5LMUM

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
molecule keywords 16S ribosomal RNA
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 5lmuM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 5lmuM02
4MB7A 3GP1A 4DUZM 4PDIA 4DR7M 1Q3CA 2UU9M 2VQFM 1Z5BA 3W0FA 2ZM6M 3J7AS 3TWKA 4LF7M 3GQ3A 1I94M 3T1HM 4X62M 3GPXA 4X66M 4LF6M 1HNWM 4JI3M 4G4OA 4JI0M 3U6OA 4JI7M 4DV0M 4DUYM 4YHHM 4LFCM 2UXDM 4B3TM 2Q2EB 1XC8A 4LF4M 1K3WA 1L2CA 4DR5M 5A2QS 4B3MM 4LFAM 4DV5M 4NRVA 3U6PA 4GKJM 4CISA 1L1ZA 4JI5M 5ITQA 1J5EM 5ITXA 3C58A 4DR3M 5LMUM 3SAUA 4GKKM 4X64M 4X65M 5BR8M 3GPYA 1L2DA 2OQ4A 3U6EA 4B3RM 4DR6M 4LF9M 4DV6M 1MX0A 4LFBM 1NNJA 3GPUA 3A42A 4LF5M 3J80S 3SATA 3U6MA 3SARA 1TDHA 1N36M 4NRWA 5ITXE 4G4QA 2UXCM 5ITUA 1XMOM 4G4NA 2E5LM 1EE8A 5ITTA 1PM5A 1PJJA 1KFVA 4NXMM 4JI1M 2EA0A 4KHPM 1N34M 4JYAM 2UUCM 1FJGM 3JAMS 4DV2M 1Z5AA 5FLXS 3VK7A 2UUAM 1N33M 2XZFA 2OPFA 4JI4M 5IWAM 3GQ4A 4LF8M 1Z59A 3JR4A 4DV1M 2UXBM 4B3SM 1HNZM 2XZUA 3A46A 1R2YA 2F5QA 1XNQM 3SASA 1L2BA 2F5NA 4PD2A 1Z5CA 3GPPA 3VK8A 1XMQM 1K82A 1IBLM 4DR2M 1N32M 3SAWA 2HHHM 4JI6M 1L1TA 3TWMA 3J81S 5ITYA 1MU5A 2VQEM 4JI2M 1R2ZA 5IT9S 4DR4M 2F5SA 4JI8M 1PJIA 1XNRM 2UUBM 4NXNM 3GO8A 4DV7M 3U6CA 5ITRA 1IBKM 1Q3BA 4G4RA 4DV3M 2F4VM 3SAVA 2F5PA 4DV4M 4PDGA 3U6QA 3U6DA 3JR5A 4OX9M 4K0KM 3GQ5A 1HNXM 3A45A 3TWLA 1K3XA 3DOAA 1IBMM 2F5OA 1Q39A 4ITQA 2ZBKB 4AQYM 3SBJA 1HR0M 4PCZA 5LMNM 1TDZA 4JV5M 4YY3M 3OTOM 4DR1M 2HKJA 3U6LA 3T1YM 3U6SA
chains in the Genus database with same CATH superfamily
3GP1A 2UU9M 4GMQA 2C99A 1DV0A 1TR8A 2C9CA 1WHCA 1Z5BA 4WURA 3VDPA 3W67A 3AV0A 3C9PA 1DGHA 1IFYA 1NHGC 4S12A 3GQ3A 1I94M 3GLIA 2BJVA 3K8ZA 3GPXA 3HGIA 3LVVA 1DGGA 4KLNA 4JI3M 4G4OA 3U6OA 2JY7A 2LH0A 3SC3A 4ANRA 1N78A 1I4WA 3R9XB 3GRVA 2CFOA 3UK6A 1EIJA 2UXDM 4HLQA 1K3WA 5A2QS 1IXRC 2L7HA 3U5ZB 4QNRA 1J09A 1SXJA 1TTEA 4I5SA 5DFLA 3GLGE 4MGKE 5FTJA 2CEAA 2XSZA 4CISA 1L1ZA 1ZMVA 3BOSA 1QAQA 2KRUA 5EP1A 2XGNA 1H6UA 3C58A 4DR3M 2ERCA 3SAUA 2LVNC 1VEJA 4GKKM 1J7KA 2KZSA 2FOIC 1WGLA 1NY5A 3U6EA 1NNUC 3GRRA 2O5RA 2BNKA 2L4EA 1JR3A 1DGBA 2R4JA 3K9PA 1MX0A 4L15A 3KS8A 3B74A 2CHVA 3PFIA 3J80S 3SATA 4IBEA 4LZZA 2KNZA 2DWZB 2HCBA 2L09A 3AOEA 3PXGA 2RRUA 3UZUA 5ITUA 2E5LM 3FKEA 5ITTA 1PJSA 1KFVA 4FWHA 4I8OA 5E26A 4JI1M 4NXMM 5EXXA 2EA0A 3FTEA 4JYAM 1XXHB 1FJGM 2QENA 1XWIA 3FYCA 3VK7A 4QOZC 2UUAM 1TH4A 4IJEA 4AZFA 2Z4RA 2XZFA 1QZMA 1T3TA 2OO9A 1C1KA 3LCUA 1T43A 3CGWA 3EIHA 3NBIA 3LVWA 2KNVA 2M5ZA 3MJ5A 2XZUA 2DWMA 2V6ZM 2F5QA 4CJ6A 4I4LA 2EUCA 3RGPA 2F5NA 4REZA 1R4GA 1Z5CA 3GPPA 1XMQM 3KW6A 3FTFA 1YUBA 4DR2M 3T15A 4EIWA 2HHHM 3MHVC 3SMPA 3IECA 4IJFA 1HT2E 3U60A 1NO1A 2LVOC 1MU5A 1QVRA 3ZCBB 3GRYA 2JNHA 1YLAA 3SARA 3UMMA 5EXSA 4B7GA 2H5XA 3FUWA 1DGHB 4KODA 1PJIA 1V33A 1OAOC 3GLIB 2J7NA 3GLHA 4A3VB 2DAGA 2DZLA 1SXJD 2JY6B 4II7A 2GNOA 3U5ZA 1HT1E 4PT5A 3U6CA 4LJ9A 4XBOA 2DZOB 4WW0A 1GLNA 2OOAA 1IM2A 3AL0C 5EP3A 4HEOA 2K0BX 2DNAA 4OX9M 4K0KM 4L4UA 2F5OA 2GQFA 3DOAA 3J2PB 2DAMA 4ITQA 3VKHA 4M9ZA 4AQYM 4JV5M 4WP2A 3SMSA 4PCZA 1JR3D 2FFJA 1SXJB 5LMNM 2FS1A 2AHMA 2R4EA 3TE6A 3T1YM 4OW0A 3I04M 2RGHA 2R46A 2W82A 2CRUA 4DUZM 1TH3A 1VEGA 2KRKA 3K92A 4MH0E 5KPRA 3L29A 3U61A 3D8BA 1QYRA 2QZ4A 2ZM6M 5FTMA 4P17A 4LF7M 3FRHA 1NV9A 1AIPC 4IBCA 4B08A 2KZUA 1EFUB 3HHWA 1G3IA 2EO2A 2LXEA 4HL4A 2FH0A 3W0LB 3LQQA 2ZTDA 2G8LA 4GITA 2RKOA 4YHHM 3HJ8A 4LFCM 5IREB 3K1JA 4GEWA 3T38A 2QPAA 3LMMA 3MMPA 4B3TM 2WSCF 5H37D 3CF6E 1L2CA 4L6V6 3L27A 3SYKA 2QHOB 1VG5A 3WHKA 4CHTB 4DV5M 2DWNA 4GC5A 3W68A 1DO0A 2CV0A 3QYEA 4MM3B 4NSOB 2XLJA 5ITQA 1IY1A 1F4IA 2LVAA 2LVQD 5LMUM 4QOSA 4X64M 4X65M 2R65A 2Z4SA 3GPYA 4RNAA 2R6FA 2OQ4A 1E32A 4B3RM 3FE3A 4XK8F 2LBCA 3HHZA 3U60B 4LF9M 5DNYA 1LV7A 4DV6M 2XFSA 3BBZA 2O25A 1PRBA 1NSFA 3A42A 4FCVA 4LG2A 2UXCM 2R62A 3RFWA 3U6MA 1N36M 3E9SA 2CUZA 2QP9X 4RF1A 5ITXE 4LJ7A 4G4QA 3CF2A 2HL7A 4G4NA 3GLHB 1EE8A 1XMOM 5C18A 1PM5A 1DGFA 