5LMUO

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmuO00
1I94O 5BXZA 4B3RO 2JRIA 4DV4O 4JI5O 3J7AU 5BR8O 4DV3O 1AB3A 1FJGO 1IBLO 5BY1A 4JI8O 1J5EO 2E5LO 2F4VO 5IT9N 2AGAA 4X66O 2LW7A 4DR5O 1N33O 1G1XB 3RT3C 3F5TA 4DR4O 4DUYO 4B3SO 4DR7O 2N74A 4LF8O 4NXNO 2UXCO 1X59A 3R66A 3SDLA 3T1HO 4A5UB 4OPAA 2UXDO 4KHPO 2VQEO 4LF4O 1XMOO 1A32A 2UUAO 4JYAO 2DOSA 1HR0O 1N32O 4X64O 1KUQA 1N36O 3OTOO 1NS1A 4DR2O 4JI6O 4LF9O 4DR1O 4X62O 4B3TO 1HNWO 2ZM6O 4LF6O 1FYJA 4DV6O 4LFCO 4DV5O 2Z0AA 1FKAO 2UXBO 4X65O 1IBMO 4YY3O 3J80N 1AILA 4AQYO 2HHHO 5LMNO 4JI7O 4OPHA 3T1YO 1XEQA 4DV1O 3J81N 1IBKO 2DJVA 4YHHO 4LF7O 4LFBO 5LL6Y 1F7YA 5H5NA 2ZKOA 4NXMO 4DR3O 4JI4O 4GKKO 3JAMN 5A2QN 1XNQO 4JI0O 5LMUO 4DV0O 4JI1O 4GKJO 1R6TA 4JV5O 2UUCO 2UU9O 4DUZO 3M8AA 2UUBO 4K0KO 4JI2O 1DK1A 3O65A 1YZBA 4OX9O 4DV7O 4JI3O 4LFAO 5IWAO 1HNXO 1R1BA 4DV2O 5FLXN 2FKXA 1XMQO 1HNZO 1XNRO 4B3MO 2VQFO 4DR6O 4LF5O 1D2DA 1N34O
chains in the Genus database with same CATH superfamily
1M56B 2WLHA 4BIZA 4GZRB 4JZ2A 1PD3A 1EN5A 5IJ9A 3DGEA 3E86A 1WAZA 3I56V 3N27A 1AR1B 4UVCA 2BCCH 1AJQA 2R72A 3F5TA 4UCTA 2HP8A 1FS0G 3AG2C 2EILC 3RGBA 4LF8O 2UXCO 1OCCB 3SDLA 5BMVB 4X65B 1YTFD 1IBMB 1W2BU 2JGDB 2UXDO 4UFZA 1VF6C 3QF7A 4H44B 5EBMC 2IH3C 3K5MA 3E8FA 1GAXA 4FZ1A 1FXKA 2YDEA 5LHGA 4CH3A 2P4VA 4JGSA 5BZBA 1ZX3A 1U97A 1HNWO 2YSUB 4RUEA 2IJHA 1I08A 4CC6A 1LR1A 1VARA 2L6LA 4X1KB 2Q0OC 5KHGA 2E5LB 1NQTA 1YJWV 1Y67A 4K8XA 5DECA 2CTWA 3LDDA 4MTOA 4FM1A 1AP5A 1KECA 4WFEA 1ORQC 3AG4C 4B08A 1G4YB 2B5UA 2QTSA 2OCCB 4EB6B 5L3CA 4JASA 1CEZA 2XTAA 3CRMA 4DR3O 5CA1B 1QHTA 1XQ8A 1YI2V 1MSDA 2GTAA 1R6TA 1Y66A 3ABLC 2ZDIA 1MZFA 3ABTA 2W6JG 3SYPA 1PKXA 4DR7B 4FFBB 2CDYA 1R73A 4O4LB 3U10A 2F93B 2FKXA 3K5NA 4IYIA 4ZBMA 3Q4HB 3ZHRA 3RN4A 1K4CC 3E8BA 5EBLC 3ABKB 1PPJH 4TWKA 4UB8Z 1SQFA 1M4UA 1Q3EA 3ZRWB 2W0XA 2E5LO 2YI8A 2IU3A 1H2LA 3ZHUA 3G4SV 2NNUA 3C3SA 4YXWG 5IYCO 4HNAB 2HR3A 1AJNA 2YXHA 2YUAA 1I0HA 1BT8A 1E1QG 2ZNJA 4OPAA 1XMOO 4YJ2B 4JYAO 2OT5A 3UT5A 5LHIA 5IYZA 3FKSG 2WPDG 4MS2A 1NS1A 3LNNA 2QGNA 2QEXV 5CA0B 4DW1A 2QM7A 3CXHF 4F4LA 4UUJC 5L3DA 2OYQA 2HKOA 3KG2A 2BSKA 2DE0X 3ICXA 1J5EB 1VQOV 1YJ9V 3J80N 1AILA 2FB5A 1NR1A 1XEQA 1OZ0A 2RCVA 1SERA 1S5LZ 4DV4B 1JJOA 4KHPB 2YC0A 4IIJB 1FFXB 4J9ZB 2RNBA 1YITV 2IU0A 1PP9H 1W0JG 1QBZA 1B3QA 1AVMA 3B8NA 2DQ3A 3ASOB 5KX5B 4I5SA 4IT5A 4B3TB 3SJBC 3GB7C 3VOUA 2ZM6B 1Q43A 2KKWA 1JFFA 4K35A 2B9ZA 2ZQMA 3NR7A 2H94A 5IYZB 1D2DA 1F51A 4R50A 4X8AA 3IC7A 2EIKB 2DWEC 2EULA 3OTOB 3KCYA 4EFBA 2H8PC 5EIBD 2LQTA 4IHJA 1IXBA 1M93A 3B4SA 1J5EO 4QPKA 1X4TA 1XREA 5L3EA 3KKYA 1IZ3A 3JCZA 3CRAA 4DR5O 2D2CB 4JI4B 3O9OA 2N05A 4JI0B 2LO1A 1NKDA 2QKCA 4JV5B 1ZSPA 2CUGA 4ZHQA 3PJSK 2PZSA 1AR4A 4KHPO 3H1JH 3H1LH 2AHZA 4CH4A 4CZZA 4U7NA 2EJ7A 4DV1B 1CP9A 4JI6O 3DSQA 4O4JA 1I94B 4MTXA 4DR1O 1KB9F 2GSMB 2ZIMA 1Y74A 1N0JA 4B3TO 2XNDG 2ZM6O 2PF4E 3A0RA 2Y69B 1D5NA 2BTQB 5CB4A 5L3BA 1O9HA 4DUYB 1TAEA 1YTFB 2HHHO 4W4KA 2OTJV 2ZE7A 1H2KA 4FM0A 2JGUA 5H6RA 1F7YA 4JI4O 4GX1A 3N2KB 1NZ6A 4JI0O 4JV5O 1ZUQA 3L73H 4ZI7A 3TGUH 3STLC 4AI8A 5LA6B 1M90W 2ZXWC 5KUMA 2R9RB 3SPJA 1M56C 4TSFG 3T1HB 4WFAV 1I94O 3BABA 4GX5A 4I9WA 2DQ0A 4W4LA 1QQCA 1O9GA 3JAWB 4J7JA 3ZJZA 1OCCC 1FXVA 1AI5A 4DUYO 2VWJA 2UXXA 2ZD9A 5JQGA 1IVSA 4YY3B 4FLUA 4N21A 2PGGA 4X1IB 5J9PC 2BTOA 2WLJA 3ZHQA 1HNXB 5LGNA 2HLDG 1IBKB 5C93A 4QGPA 3G80A 2QWQB 2P67A 4DR2O 5J2TB 1LUVA 3ABMB 2RDCA 4HYOA 2HJFC 3ZX6A 4DV0B 3ZN0A 1IBLB 2DMXA 1J95A 2Q9LA 5GW7A 4PA9A 3CCVV 1NU1H 4FLTA 4RWUA 1AR5A 3OT7A 4LNUA 2OCCC 2X6BA 2QA4V 1XUQA 2HEPA 1QNMA 2P90A 4I55B 3OMAB 5LL6Y 3WFVA 5IYDO 1B06A 4IL6Z 1VEWA 4J80A 4O4HA 4Z1MG 1G8MA 2GUZA 1V55B 1YSCA 3UKMA 1NTMH 5JQGB 3M7MX 4R8CA 4FIPC 1HNXO 1EZJA 4CH6A 3OMIB 1HNZO 2WLIB 4U3JA 3X2QC 3ABKC 3FB7C 3CRQA 2PI5A 2ZE5A 1KC8W 2EJRA 1AROP 4J7ZA 1ZL8A 3ZMZA 2WSSG 1WP7A 3JASA 1SS3A 1P4RA 1GM9A 4X9QA 3ZHVA 2HJDA 4X20B 1IBLO 1RPRA 3QNEA 3CRCA 4MTFA 5KHKA 4L8JA 5EYPB 3ML0A 2E76B 1TGOA 4WBNA 5LMUB 4BW5A 1NR7A 4TUYB 3PN1A 3CCEV 1R3JC 1D5AA 3VQXA 1NVPD 2ZINA 2CTPA 4B7EA 1SC5B 2D3OW 4CS2A 2ADQB 4D7TA 2WLKA 3B09A 2H3OA 2Q0AA 2R9AA 4MVZA 1QCEA 3BCCH 5E79Z 2ZR2A 4O4HB 1H8EG 