5LMUO

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmuO00
1F7YA 2UU9O 5BXZA 1FJGO 1N32O 1XNRO 2DOSA 3J80N 4DR7O 4OX9O 4DUYO 2UXDO 4YHHO 4LF6O 5LL6Y 4A5UB 4X64O 4JI3O 4JYAO 4YY3O 4B3SO 2ZKOA 1HNXO 4AQYO 1XNQO 4LF7O 2UUCO 1YZBA 2UXBO 5A2QN 1J5EO 1IBMO 3T1YO 4LFBO 4OPAA 3F5TA 4DR1O 5BY1A 1N36O 3SDLA 4JI1O 4NXMO 4NXNO 1KUQA 4K0KO 1N33O 4DV5O 4JI8O 4JV5O 2N74A 4GKJO 5IWAO 1IBLO 4JI4O 4DR4O 1IBKO 4KHPO 1XMOO 2HHHO 1I94O 2UUAO 3J7AU 3O65A 1DK1A 1NS1A 2JRIA 3JAMN 2E5LO 3M8AA 4LF4O 4GKKO 4DUZO 4LF8O 4JI5O 4X65O 4JI6O 3J81N 2VQEO 4X62O 4B3TO 4JI0O 4JI2O 2UXCO 2FKXA 4DV0O 3RT3C 4DV6O 4OPHA 1XEQA 2DJVA 4DR3O 5LMUO 4DV1O 4DV2O 4B3MO 1AB3A 1HR0O 1R6TA 4DV3O 4DR2O 4JI7O 1HNWO 1R1BA 2LW7A 3T1HO 4LF9O 1N34O 5H5NA 2VQFO 3OTOO 1XMQO 1FYJA 5LMNO 4DR6O 1AILA 1A32A 5BR8O 4DR5O 4LF5O 2Z0AA 4LFAO 2ZM6O 1X59A 1D2DA 4X66O 1G1XB 2F4VO 1FKAO 5FLXN 2UUBO 2AGAA 1HNZO 5IT9N 4DV7O 4DV4O 3R66A 4LFCO 4B3RO
chains in the Genus database with same CATH superfamily
1VQ8V 2XOKG 1F7YA 1RM1C 1FJGO 1EZVH 4JI0B 2UXBB 3STLC 3IC9A 2D2CB 2X6AA 5FNVA 4X9QA 4L87A 1ZAUA 2DYSB 4U3JA 2Z3YA 4A5UB 1M5IA 4JI6B 1NKDA 3CXCU 2R9IA 1Q86W 1DGSA 1M56C 4NTXA 4LNUB 1N34B 1KB9F 1M93A 2UUCO 3U11A 4TUYA 4O2AB 3ZJZA 4PA9A 3F7YC 4OPAA 3I55V 1VF6A 2LW1A 3JALA 1P84F 1NT2B 2PTMA 2ZT9B 4K0KO 1IDSA 4IGGA 2N74A 5EBWC 3K03A 2YI8A 4PELA 4DV4B 1XL6A 3R65A 4IHJB 1AI7A 1WN7A 5IJ0A 1I94O 1MZFA 4BWAA 1H2SB 2ADQB 3S3XA 3W7SA 5KHKA 3VQVA 1SF9A 4XDKA 4UCVA 1SQBH 5JJJB 1ORQC 2UUBB 2H8PC 5JCOC 2FKXA 4J7JA 3OM3B 1QU7A 2EIKC 3B8NA 1CXZB 3BAAA 2AHYA 1R6TA 1G4YB 1LR1A 3KG2A 1KKDA 1SQGA 3ML0A 2IJJA 5LBQA 4K8XA 2Q69A 1SS3A 2UXXA 2CGOA 2PYLA 2H3OA 3TJTA 3T1YB 4CH5A 1J5EB 2EIMC 2W0FC 2ITCC 1VQOV 3BA9A 1GH6A 4DV7B 4O4JB 4LF9B 2WLHA 1YXBA 5E1AC 2EINC 3CJHA 4U3FH 4DR3B 2QM4A 1FKAO 2QA4V 2ILMA 4UUJC 2CK3G 1H38A 4LF7B 3ETDA 4MT8A 2FL4A 1XUQA 2XTAA 4YXWG 3QO5A 4WFAV 4YIPA 4RO2A 3H1JH 4FLVA 5GONA 2WA3A 3X2QC 1B04A 2B1IA 2JS5A 4IHJA 4ZKIA 3JSNA 1IVSA 1MNGA 4DR7O 2ZE7A 4X1IA 4B3MB 1BHBA 2EIKB 1RPOA 2YXYA 3JALB 3JAKB 4TV8A 5GTIZ 3CCMV 3AK1A 1AR5A 1MABG 3ZRVA 4EFEA 5GTHZ 3OUFA 3JARB 1YF2A 1FD9A 1US6A 5LGUA 3X2QB 4BIUA 3BPZA 2VWJA 4P2ZA 1BQ0A 2DWDC 1N36O 1YJWV 2AZ2A 1BZKA 2ZIOA 2ODMA 2GTAA 1RFYA 2LGQA 4F6EA 4X8AA 2O57A 5BMVA 4OX9B 5LP6A 4B3SB 3SYPA 1SQFA 1YHQV 1DK1A 1MMMA 3MHHC 4DR5B 4NVPA 1YIJV 4LF4O 4LF8O 1NTKH 2JIZG 2IW5A 4JI2O 4I0XB 4CS2A 1M57C 2NR5A 4DV1O 2LP7A 1Q43A 2Z5UA 4YIOA 4MW3A 4ZIBA 4RUEA 2Q0AA 1QQCA 2CDYA 3RBZA 2WA4A 3CS5A 4O4LB 3D8CA 1NU1H 4F4LA 3JAKA 1FXKB 2OCCC 2ZM6O 1Y76B 2AHZA 1AROP 3LDDA 3TETA 1NVPB 3RVYA 5IWAB 2M6YA 4DV5B 4WBNA 2A3QA 3ZS8C 1QHTA 1PP9H 2QTSA 2P67A 2F4VB 2CTQA 1NR7A 3GVMA 2JJ1G 3OTFA 1H8HG 2R70A 1NI8A 3B40A 2ZR3A 4HNAA 2Q4PA 2QWQB 4K0KB 2NNUA 4X20A 2P90A 3CCEV 4X64O 5B3SC 4MTOA 4DO2A 5FNVB 2IM9A 3WB2A 5LP6C 2F95B 1K8AW 3OUSA 3CJHB 1P49A 4LFAB 2KKWA 1UFIA 5KHJA 4DR1O 1OV9A 1YJ9V 3G80A 4JI1O 1KUQA 5JVDA 1GO3F 4NB5A 2IH3C 5EBMC 3H01A 4DW1A 3MD0A 1BL8A 2ZDIC 5DM6V 2RDCA 1EM1A 3J81N 4D7SA 2ZM6B 3HR0A 3CX5F 3SJBC 1Z2GA 5KHHA 3ETEA 1FXVA 1LNQA 1RSOB 4QNHB 2WLIB 2WLLA 2EILB 3ASOB 3TK1A 3UQ8A 1UPGA 4ZBMA 1IXMA 2WLLB 3G67A 1JMKC 3DXRA 2QKCA 1MA1A 2ZCEA 2JEUA 2PUSA 4EB6A 4J41A 5KA6A 1NBMG 2ZINA 2ZXWC 4FK5C 4IIJA 2AGAA 3IGAC 3CC4V 1F23A 4U3JB 5JVDB 4F6RB 3TXSA 4JI8B 1B3QA 5LHGA 2Q67A 1VQ7V 2ETNA 3HKEA 1EN5A 4JTAB 1BMFG 4B3SO 2KG7A 2ZDIA 1VF5B 4WF9V 4DV6B 1VQ5V 1K7DA 4J9YB 5K1XA 4MVMA 2KG7B 4ABMA 3F5TA 4CC6A 3OTOB 3T2MA 4MVZA 3ZHSA 1VQMV 3B2EE 5LOVA 4GLXA 5L3GA 1XNRB 3B8MA 4I4TA 1EFRG 3RYCB 1AJNA 1K9MW 2E75B 2P4KA 2UXDB 1GK9A 4OPHA 3SGIA 4EEQA 4J10A 2E5LB 1JR9A 2GV9A 2EINB 5LYJA 2RNBA 1HR0O 1R6NA 1PL4A 3BABA 3KZIZ 1TUBB 4JYAB 4AHCA 3T1HO 4DR2B 2Y4TA 4DK1A 5B1AB 4U7NA 3SYOA 2JJ2G 1JCHA 2XHBA 1SQQH 1FFTB 2EZPA 4DXWA 5KAFZ 3BY6A 4GT1A 2DQ3A 4Z1VA 2BCCH 1QR9A 1WA8A 1MG1A 1GN4A 2Q0OC 5C8YB 1SZTA 5KMGA 3ZRSA 1F51A 4PDVA 2D3OW 1W0KG 4BW5A 4JTDB 4FIPC 5BXZA 4X64B 4FLTA 1N4CA 4FM2A 2YIBD 2VRZA 5BZBA 3SJCC 1TA8A 5KA5A 1QBZA 4E4EA 2UUAB 4K3AA 3ZEDA 1Z5VA 4YY3O 3HB3B 4JI1B 3K0DA 2EBOA 1XNQO 1GM9A 1W0JG 1H2GA 3VQYA 1M57B 3A0HZ 4R8CA 1EN4A 2P22C 2QR4A 1K4CC 1SC5B 5LHHA 1V9PA 1JOYA 3AG1B 3M8AA 4JI6O 2Q6AA 1IBKB 3NR7A 5JH7B 