4FVMA 2JZ0A 4KHPM 2EJSA 2UUCM 1PJTA 1GL6A 2XF3A 1NV8A 3FUVA 1HQYE 1Z5AA 2LWXA 4QHTA 2MGWA 2DZNB 1X37A 4JI4M 1OTRA 5IWAM 3GQ4A 3KOYE 4AKGA 4M0DA 4FD2A 2Y0TA 2MH8A 4B3SM 2D7EA 1HNZM 1OJLA 3KDSE 1IY0A 1UFZA 1R2YA 1XNQM 4TUWA 4AW4A 4R71A 3HHXA 1OIPA 3KFUG 3GLHE 4IBFA 4RKUF 1GKIA 1W5SA 1OKSA 1N75A 3I01M 1L1TA 2P5TA 3U61B 3ILKA 2VQEM 4D80A 1G71A 4JI2M 1HJPA 3KOWE 5KQDA 3VLFB 2D7HA 4DR4M 4JI8M 4AG6A 1L8QA 3J7BA 2JP7A 3SFZA 1A5TA 5EQTA 1ZAEA 4IBGA 2DVWB 5GKNA 1IY2A 2L7IA 1Q3BA 2DKLA 2X8AA 1VDDA 4G4RA 4LJ8A 4DV3M 2F4VM 2DENA 2Z8YM 3JR5A 4LY6A 3PVSA 3GQ5A 4L78A 3A45A 3B7NA 3FTCA 3FTDA 2C98A 4NC6A 1Q39A 4B7FA 4CGYB 8CATA 1K3XA 2ZBKB 3NWLA 4M9XA 2L4FA 1TDZA 2CV2A 3SHGB 5IZ7D 3OTOM 1V92A 4DR1M 2KA6B 2LTUA 4AKIA 1D0MA 2HKJA 3FUUA 2Y21A 4AI6A 2LVPC 2DI0A 1XXHE 3U6SA 2HWJA 1QZEA 1D2NA 1FNNA 3C3DA 4W5WA 3HU1A 3B7ZA 4PDIA 2Y0QA 3AOGA 3FUXA 4OU7A 2VQFM 2VF8A 4R3DA 2G5GX 2DXIA 1HQCA 2EKKA 4LJAA 4L8RC 4NOOB 3J7AS 1D0LA 2D7GA 2DAKA 4LRSA 1Z6TA 4LJ5A 4M9SA 3T1HM 2JXNA 1WGNA 4LF6M 1HNWM 3DA1A 3CF0A 3GLGA 1SG9A 4IBKA 5F3WA 1GABA 1XHBA 4DUYM 1G59A 1ZQ9A 2JWSA 2MJ5B 2LHGA 3H4JA 2Q2EB 3THGA 3TL4X 1D0KA 1TF0B 3HHYA 4LF4M 4DR5M 1OAIA 3E21A 5C1BA 4JN6A 3GLIE 4B3MM 1OQYA 2KHHA 5DYIA 1NJGA 4NRVA 4JXJA 3I4VA 3U6PA 2DWLA 1P3QQ 2NQ8C 3M7GA 1QQWA 3KP1E 4NSRA 2R44A 4BBAA 1J5EM 1Q02A 3ZC7B 3KP0E 2BWBA 1PGYA 3LCVB 1SXJC 3VFDA 1JB0F 4GH9A 3H4MA 1L2DA 2ZAMA 2LNHC 2X4AA 1QAOA 4F1IA 1NHWC 2CWBA 2WSEF 4DR6M 2QCUA 1Y8GA 1SXJE 3NBXX 4D82A 2DHRA 3HJSA 4MGHA 3ZH9B 3L25A 3C3EA 1XB2B 1V34A 4AG5A 2CP8A 1TDHA 2YNMD 5EP4A 4DBGB 1JQJC 2L2DA 4I81A 3M6AA 3DFZA 7CATA 1N34M 4M0WA 3KSXA 2FE8A 4GRIA 2CHGA 5KQ8A 1YSYA 1JR3E 4OVZA 4DV2M 3AOEC 2RGOA 3I51A 1N33M 1VQ1A 3AFHA 4GHLA 3HKPA 5FTKA 3HWSA 2JY8A 3J27B 4MGZE 4LF8M 1Z59A 3JR4A 2VIIA 3VKGA 1GL7A 4FWGA 3L28A 3A46A 2XH9A 3KOXE 2QSFX 2KDLA 2C5RA 3SASA 3Q8XA 2VF7A 4XGIA 2K9DA 5BPVA 3VK8A 1OFHA 4G3OA 4IBJA 4JI6M 4CIZA 2V1CA 2KEBA 1R2ZA 3L26A 5EXPA 3B9PA 4KT0F 5IT9S 2OOBA 1E9RA 2BWEA 4QHSA 1XNRM 1ZV1A 4NXNM 5FTLA 2QBYA 2JUJA 1YE9A 2CE7A 1QDRA 1RU3A 5KPZA 3GLGB 1MN3A 1QUSA 1IBKM 1GO5A 2X49A 2H1RA 1IXSA 2ZANA 4DV4M 4PDGA 1TH2A 2MROB 2ZTCA 4LCBA 3FUTA 3IG5A 4RF0A 2JZ1A 2DAIA 3TWLA 3KSJA 1IN6A 1IBMM 4AKHA 2A5YB 1NJFA 4B7HA 3IG8A 4MGIE 4IBIA 3SHFA 3FYDA 4MB7A 2CHQA 2DHYA 3FRIA 3GLFA 1GJSA 1KSFX 4DR7M 1Q3CA 3Q8GA 1TGUA 3W0FA 2HAKA 1N77A 1G4AE 1LTMA 3V76A 3TWKA 3UJNA 2R18A 1VEKA 1WIVA 2M60A 5FSWA 1R5LA 2XEPA 3HU3A 1ORYB 2YQZA 2ZAOA 3QAUA 4X62M 4X66M 1OFIA 1IN7A 4JI0M 2Z7JA 1ZMUA 4JI7M 4F2LA 2BJWA 4DV0M 3HJQA 3CTWB 3LQRA 4GIPA 1IN8A 5JI2E 3WHLA 2K47A 2C96A 2FNAA 2JY5A 1QAMA 2Y20A 1WXQA 4D81A 3HU2A 4LJ4A 3UGJA 1XC8A 2I7NA 4OVZB 3D8LA 5EJCA 1QUTA 2WZJA 2R45A 1R6BX 4LFAM 3T6PA 1C7YA 2EKFA 3KVWA 2KW0A 3PNYA 5DYGA 1IN4A 2QQ8A 4GKJM 4KO8A 4NL4H 1G8PA 3KXEC 4JI5M 2K6BA 5EXTA 3GRUA 3E46A 5ITXA 3RGSA 4BB9A 5BR8M 1BVSA 4L16A 4Q7JA 3QYBA 4MGYE 3KOZE 4IIWA 3KS4A 1W5TA 5EP2A 3ZQJA 2J7OA 5JI3E 1E9SA 4LFBM 1NY6A 5KPTA 1NNJA 2JA2A 3K2LA 3GPUA 2C9OA 2CV1A 4LF5M 4FCTA 4NRWA 1S3SA 3HZJA 2QBYB 4FCWA 2Z3XA 1PJJA 2DAEA 2YR0A 2R0IA 3FD9A 3LW5F 2N35A 3JAMS 3K9OA 3B89A 3TPZA 2G3QA 3M0EA 2XFTA 4Z6YA 1IXSB 5L8RF 5FLXS 1E94E 3MK6A 3R8FA 2OPFA 4LZJA 1PJQA 2XSZD 4ZPXA 1MJGM 3F92A 2O01F 3AKZA 4FW9A 1KYIA 5KO3A 4DV1M 2UXBM 3B7QA 1GVNA 4LGYA 4QNMA 1IN5A 1GJTA 2QNJA 1L2BA 2MR9A 3L2AA 3PNVA 4PD2A 2J5YA 3SYLA 4Z8XA 1K82A 1IBLM 3E4RA 2VDBB 2APLA 3DZDA 1N32M 3SAWA 4UN2B 3GLFB 1DO2A 4IBDA 4IBBA 1QDTA 2YFQA 3TWMA 1OIZA 3J81S 5ITYA 3A98B 3QWLA 1T6OA 3EIEA 1NVMA 3IHPA 3TQSA 1IXZA 2F5SA 2UUBM 4G6ZA 3GO8A 1G41A 1WJ7A 4DV7M 5E6JA 5FTNA 2WSFF 2V1UA 3AJIB 5ITRA 1VDLA 1XXHA 3I4YA 4BLCA 4LJ6A 1CUKA 1UM8A 3SAVA 2KXEA 2F5PA 3U6QA 2LHCA 4P16A 4R7GA 3RE8A 3U6DA 4LRTA 3GLFE 1AUAA 1ZMWA 1QANA 4FWDA 1HNXM 3BXWA 3HY5A 4LGMA 4GC9A 2I7PA 4GHAA 3SBJA 1HR0M 1R7RA 4YY3M 2L6OA 2KNAA 4Y28F 2B3TA 3U6LA 1IQPA 3VDUA 1WR1B 3HX3A