1Z2GA 4JI1B 4FK5C 1Y4MA 1UFIA 1L0NH 3U11A 3VQYA 2E74B 1F23A 3CX5F 1XL4A 2RMKB 4GT1A 1URFA 3CJHA 1VP7A 4D7SA 3CC4V 1EM1A 4Q6GA 1SESA 2VWKA 3SPIA 1DF4A 3ASOC 5LMUO 5KHJA 1FPOA 2X0LA 4Q20A 1IX9A 2AHYA 4DUZO 3H1HH 3JSLA 5BMVA 1GRJA 3CCRV 4LF8B 2JGDA 1R1BA 2EIKC 1R6NA 2CK3G 1WB7A 4BIOA 3ZMVA 2EX3A 2CGNA 1N8RW 3J7AU 4C7UA 2UXNA 3T2MA 4NVPA 1VQ4V 1SRYA 3BRCA 4XDLA 4O2BA 2OIEA 3W7WA 1Y76B 2YEVA 4YHHB 4J7KA 2ZNIA 4X66O 1U96A 2CGOA 1HNWB 1G1XB 4X1KA 5DM6V 4GKKB 1PNKA 3HKDB 2JIZG 4UCRA 1FXHA 4DK1A 4UV8A 3RW0A 2JJ1G 2QKAA 2Q7EA 1H2NA 4GX2A 2BOBC 5B1NA 3VQWA 4GLXA 1K9MW 3TXSA 1UPGA 1W0KG 5B1BB 3K57A 2EZPA 4EB6A 3FB5C 5CA1A 4DR6B 5K1XA 4PELA 3L75H 4DR3B 4FJCC 3H1KH 2IM9A 3WB0A 2Y69C 1SKVA 3I5DA 4LF6O 3WU2Z 3CCMV 4FFBA 2XAJA 3JALB 4O4LA 1IXMA 1OHHG 3OEHG 2Y4TA 3E22B 3W7TA 1NJIW 4I9QA 1HDJA 1YEWA 3Q4HA 1TUEB 3IC9A 4O2AB 3IJ4A 3HKBB 4NTYA 3E2EA 4YHHO 4PI0A 5GTHZ 4O2BB 1Q6HA 5HFMA 2YEVB 3ZRWA 4GKKO 3SYAA 4X1YB 4FVMA 4RO2A 1BE3H 4HNAA 2HVJC 3HKCB 5H9CA 4X62B 3OR7C 4YIPA 1XOUA 4G27B 1ZAUA 3CE2A 4YJ2A 3ZRSA 1HP8A 2C2AA 1XMOB 4DR6O 1SQBH 4JYAB 1MG1A 3G67A 1N34O 3L9DA 4B3RO 2QM4A 5CA0A 4TQDA 3ZIAG 3OUFA 4G2KA 2XOKG 3E8GA 3JSNA 2A9HA 2YXYA 4PA6A 2LW7A 3RT3C 2KB1A 1S76D 5EC2C 2F95B 4TT3G 3F5WC 4JTDB 1MABG 3ZMUA 3VBBA 2P06A 2KQXA 3OEEG 3SPHA 4JI2B 3SYOA 3K04A 1ZWIC 2P7TC 3ABMC 2QSAA 4IIJA 3K0DA 1FFXA 4LCUC 5B5EZ 3CS5A 2Q73A 2LP7A 4X62O 4J9YB 2YIBA 1UJWB 4XDJA 2GHYA 5KX5A 3RYFB 4FLZA 1CXZB 3JATB 2O57A 4RQFA 3OM3B 4MVSA 5EK0A 2GV9A 3A8TA 4NTWA 1I5XA 2P4KA 1NVPB 3ASNB 5A9GA 5JJNB 3L72H 2DJVA 1K5QA 1YF2A 3LNMB 4AHCA 4RUFA 4DRXB 5CBGA 1V55C 5A2QN 1KP2A 3AK2A 4MTGA 1VQ5V 3FX7A 2RJZA 1COWG 4DR5B 1AI4A 4JI2O 1RSOB 2A3QA 3IFXA 1VQMV 1PV0A 2IJIA 2UXBB 2DWDC 1JQ0A 4PDMA 3JCUZ 3AEIA 3ZMTA 1GM8A 2EIMB 2XAQA 4JI6B 3AG1B 4DR1B 4LF7B 2XHBA 1Q8IA 1R3LC 2BTQA 4B3SO 1YVWA 5K1PA 4Z1VA 3U0ZA 3JARA 1EBOA 1Y6XA 3MHSC 2VQEO 1A32A 4DO2A 2QE7G 3LSUA 1NH2B 4JI3B 2HHHB 3ETDA 2JK5C 3WB1A 3IAYA 2YIDA 4PJ0Z 4X64O 3APQA 1US6A 4WFBV 2DYRB 3RYHB 4Z2WA 1KD1W 5EIBC 4WFHA 1S77D 3N2KA 5ITZB 4LF5B 1FFTB 2HFEC 5GONB 5CBFA 1TVKB 1R6KA 5LHHA 1MOFA 3W7SA 2Q7HA 4KL1A 2M7WA 2V1DA 3K03A 4CBCA 5LA6A 1FYJA 3OGCC 3CCUV 2HVKC 2IBZH 2UXBO 1V54B 2DN9A 4NXNB 4OPHA 3T4DA 3FAVA 2WLLA 3LUTB 1K92A 2ITCC 4LF7O 1SQVH 2A79B 5LP6A 1NT2B 1K5SA 1JOYA 3RWRD 4FLWA 2AZ0A 1DF5A 1B6QA 3JAWA 4MVRA 2P6JA 3UO2A 4KP4A 1QLEB 4H33A 1KBHA 2Y0IA 4LC1A 3THOA 4OGQB 4PA3A 1I5YA 3JARB 4MVQA 2ADPA 4JI3O 5IWAO 5C8YB 3ZCCA 3EHBB 2K1EA 2YI9A 4G28B 1DTOA 4X1IA 1XNRO 3D8CA 4LF5O 1XHZA 4AQYB 3D3IA 3AG2B 3TJTA 4P30A 2WWWA 1V9PA 5J2TA 3T1YB 4DR2B 1VQ6V 3P32A 1GO3F 4JYYA 4PDRA 3SYQA 1H2GA 1ZLZA 1VIBA 2QWRB 4JAVA 1XNQB 3SYCA 3I55V 4NXNO 2XT9A 5B1BC 4CS3A 4WCEV 3TK1A 4OX9B 1K4DC 1MNGA 3FAVB 2WLLB 1VQNV 1DLBA 1OCZB 5LP6B 4I55A 2ETNA 1NI8A 1M57B 4RQEA 4J41A 1Q90D 2PY5A 3SR2C 5B1AB 3BAAA 5JH7A 2QWOB 2MK3A 1S5HC 5KAIZ 1FKAO 1PM9A 4IGGA 1N33B 4FM2A 3DC5A 2WLIA 1AI7A 4AQYO 4BR6A 2B1GA 1BL8A 2YICA 1TUBA 1HNZB 3RYCB 3FYIB 3OUSA 3T1YO 2PI4A 4N23A 2QWPB 4NTXA 3J81N 3LSSA 1K8AW 4X20A 1WPXA 2CTRA 4U7OA 3OR6C 1XNQO 1YDXA 2B1IA 3DTUB 5EYPA 2IJJA 4FZ0A 1WN7A 3CC7V 5H2FZ 5IYBO 3SGIA 5D5QA 3UM7A 1YZBA 3A0BZ 4I7ZB 4OX9O 5IJ0B 4TUYA 1RM1B 4FLVA 2AW9A 2LGQA 4ZKIA 2G38A 1JPXA 3CYOA 4DYLA 3CPWU 2GDSA 1WNSA 4TV9B 1PNMA 2CAZC 5LGTA 1AI6A 4QPJA 3CWBH 4J42A 1HW7A 5JH7B 1QVGU 1N33O 3E83A 2Q4PA 1OCOB 2FL4A 2QTOA 3BA8A 2IH1C 4ICGA 4K3AA 5F2VO 4I0XB 4FMTA 3OFNG 1SZTA 2NLJC 1TUBB 3CMAV 2QM8A 2UUBB 2JDIG 5JCOA 4KUMA 2UUAO 5LOVB 4EFEA 1R3KC 4DV2B 4TOIA 1KKCA 2YIAA 4TV8A 1KQSU 3RVYA 3LSQA 1I7FA 1AJPA 2EIJB 1F4MA 2LFSA 2W0FC 3ZHSA 3H01A 2Q7GA 2CE4A 2ZE8A 4XBFA 2DYSB 3HR0A 4KXRA 1QR9A 5KHIA 4FFKA 2ZIOA 4PD4F 5BR8B 2AXTZ 3SJAC 1WPBA 4DUZB 2LJ2A 5EZYB 2XUMA 5LGUA 1AP6A 3ASNC 4DR4B 3F7VC 4I50B 3A0HZ 3CCJV 4ZOLB 4NXMO 2WA3A 4PDVA 1Y76A 1LUWA 3F7YC 5IY5B 3MHHC 1MMMA 5KA6A 2Z5UA 4F6RB 3E35A 4X66B 1P7GA 3HKDA 1BSMA 2UUBO 5LYJB 4FLYA 3ETEA 1DGSA 1VQPV 2JEXA 1FAFA 2E75B 4DV2O 2WLMA 1BHAA 4UCVA 1ENVA 4TV8B 3K06A 1K34A 4LH6A 2CH7A 3AG1C 3OE7G 1SF9A 5BR8O 2F43G 5LMNB 4CC5A 1AB3A 1FJGO 1MZEA 2F4VO 2AGAA 1QU7A 5DN6G 4LF6B 3HKEB 4DR4O 