1NQTA 2ZE6A 1R3JC 1WNSA 2HJDA 5IJ9B 1I7FA 4H37A 4X1IB 2Q5ZA 2IJKA 5BMVB 4CS3A 1SERA 3LSSA 5LMNO 2CH7B 2HJFC 3RYFA 4JYYA 4JI7B 2WLMA 1GN3A 2ZNIA 4LF5B 3C3SA 3DXRB 5FL7G 4W4KA 3ZMZA 2XUMA 2WAMA 1JPXA 2UUBO 3A0BZ 3M7MX 2WLJA 1W2BU 1XBLA 3ZX6A 1IX9A 2Q7EA 3SYAA 1RP3B 2DYRB 5L3FA 3ZN1A 4O4LA 1VEWA 3FX7A 1SQXH 4G28B 1K34A 4UVCA 5KX5A 2HG5C 5EC2C 4P30A 3N2GB 4JI5B 2B1GA 2YIAA 3H1KH 4R6ZA 2FMLA 3H9VA 3JASB 5CA3A 4JTCB 5J9PC 4W4LA 3BEHA 4ZI7B 2EZOA 4LF7O 2IU0A 4FLUA 3CHXA 1JFFA 1IBMO 4WFHA 4JF3A 1NH2D 2GTSA 4J7KA 2Y69C 2RQ6A 1PNLA 3MHSC 4TV9A 1RPRA 1HR0B 1IBLO 4JI4O 2AZ0A 2QWPB 1XMOO 2HHHO 3T1HB 4O4HA 4HYOA 4GKKO 2OTLV 4FJCC 4JZ2A 4AQYB 1DF4A 1HNXB 1JQ0A 4WFBV 3G6EV 1BCCH 3SJAC 3FYIB 2IJHA 1KBHA 4DV2O 1BE3H 2EX3A 1AB3A 1FS0G 3UT5B 3CRRA 4J11A 2P7TC 2ARHA 4ZOLB 4KXRA 1KECA 4J7ZA 1JFFB 2VS0A 4TV9B 4TOIA 3HPLC 1XMQO 4DR5O 2Q8VA 5CA0B 4LF8B 4GZRB 2N05A 4LP8A 1GRJA 1B06A 2X6CA 1YEWA 3A8TA 4HNAB 3ZHRA 2WLNA 5L3BA 3JD3A 4FLZA 1H2NA 1NTMH 2PI5A 1HNZO 4C7UA 1GN2A 1WB8A 1XOUA 3AG1C 4NTWA 4CBCA 4Z2WA 1TVKA 3OT7A 4UVAA 4MVSA 3OMIB 3OR7C 5IYZB 2V1DA 1XMOB 2HHHB 1BHAA 3NXSA 1N32B 1FFXA 2YIBA 3C90A 1OZ0A 1CPYA 4LR3A 4YJ2B 1AVMA 3RYFB 4O2AA 2V7QG 1SRYA 3FYEB 4AQYO 2CTWA 3SJQC 1HNXO 3IC7A 1J5EO 3CP1A 4WCEV 1XREA 1DLBA 4DV2B 2EIMB 4H33A 4DV5O 1LUWA 1XHZA 1Y66A 2E74B 2OCCB 3RN4A 2B5UA 5JQGA 1COWG 1VIBA 4YJ3B 1LUVA 3F5WC 5LMNB 3AEIA 4DV0O 3FAVB 4LFBB 4PDRA 1SQPH 1QVFU 1SA0A 2CTPA 3P32A 5CN0A 2ZXWB 2UXCB 1VQKV 1HNWO 4H13B 4UV8A 4RQEA 3SR2C 1K92A 3E22B 2BE3A 3G71V 5KHGA 1E1QG 2EJRA 4PA6A 1VF7A 1WB7A 4X88A 3D3IA 2MW2B 3HKCA 1OHHG 1RSOA 3DGEA 2C2AA 2PI4A 1K33A 2PY5A 3OD4A 1M56B 2YC0A 4MVUA 1IXBA 4PD4F 3SPGA 3WB0A 4TUYB 4LF4B 4MVOA 5AG2A 2LQTA 4IYIA 4ZHQB 3K08A 1BSMA 1DTOA 1WLEA 1MSDA 1PD3A 3E86A 2Y0IA 2UUCB 2LO1A 3CB2A 1O9HA 1JX9A 1IBLB 4QPJA 4K8ZA 1Q6HA 5EYPA 1K73W 2B9ZA 1VARA 4JI4B 3MDSA 1OCCC 2WPDG 4QE9A 1SQVH 3K5NA 4JI8O 1HNWB 2GDSA 3K5MA 3E8BA 2GBOA 2XAGA 1VQ4V 1M1KW 3IFXA 1KC8W 5EZYA 4AI8A 3UCSC 4B7EA 4WFEA 3DTUB 4X65O 3PN1A 1QLEB 3LNNA 5L3EA 4YJ2A 4DV6O 4KL1A 2XASA 4LFCB 2DJVA 2X0LA 3L75H 2KB1A 4UCSA 3ZIAG 4LF6B 1FAFA 5EC1C 4JPRA 2JVDA 1FXHA 4LF9O 4PA3A 2QSAA 4KHPB 4J9ZB 3OTOO 5CA1A 3ZMSA 1YVWA 4FZ0A 1XI1A 2QDOA 4DR6O 4LH7A 1A32A 4KFMA 3LSUA 1XILA 1HNZB 1X4TA 1H2MA 5L3DA 3FD9A 2DN9A 3QG5A 2EILC 1L8DA 3JCZA 3ABMC 4HZ3A 5IT9N 5JJNB 2OWOA 4EKWA 1I0HA 2YICA 4EFBA 1N32O 2Q7GA 4D6TH 5B66Z 4PV1B 2QTOA 5DEDA 4GX2A 1YI2V 2BTOA 4DUYO 1KQSU 3H1IH 4JI3O 5JJEB 1P7GA 3L74H 1YJNV 5EIBC 5LMUB 4MS2A 2OYQA 4X65B 4EB6B 3JATB 1Q5OA 1WP8A 5B1AC 2VQFB 1KD1W 3O9OA 1ZX3A 4NXMO 1S77D 3SPJA 4YJ3A 1QLNA 2QM7A 5B3SB 1ZSPA 4L8JA 3GB7C 1K4DC 4KHPO 2UUAO 4X1KA 1Y4MA 1K3EA 2LGWA 5CBFA 2UXNA 2UXCO 1KU9A 4DR4B 3ABKB 3L71H 2R9RB 1Q90D 1XEQA 2P6JA 2A7WA 5H9CA 4E2LA 2YUAA 1EN6A 2P4VA 3C3TA 5EIBD 4I0XA 3ASNB 4DYLA 2LFRA 1WA8B 1SZXA 5C8YA 1GKFA 3E35A 3ZRWA 2QKSA 2HP8A 4DV3B 4ZOLA 5JH7A 1WJZA 4PI2A 2R72A 2F23A 1GTOA 1URFA 5LXTB 3E22A 3WG7B 5CB4A 1XDCA 2F4VO 1QNMA 3CCLV 3SPCA 3ABMB 2EIJC 2YDEA 4JAUA 4FPPA 3CCVV 2XNDG 2NN4A 4B3RO 4RAIA 3ETGA 3ABTA 2QWOB 1G8MA 4BAYA 4TSFG 1BT8A 4DR7B 2DW4A 4DK0A 2Y69B 3CEIA 4J80A 3W7UA 3RVZA 1R73A 5C93A 3ASOC 4I50A 5B1NA 4Q6GA 1Y76A 1BGYH 2Y0PA 4JYAO 3T4DA 5JQGB 2PYJA 5KLVH 1OCRC 2ZKOA 2YXLA 1AR1B 3JATA 3P3NA 5EK0A 3I5DA 3M99B 1ROPA 2RN9A 1S0VA 3OAAG 4ASUG 3B77A 1VP7A 5KAIZ 3E89A 1NTZH 1XL4A 1N0NA 2QM8A 2YSUB 4O4JA 3CRMA 4PDMA 1FFXB 3QO8A 3H1HH 4DUZO 1K5QA 3UO3A 1H2KA 4JI5O 4FFBB 1THZA 4FLXA 5CMUA 3K9AA 3AK3A 2IJIA 4UCTA 4FFBA 3FB5C 4UCRA 1OJHA 3BCCH 4JV5B 4JAVA 4ZI7A 5B1BC 3CCRV 2RCVA 2W6JG 3F7VC 5LP6B 4B3TB 5IY5B 3CCJV 4B3RB 4N21A 2XAHA 1PNMA 4IL6Z 4MW8A 5FPOA 3CD6V 1PPJH 1OCRB 4NR1A 3D3QA 1AILA 5CA0A 5BR8O 1KKCA 2F93B 2GHYA 1KP2A 1YCIA 1X59A 3CPWU 4X1KB 2ADPA 4GKKB 5IJ0B 3ZBHA 5IY5C 1U97A 4FM1A 3CWBH 1S5HC 3R66A 3E8FA 3CRCA 2UU9O 4LCUC 4PA7A 4JI3B 1P4RA 3L70H 3RGBA 3Q4HA 2JGUA 3H1LH 2A06H 2YI9A 3QVNA 5LYJB 4TQFA 4KP4A 3QNEA 4UFZA 4FVMA 1AP5A 1WAZA 3CMEV 2DQ0A 2HVJC 3HKEB 5IYDO 5CB4B 1S5LZ 1E79G 4MVQA 3K5LA 1SETA 5DN6G 1NR1A 3RYCA 3L73H 1R3KC 1JA8A 2ZQMA 3AG3B 3JAWA 4NXNO 4NKGB 3RYIB 5JCOA 4DR1B 3AG3C 4GKJO 3IJ4A 3K58A 4DR4O 1U96A 1S76D 4X66B 1Q82W 3G6BA 3J7AU 1K97A 4UB8Z 