chains in the Genus database with same CATH topology
3GP1A 2UU9M 4GMQA 2C99A 2C9CA 4WURA 1Z5BA 3VDPA 3AV0A 1DGHA 1NHGC 4S12A 3GQ3A 1I94M 3GLIA 2BJVA 3K8ZA 3GPXA 3HGIA 3LVVA 1DGGA 4KLNA 4JI3M 4G4OA 3U6OA 3SC3A 2LH0A 1N78A 1I4WA 3R9XB 3GRVA 2CFOA 3UK6A 2UXDM 4HLQA 1K3WA 5A2QS 1IXRC 2L7HA 3U5ZB 4QNRA 1J09A 1SXJA 4I5SA 4MGKE 5FTJA 2CEAA 2XSZA 4CISA 1L1ZA 3BOSA 1QAQA 2KRUA 5EP1A 2XGNA 1H6UA 3C58A 4DR3M 2ERCA 3SAUA 4GKKM 1J7KA 2KZSA 2FOIC 1NY5A 3U6EA 1NNUC 3GRRA 2O5RA 2BNKA 1JR3A 1DGBA 2R4JA 1MX0A 4L15A 3KS8A 2CHVA 3PFIA 3J80S 3SATA 4IBEA 4LZZA 2DWZB 2HCBA 2L09A 3AOEA 3PXGA 3UZUA 5ITUA 2E5LM 3FKEA 5ITTA 1KFVA 4NXMM 4FWHA 4I8OA 5E26A 4JI1M 3FTEA 5EXXA 2EA0A 4JYAM 1XXHB 1FJGM 2QENA 1XWIA 3FYCA 3VK7A 4QOZC 2UUAM 1TH4A 4IJEA 4AZFA 2Z4RA 2XZFA 1QZMA 1T3TA 1C1KA 3EIHA 3NBIA 3LVWA 2M5ZA 3MJ5A 2DWMA 2XZUA 2V6ZM 2F5QA 4I4LA 2EUCA 3RGPA 2F5NA 4REZA 1Z5CA 3GPPA 1XMQM 3FTFA 3KW6A 1YUBA 4DR2M 3T15A 4EIWA 2HHHM 3MHVC 3SMPA 4IJFA 1HT2E 3U60A 3ZCBB 1MU5A 1QVRA 3GRYA 3SARA 3UMMA 5EXSA 4B7GA 3FUWA 1DGHB 4KODA 1PJIA 3GLIB 2J7NA 3GLHA 4A3VB 1SXJD 4II7A 3U5ZA 1HT1E 4PT5A 3U6CA 4LJ9A 4XBOA 2DZOB 4WW0A 1GLNA 3AL0C 1IM2A 5EP3A 4OX9M 4K0KM 4L4UA 2F5OA 3DOAA 3J2PB 4ITQA 3VKHA 4M9ZA 4AQYM 4JV5M 3SMSA 4PCZA 5LMNM 1JR3D 2FFJA 1SXJB 2AHMA 2R4EA 3TE6A 3T1YM 4OW0A 2RGHA 2R46A 2W82A 4DUZM 1TH3A 2KRKA 3K92A 4MH0E 5KPRA 3L29A 3U61A 3D8BA 1QYRA 2QZ4A 2ZM6M 5FTMA 4LF7M 4IBCA 4B08A 2KZUA 3HHWA 1G3IA 2EO2A 2LXEA 4HL4A 3W0LB 3LQQA 2G8LA 4GITA 2RKOA 4YHHM 3HJ8A 4LFCM 5IREB 3K1JA 3T38A 2QPAA 3LMMA 4B3TM 5H37D 3CF6E 1L2CA 3SYKA 3L27A 3WHKA 4CHTB 4DV5M 2DWNA 4GC5A 1DO0A 2CV0A 4MM3B 4NSOB 2XLJA 5ITQA 1IY1A 5LMUM 4QOSA 4X64M 4X65M 2R65A 2Z4SA 3GPYA 4RNAA 2OQ4A 1E32A 4B3RM 3HHZA 3U60B 4LF9M 5DNYA 1LV7A 4DV6M 2XFSA 1NSFA 3A42A 4FCVA 4LG2A 2UXCM 2R62A 3RFWA 3U6MA 1N36M 3E9SA 2CUZA 2QP9X 4RF1A 5ITXE 4LJ7A 4G4QA 3CF2A 2HL7A 4G4NA 3GLHB 1EE8A 1XMOM 5C18A 1PM5A 1DGFA 4FVMA 4KHPM 2UUCM 1GL6A 2XF3A 3FUVA 1HQYE 1Z5AA 2LWXA 4QHTA 2DZNB 1X37A 4JI4M 5IWAM 3GQ4A 3KOYE 4AKGA 4M0DA 4FD2A 2Y0TA 4B3SM 2D7EA 1HNZM 1OJLA 3KDSE 1IY0A 1R2YA 1XNQM 4TUWA 4AW4A 3HHXA 3KFUG 4IBFA 1GKIA 1W5SA 1L1TA 1N75A 2P5TA 3U61B 3ILKA 2VQEM 4D80A 4JI2M 3KOWE 5KQDA 3VLFB 2D7HA 4DR4M 4JI8M 4AG6A 1L8QA 3J7BA 3SFZA 5EQTA 1ZAEA 4IBGA 2DVWB 5GKNA 1IY2A 2L7IA 1Q3BA 2X8AA 1VDDA 4G4RA 4LJ8A 4DV3M 2F4VM 3JR5A 4LY6A 3PVSA 3GQ5A 4L78A 3A45A 3FTCA 3FTDA 4B7FA 2C98A 4CGYB 1Q39A 8CATA 1K3XA 2ZBKB 3NWLA 4M9XA 1TDZA 2CV2A 3SHGB 5IZ7D 3OTOM 4DR1M 2KA6B 4AKIA 2HKJA 3FUUA 2Y21A 4AI6A 3U6SA 1D2NA 1FNNA 4W5WA 3HU1A 4PDIA 2Y0QA 3AOGA 3FUXA 4OU7A 2VQFM 4R3DA 2G5GX 2DXIA 1HQCA 4LJAA 4L8RC 4NOOB 3J7AS 2D7GA 4LRSA 1Z6TA 4LJ5A 4M9SA 3T1HM 4LF6M 1HNWM 3DA1A 3CF0A 3GLGA 4IBKA 5F3WA 1XHBA 4DUYM 1G59A 1ZQ9A 2Q2EB 3THGA 3TL4X 4LF4M 3HHYA 4DR5M 5C1BA 4B3MM 4JN6A 5DYIA 1NJGA 4NRVA 4JXJA 3I4VA 3U6PA 2DWLA 2NQ8C 3M7GA 1QQWA 3KP1E 4NSRA 4BBAA 1J5EM 3ZC7B 3KP0E 1SXJC 3VFDA 4GH9A 3H4MA 1L2DA 2ZAMA 2LNHC 2X4AA 1QAOA 1NHWC 4DR6M 2QCUA 1SXJE 4D82A 2DHRA 3HJSA 4MGHA 3ZH9B 3L25A 4AG5A 1TDHA 2YNMD 5EP4A 1JQJC 4I81A 3M6AA 3DFZA 7CATA 1N34M 4M0WA 3KSXA 2FE8A 4GRIA 2CHGA 5KQ8A 1YSYA 4OVZA 4DV2M 3AOEC 2RGOA 3I51A 1N33M 3AFHA 4GHLA 3HKPA 5FTKA 3HWSA 3J27B 4MGZE 4LF8M 1Z59A 3JR4A 2VIIA 3VKGA 1GL7A 4FWGA 3L28A 3A46A 2XH9A 3KOXE 2C5RA 3SASA 3Q8XA 3VK8A 4XGIA 5BPVA 1OFHA 4IBJA 4JI6M 2V1CA 2KEBA 1R2ZA 3L26A 5EXPA 3B9PA 5IT9S 1E9RA 4QHSA 1XNRM 5FTLA 4NXNM 2QBYA 1YE9A 2CE7A 5KPZA 3GLGB 1IBKM 2X49A 2H1RA 2ZANA 4DV4M 4PDGA 1TH2A 4LCBA 3FUTA 3IG5A 4RF0A 3TWLA 3KSJA 1IN6A 1IBMM 4AKHA 2A5YB 1NJFA 4B7HA 3IG8A 4MGIE 4IBIA 3SHFA 3FYDA 4MB7A 2CHQA 3GLFA 1KSFX 4DR7M 1Q3CA 1TGUA 3W0FA 1N77A 1G4AE 3TWKA 3UJNA 2R18A 2M60A 5FSWA 2XEPA 3HU3A 1ORYB 2YQZA 2ZAOA 3QAUA 4X62M 4X66M 1OFIA 1IN7A 4JI0M 2Z7JA 4JI7M 4DV0M 2BJWA 3HJQA 3CTWB 3LQRA 4GIPA 1IN8A 5JI2E 3WHLA 2K47A 2C96A 2FNAA 1QAMA 2Y20A 1WXQA 4D81A 3HU2A 4LJ4A 3UGJA 1XC8A 