2I7NA 1R2ZA 1HNXM 3D8LA 3J27B 1QAOA 4L8RC 3GLIB 1IY1A 3KDSE 4LGMA 5FLXS 4OU7A 1HT2E 3DZDA 4W5WA 2XGNA 3FUUA 4KLNA 1DGBA 4D80A 2ZANA 3TE6A 1NNJA 1HQCA 2RGOA 4IBGA 2UXBM 4RF0A 3GRUA 2UUAM 3UZUA 3GPPA 1XMOM 1HNWM 4LZZA 4YHHM 1PM5A 1G3IA 3QAUA 3WHLA 4MGYE 3PNYA 2M5ZA 2X49A 2P5TA 3GLIA 4QHSA 3B9PA 4AKIA 1IN7A 1XXHA 2R45A 3FUVA 4RF1A 4QOSA 4DR5M 3H4MA 1SXJD 3SC3A 2BJWA 1XWIA 4JV5M 3U6OA 5DYIA 4LF6M 3ILKA 3A42A 4FD2A 3W0FA 4LF8M 4GRIA 5ITUA 4QNMA 3J7AS 3E9SA 2C9CA 4GC9A 3GRVA 4LCBA 2XFTA 5FTKA 1OFHA 2EO2A 2OPFA 3M0EA 1Z5CA 2BNKA 1MX0A 2XH9A 3KXEC 2EUCA 1E9RA 5IZ7D 2V1UA 1X37A 4G4OA 3RGSA 2F5SA 4RNAA 4X65M 4DUZM 3U6PA 2A5YB 2XFSA 3AKZA 4NXNM 4B7HA 3L28A 1DO2A 3KOWE 3ZH9B 4G6ZA 3FTFA 5C1BA 2QZ4A 4FWGA 3KVWA 4I4LA 2O5RA 4DR4M 1IXZA 1PJIA 4LY6A 4JYAM 4MH0E 3GQ4A 4AKGA 1IY0A 3RE8A 1IN4A 3SMPA 3U60A 4JI1M 2C98A 1HQYE 3CTWB 3R9XB 3J7BA 3GRRA 5DNYA 4JI5M 3VKHA 3FYCA 4OVZA 5IREB 2KRUA 3FKEA 2XZUA 4JI6M 5KQ8A 4NSOB 5A2QS 4FCTA 3SBJA 1QVRA 3HU3A 1KYIA 3VDUA 2C99A 3GLGA 3AOEA 4M0WA 3TWLA 4WW0A 1IN5A 4PCZA 1Z5BA 4X64M 4X66M 5EQTA 5FSWA 4Z8XA 2EA0A 3KS8A 4LFBM 4DV1M 2ZBKB 3KOZE 2D7HA 2CEAA 3UK6A 3KW6A 2FOIC 3CF2A 1E94E 4I8OA 3K1JA 2M60A 4B3RM 2Y0TA 2LWXA 2RGHA 5DYGA 3W0LB 1ZAEA 4YY3M 1L8QA 3FYDA 2AHMA 1IXSB 2L6OA 4IBJA 2XZFA 1D2NA 4DV6M 1DO0A 2HHHM 3FUXA 4M0DA 3VK7A 4B7FA 3FUTA 1S3SA 3IG5A 3HWSA 3VKGA 2FNAA 1TH4A 1SXJC 3U6MA 5ITYA 1VDDA 4QOZC 4JI2M 5IWAM 5EXTA 4NRWA 3KSXA 1XC8A 3LVWA 4EIWA 3JAMS 3SAVA 3HKPA 4HLQA 4JI0M 2VQFM 5FTJA 2CE7A 3AFHA 2Z4RA 4DV2M 4D82A 5EXSA 1SXJB 3AL0C 4NSRA 4GHAA 4LJ5A 5JI3E 2W82A 3LQQA 1J09A 1GL6A 3U5ZA 3AV0A 2DZNB 5LMUM 3TPZA 3SYKA 4AZFA 2LNHC 3J80S 5ITXE 2L09A 1W5SA 3L26A 3GRYA 4OX9M 4IJEA 4FWHA 4DV7M 4L16A 4DUYM 5ITXA 3L27A 3L25A 3SHGB 2R46A 1N32M 1K3WA 3KFUG 3VFDA 5KPRA 4KODA 2Y20A 4LRSA 4NXMM 4MGZE 2J7OA 1QYRA 2QBYB 3Q8XA 5ITQA 1H6UA 3T1HM 4MGIE 3GLHB 2BJVA 3U6SA 2DXIA 2F5QA 2CV1A 3PNVA 3U6CA 5FTNA 4X62M 3KOXE 3ZC7B 3K92A 4DV5M 4IBKA 3E4RA 1E9SA 1JR3A 1XHBA 3TQSA 3U61A 5LMNM 2FE8A 3HJSA 1KSFX 4IJFA 2CV2A 2HKJA 4A3VB 2DWMA 3TWKA 3T1YM 4GH9A 1QAMA 3EIEA 4DV0M 4LJ6A 3UMMA 5EP2A 3MHVC 3VDPA 2D7GA 4R7GA 4PT5A 3FTDA 4IBFA 4DR3M 1FNNA 1DGHA 2C96A 2CHQA 4GHLA 3HJ8A 3LMMA 4PD2A 4B3TM 1XNRM 3SFZA 4IBEA 3HJQA 1TGUA 2VQEM 1G59A 2D7EA 3L2AA 2XSZD 3VLFB 4ITQA 3CF6E 1GKIA 5EP3A 3AOGA 3SHFA 1NVMA 2H1RA 2KRKA 4AW4A 4LJ9A 2E5LM 1FJGM 2XF3A 4JI7M 4JI8M 2F5NA 2UUCM 8CATA 1L2BA 4GITA 4JN6A 1UM8A 4IBBA 1ORYB 4GKKM 4R3DA 4LJ7A 1N77A 2R4JA 4GKJM 4DR1M 1L2CA 2V1CA 5EXXA 1IBKM 2G5GX 1R6BX 4AKHA 3U6LA 1Q3BA 4XGIA 3C58A 3NBIA 3MJ5A 4B3SM 3GLFB 3U6QA 3PFIA 4FW9A 1T3TA 4FVMA 3SMSA 4BLCA 1KFVA 1J5EM 2Y21A 5FTMA 5KO3A 3KP1E 1EE8A 3TWMA 3BOSA 2XSZA 4LJ8A 2R18A 3FUWA 4MB7A 3KSJA 4LGYA 1L1ZA 4CISA 1G41A 4JI4M 3GP1A 4LF4M 5EXPA 3ZCBB 3GQ5A 4L15A 3HU2A 4LG2A 2CHGA 2L7IA 4Z6YA 2KA6B 5EJCA 4BBAA 3UGJA 4MGHA 3RFWA 4IIWA 3GO8A 1NHGC 