1NS1A 3AG7A 1RM1B 2E5LO 4JGSA 1GN6A 5BR8B 3THOA 2VQEO 2HKOA 4JI0O 3TGUH 4UCOA 3KCYA 3CC2V 3D36A 2KSDA 1AI4A 3ZHVA 3JYCA 3KKYA 5FPRA 1JJOA 1PKXA 2VWKA 2X7RB 1Y74A 2GSMB 2WWWA 4X62B 4DV3O 3OW2U 3D36C 4MTFA 4BIZA 2HR3A 3APOA 4TQDA 1M4UA 4UXNA 1SKVA 5H5NA 1N34O 4LBEC 4MTXA 1Q3EA 4DW0A 4OXSA 4BW9A 1TAEA 1VQ9V 2ATKC 1PL0A 2Q7HA 4P9PA 5EBLC 4X89A 4DV0B 2P06A 5B1BB 3E2EA 3ZHTA 2ZE5A 1QCEA 3OEHG 2OIEA 4LWSA 2BTQA 3FAVA 5LHIA 1YTFD 3RYHA 4TT3G 4O4IB 4LFBO 4TWKA 1QVGU 3JCUZ 3P3PA 2P5OA 5H6QA 5KHIA 3QF7A 4YY3B 3OGIB 2DOSA 4QE7A 5CBHA 1KP3A 3CRAA 5IYCO 1P7BA 3UM7A 2HLDG 3K04A 4LWSB 2Q73A 3CCSV 2CH7A 3W7TA 5CA1B 1XQ8A 4XBFA 4B08A 1YZBA 3G4SV 1NH2B 3GWOA 5A2QN 1B6QA 3T1YO 2YEVB 1GMGA 3WG7C 1EBOA 1WPBA 3CXHF 4FM0A 3HKDA 4JV5O 4JZGA 1OCOB 4KUMA 2ZR2A 1IBKO 2DWEC 3OE7G 4YHHB 4CZZA 4MVRA 2JDIG 5IE9A 3CE2A 3PJSK 1HWYA 4I9WA 1CEZA 4MTGA 2PGGA 4LC1A 2K1EA 2DYRC 2F1MA 4B3TO 1R6KA 3N2KB 3A2FA 1VQPV 4P9OA 4J42A 1QLEC 3T1CA 1H2LA 5GONB 2BOBC 1HDJA 3STZC 1AI6A 3ZMVA 2HFEC 4XDLA 5KX5B 4B3MO 3ZN0A 4DR2O 4JI7O 4IYHA 4OGQB 2LW7A 1AI5A 2YS8A 4JASA 1FYJA 5K1PA 2W0XA 3JAWB 2IBZH 5JWPA 1TGOA 2UU9B 3DSQA 3AG4C 1Z5WA 3K79A 2Z0AA 3HKBA 3E83A 5KUMA 1N36B 3OFNG 1AP6A 3OEEG 1FXKA 4IIJB 2ZE8A 2IH1C 3DC6A 1W59A 3LDCA 3CC7V 4DV4O 4LFCO 3GWKC 4Z1MG 1CP9A 3ZMTA 4ZHQA 4K35A 1XHXA 3Q4HB 1V55B 3VQXA 2QJ1A 3RW0A 1IZ3A 3JD4A 1I94B 3ZCCA 4YHHO 3JD2A 3UO2A 5CBGA 2DYSC 5LA6A 5LL6Y 2LJ2A 3BVOA 2JEXA 4WBNB 1D5AA 3SYCA 2Q9LA 1SESA 1EZJA 3CYOA 3N27A 4GKJB 3RYHB 1XNQB 2QGNA 3AG4B 5D5PA 3SDLA 1YTFB 2IU3A 2RMKB 5IWAO 3DC5A 4JAAA 3ZRXA 3WFVA 3LSQA 5EZYB 2BSKA 2EULA 3O65A 1S5JA 4FMTA 4FZ1A 1J95A 5HFLA 1N8RW 1S3JA 2WSSG 4G2KA 2AW9A 3RFRA 4X62O 2GUZA 3AG2C 1PM9A 3E8GA 1NZ6A 2JGDB 3MAQA 4DUYB 1FXKC 2PF4E 4DR3O 3EVKA 4R7CA 3UKMA 5LMUO 5EYPB 3APQA 5IDJA 1Y67A 4H0LB 1WPXA 2VQFO 3BHPA 1M9NA 4JYBA 4Q20A 4O4HB 1V54B 4QPKA 4CC5A 4LF5O 3LUTB 4O2BA 1NVPD 3OMNB 5KMGB 5J2TB 3BA8A 1Q81W 1F4NA 3RYIA 1HW7A 2AXTZ 2FB5A 3SYQA 3QTCA 3CCUV 2N04A 2CTRA 3W7XA 2EIJB 2F66C 2WLIA 2QE7G 1VQ6V 1OCZB 4F6RA 4I50B 5ITZA 2QWNB 4HBNA 3I56V 1TUEB 2BTQB 2A0LA 3AG2B 3TXQA 2H94A 3ABLB 4FFKA 4PA4A 1YSCA 1BS3A 3U0ZA 1IURA 4QJFB 3W7WA 1S72V 4OX9O 1GAXA 1KYOF 4LF6O 3K59A 2M7WA 3K9SA 4DV1B 2G38A 3K5OA 2Q68A 3LDEA 1K5SA 4R50A 1UJWB 3E8HA 5H6RA 4X1YA 3CCQV 2A9HA 3EHBB 3FKSG 4DR6B 3K3WA 3SPHA 3CSXA 4B7KA 2W6IG 4I4TB 1V55C 5KUKA 2ZD9A 5BY1A 5D5QA 5LGNA 5ITZB 2KQXA 1N33O 1T5EA 5LOVB 3L9DA 4CH6A 3JSLA 1PV0A 3OR6C 3K06A 1MOFA 3ABUA 3JAMN 1AJPA 3VBBA 1ZL8B 4RQFA 4LNUA 1I5XA 3WU2Z 1NJIW 5GW7A 1VQLV 3TCUA 3FFQA 2X6BA 3FB8C 4ICGA 4QGPA 1I5YA 1Q8IA 1ZUQA 2DE0X 2CAZC 1XMQB 3A0RA 2QWRB 1MSWD 1R3IC 4O4IA 4QIWF 4PHZA 5L3CA 5F2VO 5DECA 4DUZB 4LFAO 4RWUA 2XAJA 2XAQA 3B4SA 2ZNJA 4X20B 5E79Z 4DRXB 3OMAB 5LGTA 4UB6Z 5J2UA 1GM7A 3N2GA 3T4ZA 2EJ7A 4WFFA 4BR6A 5J2UB 3B09A 2L6LA 1V54C 2RJZA 5A9GA 3ZMUA 3ZHUA 1MZEA 4NYKA 3ETQA 3ABKC 3J80N 3ZRWB 2FYUH 4U7OA 3KCXA 1FJGB 1VMGA 4MSWC 3U10A 1JJ2U 4I9QA 4O2BB 2UXBO 4I7ZB 4PI0A 3K57A 4RUFA 3L72H 4XDJA 1JVMA 2Y4UA 4LH6A 5B1OA 2XAFA 3EFFK 2LFSA 4CS4A 1HP8A 3ASNC 3ZHQA 2GUZB 1L0NH 3VQWA 2L35A 2YXHA 4PJ0Z 4UVBA 5IYZA 1H8EG 1Q7YW 2OIGA 3FB7C 4G27B 2BSKB 2JGDA 4GCZA 3EXAA 1ENVA 4X1YB 3SPIA 5H2FZ 2HEPA 4GX5A 3JD1A 4CH4A 1F4MA 3JASA 5B5EZ 3QO7A 1VF6C 4AILC 1Q6IA 1AR4A 4DRXA 3IAYA 3JARA 2DMXA 4CH3A 1OCZC 4GYCB 2CUGA 2OTJV 4UCUA 1GM8A 3S3WA 3N2KA 3OGCC 1D2DA 4X66O 4I5SA 1AJQA 2JK5C 3BFRA 1ZWIC 2YIDA 5FLXN 2CGNA 2VQEB 1O9GA 3P30A 4DV7O 1WP7A 4I55A 2Y48A 2V4DA 3JD0A 3VOUA 1XNRO 2QEXV 1L1FA 2PZSA 2HVKC 1ZLZA 1OCOC 1ZL8A 3LNMB 2UXDO 1KMIZ 1FPOA 4IT5A 4HAMA 2XT9A 1L0LH 1N33B 4NXMB 4N23A 5IJ9A 4JYCA 1QR8A 3HKBB 4GUNA 1TUBA 4BIOA 2BOCC 3CMAV 1TVKB 3AK2A 2FTKA 4FLWA 1G6UA 3BRCA 2OT5A 2R9AA 3FB6C 1YITV 2ZIMA 5IYBO 2JRIA 2MK3A 1SA0B 4I55B 1M90W 4WFGA 1N0JA 3RT3C 4TV8B 1DF5A 4H44B 4D7TA 3WB1A 1PNKA 3K0GA 1Y74B 1D5NA 4FLYA 4GX1A 2F43G 3CRQA 2K9PA 2QKAA 3HKCB 2WLKA 2ITDC 4JI2B 1R1BA 1VQNV 3RWRD 5TISZ 2YEVA 5LA6B 3ICXA 3UT5A 2NLJC 1E1RG 3HKDB 5J2TA 1Y6XA 2E3CA 4UV9A 1IBMB 2CE4A 1OCCB 4NXNB 1I08A 3ABLC 4NTYA 5HFMA 1G1XB 5LXTA 1R3LC 2A79B 4PDLA 1YDXA 1BQZA 2JS3A 2OCHA 4GX0A 1Q6UA 2E76B 1ZTEA
chains in the Genus database with same CATH topology