2I7NA 4OVZB 3D8LA 5EJCA 2R45A 1R6BX 4LFAM 3KVWA 2KW0A 3PNYA 5DYGA 1IN4A 4GKJM 4KO8A 4NL4H 1G8PA 3KXEC 4JI5M 5EXTA 3GRUA 5ITXA 3RGSA 4BB9A 5BR8M 4L16A 4MGYE 3KOZE 4IIWA 3KS4A 1W5TA 5EP2A 2J7OA 5JI3E 1E9SA 4LFBM 1NY6A 5KPTA 1NNJA 2JA2A 3K2LA 3GPUA 2C9OA 2CV1A 4LF5M 4FCTA 4NRWA 1S3SA 2QBYB 4FCWA 2Z3XA 1PJJA 2YR0A 3FD9A 3JAMS 3TPZA 3M0EA 4Z6YA 2XFTA 3R8FA 1IXSB 5FLXS 1E94E 3MK6A 2OPFA 4LZJA 2XSZD 4ZPXA 3AKZA 4FW9A 1KYIA 5KO3A 4DV1M 2UXBM 1GVNA 4LGYA 4QNMA 1IN5A 1L2BA 3L2AA 3PNVA 4PD2A 3SYLA 4Z8XA 1K82A 1IBLM 3E4RA 1N32M 3DZDA 3SAWA 3GLFB 1DO2A 4IBDA 4IBBA 2YFQA 3TWMA 3J81S 5ITYA 3A98B 3QWLA 3EIEA 1NVMA 3TQSA 1IXZA 2F5SA 2UUBM 4G6ZA 3GO8A 1G41A 4DV7M 5E6JA 5FTNA 2V1UA 3AJIB 5ITRA 1XXHA 3I4YA 4BLCA 4LJ6A 1UM8A 3SAVA 2KXEA 2F5PA 3U6QA 4P16A 4R7GA 3RE8A 3U6DA 4LRTA 1QANA 4FWDA 1HNXM 4LGMA 4GC9A 2I7PA 4GHAA 3SBJA 1HR0M 1R7RA 4YY3M 2L6OA 3U6LA 1IQPA 3VDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MB7 A;  3GP1 A;  4DUZ M;  4PDI A;  4DR7 M;  1Q3C A;  2UU9 M;  2VQF M;  1Z5B A;  3W0F A;  2ZM6 M;  3J7A S;  3TWK A;  4LF7 M;  3GQ3 A;  1I94 M;  3T1H M;  4X62 M;  3GPX A;  4X66 M;  4LF6 M;  1HNW M;  4JI3 M;  4G4O A;  4JI0 M;  3U6O A;  4JI7 M;  4DV0 M;  4DUY M;  4YHH M;  4LFC M;  2UXD M;  4B3T M;  2Q2E B;  1XC8 A;  4LF4 M;  1K3W A;  1L2C A;  4DR5 M;  5A2Q S;  4B3M M;  4LFA M;  4DV5 M;  4NRV A;  3U6P A;  4GKJ M;  4CIS A;  1L1Z A;  4JI5 M;  5ITQ A;  1J5E M;  5ITX A;  3C58 A;  4DR3 M;  5LMU M;  3SAU A;  4GKK M;  4X64 M;  4X65 M;  5BR8 M;  3GPY A;  1L2D A;  2OQ4 A;  3U6E A;  4B3R M;  4DR6 M;  4LF9 M;  4DV6 M;  1MX0 A;  4LFB M;  1NNJ A;  3GPU A;  3A42 A;  4LF5 M;  3J80 S;  3SAT A;  3U6M A;  3SAR A;  1TDH A;  1N36 M;  4NRW A;  5ITX E;  4G4Q A;  2UXC M;  5ITU A;  1XMO M;  4G4N A;  2E5L M;  1EE8 A;  5ITT A;  1PM5 A;  1PJJ A;  1KFV A;  4NXM M;  4JI1 M;  2EA0 A;  4KHP M;  1N34 M;  4JYA M;  2UUC M;  1FJG M;  3JAM S;  4DV2 M;  1Z5A A;  5FLX S;  3VK7 A;  2UUA M;  1N33 M;  2XZF A;  2OPF A;  4JI4 M;  5IWA M;  3GQ4 A;  4LF8 M;  1Z59 A;  3JR4 A;  4DV1 M;  2UXB M;  4B3S M;  1HNZ M;  2XZU A;  3A46 A;  1R2Y A;  2F5Q A;  1XNQ M;  3SAS A;  1L2B A;  2F5N A;  4PD2 A;  1Z5C A;  3GPP A;  3VK8 A;  1XMQ M;  1K82 A;  1IBL M;  4DR2 M;  1N32 M;  3SAW A;  2HHH M;  4JI6 M;  1L1T A;  3TWM A;  3J81 S;  5ITY A;  1MU5 A;  2VQE M;  4JI2 M;  1R2Z A;  5IT9 S;  4DR4 M;  2F5S A;  4JI8 M;  1PJI A;  1XNR M;  2UUB M;  4NXN M;  3GO8 A;  4DV7 M;  3U6C A;  5ITR A;  1IBK M;  1Q3B A;  4G4R A;  4DV3 M;  2F4V M;  3SAV A;  2F5P A;  4DV4 M;  4PDG A;  3U6Q A;  3U6D A;  3JR5 A;  4OX9 M;  4K0K M;  3GQ5 A;  1HNX M;  3A45 A;  3TWL A;  1K3X A;  3DOA A;  1IBM M;  2F5O A;  1Q39 A;  4ITQ A;  2ZBK B;  4AQY M;  3SBJ A;  1HR0 M;  4PCZ A;  5LMN M;  1TDZ A;  4JV5 M;  4YY3 M;  3OTO M;  4DR1 M;  2HKJ A;  3U6L A;  3T1Y M;  3U6S A; 
#chains in the Genus database with same CATH topology
 3GP1 A;  2UU9 M;  4GMQ A;  2C99 A;  1DV0 A;  1TR8 A;  2C9C A;  1WHC A;  1Z5B A;  4WUR A;  3VDP A;  3W67 A;  3AV0 A;  3C9P A;  1DGH A;  1IFY A;  1NHG C;  4S12 A;  3GQ3 A;  1I94 M;  3GLI A;  2BJV A;  3K8Z A;  3GPX A;  3HGI A;  3LVV A;  1DGG A;  4KLN A;  4JI3 M;  4G4O A;  3U6O A;  2JY7 A;  2LH0 A;  3SC3 A;  4ANR A;  1N78 A;  1I4W A;  3R9X B;  3GRV A;  2CFO A;  3UK6 A;  1EIJ A;  2UXD M;  4HLQ A;  1K3W A;  5A2Q S;  1IXR C;  2L7H A;  3U5Z B;  4QNR A;  1J09 A;  1SXJ A;  1TTE A;  4I5S A;  5DFL A;  3GLG E;  4MGK E;  5FTJ A;  2CEA A;  2XSZ A;  4CIS A;  1L1Z A;  1ZMV A;  3BOS A;  1QAQ A;  2KRU A;  5EP1 A;  2XGN A;  1H6U A;  3C58 A;  4DR3 M;  2ERC A;  3SAU A;  2LVN C;  1VEJ A;  4GKK M;  1J7K A;  2KZS A;  2FOI C;  1WGL A;  1NY5 A;  3U6E A;  1NNU C;  3GRR A;  2O5R A;  2BNK A;  2L4E A;  1JR3 A;  1DGB A;  2R4J A;  3K9P A;  1MX0 A;  4L15 A;  3KS8 A;  3B74 A;  2CHV A;  3PFI A;  3J80 S;  3SAT A;  4IBE A;  4LZZ A;  2KNZ A;  2DWZ B;  2HCB A;  2L09 A;  3AOE A;  3PXG A;  2RRU