3CC2V 3JALA 1NH2D 1SQXH 3K59A 3E22A 4X89A 2HG5C 4HBNA 2KG7A 4O2AA 2DYRC 1OCRB 3HKBA 1HR0O 4R7CA 2GTSA 3K3WA 3BVOA 2VQFB 4IYHA 1VMGA 1GN4A 3ZN1A 4X1YA 4K8ZA 1EN6A 1VQ9V 4WFFA 1FD9A 1SA0B 3HKCA 4B7KA 1V54C 1S0VA 4DV6O 4LFCO 3BPZA 1S3JA 3JAKB 3CHXA 2F23A 3B40A 1GH6A 4O4IB 3JD3A 2XAHA 2QDOA 5LMNO 2PYJA 1SQQH 2CH7B 1RPOA 1N34B 4R6ZA 4B3RB 3WG7B 2PYLA 1QLEC 4PI2A 1GK9A 1ROPA 3HPLC 1EN4A 2K9PA 2OIGA 2WLNA 1BMFG 3S3XA 3CD6V 1NBMG 2PUSA 1K7DA 1DK1A 3K58A 1N4CA 4YJ3B 2KG7B 2Q69A 3TCUA 1Q82W 3EXAA 3QO7A 2Y0PA 2ODMA 2VQFO 3ETGA 2ITDC 4QE7A 4HAMA 2JRIA 1VF7A 3SPGA 3AK1A 3D3QA 4JI7B 2EBOA 2JEUA 5JVDB 2A06H 4GCZA 5IT9N 1GMGA 3RYFA 5E1AC 3DXRA 3JATA 3BY6A 3OTFA 2N74A 1RP3B 4ASUG 1OCZC 2Q6AA 3IGAC 5LP6C 4UV9A 5CBHA 4UVBA 2JS3A 3JYCA 2ARHA 1M57C 3ZRXA 1PL0A 1Q6IA 2ILMA 2JVDA 5KAFZ 3UO3A 1HWYA 4EKWA 1E79G 1KUQA 1XMQB 5IDJA 2CTQA 3CB2A 5FL7G 3GVMA 3JD2A 4DRXA 1VQ7V 2BE3A 3L71H 1JVMA 2IJKA 2Q67A 5IJ9B 5B1AC 3TETA 4MW3A 2MW2B 4NR1A 1PL4A 4DV3B 3UCSC 1RSOA 1YJNV 4JI8B 2ZE6A 3FFQA 5IE9A 1M1KW 5JWPA 2R70A 4X65O 1IBMO 4MT8A 1GN3A 1YHQV 1S72V 3N2GA 3HB3B 3BEHA 4JI7O 2KSDA 3P3PA 3FB8C 5D5PA 4X88A 3AK3A 3CCSV 1Z5WA 3T1CA 1MA1A 5H5NA 3QVNA 3W7UA 1N32B 1FXKB 1WA8A 3X2QB 3UQ8A 4LWSA 3ZBHA 3ABUA 4MVUA 2LGWA 3DXRB 1P84F 1N36B 1Z5VA 4GUNA 3RFRA 1SQGA 5FPOA 1RM1C 4LF9B 1H2MA 5B3SB 4B3SB 1YIJV 2RQ6A 4JZGA 3GWKC 1VF5B 1XMQO 4DV5B 4E4EA 2EZOA 3SPCA 4H0LB 2VQEB 2WAMA 3CSXA 3RYHA 1SETA 5BXZA 5KHHA 4UXNA 4X64B 4TQFA 3ZHTA 5ITZA 3OGIB 4DV3O 5GONA 1TVKA 4UCUA 3P30A 4JI8O 1OCOC 1RFYA 2M6YA 4FPPA 4LFBB 5L3GA 4UB6Z 1BQZA 4DXWA 2NR5A 4DR7O 4GKJB 2EINB 5B1OA 3ZRVA 3N2GB 4UVAA 5JJEB 4K0KB 3SJCC 1P7BA 1B04A 4J11A 5J2UA 4QE9A 1N32O 3AG3B 3FYEB 2EIJC 3K9SA 5CN0A 1XDCA 4RAIA 1WA8B 1K73W 2QR4A 1N36O 4LWSB 1T5EA 2DYSC 1M9NA 1MSWD 4LF9O 4CH5A 4JI5B 3CEIA 3T4ZA 1KMIZ 1PNLA 3K9AA 1VQ8V 1JA8A 3K08A 4DV5O 2Z0AA 4WF9V 3RVZA 5C8YA 2QWNB 3C3TA 4JAUA 5IWAB 2OCHA 1XNRB 4LH7A 4P9OA 4UCOA 4BWAA 1SZXA 1VQKV 4OXSA 3BHPA 4JTAB 1CPYA 1KP3A 2A7WA 1R3IC 5IY5C 3UT5B 4LF4B 4LFBO 4PHZA 1VF6A 3QG5A 2YS8A 1XILA 3JAMN 3G6EV 4JYCA 4GKJO 4NB5A 5JCOC 3M8AA 3CMEV 4K0KO 3CCLV 2Q5ZA 3O65A 2BSKB 4PV1B 3R65A 1JCHA 5JJJB 5J2UB 3OW2U 1H8HG 2Y48A 4MW8A 1GM7A 5FNVA 4JTCB 4EEQA 4DV4O 4JI5O 1YCIA 4JPRA 4MVMA 5BY1A 1XBLA 1WJZA 3K0GA 4JF3A 1H38A 2LW1A 4MSWC 2JS5A 1NTKH 4XDKA 5LBQA 4JYBA 5KA5A 3BFRA 2UUCB 1OCRC 2A0LA 2UU9B 4PA7A 4A5UB 3RYCA 4QJFB 1JFFB 3TXQA 3JD0A 4LF4O 2EILB 3RYIA 3CP1A 2ZCEA 3GWOA 2F66C 1IURA 2RN9A 2P5OA 1YXBA 3OTOO 4J10A 3FB6C 5DEDA 4NYKA 4MVOA 2Q8VA 4IHJB 3A2FA 2XAGA 5IJ0A 2ZR3A 3H1IH 1XL6A 4BAYA 4ZHQB 5FNVB 3WG7C 4F6EA 4TV9A 1OJHA 3EFFK 2F1MA 1THZA 3VQVA 4DV1O 2ZT9B 1GN6A 4LBEC 3OMNB 1IDSA 2XASA 2OWOA 3QO8A 1KYOF 3ETQA 2L35A 2Q68A 2N04A 3AG4B 4O4JB 3LDEA 3ZS8C 2UUCO 1Y74B 1WP8A 1BGYH 1L1FA 2UU9O 3C90A 4I0XA 3D36C 2DW4A 4LP8A 1E1RG 3ABLB 2VRZA 2WA4A 5CB4B 3RYIB 4QIWF 5FLXN 4LR3A 5LOVA 3CXCU 1Q5OA 2UUAB 1EZVH 3KCXA 5H6QA 2FTKA 2VS0A 1VQLV 2QJ1A 4AILC 2Z3YA 3FD9A 1S5JA 1QLNA 4P2ZA 2ATKC 3DC6A 2AZ2A 1Q6UA 5EZYA 2V7QG 4ZI7B 3L70H 2NN4A 5FPRA 4JAAA 4BIUA 3R66A 3G71V 2FMLA 4YIOA 4I50A 4GYCB 3T1HO 2V4DA 4ZOLA 2DOSA 3RBZA 1QR8A 4U3FH 4FLXA 3EVKA 4B3MB 3ZMSA 5KMGA 1BHBA 5CMUA 4NXMB 4L87A 1N0NA 4PA4A 3BA9A 4F6RA 2W6IG 1GN2A 5LYJA 4BW9A 2FYUH 3WB2A 2Y4UA 1KKDA 4YY3O 1OV9A 1M5IA 5LXTA 2PTMA 5KUKA 1BCCH 1Q86W 3CRRA 1JMKC 1NTZH 5TISZ 1JJ2U 2X6AA 3STZC 1FXKC 4QNHB 1LNQA 1IBKO 1W59A 1XI1A 1G6UA 1BZKA 2GBOA 2ZKOA 1GKFA 4KFMA 3OD4A 1FJGB 3B77A 3MD0A 4DV0O 4UCSA 5B3SC 2F4VB 3AG7A 3QTCA 3KZIZ 3HKEA 3K5OA 3JD4A 1JR9A 4ZIBA 3G6BA 5EBWC 1QVFU 1BQ0A 1K33A 2E3CA 4B3MO 4I4TA 4LNUB 4PDLA 1HR0B 3P3NA 5KMGB 1XHXA 4DK0A 2ZDIC 1SA0A 3K5LA 2EINC 3K79A 1H2SB 2GUZB 3JAKA 4P9PA 3JD1A 4DV6B 4E2LA 4LFCB 5LXTB 1KU9A 1X59A 2QKSA 3AG3C 2EIMC 4O4IA 1L0LH 5B66Z 1EFRG 5AG2A 3LDCA 1JX9A 2JJ2G 4U3JB 4D6TH 4DV7B 4LFAB 2X6CA 2BOCC 3M99B 1ZTEA 2R9IA 1ZL8B 3APOA 3E89A 3JASB 2P22C 3B8MA 2YXLA 3W7XA 1WLEA 4NKGB 2YIBD 1P49A 3OAAG 1Q81W 4YJ3A 4H37A 1TA8A 1K97A 4ABMA 1GTOA 3D36A 1BS3A 4WBNB 3S3WA 4I4TB 1Q7YW 2X7RB 5L3FA 2IW5A 2UXCB 5GTIZ 4WFGA 3L74H 3NXSA 3ZEDA 2UXDB 2LFRA 2OTLV 2XAFA 4H13B 4HZ3A 5CA3A 5JVDA 3E8HA 3CCQV 3QO5A 4CS4A 4JI1O 5EC1C 1WB8A 3MDSA 1K3EA 5HFLA 5KLVH 3B2EE 4DV7O 1F4NA 4LFAO 3H9VA 4GX0A 1SQPH 3CJHB 4DW0A 2ZXWB 1L8DA 3MAQA 3SJQC