1F7YA 2UU9O 5BXZA 1FJGO 1N32O 1XNRO 2DOSA 3J80N 4DR7O 4OX9O 4DUYO 2UXDO 4YHHO 4LF6O 5LL6Y 4A5UB 4X64O 4JI3O 4JYAO 4YY3O 4B3SO 2ZKOA 1HNXO 4AQYO 1XNQO 4LF7O 2UUCO 1YZBA 2UXBO 5A2QN 1J5EO 1IBMO 3T1YO 4LFBO 4OPAA 3F5TA 4DR1O 5BY1A 1N36O 3SDLA 4JI1O 4NXMO 4NXNO 1KUQA 4K0KO 1N33O 4DV5O 4JI8O 4JV5O 2N74A 4GKJO 5IWAO 1IBLO 4JI4O 4DR4O 1IBKO 4KHPO 1XMOO 2HHHO 1I94O 2UUAO 3J7AU 3O65A 1DK1A 1NS1A 2JRIA 3JAMN 2E5LO 3M8AA 4LF4O 4GKKO 4DUZO 4LF8O 4JI5O 4X65O 4JI6O 3J81N 2VQEO 4X62O 4B3TO 4JI0O 4JI2O 2UXCO 2FKXA 4DV0O 3RT3C 4DV6O 4OPHA 1XEQA 2DJVA 4DR3O 5LMUO 4DV1O 4DV2O 4B3MO 1AB3A 1HR0O 1R6TA 4DV3O 4DR2O 4JI7O 1HNWO 1R1BA 2LW7A 3T1HO 4LF9O 1N34O 5H5NA 2VQFO 3OTOO 1XMQO 1FYJA 5LMNO 4DR6O 1AILA 1A32A 5BR8O 4DR5O 4LF5O 2Z0AA 4LFAO 2ZM6O 1X59A 1D2DA 4X66O 1G1XB 2F4VO 1FKAO 5FLXN 2UUBO 2AGAA 1HNZO 5IT9N 4DV7O 4DV4O 3R66A 4LFCO 4B3RO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7Y A;  2UU9 O;  5BXZ A;  1FJG O;  1N32 O;  1XNR O;  2DOS A;  3J80 N;  4DR7 O;  4OX9 O;  4DUY O;  2UXD O;  4YHH O;  4LF6 O;  5LL6 Y;  4A5U B;  4X64 O;  4JI3 O;  4JYA O;  4YY3 O;  4B3S O;  2ZKO A;  1HNX O;  4AQY O;  1XNQ O;  4LF7 O;  2UUC O;  1YZB A;  2UXB O;  5A2Q N;  1J5E O;  1IBM O;  3T1Y O;  4LFB O;  4OPA A;  3F5T A;  4DR1 O;  5BY1 A;  1N36 O;  3SDL A;  4JI1 O;  4NXM O;  4NXN O;  1KUQ A;  4K0K O;  1N33 O;  4DV5 O;  4JI8 O;  4JV5 O;  2N74 A;  4GKJ O;  5IWA O;  1IBL O;  4JI4 O;  4DR4 O;  1IBK O;  4KHP O;  1XMO O;  2HHH O;  1I94 O;  2UUA O;  3J7A U;  3O65 A;  1DK1 A;  1NS1 A;  2JRI A;  3JAM N;  2E5L O;  3M8A A;  4LF4 O;  4GKK O;  4DUZ O;  4LF8 O;  4JI5 O;  4X65 O;  4JI6 O;  3J81 N;  2VQE O;  4X62 O;  4B3T O;  4JI0 O;  4JI2 O;  2UXC O;  2FKX A;  4DV0 O;  3RT3 C;  4DV6 O;  4OPH A;  1XEQ A;  2DJV A;  4DR3 O;  5LMU O;  4DV1 O;  4DV2 O;  4B3M O;  1AB3 A;  1HR0 O;  1R6T A;  4DV3 O;  4DR2 O;  4JI7 O;  1HNW O;  1R1B A;  2LW7 A;  3T1H O;  4LF9 O;  1N34 O;  5H5N A;  2VQF O;  3OTO O;  1XMQ O;  1FYJ A;  5LMN O;  4DR6 O;  1AIL A;  1A32 A;  5BR8 O;  4DR5 O;  4LF5 O;  2Z0A A;  4LFA O;  2ZM6 O;  1X59 A;  1D2D A;  4X66 O;  1G1X B;  2F4V O;  1FKA O;  5FLX N;  2UUB O;  2AGA A;  1HNZ O;  5IT9 N;  4DV7 O;  4DV4 O;  3R66 A;  4LFC O;  4B3R O; 
#chains in the Genus database with same CATH topology
 1VQ8 V;  2XOK G;  1F7Y A;  1RM1 C;  1FJG O;  1EZV H;  4JI0 B;  2UXB B;  3STL C;  3IC9 A;  2D2C B;  2X6A A;  5FNV A;  4X9Q A;  4L87 A;  1ZAU A;  2DYS B;  4U3J A;  2Z3Y A;  4A5U B;  1M5I A;  4JI6 B;  1NKD A;  3CXC U;  2R9I A;  1Q86 W;  1DGS A;  1M56 C;  4NTX A;  4LNU B;  1N34 B;  1KB9 F;  1M93 A;  2UUC O;  3U11 A;  4TUY A;  4O2A B;  3ZJZ A;  4PA9 A;  3F7Y C;  4OPA A;  3I55 V;  1VF6 A;  2LW1 A;  3JAL A;  1P84 F;  1NT2 B;  2PTM A;  2ZT9 B;  4K0K O;  1IDS A;  4IGG A;  2N74 A;  5EBW C;  3K03 A;  2YI8 A;  4PEL A;  4DV4 B;  1XL6 A;  3R65 A;  4IHJ B;  1AI7 A;  1WN7 A;  5IJ0 A;  1I94 O;  1MZF A;  4BWA A;  1H2S B;  2ADQ B;  3S3X A;  3W7S A;  5KHK A;  3VQV A;  1SF9 A;  4XDK A;  4UCV A;  1SQB H;  5JJJ B;  1ORQ C;  2UUB B;  2H8P C;  5JCO C;  2FKX A;  4J7J A;  3OM3 B;  1QU7 A;  2EIK C;  3B8N A;  1CXZ B;  3BAA A;  2AHY A;  1R6T A;  1G4Y B;  1LR1 A;  3KG2 A;  1KKD A;  1SQG A;  3ML0 A;  2IJJ A;  5LBQ A;  4K8X A;  2Q69 A;  1SS3 A;  2UXX A;  2CGO A;  2PYL A;  2H3O A;  3TJT A;  3T1Y B;  4CH5 A;  1J5E B;  2EIM C;  2W0F C;  2ITC C;  1VQO V;  3BA9 A;  1GH6 A;  4DV7 B;  4O4J B;  4LF9 B;  2WLH A;  1YXB A;  5E1A C;  2EIN C;  3CJH A;  4U3F H;  4DR3 B;  2QM4 A;  1FKA O;  2QA4 V;  2ILM A;  4UUJ C;  2CK3 G;  1H38 A;  4LF7 B;  3ETD A;  4MT8 A;  2FL4 A;  1XUQ A;  2XTA A;  4YXW G;  3QO5 A;  4WFA V;  4YIP A;  4RO2 A;  3H1J H;  4FLV A;  5GON A;  2WA3 A;  3X2Q C;  1B04 A;  2B1I A;  2JS5 A;  4IHJ A;  4ZKI A;  3JSN A;  1IVS A;  1MNG A;  4DR7 O;  2ZE7 A;  4X1I A;  4B3M B;  1BHB A;  2EIK B;  1RPO A;  2YXY A;  3JAL B;  3JAK B;  4TV8 A;  5GTI Z;  3CCM V;  3AK1 A;  1AR5 A;  1MAB G;  3ZRV A;  4EFE A;  5GTH Z;  3OUF A;  3JAR B;  1YF2 A;  1FD9 A;  1US6 A;  5LGU A;  3X2Q B;  4BIU A;  3BPZ A;  2VWJ A;  4P2Z A;  1BQ0 A;  2DWD C;  1N36 O;  1YJW V;  2AZ2 A;  1BZK A;  2ZIO A;  2ODM A;  2GTA A;  1RFY A;  2LGQ A;  4F6E A;  4X8A A;  2O57 A;  5BMV A;  4OX9 B;  5LP6 