1NNUC 1YE9A 1N34M 3HGIA 4DR7M 4IBCA 4AQYM 4TUWA 1NJGA 4G4NA 2HL7A 3VK8A 1JR3D 3KOYE 4PDGA 1G4AE 2UUBM 4NOOB 2Q2EB 1Z6TA 1DGHB 2R62A 4FWDA 1HT1E 4IBIA 2KZSA 2DHRA 1Q39A 3IG8A 2R65A 4DR2M 2UXDM 2QP9X 2J7NA 3GQ3A 3I4YA 2Z4SA 1GVNA 1GLNA 2YNMD 1TH2A 1K82A 2F5OA 3THGA 4DV4M 2XLJA 5BPVA 4L4UA 3JR4A 2XEPA 2OQ4A 3U5ZB 3U61B 1IBLM 2CV0A 5ITRA 1QAQA 1ZQ9A 4K0KM 1E32A 2DWNA 3A46A 4S12A 4LZJA 2RKOA 4I81A 1HR0M 1MU5A 7CATA 3GLHA 3GPXA 3AOEC 2C5RA 2KEBA 3PXGA 4ZPXA 4LFAM 4AG6A 1Z59A 2V6ZM 4M9XA 3GPUA 2QBYA 2QPAA 4BB9A 4LF5M 2X8AA 3QWLA 3JR5A 2LXEA 2HCBA 1HNZM 5BR8M 4B3MM 2R4EA 3HHYA 5F3WA 5IT9S 3FTEA 4NRVA 2G8LA 3T38A 2DZOB 2UXCM 2Y0QA 3U6DA 3FTCA 1NHWC 4P16A 3SASA 4DR6M 2Z7JA 4GC5A 2K47A 4GIPA 3EIHA 1R2YA 3M6AA 2KW0A 3SATA 5KPTA 4G4RA 1OJLA 1SXJA 3SYLA 1IBMM 1Q3CA 5C18A 2JA2A 1YSYA 3A98B 1DGFA 5ITTA 4LF7M 1YUBA 2ERCA 3WHKA 1JQJC 3L29A 3PVSA 4QHTA 4XBOA 3FD9A 2YR0A 3HU1A 3I4VA 3J2PB 4LRTA 3AJIB 3HHWA 4G4QA 3SARA 2DWZB 2KZUA 4LJAA 2YFQA 1I4WA 4II7A 4JXJA 4GMQA 4REZA 2QCUA 1IQPA 2LH0A 2KXEA 5E6JA 4OVZB 1NY6A 4JI3M 1K3XA 5E26A 3J81S 2ZAMA 1NY5A 3K8ZA 4FCWA 3TL4X 3KP0E 1QQWA 1R7RA 3UJNA 3MK6A 2DVWB 5EP4A 1IY2A 4B08A 2QENA 2NQ8C 3GLFA 1XMQM 3SAUA 1TDHA 2ZAOA 3LQRA 3K2LA 1G8PA 4IBDA 4KHPM 4CGYB 2C9OA 3DFZA 2F4VM 1N33M 1N75A 5KPZA 2I7PA 4D81A 5FTLA 3GLGB 3HHZA 1TDZA 3GPYA 3I51A 2X4AA 4WURA 4CHTB 3RGPA 1NJFA 5GKNA 1QANA 1TH3A 3T15A 1IN6A 3DA1A 4LFCM 4MGKE 2CFOA 3OTOM 2Z3XA 1QZMA 1PJJA 2VIIA 1IXRC 3HHXA 1N78A 3A45A 4PDIA 3SAWA 1W5TA 2ZM6M 3U60B 2UU9M 3KS4A 4M9ZA 5KQDA 2DWLA 1WXQA 3D8BA 2CHVA 3LVVA 2F5PA 2CUZA 3CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZU A;  4JI6 M;  1XNQ M;  3GPX A;  4DV0 M;  5A2Q S;  3SBJ A;  4LFA M;  3GPU A;  1Z59 A;  1Z5A A;  1I94 M;  3TWL A;  4DR3 M;  4LF5 M;  1L2D A;  4PCZ A;  1Z5B A;  4X64 M;  3JR5 A;  4X66 M;  1HNZ M;  4PD2 A;  5BR8 M;  4B3M M;  4LF9 M;  4B3T M;  1XNR M;  5IT9 S;  4NRV A;  2EA0 A;  4DV3 M;  4LFB M;  2UXC M;  2VQE M;  4DV1 M;  2ZBK B;  4ITQ A;  3U6D A;  1N36 M;  3SAS A;  4DR6 M;  2E5L M;  1FJG M;  4JI8 M;  1L1T A;  3DOA A;  4JI7 M;  2F5N A;  4B3R M;  2UUC M;  1R2Y A;  1L2B A;  4YY3 M;  3U6E A;  3SAT A;  2XZF A;  4GKK M;  4G4R A;  4DV6 M;  2HHH M;  4GKJ M;  4DR1 M;  1L2C A;  1R2Z A;  1IBK M;  1HNX M;  1IBM M;  1Q3C A;  3VK7 A;  5FLX S;  3U6L A;  1Q3B A;  3C58 A;  5ITT A;  4B3S M;  1NNJ A;  4LF7 M;  3U6Q A;  2UXB M;  3U6M A;  5ITY A;  2UUA M;  4JI2 M;  5IWA M;  4G4Q A;  1KFV A;  3GPP A;  1J5E M;  1XMO M;  3SAR A;  4NRW A;  1HNW M;  4YHH M;  1XC8 A;  1PM5 A;  3TWM A;  1EE8 A;  3JAM S;  4MB7 A;  3SAV A;  1L1Z A;  4CIS A;  4JI4 M;  3GP1 A;  4LF4 M;  4JI0 M;  2VQF M;  4DV2 M;  3GQ5 A;  4JI3 M;  1K3X A;  4DR5 M;  4JV5 M;  3U6O A;  4LF6 M;  3A42 A;  3W0F A;  5LMU M;  4LF8 M;  5ITU A;  3J7A S;  3J80 S;  3GO8 A;  5ITX E;  2OPF A;  1N34 M;  1Z5C A;  4DR7 M;  1MX0 A;  4OX9 M;  4AQY