A;  3UZU A;  5ITU A;  2E5L M;  3FKE A;  5ITT A;  1PJS A;  1KFV A;  4FWH A;  4I8O A;  5E26 A;  4JI1 M;  4NXM M;  5EXX A;  2EA0 A;  3FTE A;  4JYA M;  1XXH B;  1FJG M;  2QEN A;  1XWI A;  3FYC A;  3VK7 A;  4QOZ C;  2UUA M;  1TH4 A;  4IJE A;  4AZF A;  2Z4R A;  2XZF A;  1QZM A;  1T3T A;  2OO9 A;  1C1K A;  3LCU A;  1T43 A;  3CGW A;  3EIH A;  3NBI A;  3LVW A;  2KNV A;  2M5Z A;  3MJ5 A;  2XZU A;  2DWM A;  2V6Z M;  2F5Q A;  4CJ6 A;  4I4L A;  2EUC A;  3RGP A;  2F5N A;  4REZ A;  1R4G A;  1Z5C A;  3GPP A;  1XMQ M;  3KW6 A;  3FTF A;  1YUB A;  4DR2 M;  3T15 A;  4EIW A;  2HHH M;  3MHV C;  3SMP A;  3IEC A;  4IJF A;  1HT2 E;  3U60 A;  1NO1 A;  2LVO C;  1MU5 A;  1QVR A;  3ZCB B;  3GRY A;  2JNH A;  1YLA A;  3SAR A;  3UMM A;  5EXS A;  4B7G A;  2H5X A;  3FUW A;  1DGH B;  4KOD A;  1PJI A;  1V33 A;  1OAO C;  3GLI B;  2J7N A;  3GLH A;  4A3V B;  2DAG A;  2DZL A;  1SXJ D;  2JY6 B;  4II7 A;  2GNO A;  3U5Z A;  1HT1 E;  4PT5 A;  3U6C A;  4LJ9 A;  4XBO A;  2DZO B;  4WW0 A;  1GLN A;  2OOA A;  1IM2 A;  3AL0 C;  5EP3 A;  4HEO A;  2K0B X;  2DNA A;  4OX9 M;  4K0K M;  4L4U A;  2F5O A;  2GQF A;  3DOA A;  3J2P B;  2DAM A;  4ITQ A;  3VKH A;  4M9Z A;  4AQY M;  4JV5 M;  4WP2 A;  3SMS A;  4PCZ A;  1JR3 D;  2FFJ A;  1SXJ B;  5LMN M;  2FS1 A;  2AHM A;  2R4E A;  3TE6 A;  3T1Y M;  4OW0 A;  3I04 M;  2RGH A;  2R46 A;  2W82 A;  2CRU A;  4DUZ M;  1TH3 A;  1VEG A;  2KRK A;  3K92 A;  4MH0 E;  5KPR A;  3L29 A;  3U61 A;  3D8B A;  1QYR A;  2QZ4 A;  2ZM6 M;  5FTM A;  4P17 A;  4LF7 M;  3FRH A;  1NV9 A;  1AIP C;  4IBC A;  4B08 A;  2KZU A;  1EFU B;  3HHW A;  1G3I A;  2EO2 A;  2LXE A;  4HL4 A;  2FH0 A;  3W0L B;  3LQQ A;  2ZTD A;  2G8L A;  4GIT A;  2RKO A;  4YHH M;  3HJ8 A;  4LFC M;  5IRE B;  3K1J A;  4GEW A;  3T38 A;  2QPA A;  3LMM A;  3MMP A;  4B3T M;  2WSC F;  5H37 D;  3CF6 E;  1L2C A;  4L6V 6;  3L27 A;  3SYK A;  2QHO B;  1VG5 A;  3WHK A;  4CHT B;  4DV5 M;  2DWN A;  4GC5 A;  3W68 A;  1DO0 A;  2CV0 A;  3QYE A;  4MM3 B;  4NSO B;  2XLJ A;  5ITQ A;  1IY1 A;  1F4I A;  2LVA A;  2LVQ D;  5LMU M;  4QOS A;  4X64 M;  4X65 M;  2R65 A;  2Z4S A;  3GPY A;  4RNA A;  2R6F A;  2OQ4 A;  1E32 A;  4B3R M;  3FE3 A;  4XK8 F;  2LBC A;  3HHZ A;  3U60 B;  4LF9 M;  5DNY A;  1LV7 A;  4DV6 M;  2XFS A;  3BBZ A;  2O25 A;  1PRB A;  1NSF A;  3A42 A;  4FCV A;  4LG2 A;  2UXC M;  2R62 A;  3RFW A;  3U6M A;  1N36 M;  3E9S A;  2CUZ A;  2QP9 X;  4RF1 A;  5ITX E;  4LJ7 A;  4G4Q A;  3CF2 A;  2HL7 A;  4G4N A;  3GLH B;  1EE8 A;  1XMO M;  5C18 A;  1PM5 A;  1DGF A;  4FVM A;  2JZ0 A;  4KHP M;  2EJS A;  2UUC M;  1PJT A;  1GL6 A;  2XF3 A;  1NV8 A;  3FUV A;  1HQY E;  1Z5A A;  2LWX A;  4QHT A;  2MGW A;  2DZN B;  1X37 A;  4JI4 M;  1OTR A;  5IWA M;  3GQ4 A;  3KOY E;  4AKG A;  4M0D A;  4FD2 A;  2Y0T A;  2MH8 A;  4B3S M;  2D7E A;  1HNZ M;  1OJL A;  3KDS E;  1IY0 A;  1UFZ A;  1R2Y A;  1XNQ M;  4TUW A;  4AW4 A;  4R71 A;  3HHX A;  1OIP A;  3KFU G;  3GLH E;  4IBF A;  4RKU F;  1GKI A;  1W5S A;  1OKS A;  1N75 A;  3I01 M;  1L1T A;  2P5T A;  3U61 B;  3ILK A;  2VQE M;  4D80 A;  1G71 A;  4JI2 M;  1HJP A;  3KOW E;  5KQD A;  3VLF B;  2D7H A;  4DR4 M;  4JI8 M;  4AG6 A;  1L8Q A;  3J7B A;  2JP7 A;  3SFZ A;  1A5T A;  5EQT A;  1ZAE A;  4IBG A;  2DVW B;  5GKN A;  1IY2 A;  2L7I A;  1Q3B A;  2DKL A;  2X8A A;  1VDD A;  4G4R A;  4LJ8 A;  4DV3 M;  2F4V M;  2DEN A;  2Z8Y M;  3JR5 A;  4LY6 A;  3PVS A;  3GQ5 A;  4L78 A;  3A45 A;  3B7N A;  3FTC A;  3FTD A;  2C98 A;  4NC6 A;  1Q39 A;  4B7F A;  4CGY B;  8CAT A;  1K3X A;  2ZBK B;  3NWL A;  4M9X A;  2L4F A;  1TDZ A;  2CV2 A;  3SHG B;  5IZ7 D;  3OTO M;  1V92 A;  4DR1 M;  2KA6 B;  2LTU A;  4AKI A;  1D0M A;  2HKJ A;  3FUU A;  2Y21 A;  4AI6 A;  2LVP C;  2DI0 A;  1XXH E;  3U6S A;  2HWJ A;  1QZE A;  1D2N A;  1FNN A;  3C3D A;  4W5W A;  3HU1 A;  3B7Z A;  4PDI A;  2Y0Q A;  3AOG A;  3FUX A;  4OU7 A;  2VQF M;  2VF8 A;  4R3D A;  2G5G X;  2DXI A;  1HQC A;  