A;  4B3S B;  3SYP A;  1SQF A;  1YHQ V;  1DK1 A;  1MMM A;  3MHH C;  4DR5 B;  4NVP A;  1YIJ V;  4LF4 O;  4LF8 O;  1NTK H;  2JIZ G;  2IW5 A;  4JI2 O;  4I0X B;  4CS2 A;  1M57 C;  2NR5 A;  4DV1 O;  2LP7 A;  1Q43 A;  2Z5U A;  4YIO A;  4MW3 A;  4ZIB A;  4RUE A;  2Q0A A;  1QQC A;  2CDY A;  3RBZ A;  2WA4 A;  3CS5 A;  4O4L B;  3D8C A;  1NU1 H;  4F4L A;  3JAK A;  1FXK B;  2OCC C;  2ZM6 O;  1Y76 B;  2AHZ A;  1ARO P;  3LDD A;  3TET A;  1NVP B;  3RVY A;  5IWA B;  2M6Y A;  4DV5 B;  4WBN A;  2A3Q A;  3ZS8 C;  1QHT A;  1PP9 H;  2QTS A;  2P67 A;  2F4V B;  2CTQ A;  1NR7 A;  3GVM A;  2JJ1 G;  3OTF A;  1H8H G;  2R70 A;  1NI8 A;  3B40 A;  2ZR3 A;  4HNA A;  2Q4P A;  2QWQ B;  4K0K B;  2NNU A;  4X20 A;  2P90 A;  3CCE V;  4X64 O;  5B3S C;  4MTO A;  4DO2 A;  5FNV B;  2IM9 A;  3WB2 A;  5LP6 C;  2F95 B;  1K8A W;  3OUS A;  3CJH B;  1P49 A;  4LFA B;  2KKW A;  1UFI A;  5KHJ A;  4DR1 O;  1OV9 A;  1YJ9 V;  3G80 A;  4JI1 O;  1KUQ A;  5JVD A;  1GO3 F;  4NB5 A;  2IH3 C;  5EBM C;  3H01 A;  4DW1 A;  3MD0 A;  1BL8 A;  2ZDI C;  5DM6 V;  2RDC A;  1EM1 A;  3J81 N;  4D7S A;  2ZM6 B;  3HR0 A;  3CX5 F;  3SJB C;  1Z2G A;  5KHH A;  3ETE A;  1FXV A;  1LNQ A;  1RSO B;  4QNH B;  2WLI B;  2WLL A;  2EIL B;  3ASO B;  3TK1 A;  3UQ8 A;  1UPG A;  4ZBM A;  1IXM A;  2WLL B;  3G67 A;  1JMK C;  3DXR A;  2QKC A;  1MA1 A;  2ZCE A;  2JEU A;  2PUS A;  4EB6 A;  4J41 A;  5KA6 A;  1NBM G;  2ZIN A;  2ZXW C;  4FK5 C;  4IIJ A;  2AGA A;  3IGA C;  3CC4 V;  1F23 A;  4U3J B;  5JVD B;  4F6R B;  3TXS A;  4JI8 B;  1B3Q A;  5LHG A;  2Q67 A;  1VQ7 V;  2ETN A;  3HKE A;  1EN5 A;  4JTA B;  1BMF G;  4B3S O;  2KG7 A;  2ZDI A;  1VF5 B;  4WF9 V;  4DV6 B;  1VQ5 V;  1K7D A;  4J9Y B;  5K1X A;  4MVM A;  2KG7 B;  4ABM A;  3F5T A;  4CC6 A;  3OTO B;  3T2M A;  4MVZ A;  3ZHS A;  1VQM V;  3B2E E;  5LOV A;  4GLX A;  5L3G A;  1XNR B;  3B8M A;  4I4T A;  1EFR G;  3RYC B;  1AJN A;  1K9M W;  2E75 B;  2P4K A;  2UXD B;  1GK9 A;  4OPH A;  3SGI A;  4EEQ A;  4J10 A;  2E5L B;  1JR9 A;  2GV9 A;  2EIN B;  5LYJ A;  2RNB A;  1HR0 O;  1R6N A;  1PL4 A;  3BAB A;  3KZI Z;  1TUB B;  4JYA B;  4AHC A;  3T1H O;  4DR2 B;  2Y4T A;  4DK1 A;  5B1A B;  4U7N A;  3SYO A;  2JJ2 G;  1JCH A;  2XHB A;  1SQQ H;  1FFT B;  2EZP A;  4DXW A;  5KAF Z;  3BY6 A;  4GT1 A;  2DQ3 A;  4Z1V A;  2BCC H;  1QR9 A;  1WA8 A;  1MG1 A;  1GN4 A;  2Q0O C;  5C8Y B;  1SZT A;  5KMG A;  3ZRS A;  1F51 A;  4PDV A;  2D3O W;  1W0K G;  4BW5 A;  4JTD B;  4FIP C;  5BXZ A;  4X64 B;  4FLT A;  1N4C A;  4FM2 A;  2YIB D;  2VRZ A;  5BZB A;  3SJC C;  1TA8 A;  5KA5 A;  1QBZ A;  4E4E A;  2UUA B;  4K3A A;  3ZED A;  1Z5V A;  4YY3 O;  3HB3 B;  4JI1 B;  3K0D A;  2EBO A;  1XNQ O;  1GM9 A;  1W0J G;  1H2G A;  3VQY A;  1M57 B;  3A0H Z;  4R8C A;  1EN4 A;  2P22 C;  2QR4 A;  1K4C C;  1SC5 B;  5LHH A;  1V9P A;  1JOY A;  3AG1 B;  3M8A A;  4JI6 O;  2Q6A A;  1IBK B;  3NR7 A;  5JH7 B;  1NQT A;  2ZE6 A;  1R3J C;  1WNS A;  2HJD A;  5IJ9 B;  1I7F A;  4H37 A;  4X1I B;  2Q5Z A;  2IJK A;  5BMV B;  4CS3 A;  1SER A;  3LSS A;  5LMN O;  2CH7 B;  2HJF C;  3RYF A;  4JYY A;  4JI7 B;  2WLM A;  1GN3 A;  2ZNI A;  4LF5 B;  3C3S A;  3DXR B;  5FL7 G;  4W4K A;  3ZMZ A;  2XUM A;  2WAM A;  1JPX A;  2UUB O;  3A0B Z;  3M7M X;  2WLJ A;  1W2B U;  1XBL A;  3ZX6 A;  1IX9 A;  2Q7E A;  3SYA A;  1RP3 B;  2DYR B;  5L3F A;  3ZN1 A;  4O4L A;  1VEW A;  3FX7 A;  1SQX H;  4G28 B;  1K34 A;  4UVC A;  5KX5 A;  2HG5 C;  5EC2 C;  4P30 A;  3N2G B;  4JI5 B;  2B1G A;  2YIA A;  3H1K H;  4R6Z A;  2FML A;  3H9V A;  3JAS B;  5CA3 A;  4JTC B;  5J9P C;  4W4L A;  3BEH A;  4ZI7 B;  2EZO A;  4LF7 O;  2IU0 A;  4FLU A;  3CHX A;  1JFF A;  1IBM O;  4WFH A;  4JF3 A;  1NH2 D;  2GTS A;  4J7K A;  2Y69 C;  2RQ6 A;  1PNL A;  3MHS C;  4TV9 A;  1RPR A;  1HR0 B;  1IBL O;  4JI4 O;  2AZ0 A;  2QWP B;  1XMO O;  2HHH O;  3T1H B;  4O4H A;  4HYO A;  4GKK O;  2OTL V;  4FJC C;  4JZ2 A;  4AQY B;  1DF4 A;  1HNX B;  1JQ0 A;  4WFB V;  3G6E V;  1BCC H;  3SJA C;  3FYI B;  2IJH A;  1KBH A;  4DV2 O;  1BE3 H;  2EX3 A;  1AB3 A;  1FS0 G;  3UT5 B;  3CRR A;  4J11 A;  2P7T C;  2ARH A;  4ZOL B;  4KXR A;  1KEC A;  4J7Z A;  1JFF B;  2VS0 A;  4TV9 B;  4TOI A;  3HPL C;  1XMQ O;  4DR5 O;  2Q8V A;  5CA0 B;  4LF8 B;  4GZR