chains in the Genus database with same CATH topology
1I94O 5BXZA 4B3RO 2JRIA 4DV4O 4JI5O 3J7AU 5BR8O 4DV3O 1AB3A 1FJGO 1IBLO 5BY1A 4JI8O 1J5EO 2E5LO 2F4VO 5IT9N 2AGAA 4X66O 2LW7A 4DR5O 1N33O 1G1XB 3RT3C 3F5TA 4DR4O 4DUYO 4B3SO 4DR7O 2N74A 4LF8O 4NXNO 2UXCO 1X59A 3R66A 3SDLA 3T1HO 4A5UB 4OPAA 2UXDO 4KHPO 2VQEO 4LF4O 1XMOO 1A32A 2UUAO 4JYAO 2DOSA 1HR0O 1N32O 4X64O 1KUQA 1N36O 3OTOO 1NS1A 4DR2O 4JI6O 4LF9O 4DR1O 4X62O 4B3TO 1HNWO 2ZM6O 4LF6O 1FYJA 4DV6O 4LFCO 4DV5O 2Z0AA 1FKAO 2UXBO 4X65O 1IBMO 4YY3O 3J80N 1AILA 4AQYO 2HHHO 5LMNO 4JI7O 4OPHA 3T1YO 1XEQA 4DV1O 3J81N 1IBKO 2DJVA 4YHHO 4LF7O 4LFBO 5LL6Y 1F7YA 5H5NA 2ZKOA 4NXMO 4DR3O 4JI4O 4GKKO 3JAMN 5A2QN 1XNQO 4JI0O 5LMUO 4DV0O 4JI1O 4GKJO 1R6TA 4JV5O 2UUCO 2UU9O 4DUZO 3M8AA 2UUBO 4K0KO 4JI2O 1DK1A 3O65A 1YZBA 4OX9O 4DV7O 4JI3O 4LFAO 5IWAO 1HNXO 1R1BA 4DV2O 5FLXN 2FKXA 1XMQO 1HNZO 1XNRO 4B3MO 2VQFO 4DR6O 4LF5O 1D2DA 1N34O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 O;  5BXZ A;  4B3R O;  2JRI A;  4DV4 O;  4JI5 O;  3J7A U;  5BR8 O;  4DV3 O;  1AB3 A;  1FJG O;  1IBL O;  5BY1 A;  4JI8 O;  1J5E O;  2E5L O;  2F4V O;  5IT9 N;  2AGA A;  4X66 O;  2LW7 A;  4DR5 O;  1N33 O;  1G1X B;  3RT3 C;  3F5T A;  4DR4 O;  4DUY O;  4B3S O;  4DR7 O;  2N74 A;  4LF8 O;  4NXN O;  2UXC O;  1X59 A;  3R66 A;  3SDL A;  3T1H O;  4A5U B;  4OPA A;  2UXD O;  4KHP O;  2VQE O;  4LF4 O;  1XMO O;  1A32 A;  2UUA O;  4JYA O;  2DOS A;  1HR0 O;  1N32 O;  4X64 O;  1KUQ A;  1N36 O;  3OTO O;  1NS1 A;  4DR2 O;  4JI6 O;  4LF9 O;  4DR1 O;  4X62 O;  4B3T O;  1HNW O;  2ZM6 O;  4LF6 O;  1FYJ A;  4DV6 O;  4LFC O;  4DV5 O;  2Z0A A;  1FKA O;  2UXB O;  4X65 O;  1IBM O;  4YY3 O;  3J80 N;  1AIL A;  4AQY O;  2HHH O;  5LMN O;  4JI7 O;  4OPH A;  3T1Y O;  1XEQ A;  4DV1 O;  3J81 N;  1IBK O;  2DJV A;  4YHH O;  4LF7 O;  4LFB O;  5LL6 Y;  1F7Y A;  5H5N A;  2ZKO A;  4NXM O;  4DR3 O;  4JI4 O;  4GKK O;  3JAM N;  5A2Q N;  1XNQ O;  4JI0 O;  5LMU O;  4DV0 O;  4JI1 O;  4GKJ O;  1R6T A;  4JV5 O;  2UUC O;  2UU9 O;  4DUZ O;  3M8A A;  2UUB O;  4K0K O;  4JI2 O;  1DK1 A;  3O65 A;  1YZB A;  4OX9 O;  4DV7 O;  4JI3 O;  4LFA O;  5IWA O;  1HNX O;  1R1B A;  4DV2 O;  5FLX N;  2FKX A;  1XMQ O;  1HNZ O;  1XNR O;  4B3M O;  2VQF O;  4DR6 O;  4LF5 O;  1D2D A;  1N34 O; 
#chains in the Genus database with same CATH topology
 1M56 B;  2WLH A;  4BIZ A;  4GZR B;  4JZ2 A;  1PD3 A;  1EN5 A;  5IJ9 A;  3DGE A;  3E86 A;  1WAZ A;  3I56 V;  3N27 A;  1AR1 B;  4UVC A;  2BCC H;  1AJQ A;  2R72 A;  3F5T A;  4UCT A;  2HP8 A;  1FS0 G;  3AG2 C;  2EIL C;  3RGB A;  4LF8 O;  2UXC O;  1OCC B;  3SDL A;  5BMV B;  4X65 B;  1YTF D;  1IBM B;  1W2B U;  2JGD B;  2UXD O;  4UFZ A;  1VF6 C;  3QF7 A;  4H44 B;  5EBM C;  2IH3 C;  3K5M A;  3E8F A;  1GAX A;  4FZ1 A;  1FXK A;  2YDE A;  5LHG A;  4CH3 A;  2P4V A;  4JGS A;  5BZB A;  1ZX3 A;  1U97 A;  1HNW O;  2YSU B;  4RUE A;  2IJH A;  1I08 A;  4CC6 A;  1LR1 A;  1VAR A;  2L6L A;  4X1K B;  2Q0O C;  5KHG A;  2E5L B;  1NQT A;  1YJW V;  1Y67 A;  4K8X A;  5DEC A;  2CTW A;  3LDD A;  4MTO A;  4FM1 A;  1AP5 A;  1KEC A;  4WFE A;  1ORQ C;  3AG4 C;  4B08 A;  1G4Y B;  2B5U A;  2QTS A;  2OCC B;  4EB6 B;  5L3C A;  4JAS A;  1CEZ A;  2XTA A;  3CRM A;  4DR3 O;  5CA1 B;  1QHT A;  1XQ8 A;  1YI2 V;  1MSD A;  2GTA A;  1R6T A;  1Y66 A;  3ABL C;  2ZDI A;  1MZF A;  3ABT A;  2W6J G;  3SYP A;  1PKX A;  4DR7 B;  4FFB B;  2CDY A;  1R73 A;  4O4L B;  3U10 A;  2F93 B;  2FKX A;  3K5N A;  4IYI A;  4ZBM A;  3Q4H B;  3ZHR A;  3RN4 A;  1K4C C;  3E8B A;  5EBL C;  3ABK B;  1PPJ H;  4TWK A;  4UB8 Z;  1SQF A;  1M4U A;  1Q3E A;  3ZRW B;  2W0X A;  2E5L O;  2YI8 A;  2IU3 A;  1H2L A;  3ZHU A;  3G4S V;  2NNU A;  3C3S A;  4YXW G;  5IYC O;  4HNA B;  2HR3 A;  1AJN A;  2YXH A;  2YUA A;  1I0H A;  1BT8 A;  1E1Q G;  2ZNJ A;  4OPA A;  1XMO O;  4YJ2 B;  4JYA O;  2OT5 A;  3UT5 A;  5LHI A;  5IYZ A;  3FKS G;  2WPD G;  4MS2 A;  1NS1 A;  3LNN A;  2QGN A;  2QEX V;  5CA0 B;  4DW1 A;  2QM7 A;  3CXH