M;  4DV7 M;  4DUY M;  4G4O A;  4G4N A;  3SAU A;  1TDH A;  3VK8 A;  5ITX A;  4PDG A;  4X65 M;  4DUZ M;  3U6P A;  2F5S A;  2UUB M;  4NXN M;  1N32 M;  4KHP M;  2Q2E B;  1K3W A;  2F4V M;  1N33 M;  4NXM M;  1Q39 A;  1TDZ A;  5ITQ A;  4DR2 M;  3T1H M;  3GPY A;  4DR4 M;  2UXD M;  1PJI A;  3GQ3 A;  3U6S A;  4JYA M;  2F5Q A;  3U6C A;  4X62 M;  3GQ4 A;  1K82 A;  2F5O A;  4DV4 M;  4DV5 M;  4LFC M;  4JI1 M;  3JR4 A;  2OQ4 A;  3OTO M;  1IBL M;  1PJJ A;  5ITR A;  3A45 A;  4PDI A;  5LMN M;  2ZM6 M;  3SAW A;  2UU9 M;  4K0K M;  2HKJ A;  1XMQ M;  4JI5 M;  3A46 A;  3TWK A;  2F5P A;  3T1Y M;  3J81 S;  1HR0 M;  1MU5 A; 
#chains in the Genus database with same CATH topology
 3M7G A;  1EFU B;  4MM3 B;  1IM2 A;  2LVA A;  1LTM A;  1XNQ M;  1NSF A;  2OOB A;  1OFI A;  1Z5A A;  2FFJ A;  5JI2 E;  1I94 M;  1C1K A;  4I5S A;  4L78 A;  4M9S A;  3BBZ A;  4HL4 A;  1L2D A;  5EP1 A;  4KO8 A;  2DNA A;  4LJ4 A;  2VF7 A;  4LF9 M;  4QNR A;  2JZ0 A;  2WSF F;  4FCV A;  4AG5 A;  4DV3 M;  5H37 D;  4B7G A;  1DGG A;  2L7H A;  1N36 M;  2B3T A;  2RRU A;  3NWL A;  1IN8 A;  1LV7 A;  3R8F A;  1JB0 F;  1SXJ E;  3DOA A;  1L1T A;  1T6O A;  2DZL A;  4NL4 H;  1J7K A;  3U6E A;  1GL7 A;  4OW0 A;  4AI6 A;  1UFZ A;  2YQZ A;  1XXH B;  2I7N A;  1R2Z A;  1HNX M;  3D8L A;  1ZV1 A;  2EKK A;  1QAO A;  2DAK A;  3J27 B;  4L8R C;  3GLI B;  1IY1 A;  1OTR A;  3KDS E;  4LGM A;  2G3Q A;  1HT2 E;  3DZD A;  3GLH E;  4W5W A;  5FLX S;  2JY8 A;  2XGN A;  3FUU A;  4KLN A;  1D0L A;  1DGB A;  4D80 A;  2ZAN A;  3TE6 A;  1NNJ A;  1HQC A;  2RGO A;  4IBG A;  3C3E A;  2UXB M;  4RF0 A;  1YLA A;  3GRU A;  2UUA M;  3UZU A;  2H5X A;  3GPP A;  1XMO M;  1HNW M;  4LZZ A;  4YHH M;  1PM5 A;  1G3I A;  3QAU A;  1WGL A;  3WHL A;  4MGY E;  3PNY A;  2M5Z A;  2X49 A;  2L4F A;  4Y28 F;  2KHH A;  2P5T A;  3GLI A;  4QHS A;  3B9P A;  4AKI A;  1IN7 A;  1XXH A;  2LVO C;  2R45 A;  3FUV A;  4RF1 A;  4QOS A;  4F1I A;  4DR5 M;  3H4M A;  2LHC A;  3MMP A;  1SXJ D;  3SC3 A;  2BJW A;  1XWI A;  4JV5 M;  3U6O A;  5DYI A;  4LF6 M;  3ILK A;  3A42 A;  4FD2 A;  2O25 A;  3W0F A;  2JP7 A;  4GRI A;  2R44 A;  5ITU A;  4QNM A;  4LF8 M;  3J7A S;  3E9S A;  4F2L A;  2C9C A;  4GC9 A;  3GRV A;  4LCB A;  2XFT A;  5FTK A;  1OFH A;  2EO2 A;  2OPF A;  1G71 A;  1Z5C A;  1OIZ A;  1MX0 A;  2BNK A;  2XH9 A;  2EUC A;  1E9R A;  3KXE C;  3M0E A;  5IZ7 D;  2V1U A;  2MRO B;  1X37 A;  2QNJ A;  3RGS A;  2JWS A;  4G4O A;  2F5S A;  4RNA A;  2N35 A;  2L2D A;  4X65 M;  4DUZ M;  3U6P A;  2A5Y B;  2GNO A;  2XFS A;  3AKZ A;  1QUT A;  4NXN M;  4B7H A;  2HAK A;  2K0B X;  3L28 A;  1DO2 A;  3CGW A;  3KOW E;  3QYB A;  3ZH9 B;  4G6Z A;  3FTF A;  5C1B A;  3GLG E;  2QZ4 A;  4FWG A;  3KVW A;  4I4L A;  2O5R A;  4DR4 M;  1IXZ A;  1PJI A;  2OO9 A;  4LY6 A;  4JYA M;  1JR3 E;  4MH0 E;  3GQ4 A;  4AKG A;  2KNV A;  1IY0 A;  4GEW A;  3RE8 A;  1IN4 A;  3B7Z A;  3SMP A;  