B;  2N05 A;  4LP8 A;  1GRJ A;  1B06 A;  2X6C A;  1YEW A;  3A8T A;  4HNA B;  3ZHR A;  2WLN A;  5L3B A;  3JD3 A;  4FLZ A;  1H2N A;  1NTM H;  2PI5 A;  1HNZ O;  4C7U A;  1GN2 A;  1WB8 A;  1XOU A;  3AG1 C;  4NTW A;  4CBC A;  4Z2W A;  1TVK A;  3OT7 A;  4UVA A;  4MVS A;  3OMI B;  3OR7 C;  5IYZ B;  2V1D A;  1XMO B;  2HHH B;  1BHA A;  3NXS A;  1N32 B;  1FFX A;  2YIB A;  3C90 A;  1OZ0 A;  1CPY A;  4LR3 A;  4YJ2 B;  1AVM A;  3RYF B;  4O2A A;  2V7Q G;  1SRY A;  3FYE B;  4AQY O;  2CTW A;  3SJQ C;  1HNX O;  3IC7 A;  1J5E O;  3CP1 A;  4WCE V;  1XRE A;  1DLB A;  4DV2 B;  2EIM B;  4H33 A;  4DV5 O;  1LUW A;  1XHZ A;  1Y66 A;  2E74 B;  2OCC B;  3RN4 A;  2B5U A;  5JQG A;  1COW G;  1VIB A;  4YJ3 B;  1LUV A;  3F5W C;  5LMN B;  3AEI A;  4DV0 O;  3FAV B;  4LFB B;  4PDR A;  1SQP H;  1QVF U;  1SA0 A;  2CTP A;  3P32 A;  5CN0 A;  2ZXW B;  2UXC B;  1VQK V;  1HNW O;  4H13 B;  4UV8 A;  4RQE A;  3SR2 C;  1K92 A;  3E22 B;  2BE3 A;  3G71 V;  5KHG A;  1E1Q G;  2EJR A;  4PA6 A;  1VF7 A;  1WB7 A;  4X88 A;  3D3I A;  2MW2 B;  3HKC A;  1OHH G;  1RSO A;  3DGE A;  2C2A A;  2PI4 A;  1K33 A;  2PY5 A;  3OD4 A;  1M56 B;  2YC0 A;  4MVU A;  1IXB A;  4PD4 F;  3SPG A;  3WB0 A;  4TUY B;  4LF4 B;  4MVO A;  5AG2 A;  2LQT A;  4IYI A;  4ZHQ B;  3K08 A;  1BSM A;  1DTO A;  1WLE A;  1MSD A;  1PD3 A;  3E86 A;  2Y0I A;  2UUC B;  2LO1 A;  3CB2 A;  1O9H A;  1JX9 A;  1IBL B;  4QPJ A;  4K8Z A;  1Q6H A;  5EYP A;  1K73 W;  2B9Z A;  1VAR A;  4JI4 B;  3MDS A;  1OCC C;  2WPD G;  4QE9 A;  1SQV H;  3K5N A;  4JI8 O;  1HNW B;  2GDS A;  3K5M A;  3E8B A;  2GBO A;  2XAG A;  1VQ4 V;  1M1K W;  3IFX A;  1KC8 W;  5EZY A;  4AI8 A;  3UCS C;  4B7E A;  4WFE A;  3DTU B;  4X65 O;  3PN1 A;  1QLE B;  3LNN A;  5L3E A;  4YJ2 A;  4DV6 O;  4KL1 A;  2XAS A;  4LFC B;  2DJV A;  2X0L A;  3L75 H;  2KB1 A;  4UCS A;  3ZIA G;  4LF6 B;  1FAF A;  5EC1 C;  4JPR A;  2JVD A;  1FXH A;  4LF9 O;  4PA3 A;  2QSA A;  4KHP B;  4J9Z B;  3OTO O;  5CA1 A;  3ZMS A;  1YVW A;  4FZ0 A;  1XI1 A;  2QDO A;  4DR6 O;  4LH7 A;  1A32 A;  4KFM A;  3LSU A;  1XIL A;  1HNZ B;  1X4T A;  1H2M A;  5L3D A;  3FD9 A;  2DN9 A;  3QG5 A;  2EIL C;  1L8D A;  3JCZ A;  3ABM C;  4HZ3 A;  5IT9 N;  5JJN B;  2OWO A;  4EKW A;  1I0H A;  2YIC A;  4EFB A;  1N32 O;  2Q7G A;  4D6T H;  5B66 Z;  4PV1 B;  2QTO A;  5DED A;  4GX2 A;  1YI2 V;  2BTO A;  4DUY O;  1KQS U;  3H1I H;  4JI3 O;  5JJE B;  1P7G A;  3L74 H;  1YJN V;  5EIB C;  5LMU B;  4MS2 A;  2OYQ A;  4X65 B;  4EB6 B;  3JAT B;  1Q5O A;  1WP8 A;  5B1A C;  2VQF B;  1KD1 W;  3O9O A;  1ZX3 A;  4NXM O;  1S77 D;  3SPJ A;  4YJ3 A;  1QLN A;  2QM7 A;  5B3S B;  1ZSP A;  4L8J A;  3GB7 C;  1K4D C;  4KHP O;  2UUA O;  4X1K A;  1Y4M A;  1K3E A;  2LGW A;  5CBF A;  2UXN A;  2UXC O;  1KU9 A;  4DR4 B;  3ABK B;  3L71 H;  2R9R B;  1Q90 D;  1XEQ A;  2P6J A;  2A7W A;  5H9C A;  4E2L A;  2YUA A;  1EN6 A;  2P4V A;  3C3T A;  5EIB D;  4I0X A;  3ASN B;  4DYL A;  2LFR A;  1WA8 B;  1SZX A;  5C8Y A;  1GKF A;  3E35 A;  3ZRW A;  2QKS A;  2HP8 A;  4DV3 B;  4ZOL A;  5JH7 A;  1WJZ A;  4PI2 A;  2R72 A;  2F23 A;  1GTO A;  1URF A;  5LXT B;  3E22 A;  3WG7 B;  5CB4 A;  1XDC A;  2F4V O;  1QNM A;  3CCL V;  3SPC A;  3ABM B;  2EIJ C;  2YDE A;  4JAU A;  4FPP A;  3CCV V;  2XND G;  2NN4 A;  4B3R O;  4RAI A;  3ETG A;  3ABT A;  2QWO B;  1G8M A;  4BAY A;  4TSF G;  1BT8 A;  4DR7 B;  2DW4 A;  4DK0 A;  2Y69 B;  3CEI A;  4J80 A;  3W7U A;  3RVZ A;  1R73 A;  5C93 A;  3ASO C;  4I50 A;  5B1N A;  4Q6G A;  1Y76 A;  1BGY H;  2Y0P A;  4JYA O;  3T4D A;  5JQG B;  2PYJ A;  5KLV H;  1OCR C;  2ZKO A;  2YXL A;  1AR1 B;  3JAT A;  3P3N A;  5EK0 A;  3I5D A;  3M99 B;  1ROP A;  2RN9 A;  1S0V A;  3OAA G;  4ASU G;  3B77 A;  1VP7 A;  5KAI Z;  3E89 A;  1NTZ H;  1XL4 A;  1N0N A;  2QM8 A;  2YSU B;  4O4J A;  3CRM A;  4PDM A;  1FFX B;  3QO8 A;  3H1H H;  4DUZ O;  1K5Q A;  3UO3 A;  1H2K A;  4JI5 O;  4FFB B;  1THZ A;  4FLX A;  5CMU A;  3K9A A;  3AK3 A;  2IJI A;  4UCT A;  4FFB A;  3FB5 C;  4UCR A;  1OJH A;  3BCC H;  4JV5 B;  4JAV A;  4ZI7 A;  5B1B C;  3CCR V;  2RCV A;  2W6J G;  3F7V C;  5LP6 B;  4B3T B;  5IY5 B;  3CCJ V;  4B3R B;  4N21 A;  2XAH A;  1PNM A;  4IL6 Z;  4MW8 A;  5FPO A;  3CD6 V;  1PPJ H;  1OCR B;  4NR1 A;  3D3Q