F;  4F4L A;  4UUJ C;  5L3D A;  2OYQ A;  2HKO A;  3KG2 A;  2BSK A;  2DE0 X;  3ICX A;  1J5E B;  1VQO V;  1YJ9 V;  3J80 N;  1AIL A;  2FB5 A;  1NR1 A;  1XEQ A;  1OZ0 A;  2RCV A;  1SER A;  1S5L Z;  4DV4 B;  1JJO A;  4KHP B;  2YC0 A;  4IIJ B;  1FFX B;  4J9Z B;  2RNB A;  1YIT V;  2IU0 A;  1PP9 H;  1W0J G;  1QBZ A;  1B3Q A;  1AVM A;  3B8N A;  2DQ3 A;  3ASO B;  5KX5 B;  4I5S A;  4IT5 A;  4B3T B;  3SJB C;  3GB7 C;  3VOU A;  2ZM6 B;  1Q43 A;  2KKW A;  1JFF A;  4K35 A;  2B9Z A;  2ZQM A;  3NR7 A;  2H94 A;  5IYZ B;  1D2D A;  1F51 A;  4R50 A;  4X8A A;  3IC7 A;  2EIK B;  2DWE C;  2EUL A;  3OTO B;  3KCY A;  4EFB A;  2H8P C;  5EIB D;  2LQT A;  4IHJ A;  1IXB A;  1M93 A;  3B4S A;  1J5E O;  4QPK A;  1X4T A;  1XRE A;  5L3E A;  3KKY A;  1IZ3 A;  3JCZ A;  3CRA A;  4DR5 O;  2D2C B;  4JI4 B;  3O9O A;  2N05 A;  4JI0 B;  2LO1 A;  1NKD A;  2QKC A;  4JV5 B;  1ZSP A;  2CUG A;  4ZHQ A;  3PJS K;  2PZS A;  1AR4 A;  4KHP O;  3H1J H;  3H1L H;  2AHZ A;  4CH4 A;  4CZZ A;  4U7N A;  2EJ7 A;  4DV1 B;  1CP9 A;  4JI6 O;  3DSQ A;  4O4J A;  1I94 B;  4MTX A;  4DR1 O;  1KB9 F;  2GSM B;  2ZIM A;  1Y74 A;  1N0J A;  4B3T O;  2XND G;  2ZM6 O;  2PF4 E;  3A0R A;  2Y69 B;  1D5N A;  2BTQ B;  5CB4 A;  5L3B A;  1O9H A;  4DUY B;  1TAE A;  1YTF B;  2HHH O;  4W4K A;  2OTJ V;  2ZE7 A;  1H2K A;  4FM0 A;  2JGU A;  5H6R A;  1F7Y A;  4JI4 O;  4GX1 A;  3N2K B;  1NZ6 A;  4JI0 O;  4JV5 O;  1ZUQ A;  3L73 H;  4ZI7 A;  3TGU H;  3STL C;  4AI8 A;  5LA6 B;  1M90 W;  2ZXW C;  5KUM A;  2R9R B;  3SPJ A;  1M56 C;  4TSF G;  3T1H B;  4WFA V;  1I94 O;  3BAB A;  4GX5 A;  4I9W A;  2DQ0 A;  4W4L A;  1QQC A;  1O9G A;  3JAW B;  4J7J A;  3ZJZ A;  1OCC C;  1FXV A;  1AI5 A;  4DUY O;  2VWJ A;  2UXX A;  2ZD9 A;  5JQG A;  1IVS A;  4YY3 B;  4FLU A;  4N21 A;  2PGG A;  4X1I B;  5J9P C;  2BTO A;  2WLJ A;  3ZHQ A;  1HNX B;  5LGN A;  2HLD G;  1IBK B;  5C93 A;  4QGP A;  3G80 A;  2QWQ B;  2P67 A;  4DR2 O;  5J2T B;  1LUV A;  3ABM B;  2RDC A;  4HYO A;  2HJF C;  3ZX6 A;  4DV0 B;  3ZN0 A;  1IBL B;  2DMX A;  1J95 A;  2Q9L A;  5GW7 A;  4PA9 A;  3CCV V;  1NU1 H;  4FLT A;  4RWU A;  1AR5 A;  3OT7 A;  4LNU A;  2OCC C;  2X6B A;  2QA4 V;  1XUQ A;  2HEP A;  1QNM A;  2P90 A;  4I55 B;  3OMA B;  5LL6 Y;  3WFV A;  5IYD O;  1B06 A;  4IL6 Z;  1VEW A;  4J80 A;  4O4H A;  4Z1M G;  1G8M A;  2GUZ A;  1V55 B;  1YSC A;  3UKM A;  1NTM H;  5JQG B;  3M7M X;  4R8C A;  4FIP C;  1HNX O;  1EZJ A;  4CH6 A;  3OMI B;  1HNZ O;  2WLI B;  4U3J A;  3X2Q C;  3ABK C;  3FB7 C;  3CRQ A;  2PI5 A;  2ZE5 A;  1KC8 W;  2EJR A;  1ARO P;  4J7Z A;  1ZL8 A;  3ZMZ A;  2WSS G;  1WP7 A;  3JAS A;  1SS3 A;  1P4R A;  1GM9 A;  4X9Q A;  3ZHV A;  2HJD A;  4X20 B;  1IBL O;  1RPR A;  3QNE A;  3CRC A;  4MTF A;  5KHK A;  4L8J A;  5EYP B;  3ML0 A;  2E76 B;  1TGO A;  4WBN A;  5LMU B;  4BW5 A;  1NR7 A;  4TUY B;  3PN1 A;  3CCE V;  1R3J C;  1D5A A;  3VQX A;  1NVP D;  2ZIN A;  2CTP A;  4B7E A;  1SC5 B;  2D3O W;  4CS2 A;  2ADQ B;  4D7T A;  2WLK A;  3B09 A;  2H3O A;  2Q0A A;  2R9A A;  4MVZ A;  1QCE A;  3BCC H;  5E79 Z;  2ZR2 A;  4O4H B;  1H8E G;  1Z2G A;  4JI1 B;  4FK5 C;  1Y4M A;  1UFI A;  1L0N H;  3U11 A;  3VQY A;  2E74 B;  1F23 A;  3CX5 F;  1XL4 A;  2RMK B;  4GT1 A;  1URF A;  3CJH A;  1VP7 A;  4D7S A;  3CC4 V;  1EM1 A;  4Q6G A;  1SES A;  2VWK A;  3SPI A;  1DF4 A;  3ASO C;  5LMU O;  5KHJ A;  1FPO A;  2X0L A;  4Q20 A;  1IX9 A;  2AHY A;  4DUZ O;  3H1H H;  3JSL A;  5BMV A;  1GRJ A;  3CCR V;  4LF8 B;  2JGD A;  1R1B A;  2EIK C;  1R6N A;  2CK3 G;  1WB7 A;  4BIO A;  3ZMV A;  2EX3 A;  2CGN A;  1N8R W;  3J7A U;  4C7U A;  2UXN A;  3T2M A;  4NVP A;  1VQ4 V;  1SRY A;  3BRC A;  4XDL A;  4O2B A;  2OIE A;  3W7W A;  1Y76 B;  2YEV A;  4YHH B;  4J7K A;  2ZNI A;  4X66 O;  1U96 A;  2CGO A;  1HNW B;  1G1X B;  4X1K A;  5DM6 V;  4GKK B;  1PNK A;  3HKD B;  2JIZ G;  4UCR A;  1FXH A;  4DK1 A;  4UV8 A;  3RW0 A;  2JJ1 G;  2QKA A;  2Q7E A;  1H2N A;  4GX2 A;  2BOB C;  5B1N A;  3VQW A;  4GLX A;  1K9M W;  3TXS A;  1UPG A;  1W0K G;  5B1B B;  3K57 A;  2EZP A;  4EB6 A;  3FB5 C;  5CA1 A;  4DR6 B;  5K1X A;  4PEL A;  3L75 H;  4DR3 B;  4FJC C;  3H1K H;  2IM9 A;  3WB0 A;  