2EKK A;  4LJA A;  4L8R C;  4NOO B;  3J7A S;  1D0L A;  2D7G A;  2DAK A;  4LRS A;  1Z6T A;  4LJ5 A;  4M9S A;  3T1H M;  2JXN A;  1WGN A;  4LF6 M;  1HNW M;  3DA1 A;  3CF0 A;  3GLG A;  1SG9 A;  4IBK A;  5F3W A;  1GAB A;  1XHB A;  4DUY M;  1G59 A;  1ZQ9 A;  2JWS A;  2MJ5 B;  2LHG A;  3H4J A;  2Q2E B;  3THG A;  3TL4 X;  1D0K A;  1TF0 B;  3HHY A;  4LF4 M;  4DR5 M;  1OAI A;  3E21 A;  5C1B A;  4JN6 A;  3GLI E;  4B3M M;  1OQY A;  2KHH A;  5DYI A;  1NJG A;  4NRV A;  4JXJ A;  3I4V A;  3U6P A;  2DWL A;  1P3Q Q;  2NQ8 C;  3M7G A;  1QQW A;  3KP1 E;  4NSR A;  2R44 A;  4BBA A;  1J5E M;  1Q02 A;  3ZC7 B;  3KP0 E;  2BWB A;  1PGY A;  3LCV B;  1SXJ C;  3VFD A;  1JB0 F;  4GH9 A;  3H4M A;  1L2D A;  2ZAM A;  2LNH C;  2X4A A;  1QAO A;  4F1I A;  1NHW C;  2CWB A;  2WSE F;  4DR6 M;  2QCU A;  1Y8G A;  1SXJ E;  3NBX X;  4D82 A;  2DHR A;  3HJS A;  4MGH A;  3ZH9 B;  3L25 A;  3C3E A;  1XB2 B;  1V34 A;  4AG5 A;  2CP8 A;  1TDH A;  2YNM D;  5EP4 A;  4DBG B;  1JQJ C;  2L2D A;  4I81 A;  3M6A A;  3DFZ A;  7CAT A;  1N34 M;  4M0W A;  3KSX A;  2FE8 A;  4GRI A;  2CHG A;  5KQ8 A;  1YSY A;  1JR3 E;  4OVZ A;  4DV2 M;  3AOE C;  2RGO A;  3I51 A;  1N33 M;  1VQ1 A;  3AFH A;  4GHL A;  3HKP A;  5FTK A;  3HWS A;  2JY8 A;  3J27 B;  4MGZ E;  4LF8 M;  1Z59 A;  3JR4 A;  2VII A;  3VKG A;  1GL7 A;  4FWG A;  3L28 A;  3A46 A;  2XH9 A;  3KOX E;  2QSF X;  2KDL A;  2C5R A;  3SAS A;  3Q8X A;  2VF7 A;  4XGI A;  2K9D A;  5BPV A;  3VK8 A;  1OFH A;  4G3O A;  4IBJ A;  4JI6 M;  4CIZ A;  2V1C A;  2KEB A;  1R2Z A;  3L26 A;  5EXP A;  3B9P A;  4KT0 F;  5IT9 S;  2OOB A;  1E9R A;  2BWE A;  4QHS A;  1XNR M;  1ZV1 A;  4NXN M;  5FTL A;  2QBY A;  2JUJ A;  1YE9 A;  2CE7 A;  1QDR A;  1RU3 A;  5KPZ A;  3GLG B;  1MN3 A;  1QUS A;  1IBK M;  1GO5 A;  2X49 A;  2H1R A;  1IXS A;  2ZAN A;  4DV4 M;  4PDG A;  1TH2 A;  2MRO B;  2ZTC A;  4LCB A;  3FUT A;  3IG5 A;  4RF0 A;  2JZ1 A;  2DAI A;  3TWL A;  3KSJ A;  1IN6 A;  1IBM M;  4AKH A;  2A5Y B;  1NJF A;  4B7H A;  3IG8 A;  4MGI E;  4IBI A;  3SHF A;  3FYD A;  4MB7 A;  2CHQ A;  2DHY A;  3FRI A;  3GLF A;  1GJS A;  1KSF X;  4DR7 M;  1Q3C A;  3Q8G A;  1TGU A;  3W0F A;  2HAK A;  1N77 A;  1G4A E;  1LTM A;  3V76 A;  3TWK A;  3UJN A;  2R18 A;  1VEK A;  1WIV A;  2M60 A;  5FSW A;  1R5L A;  2XEP A;  3HU3 A;  1ORY B;  2YQZ A;  2ZAO A;  3QAU A;  4X62 M;  4X66 M;  1OFI A;  1IN7 A;  4JI0 M;  2Z7J A;  1ZMU A;  4JI7 M;  4F2L A;  2BJW A;  4DV0 M;  3HJQ A;  3CTW B;  3LQR A;  4GIP A;  1IN8 A;  5JI2 E;  3WHL A;  2K47 A;  2C96 A;  2FNA A;  2JY5 A;  1QAM A;  2Y20 A;  1WXQ A;  4D81 A;  3HU2 A;  4LJ4 A;  3UGJ A;  1XC8 A;  2I7N A;  4OVZ B;  3D8L A;  5EJC A;  1QUT A;  2WZJ A;  2R45 A;  1R6B X;  4LFA M;  3T6P A;  1C7Y A;  2EKF A;  3KVW A;  2KW0 A;  3PNY A;  5DYG A;  1IN4 A;  2QQ8 A;  4GKJ M;  4KO8 A;  4NL4 H;  1G8P A;  3KXE C;  4JI5 M;  2K6B A;  5EXT A;  3GRU A;  3E46 A;  5ITX A;  3RGS A;  4BB9 A;  5BR8 M;  1BVS A;  4L16 A;  4Q7J A;  3QYB A;  4MGY E;  3KOZ E;  4IIW A;  3KS4 A;  1W5T A;  5EP2 A;  3ZQJ A;  2J7O A;  5JI3 E;  1E9S A;  4LFB M;  1NY6 A;  5KPT A;  1NNJ A;  2JA2 A;  3K2L A;  3GPU A;  2C9O A;  2CV1 A;  4LF5 M;  4FCT A;  4NRW A;  1S3S A;  3HZJ A;  2QBY B;  4FCW A;  2Z3X A;  1PJJ A;  2DAE A;  2YR0 A;  2R0I A;  3FD9 A;  3LW5 F;  2N35 A;  3JAM S;  3K9O A;  3B89 A;  3TPZ A;  2G3Q A;  3M0E A;  2XFT A;  4Z6Y A;  1IXS B;  5L8R F;  5FLX S;  1E94 E;  3MK6 A;  3R8F A;  2OPF A;  4LZJ A;  1PJQ A;  2XSZ D;  4ZPX A;  1MJG M;  3F92 A;  2O01 F;  3AKZ A;  4FW9 A;  1KYI A;  5KO3 A;  4DV1 M;  2UXB M;  3B7Q A;  1GVN A;  4LGY A;  4QNM A;  1IN5 A;  1GJT A;  2QNJ A;  1L2B A;  2MR9 A;  3L2A A;  3PNV A;  4PD2 A;  2J5Y A;  3SYL A;  4Z8X A;  1K82 A;  1IBL M;  3E4R A;  2VDB B;  2APL A;  3DZD A;  1N32 M;  3SAW A;  4UN2 B;  3GLF B;  1DO2 A;  4IBD A;  4IBB A;  1QDT A;  2YFQ A;  3TWM A;  1OIZ A;  3J81 S;  5ITY A;  3A98 B;  3QWL A;  1T6O A;  3EIE A;  1NVM A;  3IHP A;  3TQS A;  1IXZ A;  2F5S A;  2UUB M;  4G6Z A;  3GO8 A;  1G41 A;  1WJ7 A;  4DV7 M;  5E6J A;  5FTN A;  2WSF F;  2V1U A;  3AJI B;  5ITR A;  1VDL A;  1XXH A;  3I4Y A;  4BLC A;  4LJ6 A;  1CUK A;  1UM8 A;  3SAV A;  2KXE A;  2F5P A;  3U6Q A;  2LHC A;  4P16 A;  4R7G A;  3RE8 A;  3U6D A;  4LRT A;  3GLF E;  1AUA A;  1ZMW A;  1QAN A;  4FWD A;  1HNX M;  3BXW A;  3HY5 A;  4LGM A;  4GC9 A;  2I7P A;  4GHA A;  3SBJ A;  1HR0 M;  1R7R A;  4YY3 M;  2L6O A;  2KNA A;  4Y28 F;  2B3T A;  3U6L A;  1IQP A;  3VDU A;  1WR1 B;  3HX3 A; 