A;  1AIL A;  5CA0 A;  5BR8 O;  1KKC A;  2F93 B;  2GHY A;  1KP2 A;  1YCI A;  1X59 A;  3CPW U;  4X1K B;  2ADP A;  4GKK B;  5IJ0 B;  3ZBH A;  5IY5 C;  1U97 A;  4FM1 A;  3CWB H;  1S5H C;  3R66 A;  3E8F A;  3CRC A;  2UU9 O;  4LCU C;  4PA7 A;  4JI3 B;  1P4R A;  3L70 H;  3RGB A;  3Q4H A;  2JGU A;  3H1L H;  2A06 H;  2YI9 A;  3QVN A;  5LYJ B;  4TQF A;  4KP4 A;  3QNE A;  4UFZ A;  4FVM A;  1AP5 A;  1WAZ A;  3CME V;  2DQ0 A;  2HVJ C;  3HKE B;  5IYD O;  5CB4 B;  1S5L Z;  1E79 G;  4MVQ A;  3K5L A;  1SET A;  5DN6 G;  1NR1 A;  3RYC A;  3L73 H;  1R3K C;  1JA8 A;  2ZQM A;  3AG3 B;  3JAW A;  4NXN O;  4NKG B;  3RYI B;  5JCO A;  4DR1 B;  3AG3 C;  4GKJ O;  3IJ4 A;  3K58 A;  4DR4 O;  1U96 A;  1S76 D;  4X66 B;  1Q82 W;  3G6B A;  3J7A U;  1K97 A;  4UB8 Z;  1NS1 A;  3AG7 A;  1RM1 B;  2E5L O;  4JGS A;  1GN6 A;  5BR8 B;  3THO A;  2VQE O;  2HKO A;  4JI0 O;  3TGU H;  4UCO A;  3KCY A;  3CC2 V;  3D36 A;  2KSD A;  1AI4 A;  3ZHV A;  3JYC A;  3KKY A;  5FPR A;  1JJO A;  1PKX A;  2VWK A;  2X7R B;  1Y74 A;  2GSM B;  2WWW A;  4X62 B;  4DV3 O;  3OW2 U;  3D36 C;  4MTF A;  4BIZ A;  2HR3 A;  3APO A;  4TQD A;  1M4U A;  4UXN A;  1SKV A;  5H5N A;  1N34 O;  4LBE C;  4MTX A;  1Q3E A;  4DW0 A;  4OXS A;  4BW9 A;  1TAE A;  1VQ9 V;  2ATK C;  1PL0 A;  2Q7H A;  4P9P A;  5EBL C;  4X89 A;  4DV0 B;  2P06 A;  5B1B B;  3E2E A;  3ZHT A;  2ZE5 A;  1QCE A;  3OEH G;  2OIE A;  4LWS A;  2BTQ A;  3FAV A;  5LHI A;  1YTF D;  3RYH A;  4TT3 G;  4O4I B;  4LFB O;  4TWK A;  1QVG U;  3JCU Z;  3P3P A;  2P5O A;  5H6Q A;  5KHI A;  3QF7 A;  4YY3 B;  3OGI B;  2DOS A;  4QE7 A;  5CBH A;  1KP3 A;  3CRA A;  5IYC O;  1P7B A;  3UM7 A;  2HLD G;  3K04 A;  4LWS B;  2Q73 A;  3CCS V;  2CH7 A;  3W7T A;  5CA1 B;  1XQ8 A;  4XBF A;  4B08 A;  1YZB A;  3G4S V;  1NH2 B;  3GWO A;  5A2Q N;  1B6Q A;  3T1Y O;  2YEV B;  1GMG A;  3WG7 C;  1EBO A;  1WPB A;  3CXH F;  4FM0 A;  3HKD A;  4JV5 O;  4JZG A;  1OCO B;  4KUM A;  2ZR2 A;  1IBK O;  2DWE C;  3OE7 G;  4YHH B;  4CZZ A;  4MVR A;  2JDI G;  5IE9 A;  3CE2 A;  3PJS K;  1HWY A;  4I9W A;  1CEZ A;  4MTG A;  2PGG A;  4LC1 A;  2K1E A;  2DYR C;  2F1M A;  4B3T O;  1R6K A;  3N2K B;  3A2F A;  1VQP V;  4P9O A;  4J42 A;  1QLE C;  3T1C A;  1H2L A;  5GON B;  2BOB C;  1HDJ A;  3STZ C;  1AI6 A;  3ZMV A;  2HFE C;  4XDL A;  5KX5 B;  4B3M O;  3ZN0 A;  4DR2 O;  4JI7 O;  4IYH A;  4OGQ B;  2LW7 A;  1AI5 A;  2YS8 A;  4JAS A;  1FYJ A;  5K1P A;  2W0X A;  3JAW B;  2IBZ H;  5JWP A;  1TGO A;  2UU9 B;  3DSQ A;  3AG4 C;  1Z5W A;  3K79 A;  2Z0A A;  3HKB A;  3E83 A;  5KUM A;  1N36 B;  3OFN G;  1AP6 A;  3OEE G;  1FXK A;  4IIJ B;  2ZE8 A;  2IH1 C;  3DC6 A;  1W59 A;  3LDC A;  3CC7 V;  4DV4 O;  4LFC O;  3GWK C;  4Z1M G;  1CP9 A;  3ZMT A;  4ZHQ A;  4K35 A;  1XHX A;  3Q4H B;  1V55 B;  3VQX A;  2QJ1 A;  3RW0 A;  1IZ3 A;  3JD4 A;  1I94 B;  3ZCC A;  4YHH O;  3JD2 A;  3UO2 A;  5CBG A;  2DYS C;  5LA6 A;  5LL6 Y;  2LJ2 A;  3BVO A;  2JEX A;  4WBN B;  1D5A A;  3SYC A;  2Q9L A;  1SES A;  1EZJ A;  3CYO A;  3N27 A;  4GKJ B;  3RYH B;  1XNQ B;  2QGN A;  3AG4 B;  5D5P A;  3SDL A;  1YTF B;  2IU3 A;  2RMK B;  5IWA O;  3DC5 A;  4JAA A;  3ZRX A;  3WFV A;  3LSQ A;  5EZY B;  2BSK A;  2EUL A;  3O65 A;  1S5J A;  4FMT A;  4FZ1 A;  1J95 A;  5HFL A;  1N8R W;  1S3J A;  2WSS G;  4G2K A;  2AW9 A;  3RFR A;  4X62 O;  2GUZ A;  3AG2 C;  1PM9 A;  3E8G A;  1NZ6 A;  2JGD B;  3MAQ A;  4DUY B;  1FXK C;  2PF4 E;  4DR3 O;  3EVK A;  4R7C A;  3UKM A;  5LMU O;  5EYP B;  3APQ A;  5IDJ A;  1Y67 A;  4H0L B;  1WPX A;  2VQF O;  3BHP A;  1M9N A;  4JYB A;  4Q20 A;  4O4H B;  1V54 B;  4QPK A;  4CC5 A;  4LF5 O;  3LUT B;  4O2B A;  1NVP D;  3OMN B;  5KMG B;  5J2T B;  3BA8 A;  1Q81 W;  1F4N A;  3RYI A;  1HW7 A;  2AXT Z;  2FB5 A;  3SYQ A;  3QTC A;  3CCU V;  2N04 A;  2CTR A;  3W7X A;  2EIJ B;  2F66 C;  2WLI A;  2QE7 G;  1VQ6 V;  1OCZ B;  4F6R A;  4I50 B;  5ITZ A;  2QWN B;  4HBN A;  3I56 V;  1TUE B;  2BTQ B;  2A0L A;  3AG2 B;  3TXQ A;  2H94 A;  3ABL B;  4FFK A;  4PA4 A;  1YSC A;  1BS3 A;  3U0Z A;  1IUR A;  4QJF B;  3W7W A;  1S72 V;  4OX9 O;  1GAX A;  1KYO F;  4LF6 O;  3K59 A;  2M7W A;  3K9S A;  4DV1 B;  2G38 A;  3K5O A;  2Q68 A;  3LDE A;  1K5S A;  4R50 A;  1UJW B;  3E8H A;  5H6R A;  