2Y69 C;  1SKV A;  3I5D A;  4LF6 O;  3WU2 Z;  3CCM V;  4FFB A;  2XAJ A;  3JAL B;  4O4L A;  1IXM A;  1OHH G;  3OEH G;  2Y4T A;  3E22 B;  3W7T A;  1NJI W;  4I9Q A;  1HDJ A;  1YEW A;  3Q4H A;  1TUE B;  3IC9 A;  4O2A B;  3IJ4 A;  3HKB B;  4NTY A;  3E2E A;  4YHH O;  4PI0 A;  5GTH Z;  4O2B B;  1Q6H A;  5HFM A;  2YEV B;  3ZRW A;  4GKK O;  3SYA A;  4X1Y B;  4FVM A;  4RO2 A;  1BE3 H;  4HNA A;  2HVJ C;  3HKC B;  5H9C A;  4X62 B;  3OR7 C;  4YIP A;  1XOU A;  4G27 B;  1ZAU A;  3CE2 A;  4YJ2 A;  3ZRS A;  1HP8 A;  2C2A A;  1XMO B;  4DR6 O;  1SQB H;  4JYA B;  1MG1 A;  3G67 A;  1N34 O;  3L9D A;  4B3R O;  2QM4 A;  5CA0 A;  4TQD A;  3ZIA G;  3OUF A;  4G2K A;  2XOK G;  3E8G A;  3JSN A;  2A9H A;  2YXY A;  4PA6 A;  2LW7 A;  3RT3 C;  2KB1 A;  1S76 D;  5EC2 C;  2F95 B;  4TT3 G;  3F5W C;  4JTD B;  1MAB G;  3ZMU A;  3VBB A;  2P06 A;  2KQX A;  3OEE G;  3SPH A;  4JI2 B;  3SYO A;  3K04 A;  1ZWI C;  2P7T C;  3ABM C;  2QSA A;  4IIJ A;  3K0D A;  1FFX A;  4LCU C;  5B5E Z;  3CS5 A;  2Q73 A;  2LP7 A;  4X62 O;  4J9Y B;  2YIB A;  1UJW B;  4XDJ A;  2GHY A;  5KX5 A;  3RYF B;  4FLZ A;  1CXZ B;  3JAT B;  2O57 A;  4RQF A;  3OM3 B;  4MVS A;  5EK0 A;  2GV9 A;  3A8T A;  4NTW A;  1I5X A;  2P4K A;  1NVP B;  3ASN B;  5A9G A;  5JJN B;  3L72 H;  2DJV A;  1K5Q A;  1YF2 A;  3LNM B;  4AHC A;  4RUF A;  4DRX B;  5CBG A;  1V55 C;  5A2Q N;  1KP2 A;  3AK2 A;  4MTG A;  1VQ5 V;  3FX7 A;  2RJZ A;  1COW G;  4DR5 B;  1AI4 A;  4JI2 O;  1RSO B;  2A3Q A;  3IFX A;  1VQM V;  1PV0 A;  2IJI A;  2UXB B;  2DWD C;  1JQ0 A;  4PDM A;  3JCU Z;  3AEI A;  3ZMT A;  1GM8 A;  2EIM B;  2XAQ A;  4JI6 B;  3AG1 B;  4DR1 B;  4LF7 B;  2XHB A;  1Q8I A;  1R3L C;  2BTQ A;  4B3S O;  1YVW A;  5K1P A;  4Z1V A;  3U0Z A;  3JAR A;  1EBO A;  1Y6X A;  3MHS C;  2VQE O;  1A32 A;  4DO2 A;  2QE7 G;  3LSU A;  1NH2 B;  4JI3 B;  2HHH B;  3ETD A;  2JK5 C;  3WB1 A;  3IAY A;  2YID A;  4PJ0 Z;  4X64 O;  3APQ A;  1US6 A;  4WFB V;  2DYR B;  3RYH B;  4Z2W A;  1KD1 W;  5EIB C;  4WFH A;  1S77 D;  3N2K A;  5ITZ B;  4LF5 B;  1FFT B;  2HFE C;  5GON B;  5CBF A;  1TVK B;  1R6K A;  5LHH A;  1MOF A;  3W7S A;  2Q7H A;  4KL1 A;  2M7W A;  2V1D A;  3K03 A;  4CBC A;  5LA6 A;  1FYJ A;  3OGC C;  3CCU V;  2HVK C;  2IBZ H;  2UXB O;  1V54 B;  2DN9 A;  4NXN B;  4OPH A;  3T4D A;  3FAV A;  2WLL A;  3LUT B;  1K92 A;  2ITC C;  4LF7 O;  1SQV H;  2A79 B;  5LP6 A;  1NT2 B;  1K5S A;  1JOY A;  3RWR D;  4FLW A;  2AZ0 A;  1DF5 A;  1B6Q A;  3JAW A;  4MVR A;  2P6J A;  3UO2 A;  4KP4 A;  1QLE B;  4H33 A;  1KBH A;  2Y0I A;  4LC1 A;  3THO A;  4OGQ B;  4PA3 A;  1I5Y A;  3JAR B;  4MVQ A;  2ADP A;  4JI3 O;  5IWA O;  5C8Y B;  3ZCC A;  3EHB B;  2K1E A;  2YI9 A;  4G28 B;  1DTO A;  4X1I A;  1XNR O;  3D8C A;  4LF5 O;  1XHZ A;  4AQY B;  3D3I A;  3AG2 B;  3TJT A;  4P30 A;  2WWW A;  1V9P A;  5J2T A;  3T1Y B;  4DR2 B;  1VQ6 V;  3P32 A;  1GO3 F;  4JYY A;  4PDR A;  3SYQ A;  1H2G A;  1ZLZ A;  1VIB A;  2QWR B;  4JAV A;  1XNQ B;  3SYC A;  3I55 V;  4NXN O;  2XT9 A;  5B1B C;  4CS3 A;  4WCE V;  3TK1 A;  4OX9 B;  1K4D C;  1MNG A;  3FAV B;  2WLL B;  1VQN V;  1DLB A;  1OCZ B;  5LP6 B;  4I55 A;  2ETN A;  1NI8 A;  1M57 B;  4RQE A;  4J41 A;  1Q90 D;  2PY5 A;  3SR2 C;  5B1A B;  3BAA A;  5JH7 A;  2QWO B;  2MK3 A;  1S5H C;  5KAI Z;  1FKA O;  1PM9 A;  4IGG A;  1N33 B;  4FM2 A;  3DC5 A;  2WLI A;  1AI7 A;  4AQY O;  4BR6 A;  2B1G A;  1BL8 A;  2YIC A;  1TUB A;  1HNZ B;  3RYC B;  3FYI B;  3OUS A;  3T1Y O;  2PI4 A;  4N23 A;  2QWP B;  4NTX A;  3J81 N;  3LSS A;  1K8A W;  4X20 A;  1WPX A;  2CTR A;  4U7O A;  3OR6 C;  1XNQ O;  1YDX A;  2B1I A;  3DTU B;  5EYP A;  2IJJ A;  4FZ0 A;  1WN7 A;  3CC7 V;  5H2F Z;  5IYB O;  3SGI A;  5D5Q A;  3UM7 A;  1YZB A;  3A0B Z;  4I7Z B;  4OX9 O;  5IJ0 B;  4TUY A;  1RM1 B;  4FLV A;  2AW9 A;  2LGQ A;  4ZKI A;  2G38 A;  1JPX A;  3CYO A;  4DYL A;  3CPW U;  2GDS A;  1WNS A;  4TV9 B;  1PNM A;  2CAZ C;  5LGT A;  1AI6 A;  4QPJ A;  3CWB H;  4J42 A;  1HW7 A;  5JH7 B;  1QVG U;  1N33 O;  3E83 A;  2Q4P A;  1OCO B;  2FL4 A;  2QTO A;  3BA8 A;  2IH1 C;  4ICG A;  4K3A A;  5F2V O;  4I0X B;  4FMT A;  3OFN G;  1SZT A;  2NLJ C;  1TUB B;  3CMA