#chains in the Genus database with same CATH homology
 3GP1 A;  2UU9 M;  4GMQ A;  2C99 A;  2C9C A;  4WUR A;  1Z5B A;  3VDP A;  3AV0 A;  1DGH A;  1NHG C;  4S12 A;  3GQ3 A;  1I94 M;  3GLI A;  2BJV A;  3K8Z A;  3GPX A;  3HGI A;  3LVV A;  1DGG A;  4KLN A;  4JI3 M;  4G4O A;  3U6O A;  3SC3 A;  2LH0 A;  1N78 A;  1I4W A;  3R9X B;  3GRV A;  2CFO A;  3UK6 A;  2UXD M;  4HLQ A;  1K3W A;  5A2Q S;  1IXR C;  2L7H A;  3U5Z B;  4QNR A;  1J09 A;  1SXJ A;  4I5S A;  4MGK E;  5FTJ A;  2CEA A;  2XSZ A;  4CIS A;  1L1Z A;  3BOS A;  1QAQ A;  2KRU A;  5EP1 A;  2XGN A;  1H6U A;  3C58 A;  4DR3 M;  2ERC A;  3SAU A;  4GKK M;  1J7K A;  2KZS A;  2FOI C;  1NY5 A;  3U6E A;  1NNU C;  3GRR A;  2O5R A;  2BNK A;  1JR3 A;  1DGB A;  2R4J A;  1MX0 A;  4L15 A;  3KS8 A;  2CHV A;  3PFI A;  3J80 S;  3SAT A;  4IBE A;  4LZZ A;  2DWZ B;  2HCB A;  2L09 A;  3AOE A;  3PXG A;  3UZU A;  5ITU A;  2E5L M;  3FKE A;  5ITT A;  1KFV A;  4NXM M;  4FWH A;  4I8O A;  5E26 A;  4JI1 M;  3FTE A;  5EXX A;  2EA0 A;  4JYA M;  1XXH B;  1FJG M;  2QEN A;  1XWI A;  3FYC A;  3VK7 A;  4QOZ C;  2UUA M;  1TH4 A;  4IJE A;  4AZF A;  2Z4R A;  2XZF A;  1QZM A;  1T3T A;  1C1K A;  3EIH A;  3NBI A;  3LVW A;  2M5Z A;  3MJ5 A;  2DWM A;  2XZU A;  2V6Z M;  2F5Q A;  4I4L A;  2EUC A;  3RGP A;  2F5N A;  4REZ A;  1Z5C A;  3GPP A;  1XMQ M;  3FTF A;  3KW6 A;  1YUB A;  4DR2 M;  3T15 A;  4EIW A;  2HHH M;  3MHV C;  3SMP A;  4IJF A;  1HT2 E;  3U60 A;  3ZCB B;  1MU5 A;  1QVR A;  3GRY A;  3SAR A;  3UMM A;  5EXS A;  4B7G A;  3FUW A;  1DGH B;  4KOD A;  1PJI A;  3GLI B;  2J7N A;  3GLH A;  4A3V B;  1SXJ D;  4II7 A;  3U5Z A;  1HT1 E;  4PT5 A;  3U6C A;  4LJ9 A;  4XBO A;  2DZO B;  4WW0 A;  1GLN A;  3AL0 C;  1IM2 A;  5EP3 A;  4OX9 M;  4K0K M;  4L4U A;  2F5O A;  3DOA A;  3J2P B;  4ITQ A;  3VKH A;  4M9Z A;  4AQY M;  4JV5 M;  3SMS A;  4PCZ A;  5LMN M;  1JR3 D;  2FFJ A;  1SXJ B;  2AHM A;  2R4E A;  3TE6 A;  3T1Y M;  4OW0 A;  2RGH A;  2R46 A;  2W82 A;  4DUZ M;  1TH3 A;  2KRK A;  3K92 A;  4MH0 E;  5KPR A;  3L29 A;  3U61 A;  3D8B A;  1QYR A;  2QZ4 A;  2ZM6 M;  5FTM A;  4LF7 M;  4IBC A;  4B08 A;  2KZU A;  3HHW A;  1G3I A;  2EO2 A;  2LXE A;  4HL4 A;  3W0L B;  3LQQ A;  2G8L A;  4GIT A;  2RKO A;  4YHH M;  3HJ8 A;  4LFC M;  5IRE B;  3K1J A;  3T38 A;  2QPA A;  3LMM A;  4B3T M;  5H37 D;  3CF6 E;  1L2C A;  3SYK A;  3L27 A;  3WHK A;  4CHT B;  4DV5 M;  2DWN A;  4GC5 A;  1DO0 A;  2CV0 A;  4MM3 B;  4NSO B;  2XLJ A;  5ITQ A;  1IY1 A;  5LMU M;  4QOS A;  4X64 M;  4X65 M;  2R65 A;  2Z4S A;  3GPY A;  4RNA A;  2OQ4 A;  1E32 A;  4B3R M;  3HHZ A;  3U60 B;  4LF9 M;  5DNY A;  1LV7 A;  4DV6 M;  2XFS A;  1NSF A;  3A42 A;  4FCV A;  4LG2 A;  2UXC M;  2R62 A;  3RFW A;  3U6M A;  1N36 M;  3E9S A;  2CUZ A;  2QP9 X;  4RF1 A;  5ITX E;  4LJ7 A;  4G4Q A;  3CF2 A;  2HL7 A;  4G4N A;  3GLH B;  1EE8 A;  1XMO M;  5C18 A;  1PM5 A;  1DGF A;  4FVM A;  4KHP M;  2UUC M;  1GL6 A;  2XF3 A;  3FUV A;  1HQY E;  1Z5A A;  2LWX A;  4QHT A;  2DZN B;  1X37 A;  4JI4 M;  5IWA M;  3GQ4 A;  3KOY E;  4AKG A;  4M0D A;  4FD2 A;  2Y0T A;  4B3S M;  2D7E A;  1HNZ M;  1OJL A;  3KDS E;  1IY0 A;  1R2Y A;  1XNQ M;  4TUW A;  4AW4 A;  3HHX A;  3KFU G;  4IBF A;  1GKI A;  1W5S A;  1L1T A;  1N75 A;  2P5T A;  3U61 B;  3ILK A;  2VQE M;  4D80 A;  4JI2 M;  3KOW E;  5KQD A;  3VLF B;  2D7H A;  4DR4 M;  4JI8 M;  4AG6 A;  