4X1Y A;  3CCQ V;  2A9H A;  3EHB B;  3FKS G;  4DR6 B;  3K3W A;  3SPH A;  3CSX A;  4B7K A;  2W6I G;  4I4T B;  1V55 C;  5KUK A;  2ZD9 A;  5BY1 A;  5D5Q A;  5LGN A;  5ITZ B;  2KQX A;  1N33 O;  1T5E A;  5LOV B;  3L9D A;  4CH6 A;  3JSL A;  1PV0 A;  3OR6 C;  3K06 A;  1MOF A;  3ABU A;  3JAM N;  1AJP A;  3VBB A;  1ZL8 B;  4RQF A;  4LNU A;  1I5X A;  3WU2 Z;  1NJI W;  5GW7 A;  1VQL V;  3TCU A;  3FFQ A;  2X6B A;  3FB8 C;  4ICG A;  4QGP A;  1I5Y A;  1Q8I A;  1ZUQ A;  2DE0 X;  2CAZ C;  1XMQ B;  3A0R A;  2QWR B;  1MSW D;  1R3I C;  4O4I A;  4QIW F;  4PHZ A;  5L3C A;  5F2V O;  5DEC A;  4DUZ B;  4LFA O;  4RWU A;  2XAJ A;  2XAQ A;  3B4S A;  2ZNJ A;  4X20 B;  5E79 Z;  4DRX B;  3OMA B;  5LGT A;  4UB6 Z;  5J2U A;  1GM7 A;  3N2G A;  3T4Z A;  2EJ7 A;  4WFF A;  4BR6 A;  5J2U B;  3B09 A;  2L6L A;  1V54 C;  2RJZ A;  5A9G A;  3ZMU A;  3ZHU A;  1MZE A;  4NYK A;  3ETQ A;  3ABK C;  3J80 N;  3ZRW B;  2FYU H;  4U7O A;  3KCX A;  1FJG B;  1VMG A;  4MSW C;  3U10 A;  1JJ2 U;  4I9Q A;  4O2B B;  2UXB O;  4I7Z B;  4PI0 A;  3K57 A;  4RUF A;  3L72 H;  4XDJ A;  1JVM A;  2Y4U A;  4LH6 A;  5B1O A;  2XAF A;  3EFF K;  2LFS A;  4CS4 A;  1HP8 A;  3ASN C;  3ZHQ A;  2GUZ B;  1L0N H;  3VQW A;  2L35 A;  2YXH A;  4PJ0 Z;  4UVB A;  5IYZ A;  1H8E G;  1Q7Y W;  2OIG A;  3FB7 C;  4G27 B;  2BSK B;  2JGD A;  4GCZ A;  3EXA A;  1ENV A;  4X1Y B;  3SPI A;  5H2F Z;  2HEP A;  4GX5 A;  3JD1 A;  4CH4 A;  1F4M A;  3JAS A;  5B5E Z;  3QO7 A;  1VF6 C;  4AIL C;  1Q6I A;  1AR4 A;  4DRX A;  3IAY A;  3JAR A;  2DMX A;  4CH3 A;  1OCZ C;  4GYC B;  2CUG A;  2OTJ V;  4UCU A;  1GM8 A;  3S3W A;  3N2K A;  3OGC C;  1D2D A;  4X66 O;  4I5S A;  1AJQ A;  2JK5 C;  3BFR A;  1ZWI C;  2YID A;  5FLX N;  2CGN A;  2VQE B;  1O9G A;  3P30 A;  4DV7 O;  1WP7 A;  4I55 A;  2Y48 A;  2V4D A;  3JD0 A;  3VOU A;  1XNR O;  2QEX V;  1L1F A;  2PZS A;  2HVK C;  1ZLZ A;  1OCO C;  1ZL8 A;  3LNM B;  2UXD O;  1KMI Z;  1FPO A;  4IT5 A;  4HAM A;  2XT9 A;  1L0L H;  1N33 B;  4NXM B;  4N23 A;  5IJ9 A;  4JYC A;  1QR8 A;  3HKB B;  4GUN A;  1TUB A;  4BIO A;  2BOC C;  3CMA V;  1TVK B;  3AK2 A;  2FTK A;  4FLW A;  1G6U A;  3BRC A;  2OT5 A;  2R9A A;  3FB6 C;  1YIT V;  2ZIM A;  5IYB O;  2JRI A;  2MK3 A;  1SA0 B;  4I55 B;  1M90 W;  4WFG A;  1N0J A;  3RT3 C;  4TV8 B;  1DF5 A;  4H44 B;  4D7T A;  3WB1 A;  1PNK A;  3K0G A;  1Y74 B;  1D5N A;  4FLY A;  4GX1 A;  2F43 G;  3CRQ A;  2K9P A;  2QKA A;  3HKC B;  2WLK A;  2ITD C;  4JI2 B;  1R1B A;  1VQN V;  3RWR D;  5TIS Z;  2YEV A;  5LA6 B;  3ICX A;  3UT5 A;  2NLJ C;  1E1R G;  3HKD B;  5J2T A;  1Y6X A;  2E3C A;  4UV9 A;  1IBM B;  2CE4 A;  1OCC B;  4NXN B;  1I08 A;  3ABL C;  4NTY A;  5HFM A;  1G1X B;  5LXT A;  1R3L C;  2A79 B;  4PDL A;  1YDX A;  1BQZ A;  2JS3 A;  2OCH A;  4GX0 A;  1Q6U A;  2E76 B;  1ZTE A; 
#chains in the Genus database with same CATH homology
 1F7Y A;  2UU9 O;  5BXZ A;  1FJG O;  1N32 O;  1XNR O;  2DOS A;  3J80 N;  4DR7 O;  4OX9 O;  4DUY O;  2UXD O;  4YHH O;  4LF6 O;  5LL6 Y;  4A5U B;  4X64 O;  4JI3 O;  4JYA O;  4YY3 O;  4B3S O;  2ZKO A;  1HNX O;  4AQY O;  1XNQ O;  4LF7 O;  2UUC O;  1YZB A;  2UXB O;  5A2Q N;  1J5E O;  1IBM O;  3T1Y O;  4LFB O;  4OPA A;  3F5T A;  4DR1 O;  5BY1 A;  1N36 O;  3SDL A;  4JI1 O;  4NXM O;  4NXN O;  1KUQ A;  4K0K O;  1N33 O;  4DV5 O;  4JI8 O;  4JV5 O;  2N74 A;  4GKJ O;  5IWA O;  1IBL O;  4JI4 O;  4DR4 O;  1IBK O;  4KHP O;  1XMO O;  2HHH O;  1I94 O;  2UUA O;  3J7A U;  3O65 A;  1DK1 A;  1NS1 A;  2JRI A;  3JAM N;  2E5L O;  3M8A A;  4LF4 O;  4GKK O;  4DUZ O;  4LF8 O;  4JI5 O;  4X65 O;  4JI6 O;  3J81 N;  2VQE O;  4X62 O;  4B3T O;  4JI0 O;  4JI2 O;  2UXC O;  2FKX A;  4DV0 O;  3RT3 C;  4DV6 O;  4OPH A;  1XEQ A;  2DJV A;  4DR3 O;  5LMU O;  4DV1 O;  4DV2 O;  4B3M O;  1AB3 A;  1HR0 O;  1R6T A;  4DV3 O;  4DR2 O;  4JI7 O;  1HNW O;  1R1B A;  2LW7 A;  3T1H O;  4LF9 O;  1N34 O;  5H5N A;  2VQF O;  3OTO O;  1XMQ O;  1FYJ A;  5LMN O;  4DR6 O;  1AIL A;  1A32 A;  5BR8 O;  4DR5 O;  4LF5 O;  2Z0A A;  4LFA O;  2ZM6 O;  1X59 A;  1D2D A;  4X66 O;  1G1X B;  2F4V O;  1FKA O;  5FLX N;  2UUB O;  2AGA A;  1HNZ O;  5IT9 N;  4DV7 O;  4DV4 O;  3R66 A;  4LFC O;  4B3R O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...