3U60 A;  4JI1 M;  2C98 A;  1HQY E;  3CTW B;  3R9X B;  2EKF A;  3J7B A;  2BWE A;  3GRR A;  5DNY A;  3H4J A;  4JI5 M;  3VKH A;  3FYC A;  3FRI A;  4OVZ A;  5IRE B;  2KRU A;  3FKE A;  2XZU A;  1PJS A;  4JI6 M;  5KQ8 A;  4NSO B;  5A2Q S;  4FCT A;  3SBJ A;  4ANR A;  1QVR A;  3HU3 A;  1KYI A;  3VDU A;  2C99 A;  3GLG A;  3AOE A;  4G3O A;  4M0W A;  3TWL A;  4WW0 A;  1IN5 A;  4PCZ A;  1Z5B A;  4X64 M;  4X66 M;  1NV9 A;  5EQT A;  5FSW A;  4Z8X A;  1TF0 B;  2K9D A;  2EA0 A;  3KS8 A;  2DKL A;  1V92 A;  2JNH A;  4LFB M;  4DV1 M;  2ZBK B;  3HX3 A;  2D7H A;  2CEA A;  3KOZ E;  3UK6 A;  4HEO A;  3KW6 A;  2FOI C;  2HWJ A;  3CF2 A;  1E94 E;  1V33 A;  4I8O A;  3K1J A;  2M60 A;  1Y8G A;  4B3R M;  1VG5 A;  2MH8 A;  2Y0T A;  2LWX A;  2RGH A;  5DYG A;  1AIP C;  1WIV A;  1ZAE A;  3W0L B;  1L8Q A;  4YY3 M;  3FYD A;  2AHM A;  1IXS B;  2L6O A;  4IBJ A;  2XZF A;  1GO5 A;  1D2N A;  4DV6 M;  1DO0 A;  2HHH M;  3FUX A;  4M0D A;  1XXH E;  3FRH A;  3B89 A;  3VK7 A;  2CP8 A;  4B7F A;  3FUT A;  1S3S A;  3IG5 A;  3HWS A;  3VKG A;  2DHY A;  2FNA A;  1OAI A;  2LVN C;  1TH4 A;  1SXJ C;  1T43 A;  3U6M A;  5ITY A;  2MR9 A;  1VDD A;  4QOZ C;  4JI2 M;  5IWA M;  5EXT A;  4WP2 A;  4NRW A;  3KSX A;  1IFY A;  1XC8 A;  3LVW A;  4EIW A;  3ZQJ A;  3JAM S;  3SAV A;  5DFL A;  3HKP A;  4HLQ A;  4JI0 M;  2VQF M;  5FTJ A;  2CE7 A;  3AFH A;  1P3Q Q;  2Z4R A;  4D82 A;  4DV2 M;  5EXS A;  1SXJ B;  3AL0 C;  1V34 A;  4NSR A;  4GHA A;  3K9O A;  4LJ5 A;  5JI3 E;  2R6F A;  1VDL A;  2W82 A;  3LQQ A;  1J09 A;  1GL6 A;  2KNZ A;  3U5Z A;  3AV0 A;  2DZN B;  5LMU M;  3TPZ A;  3SYK A;  4AZF A;  2LNH C;  3J80 S;  2O01 F;  2EJS A;  2L09 A;  5ITX E;  1W5S A;  3L26 A;  4CJ6 A;  3GRY A;  4Q7J A;  2DAI A;  4OX9 M;  4IJE A;  4FWH A;  3FE3 A;  4L16 A;  3W67 A;  4DUY M;  4DV7 M;  5ITX A;  3L27 A;  1QDT A;  3SHG B;  2R46 A;  3L25 A;  3LW5 F;  1N32 M;  1A5T A;  1D0K A;  1K3W A;  3KFU G;  3VFD A;  5KPR A;  1MN3 A;  2Y20 A;  4KOD A;  4LRS A;  4NXM M;  4MGZ E;  2J7O A;  1OQY A;  1QYR A;  2QBY B;  3Q8X A;  5ITQ A;  1H6U A;  3T1H M;  4MGI E;  1AUA A;  3GLH B;  1RU3 A;  2BJV A;  2KNA A;  3U6S A;  2DXI A;  2F5Q A;  2CV1 A;  3PNV A;  3U6C A;  5FTN A;  4X62 M;  2L4E A;  3I04 M;  3KOX E;  3ZC7 B;  3K92 A;  4DV5 M;  4IBK A;  3E4R A;  1E9S A;  1JR3 A;  1XHB A;  3TQS A;  3V76 A;  3U61 A;  5LMN M;  2FE8 A;  3HJS A;  1KSF X;  4IJF A;  2CV2 A;  2HKJ A;  4A3V B;  2DWM A;  3TWK A;  3T1Y M;  4GH9 A;  1QAM A;  2JZ1 A;  1WR1 B;  3EIE A;  1SG9 A;  4DV0 M;  4LJ6 A;  3UMM A;  2CWB A;  4DBG B;  5EP2 A;  3MHV C;  3VDP A;  2D7G A;  4R7G A;  4PT5 A;  3FTD A;  4IBF A;  4DR3 M;  1FNN A;  1DGH A;  2C96 A;  2CHQ A;  4GHL A;  3HJ8 A;  3QYE A;  3LMM A;  4PD2 A;  4B3T M;  1XNR M;  3SFZ A;  4IBE A;  3HJQ A;  1TGU A;  3LCV B;  2VQE M;  1G59 A;  2D7E A;  3L2A A;  2XSZ D;  3C3D A;  3VLF B;  4ITQ A;  3CF6 E;  2MJ5 B;  1XB2 