1L8Q A;  3J7B A;  3SFZ A;  5EQT A;  1ZAE A;  4IBG A;  2DVW B;  5GKN A;  1IY2 A;  2L7I A;  1Q3B A;  2X8A A;  1VDD A;  4G4R A;  4LJ8 A;  4DV3 M;  2F4V M;  3JR5 A;  4LY6 A;  3PVS A;  3GQ5 A;  4L78 A;  3A45 A;  3FTC A;  3FTD A;  4B7F A;  2C98 A;  4CGY B;  1Q39 A;  8CAT A;  1K3X A;  2ZBK B;  3NWL A;  4M9X A;  1TDZ A;  2CV2 A;  3SHG B;  5IZ7 D;  3OTO M;  4DR1 M;  2KA6 B;  4AKI A;  2HKJ A;  3FUU A;  2Y21 A;  4AI6 A;  3U6S A;  1D2N A;  1FNN A;  4W5W A;  3HU1 A;  4PDI A;  2Y0Q A;  3AOG A;  3FUX A;  4OU7 A;  2VQF M;  4R3D A;  2G5G X;  2DXI A;  1HQC A;  4LJA A;  4L8R C;  4NOO B;  3J7A S;  2D7G A;  4LRS A;  1Z6T A;  4LJ5 A;  4M9S A;  3T1H M;  4LF6 M;  1HNW M;  3DA1 A;  3CF0 A;  3GLG A;  4IBK A;  5F3W A;  1XHB A;  4DUY M;  1G59 A;  1ZQ9 A;  2Q2E B;  3THG A;  3TL4 X;  4LF4 M;  3HHY A;  4DR5 M;  5C1B A;  4B3M M;  4JN6 A;  5DYI A;  1NJG A;  4NRV A;  4JXJ A;  3I4V A;  3U6P A;  2DWL A;  2NQ8 C;  3M7G A;  1QQW A;  3KP1 E;  4NSR A;  4BBA A;  1J5E M;  3ZC7 B;  3KP0 E;  1SXJ C;  3VFD A;  4GH9 A;  3H4M A;  1L2D A;  2ZAM A;  2LNH C;  2X4A A;  1QAO A;  1NHW C;  4DR6 M;  2QCU A;  1SXJ E;  4D82 A;  2DHR A;  3HJS A;  4MGH A;  3ZH9 B;  3L25 A;  4AG5 A;  1TDH A;  2YNM D;  5EP4 A;  1JQJ C;  4I81 A;  3M6A A;  3DFZ A;  7CAT A;  1N34 M;  4M0W A;  3KSX A;  2FE8 A;  4GRI A;  2CHG A;  5KQ8 A;  1YSY A;  4OVZ A;  4DV2 M;  3AOE C;  2RGO A;  3I51 A;  1N33 M;  3AFH A;  4GHL A;  3HKP A;  5FTK A;  3HWS A;  3J27 B;  4MGZ E;  4LF8 M;  1Z59 A;  3JR4 A;  2VII A;  3VKG A;  1GL7 A;  4FWG A;  3L28 A;  3A46 A;  2XH9 A;  3KOX E;  2C5R A;  3SAS A;  3Q8X A;  3VK8 A;  4XGI A;  5BPV A;  1OFH A;  4IBJ A;  4JI6 M;  2V1C A;  2KEB A;  1R2Z A;  3L26 A;  5EXP A;  3B9P A;  5IT9 S;  1E9R A;  4QHS A;  1XNR M;  5FTL A;  4NXN M;  2QBY A;  1YE9 A;  2CE7 A;  5KPZ A;  3GLG B;  1IBK M;  2X49 A;  2H1R A;  2ZAN A;  4DV4 M;  4PDG A;  1TH2 A;  4LCB A;  3FUT A;  3IG5 A;  4RF0 A;  3TWL A;  3KSJ A;  1IN6 A;  1IBM M;  4AKH A;  2A5Y B;  1NJF A;  4B7H A;  3IG8 A;  4MGI E;  4IBI A;  3SHF A;  3FYD A;  4MB7 A;  2CHQ A;  3GLF A;  1KSF X;  4DR7 M;  1Q3C A;  1TGU A;  3W0F A;  1N77 A;  1G4A E;  3TWK A;  3UJN A;  2R18 A;  2M60 A;  5FSW A;  2XEP A;  3HU3 A;  1ORY B;  2YQZ A;  2ZAO A;  3QAU A;  4X62 M;  4X66 M;  1OFI A;  1IN7 A;  4JI0 M;  2Z7J A;  4JI7 M;  4DV0 M;  2BJW A;  3HJQ A;  3CTW B;  3LQR A;  4GIP A;  1IN8 A;  5JI2 E;  3WHL A;  2K47 A;  2C96 A;  2FNA A;  1QAM A;  2Y20 A;  1WXQ A;  4D81 A;  3HU2 A;  4LJ4 A;  3UGJ A;  1XC8 A;  2I7N A;  4OVZ B;  3D8L A;  5EJC A;  2R45 A;  1R6B X;  4LFA M;  3KVW A;  2KW0 A;  3PNY A;  5DYG A;  1IN4 A;  4GKJ M;  4KO8 A;  4NL4 H;  1G8P A;  3KXE C;  4JI5 M;  5EXT A;  3GRU A;  5ITX A;  3RGS A;  4BB9 A;  5BR8 M;  4L16 A;  4MGY E;  3KOZ E;  4IIW A;  3KS4 A;  1W5T A;  5EP2 A;  2J7O A;  5JI3 E;  1E9S A;  4LFB M;  1NY6 A;  5KPT A;  1NNJ A;  2JA2 A;  3K2L A;  3GPU A;  2C9O A;  2CV1 A;  4LF5 M;  4FCT A;  4NRW A;  1S3S A;  2QBY B;  4FCW A;  2Z3X A;  1PJJ A;  2YR0 A;  3FD9 A;  3JAM S;  3TPZ A;  3M0E A;  4Z6Y A;  2XFT A;  3R8F A;  1IXS B;  5FLX S;  1E94 E;  3MK6 A;  2OPF A;  4LZJ A;  2XSZ D;  4ZPX A;  3AKZ A;  4FW9 A;  1KYI A;  5KO3 A;  4DV1 M;  2UXB M;  1GVN A;  4LGY A;  4QNM A;  1IN5 A;  1L2B A;  3L2A A;  3PNV A;  4PD2 A;  3SYL A;  4Z8X A;  1K82 A;  1IBL M;  3E4R A;  1N32 M;  3DZD A;  3SAW A;  3GLF B;  1DO2 A;  4IBD A;  4IBB A;  2YFQ A;  3TWM A;  3J81 S;  5ITY A;  3A98 B;  3QWL A;  3EIE A;  1NVM A;  3TQS A;  1IXZ A;  2F5S A;  2UUB M;  4G6Z A;  3GO8 A;  1G41 A;  4DV7 M;  5E6J A;  5FTN A;  2V1U A;  3AJI B;  5ITR A;  1XXH A;  3I4Y A;  4BLC A;  4LJ6 A;  1UM8 A;  3SAV A;  2KXE A;  2F5P A;  3U6Q A;  4P16 A;  4R7G A;  3RE8 A;  3U6D A;  4LRT A;  1QAN A;  4FWD A;  1HNX M;  4LGM A;  4GC9 A;  2I7P A;  4GHA A;  3SBJ A;  1HR0 M;  1R7R A;  4YY3 M;  2L6O A;  3U6L A;  1IQP A;  3VDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...