V;  2QM8 A;  2UUB B;  2JDI G;  5JCO A;  4KUM A;  2UUA O;  5LOV B;  4EFE A;  1R3K C;  4DV2 B;  4TOI A;  1KKC A;  2YIA A;  4TV8 A;  1KQS U;  3RVY A;  3LSQ A;  1I7F A;  1AJP A;  2EIJ B;  1F4M A;  2LFS A;  2W0F C;  3ZHS A;  3H01 A;  2Q7G A;  2CE4 A;  2ZE8 A;  4XBF A;  2DYS B;  3HR0 A;  4KXR A;  1QR9 A;  5KHI A;  4FFK A;  2ZIO A;  4PD4 F;  5BR8 B;  2AXT Z;  3SJA C;  1WPB A;  4DUZ B;  2LJ2 A;  5EZY B;  2XUM A;  5LGU A;  1AP6 A;  3ASN C;  4DR4 B;  3F7V C;  4I50 B;  3A0H Z;  3CCJ V;  4ZOL B;  4NXM O;  2WA3 A;  4PDV A;  1Y76 A;  1LUW A;  3F7Y C;  5IY5 B;  3MHH C;  1MMM A;  5KA6 A;  2Z5U A;  4F6R B;  3E35 A;  4X66 B;  1P7G A;  3HKD A;  1BSM A;  2UUB O;  5LYJ B;  4FLY A;  3ETE A;  1DGS A;  1VQP V;  2JEX A;  1FAF A;  2E75 B;  4DV2 O;  2WLM A;  1BHA A;  4UCV A;  1ENV A;  4TV8 B;  3K06 A;  1K34 A;  4LH6 A;  2CH7 A;  3AG1 C;  3OE7 G;  1SF9 A;  5BR8 O;  2F43 G;  5LMN B;  4CC5 A;  1AB3 A;  1FJG O;  1MZE A;  2F4V O;  2AGA A;  1QU7 A;  5DN6 G;  4LF6 B;  3HKE B;  4DR4 O;  3CC2 V;  3JAL A;  1NH2 D;  1SQX H;  3K59 A;  3E22 A;  4X89 A;  2HG5 C;  4HBN A;  2KG7 A;  4O2A A;  2DYR C;  1OCR B;  3HKB A;  1HR0 O;  4R7C A;  2GTS A;  3K3W A;  3BVO A;  2VQF B;  4IYH A;  1VMG A;  1GN4 A;  3ZN1 A;  4X1Y A;  4K8Z A;  1EN6 A;  1VQ9 V;  4WFF A;  1FD9 A;  1SA0 B;  3HKC A;  4B7K A;  1V54 C;  1S0V A;  4DV6 O;  4LFC O;  3BPZ A;  1S3J A;  3JAK B;  3CHX A;  2F23 A;  3B40 A;  1GH6 A;  4O4I B;  3JD3 A;  2XAH A;  2QDO A;  5LMN O;  2PYJ A;  1SQQ H;  2CH7 B;  1RPO A;  1N34 B;  4R6Z A;  4B3R B;  3WG7 B;  2PYL A;  1QLE C;  4PI2 A;  1GK9 A;  1ROP A;  3HPL C;  1EN4 A;  2K9P A;  2OIG A;  2WLN A;  1BMF G;  3S3X A;  3CD6 V;  1NBM G;  2PUS A;  1K7D A;  1DK1 A;  3K58 A;  1N4C A;  4YJ3 B;  2KG7 B;  2Q69 A;  3TCU A;  1Q82 W;  3EXA A;  3QO7 A;  2Y0P A;  2ODM A;  2VQF O;  3ETG A;  2ITD C;  4QE7 A;  4HAM A;  2JRI A;  1VF7 A;  3SPG A;  3AK1 A;  3D3Q A;  4JI7 B;  2EBO A;  2JEU A;  5JVD B;  2A06 H;  4GCZ A;  5IT9 N;  1GMG A;  3RYF A;  5E1A C;  3DXR A;  3JAT A;  3BY6 A;  3OTF A;  2N74 A;  1RP3 B;  4ASU G;  1OCZ C;  2Q6A A;  3IGA C;  5LP6 C;  4UV9 A;  5CBH A;  4UVB A;  2JS3 A;  3JYC A;  2ARH A;  1M57 C;  3ZRX A;  1PL0 A;  1Q6I A;  2ILM A;  2JVD A;  5KAF Z;  3UO3 A;  1HWY A;  4EKW A;  1E79 G;  1KUQ A;  1XMQ B;  5IDJ A;  2CTQ A;  3CB2 A;  5FL7 G;  3GVM A;  3JD2 A;  4DRX A;  1VQ7 V;  2BE3 A;  3L71 H;  1JVM A;  2IJK A;  2Q67 A;  5IJ9 B;  5B1A C;  3TET A;  4MW3 A;  2MW2 B;  4NR1 A;  1PL4 A;  4DV3 B;  3UCS C;  1RSO A;  1YJN V;  4JI8 B;  2ZE6 A;  3FFQ A;  5IE9 A;  1M1K W;  5JWP A;  2R70 A;  4X65 O;  1IBM O;  4MT8 A;  1GN3 A;  1YHQ V;  1S72 V;  3N2G A;  3HB3 B;  3BEH A;  4JI7 O;  2KSD A;  3P3P A;  3FB8 C;  5D5P A;  4X88 A;  3AK3 A;  3CCS V;  1Z5W A;  3T1C A;  1MA1 A;  5H5N A;  3QVN A;  3W7U A;  1N32 B;  1FXK B;  1WA8 A;  3X2Q B;  3UQ8 A;  4LWS A;  3ZBH A;  3ABU A;  4MVU A;  2LGW A;  3DXR B;  1P84 F;  1N36 B;  1Z5V A;  4GUN A;  3RFR A;  1SQG A;  5FPO A;  1RM1 C;  4LF9 B;  1H2M A;  5B3S B;  4B3S B;  1YIJ V;  2RQ6 A;  4JZG A;  3GWK C;  1VF5 B;  1XMQ O;  4DV5 B;  4E4E A;  2EZO A;  3SPC A;  4H0L B;  2VQE B;  2WAM A;  3CSX A;  3RYH A;  1SET A;  5BXZ A;  5KHH A;  4UXN A;  4X64 B;  4TQF A;  3ZHT A;  5ITZ A;  3OGI B;  4DV3 O;  5GON A;  1TVK A;  4UCU A;  3P30 A;  4JI8 O;  1OCO C;  1RFY A;  2M6Y A;  4FPP A;  4LFB B;  5L3G A;  4UB6 Z;  1BQZ A;  4DXW A;  2NR5 A;  4DR7 O;  4GKJ B;  2EIN B;  5B1O A;  3ZRV A;  3N2G B;  4UVA A;  5JJE B;  4K0K B;  3SJC C;  1P7B A;  1B04 A;  4J11 A;  5J2U A;  4QE9 A;  1N32 O;  3AG3 B;  3FYE B;  2EIJ C;  3K9S A;  5CN0 A;  1XDC A;  4RAI A;  1WA8 B;  1K73 W;  2QR4 A;  1N36 O;  4LWS B;  1T5E A;  2DYS C;  1M9N A;  1MSW D;  4LF9 O;  4CH5 A;  4JI5 B;  3CEI A;  3T4Z A;  1KMI Z;  1PNL A;  3K9A A;  1VQ8 V;  1JA8 A;  3K08 A;  4DV5 O;  2Z0A A;  4WF9 V;  3RVZ A;  5C8Y A;  2QWN B;  3C3T A;  4JAU A;  5IWA B;  2OCH A;  1XNR B;  4LH7 A;  4P9O A;  4UCO A;  4BWA A;  1SZX A;  1VQK V;  4OXS A;  3BHP A;  4JTA B;  1CPY A;  1KP3 A;  2A7W A;  1R3I C;  5IY5 C;  3UT5 B;  4LF4 B;  4LFB O;  4PHZ A;  1VF6 A;  3QG5 A;  2YS8 A;  1XIL A;  3JAM N;  3G6E V;  4JYC