B;  1GKI A;  5EP3 A;  3AOG A;  3SHF A;  1NVM A;  2H1R A;  2KRK A;  4AW4 A;  4LJ9 A;  2E5L M;  1FJG M;  2XF3 A;  4JI7 M;  4JI8 M;  2F5N A;  1GJS A;  1MJG M;  3NBX X;  2UUC M;  2DAG A;  8CAT A;  1L2B A;  4GIT A;  4JN6 A;  3B7Q A;  1UM8 A;  4RKU F;  1C7Y A;  4IBB A;  1ORY B;  2LVQ D;  4R3D A;  4GKK M;  4LJ7 A;  1N77 A;  2R4J A;  4GKJ M;  4DR1 M;  1L2C A;  2V1C A;  5EXX A;  1IBK M;  2G5G X;  1R6B X;  4AKH A;  3U6L A;  1Q3B A;  2WSE F;  3I01 M;  4XGI A;  3C58 A;  3NBI A;  3MJ5 A;  4B3S M;  2Z8Y M;  3GLF B;  2MGW A;  3U6Q A;  2WSC F;  2K6B A;  3PFI A;  4FW9 A;  1T3T A;  1TTE A;  4FVM A;  3SMS A;  4BLC A;  1KFV A;  1J5E M;  2Y21 A;  5FTM A;  5KO3 A;  3KP1 E;  1EE8 A;  2DI0 A;  3TWM A;  2ZTD A;  3BOS A;  2XSZ A;  4LJ8 A;  2R18 A;  3FUW A;  4MB7 A;  3KSJ A;  4LGY A;  1L1Z A;  4CIS A;  1G41 A;  4JI4 M;  3GP1 A;  4LF4 M;  1ZMV A;  5EXP A;  3ZCB B;  3GQ5 A;  4L15 A;  3HU2 A;  1BVS A;  4LG2 A;  2CHG A;  2L7I A;  4Z6Y A;  2KA6 B;  2VDB B;  5EJC A;  4BBA A;  4OU7 A;  3UGJ A;  4MGH A;  3RFW A;  4IIW A;  3GO8 A;  1NHG C;  1NNU C;  3B74 A;  1YE9 A;  2LBC A;  2DAM A;  3E21 A;  3HGI A;  1N34 M;  4DR7 M;  4IBC A;  3Q8G A;  4AQY M;  4TUW A;  1QDR A;  1NJG A;  4G4N A;  2HL7 A;  3VK8 A;  1JR3 D;  3KOY E;  4PDG A;  1G4A E;  2ZTC A;  2UUB M;  4NOO B;  1NO1 A;  2Q2E B;  1Z6T A;  1DGH B;  2R62 A;  3BXW A;  4FWD A;  1DV0 A;  1ZMU A;  1HT1 E;  4IBI A;  2KZS A;  4NC6 A;  1NV8 A;  2DHR A;  1Q39 A;  3IG8 A;  2R65 A;  4DR2 M;  2UXD M;  2QP9 X;  1TR8 A;  3GLI E;  2J7N A;  3GQ3 A;  3I4Y A;  2Z4S A;  1GVN A;  1GLN A;  2YNM D;  1TH2 A;  1K82 A;  2F5O A;  3HZJ A;  3THG A;  4DV4 M;  1QUS A;  2XLJ A;  5BPV A;  5L8R F;  4L4U A;  3JR4 A;  2XEP A;  2OQ4 A;  3U5Z B;  3W68 A;  3U61 B;  1IBL M;  2CV0 A;  1PGY A;  1ZMW A;  1QAQ A;  5ITR A;  1CUK A;  1ZQ9 A;  4K0K M;  1E32 A;  2DWN A;  1F4I A;  1WJ7 A;  3A46 A;  4S12 A;  4LZJ A;  2RKO A;  4I81 A;  1HR0 M;  1EIJ A;  1MU5 A;  7CAT A;  2JUJ A;  3GLH A;  2QQ8 A;  3GPX A;  3AOE C;  2C5R A;  2KEB A;  3PXG A;  4ZPX A;  4LFA M;  4AG6 A;  1Z59 A;  2V6Z M;  1GJT A;  4M9X A;  3GPU A;  2QBY A;  2JXN A;  2QPA A;  4BB9 A;  3LCU A;  4LF5 M;  2X8A A;  3QWL A;  2QHO B;  3JR5 A;  2LXE A;  1R5L A;  1GAB A;  2HCB A;  1HNZ M;  5BR8 M;  4B3M M;  2R4E A;  1OIP A;  2DAE A;  3HHY A;  2FS1 A;  4NRV A;  5F3W A;  3FTE A;  2G8L A;  5IT9 S;  3T38 A;  2DZO B;  1WGN A;  2UXC M;  2APL A;  2Y0Q A;  3U6D A;  3FTC A;  1NHW C;  4P16 A;  3SAS A;  4DR6 M;  2Z7J A;  4GC5 A;  2K47 A;  2VF8 A;  4GIP A;  1VEK A;  2GQF A;  3EIH A;  4KT0 F;  1D0M A;  1R2Y A;  3M6A A;  2KW0 A;  3SAT A;  5KPT A;  4G4R A;  1OJL A;  1SXJ A;  3B7N A;  3SYL A;  1IBM M;  1Q3C A;  5C18 A;  2KDL A;  2LVP C;  2JA2 A;  1YSY A;  3A98 B;  1DGF A;  2CRU A;  1PJT A;  5ITT A;  4LF7 M;  1YUB A;  2ERC A;  3WHK A;  1JQJ C;  3L29 A;  3PVS A;  4QHT A;  4XBO A;  4R71 A;  2LTU A;  3FD9 A;  2YR0 A;  3HU1 A;  3I4V A;  2LHG A;  3J2P B;  4LRT A;  3AJI B;  3HHW A;  4G4Q A;  3SAR A;  2DWZ B;  2KZU A;  4LJA A;  2YFQ A;  1I4W A;  4II7 A;  4JXJ A;  4GMQ A;  4REZ A;  1R4G A;  2QCU A;  1IQP A;  2LH0 A;  2KXE A;  5E6J A;  4OVZ B;  1QZE A;  3K9P A;  1NY6 A;  4JI3 M;  1K3X A;  5E26 A;  1IXS A;  3J81 S;  2ZAM A;  1HJP A;  3E46 A;  3F92 A;  1NY5 A;  3K8Z A;  1OKS A;  4FCW A;  3TL4 X;  4CIZ A;  3KP0 E;  1QQW A;  1R7R A;  1VQ1 A;  3UJN A;  3MK6 A;  2OOA A;  2DVW B;  5EP4 A;  1VEG A;  1IY2 A;  4B08 A;  2QEN A;  3T6P A;  2QSF X;  2WZJ A;  4P17 A;  2NQ8 C;  3GLF A;  2BWB A;  4UN2 B;  1XMQ M;  3SAU A;  1TDH A;  3IHP A;  2ZAO A;  2JY5 A;  3IEC A;  2FH0 A;  3C9P A;  3K2L A;  3LQR A;  1VEJ A;  1G8P A;  4IBD A;  4KHP M;  4CGY B;  2JY7 A;  2C9O A;  3DFZ A;  2F4V M;  1WHC A;  3HY5 A;  4XK8 F;  1N75 A;  1N33 M;  5KPZ A;  2I7P A;  4D81 A;  5FTL A;  3GLG B;  3HHZ A;  1TDZ A;  3GPY A;  2DEN A;  3I51 A;  3GLF E;  2X4A A;  4WUR A;  4CHT B;  3RGP A;  1NJF A;  5GKN A;  1QAN A;  1TH3 A;  3T15 A;  1IN6 A;  3DA1 A;  4LFC M;  2JY6 B;  4MGK E;  1PJQ A;  2CFO A;  1Q02 A;  3OTO M;  2Z3X A;  1QZM A;  1OAO C;  2R0I A;  1PJJ A;  2VII A;  1IXR C;  3HHX A;  1N78 A;  3A45 A;  4PDI A;  3SAW A;  1W5T A;  2ZM6 M;  3U60 B;  2UU9 M;  3KS4 A;  2J5Y A;  4M9Z A;  5KQD A;  2DWL A;  1WXQ A;  3D8B A;  1PRB A;  2CHV A;  4L6V 6;  3LVV A;  2F5P A;  2CUZ A;  3CF0 A; 
#chains in the Genus database with same CATH homology
 3M7G A;  4MM3 B;  1IM2 A;  1XNQ M;  1NSF A;  1OFI A;  1Z5A A;  2FFJ A;  5JI2 E;  1I94 M;  1C1K A;  4I5S A;  4L78 A;  4M9S A;  4HL4 A;  1L2D A;  5EP1 A;  4KO8 A;  4LJ4 A;  4LF9 M;  4QNR A;  4FCV A;  4AG5 A;  4DV3 M;  5H37 D;  4B7G A;  1DGG A;  2L7H A;  1N36 M;  3NWL A;  1IN8 A;  1LV7 A;  3R8F A;  1L1T A;  1SXJ E;  3DOA A;  4NL4 H;  1J7K A;  3U6E A;  1GL7 A;  4OW0 A;  4AI6 A;  2YQZ A;  1XXH B;  2I7N A;  1R2Z A;  1HNX M;  3D8L A;  3J27 B;  1QAO A;  4L8R C;  3GLI B;  1IY1 A;  3KDS E;  4LGM A;  5FLX S;  4OU7 A;  1HT2 E;  3DZD A;  4W5W A;  2XGN A;  3FUU A;  4KLN A;  1DGB A;  4D80 A;  2ZAN A;  3TE6 A;  1NNJ A;  1HQC A;  2RGO A;  4IBG A;  2UXB M;  4RF0 A;  3GRU A;  2UUA M;  3UZU A;  3GPP A;  1XMO M;  1HNW M;  4LZZ A;  4YHH M;  1PM5 A;  1G3I A;  3QAU A;  3WHL A;  4MGY E;  3PNY A;  2M5Z A;  2X49 A;  2P5T A;  3GLI A;  4QHS A;  3B9P A;  4AKI A;  1IN7 A;  1XXH A;  2R45 A;  3FUV A;  4RF1 A;  4QOS A;  4DR5 M;  3H4M A;  1SXJ D;  3SC3 A;  2BJW A;  1XWI A;  4JV5 M;  3U6O A;  5DYI A;  4LF6 M;  3ILK A;  3A42 A;  4FD2 A;  3W0F A;  4LF8 M;  4GRI A;  5ITU A;  4QNM A;  3J7A S;  3E9S A;  2C9C A;  4GC9 A;  3GRV A;  4LCB A;  2XFT A;  5FTK A;  1OFH A;  2EO2 A;  2OPF A;  3M0E A;  1Z5C A;  2BNK A;  1MX0 A;  2XH9 A;  3KXE C;  2EUC A;  1E9R A;  5IZ7 D;  2V1U A;  1X37 A;  4G4O A;  3RGS A;  2F5S A;  4RNA A;  4X65 M;  4DUZ M;  3U6P A;  2A5Y B;  2XFS A;  3AKZ A;  4NXN M;  4B7H A;  3L28 A;  1DO2 A;  3KOW E;  3ZH9 B;  4G6Z A;  3FTF A;  5C1B A;  2QZ4 A;  4FWG A;  3KVW A;  4I4L A;  2O5R A;  4DR4 M;  1IXZ A;  1PJI A;  4LY6 A;  4JYA M;  4MH0 E;  3GQ4 A;  4AKG A;  1IY0 A;  3RE8 A;  1IN4 A;  3SMP A;  3U60 A;  4JI1 M;  2C98 A;  1HQY E;  3CTW B;  3R9X B;  3J7B A;  3GRR A;  5DNY A;  4JI5 M;  3VKH A;  3FYC A;  4OVZ A;  5IRE B;  2KRU A;  3FKE A;  2XZU A;  4JI6 M;  5KQ8 A;  4NSO B;  5A2Q S;  4FCT A;  3SBJ A;  1QVR A;  3HU3 A;  1KYI A;  3VDU A;  2C99 A;  3GLG A;  3AOE A;  4M0W A;  3TWL A;  4WW0 A;  1IN5 A;  4PCZ A;  1Z5B A;  4X64 M;  4X66 M;  5EQT A;  5FSW A;  4Z8X A;  2EA0 A;  3KS8 A;  4LFB M;  4DV1 M;  2ZBK B;  3KOZ E;  2D7H A;  2CEA A;  3UK6 A;  3KW6 A;  2FOI C;  3CF2 A;  1E94 E;  4I8O A;  3K1J A;  2M60 A;  4B3R M;  2Y0T A;  2LWX A;  2RGH A;  5DYG A;  3W0L B;  1ZAE A;  4YY3 M;  1L8Q A;  3FYD A;  2AHM A;  1IXS B;  2L6O A;  4IBJ A;  2XZF A;  1D2N A;  4DV6 M;  1DO0 A;  2HHH M;  3FUX A;  4M0D A;  3VK7 A;  4B7F A;  3FUT A;  1S3S A;  3IG5 A;  3HWS A;  3VKG A;  2FNA A;  1TH4 A;  1SXJ C;  3U6M A;  5ITY A;  1VDD A;  4QOZ C;  4JI2 M;  5IWA M;  5EXT A;  4NRW A;  3KSX A;  1XC8 A;  3LVW A;  4EIW A;  3JAM S;  3SAV A;  3HKP A;  4HLQ A;  4JI0 M;  2VQF M;  5FTJ A;  2CE7 A;  3AFH A;  2Z4R A;  4DV2 M;  4D82 A;  5EXS A;  1SXJ B;  3AL0 C;  4NSR A;  4GHA A;  4LJ5 A;  5JI3 E;  2W82 A;  3LQQ A;  1J09 A;  1GL6 A;  3U5Z A;  3AV0 A;  2DZN B;  5LMU M;  3TPZ A;  3SYK A;  4AZF A;  2LNH C;  3J80 S;  5ITX E;  2L09 A;  1W5S A;  3L26 A;  3GRY A;  4OX9 M;  4IJE A;  4FWH A;  4DV7 M;  4L16 A;  4DUY M;  5ITX A;  3L27 A;  3L25 A;  3SHG B;  2R46 A;  1N32 M;  1K3W A;  3KFU G;  3VFD A;  5KPR A;  4KOD A;  2Y20 A;  4LRS A;  4NXM M;  4MGZ E;  2J7O A;  1QYR A;  2QBY B;  3Q8X A;  5ITQ A;  1H6U A;  3T1H M;  4MGI E;  3GLH B;  2BJV A;  3U6S A;  2DXI A;  2F5Q A;  2CV1 A;  3PNV A;  3U6C A;  5FTN A;  4X62 M;  3KOX E;  3ZC7 B;  3K92 A;  4DV5 M;  4IBK A;  3E4R A;  1E9S A;  1JR3 A;  1XHB A;  3TQS A;  3U61 A;  5LMN M;  2FE8 A;  3HJS A;  1KSF X;  4IJF A;  2CV2 A;  2HKJ A;  4A3V B;  2DWM A;  3TWK A;  3T1Y M;  4GH9 A;  1QAM A;  3EIE A;  4DV0 M;  4LJ6 A;  3UMM A;  5EP2 A;  3MHV C;  3VDP A;  2D7G A;  4R7G A;  4PT5 A;  3FTD A;  4IBF A;  4DR3 M;  1FNN A;  1DGH A;  2C96 A;  2CHQ A;  4GHL A;  3HJ8 A;  3LMM A;  4PD2 A;  4B3T M;  1XNR M;  3SFZ A;  4IBE A;  3HJQ A;  1TGU A;  2VQE M;  1G59 A;  2D7E A;  3L2A A;  2XSZ D;  3VLF B;  4ITQ A;  3CF6 E;  1GKI A;  5EP3 A;  3AOG A;  3SHF A;  1NVM A;  2H1R A;  2KRK A;  4AW4 A;  4LJ9 A;  2E5L M;  1FJG M;  2XF3 A;  4JI7 M;  4JI8 M;  2F5N A;  2UUC M;  8CAT A;  1L2B A;  4GIT A;  4JN6 A;  1UM8 A;  4IBB A;  1ORY B;  4GKK M;  4R3D A;  4LJ7 A;  1N77 A;  2R4J A;  4GKJ M;  4DR1 M;  1L2C A;  2V1C A;  5EXX A;  1IBK M;  2G5G X;  1R6B X;  4AKH A;  3U6L A;  1Q3B A;  4XGI A;  3C58 A;  3NBI A;  3MJ5 A;  4B3S M;  3GLF B;  3U6Q A;  3PFI A;  4FW9 A;  1T3T A;  4FVM A;  3SMS A;  4BLC A;  1KFV A;  1J5E M;  2Y21 A;  5FTM A;  5KO3 A;  3KP1 E;  1EE8 A;  3TWM A;  3BOS A;  2XSZ A;  4LJ8 A;  2R18 A;  3FUW A;  4MB7 A;  3KSJ A;  4LGY A;  1L1Z A;  4CIS A;  1G41 A;  4JI4 M;  3GP1 A;  4LF4 M;  5EXP A;  3ZCB B;  3GQ5 A;  4L15 A;  3HU2 A;  4LG2 A;  2CHG A;  2L7I A;  4Z6Y A;  2KA6 B;  5EJC A;  4BBA A;  3UGJ A;  4MGH A;  3RFW A;  4IIW A;  3GO8 A;  1NHG C;  1NNU C;  1YE9 A;  1N34 M;  3HGI A;  4DR7 M;  4IBC A;  4AQY M;  4TUW A;  1NJG A;  4G4N A;  2HL7 A;  3VK8 A;  1JR3 D;  3KOY E;  4PDG A;  1G4A E;  2UUB M;  4NOO B;  2Q2E B;  1Z6T A;  1DGH B;  2R62 A;  4FWD A;  1HT1 E;  4IBI A;  2KZS A;  2DHR A;  1Q39 A;  3IG8 A;  2R65 A;  4DR2 M;  2UXD M;  2QP9 X;  2J7N A;  3GQ3 A;  3I4Y A;  2Z4S A;  1GVN A;  1GLN A;  2YNM D;  1TH2 A;  1K82 A;  2F5O A;  3THG A;  4DV4 M;  2XLJ A;  5BPV A;  4L4U A;  3JR4 A;  2XEP A;  2OQ4 A;  3U5Z B;  3U61 B;  1IBL M;  2CV0 A;  5ITR A;  1QAQ A;  1ZQ9 A;  4K0K M;  1E32 A;  2DWN A;  3A46 A;  4S12 A;  4LZJ A;  2RKO A;  4I81 A;  1HR0 M;  1MU5 A;  7CAT A;  3GLH A;  3GPX A;  3AOE C;  2C5R A;  2KEB A;  3PXG A;  4ZPX A;  4LFA M;  4AG6 A;  1Z59 A;  2V6Z M;  4M9X A;  3GPU A;  2QBY A;  2QPA A;  4BB9 A;  4LF5 M;  2X8A A;  3QWL A;  3JR5 A;  2LXE A;  2HCB A;  1HNZ M;  5BR8 M;  4B3M M;  2R4E A;  3HHY A;  5F3W A;  5IT9 S;  3FTE A;  4NRV A;  2G8L A;  3T38 A;  2DZO B;  2UXC M;  2Y0Q A;  3U6D A;  3FTC A;  1NHW C;  4P16 A;  3SAS A;  4DR6 M;  2Z7J A;  4GC5 A;  2K47 A;  4GIP A;  3EIH A;  1R2Y A;  3M6A A;  2KW0 A;  3SAT A;  5KPT A;  4G4R A;  1OJL A;  1SXJ A;  3SYL A;  1IBM M;  1Q3C A;  5C18 A;  2JA2 A;  1YSY A;  3A98 B;  1DGF A;  5ITT A;  4LF7 M;  1YUB A;  2ERC A;  3WHK A;  1JQJ C;  3L29 A;  3PVS A;  4QHT A;  4XBO A;  3FD9 A;  2YR0 A;  3HU1 A;  3I4V A;  3J2P B;  4LRT A;  3AJI B;  3HHW A;  4G4Q A;  3SAR A;  2DWZ B;  2KZU A;  4LJA A;  2YFQ A;  1I4W A;  4II7 A;  4JXJ A;  4GMQ A;  4REZ A;  2QCU A;  1IQP A;  2LH0 A;  2KXE A;  5E6J A;  4OVZ B;  1NY6 A;  4JI3 M;  1K3X A;  5E26 A;  3J81 S;  2ZAM A;  1NY5 A;  3K8Z A;  4FCW A;  3TL4 X;  3KP0 E;  1QQW A;  1R7R A;  3UJN A;  3MK6 A;  2DVW B;  5EP4 A;  1IY2 A;  4B08 A;  2QEN A;  2NQ8 C;  3GLF A;  1XMQ M;  3SAU A;  1TDH A;  2ZAO A;  3LQR A;  3K2L A;  1G8P A;  4IBD A;  4KHP M;  4CGY B;  2C9O A;  3DFZ A;  2F4V M;  1N33 M;  1N75 A;  5KPZ A;  2I7P A;  4D81 A;  5FTL A;  3GLG B;  3HHZ A;  1TDZ A;  3GPY A;  3I51 A;  2X4A A;  4WUR A;  4CHT B;  3RGP A;  1NJF A;  5GKN A;  1QAN A;  1TH3 A;  3T15 A;  1IN6 A;  3DA1 A;  4LFC M;  4MGK E;  2CFO A;  3OTO M;  2Z3X A;  1QZM A;  1PJJ A;  2VII A;  1IXR C;  3HHX A;  1N78 A;  3A45 A;  4PDI A;  3SAW A;  1W5T A;  2ZM6 M;  3U60 B;  2UU9 M;  3KS4 A;  4M9Z A;  5KQD A;  2DWL A;  1WXQ A;  3D8B A;  2CHV A;  3LVV A;  2F5P A;  2CUZ A;  3CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...