A;  4GKJ O;  4NB5 A;  5JCO C;  3M8A A;  3CME V;  4K0K O;  3CCL V;  2Q5Z A;  3O65 A;  2BSK B;  4PV1 B;  3R65 A;  1JCH A;  5JJJ B;  5J2U B;  3OW2 U;  1H8H G;  2Y48 A;  4MW8 A;  1GM7 A;  5FNV A;  4JTC B;  4EEQ A;  4DV4 O;  4JI5 O;  1YCI A;  4JPR A;  4MVM A;  5BY1 A;  1XBL A;  1WJZ A;  3K0G A;  4JF3 A;  1H38 A;  2LW1 A;  4MSW C;  2JS5 A;  1NTK H;  4XDK A;  5LBQ A;  4JYB A;  5KA5 A;  3BFR A;  2UUC B;  1OCR C;  2A0L A;  2UU9 B;  4PA7 A;  4A5U B;  3RYC A;  4QJF B;  1JFF B;  3TXQ A;  3JD0 A;  4LF4 O;  2EIL B;  3RYI A;  3CP1 A;  2ZCE A;  3GWO A;  2F66 C;  1IUR A;  2RN9 A;  2P5O A;  1YXB A;  3OTO O;  4J10 A;  3FB6 C;  5DED A;  4NYK A;  4MVO A;  2Q8V A;  4IHJ B;  3A2F A;  2XAG A;  5IJ0 A;  2ZR3 A;  3H1I H;  1XL6 A;  4BAY A;  4ZHQ B;  5FNV B;  3WG7 C;  4F6E A;  4TV9 A;  1OJH A;  3EFF K;  2F1M A;  1THZ A;  3VQV A;  4DV1 O;  2ZT9 B;  1GN6 A;  4LBE C;  3OMN B;  1IDS A;  2XAS A;  2OWO A;  3QO8 A;  1KYO F;  3ETQ A;  2L35 A;  2Q68 A;  2N04 A;  3AG4 B;  4O4J B;  3LDE A;  3ZS8 C;  2UUC O;  1Y74 B;  1WP8 A;  1BGY H;  1L1F A;  2UU9 O;  3C90 A;  4I0X A;  3D36 C;  2DW4 A;  4LP8 A;  1E1R G;  3ABL B;  2VRZ A;  2WA4 A;  5CB4 B;  3RYI B;  4QIW F;  5FLX N;  4LR3 A;  5LOV A;  3CXC U;  1Q5O A;  2UUA B;  1EZV H;  3KCX A;  5H6Q A;  2FTK A;  2VS0 A;  1VQL V;  2QJ1 A;  4AIL C;  2Z3Y A;  3FD9 A;  1S5J A;  1QLN A;  4P2Z A;  2ATK C;  3DC6 A;  2AZ2 A;  1Q6U A;  5EZY A;  2V7Q G;  4ZI7 B;  3L70 H;  2NN4 A;  5FPR A;  4JAA A;  4BIU A;  3R66 A;  3G71 V;  2FML A;  4YIO A;  4I50 A;  4GYC B;  3T1H O;  2V4D A;  4ZOL A;  2DOS A;  3RBZ A;  1QR8 A;  4U3F H;  4FLX A;  3EVK A;  4B3M B;  3ZMS A;  5KMG A;  1BHB A;  5CMU A;  4NXM B;  4L87 A;  1N0N A;  4PA4 A;  3BA9 A;  4F6R A;  2W6I G;  1GN2 A;  5LYJ A;  4BW9 A;  2FYU H;  3WB2 A;  2Y4U A;  1KKD A;  4YY3 O;  1OV9 A;  1M5I A;  5LXT A;  2PTM A;  5KUK A;  1BCC H;  1Q86 W;  3CRR A;  1JMK C;  1NTZ H;  5TIS Z;  1JJ2 U;  2X6A A;  3STZ C;  1FXK C;  4QNH B;  1LNQ A;  1IBK O;  1W59 A;  1XI1 A;  1G6U A;  1BZK A;  2GBO A;  2ZKO A;  1GKF A;  4KFM A;  3OD4 A;  1FJG B;  3B77 A;  3MD0 A;  4DV0 O;  4UCS A;  5B3S C;  2F4V B;  3AG7 A;  3QTC A;  3KZI Z;  3HKE A;  3K5O A;  3JD4 A;  1JR9 A;  4ZIB A;  3G6B A;  5EBW C;  1QVF U;  1BQ0 A;  1K33 A;  2E3C A;  4B3M O;  4I4T A;  4LNU B;  4PDL A;  1HR0 B;  3P3N A;  5KMG B;  1XHX A;  4DK0 A;  2ZDI C;  1SA0 A;  3K5L A;  2EIN C;  3K79 A;  1H2S B;  2GUZ B;  3JAK A;  4P9P A;  3JD1 A;  4DV6 B;  4E2L A;  4LFC B;  5LXT B;  1KU9 A;  1X59 A;  2QKS A;  3AG3 C;  2EIM C;  4O4I A;  1L0L H;  5B66 Z;  1EFR G;  5AG2 A;  3LDC A;  1JX9 A;  2JJ2 G;  4U3J B;  4D6T H;  4DV7 B;  4LFA B;  2X6C A;  2BOC C;  3M99 B;  1ZTE A;  2R9I A;  1ZL8 B;  3APO A;  3E89 A;  3JAS B;  2P22 C;  3B8M A;  2YXL A;  3W7X A;  1WLE A;  4NKG B;  2YIB D;  1P49 A;  3OAA G;  1Q81 W;  4YJ3 A;  4H37 A;  1TA8 A;  1K97 A;  4ABM A;  1GTO A;  3D36 A;  1BS3 A;  4WBN B;  3S3W A;  4I4T B;  1Q7Y W;  2X7R B;  5L3F A;  2IW5 A;  2UXC B;  5GTI Z;  4WFG A;  3L74 H;  3NXS A;  3ZED A;  2UXD B;  2LFR A;  2OTL V;  2XAF A;  4H13 B;  4HZ3 A;  5CA3 A;  5JVD A;  3E8H A;  3CCQ V;  3QO5 A;  4CS4 A;  4JI1 O;  5EC1 C;  1WB8 A;  3MDS A;  1K3E A;  5HFL A;  5KLV H;  3B2E E;  4DV7 O;  1F4N A;  4LFA O;  3H9V A;  4GX0 A;  1SQP H;  3CJH B;  4DW0 A;  2ZXW B;  1L8D A;  3MAQ A;  3SJQ C; 
#chains in the Genus database with same CATH homology
 1I94 O;  5BXZ A;  4B3R O;  2JRI A;  4DV4 O;  4JI5 O;  3J7A U;  5BR8 O;  4DV3 O;  1AB3 A;  1FJG O;  1IBL O;  5BY1 A;  4JI8 O;  1J5E O;  2E5L O;  2F4V O;  5IT9 N;  2AGA A;  4X66 O;  2LW7 A;  4DR5 O;  1N33 O;  1G1X B;  3RT3 C;  3F5T A;  4DR4 O;  4DUY O;  4B3S O;  4DR7 O;  2N74 A;  4LF8 O;  4NXN O;  2UXC O;  1X59 A;  3R66 A;  3SDL A;  3T1H O;  4A5U B;  4OPA A;  2UXD O;  4KHP O;  2VQE O;  4LF4 O;  1XMO O;  1A32 A;  2UUA O;  4JYA O;  2DOS A;  1HR0 O;  1N32 O;  4X64 O;  1KUQ A;  1N36 O;  3OTO O;  1NS1 A;  4DR2 O;  4JI6 O;  4LF9 O;  4DR1 O;  4X62 O;  4B3T O;  1HNW O;  2ZM6 O;  4LF6 O;  1FYJ A;  4DV6 O;  4LFC O;  4DV5 O;  2Z0A A;  1FKA O;  2UXB O;  4X65 O;  1IBM O;  4YY3 O;  3J80 N;  1AIL A;  4AQY O;  2HHH O;  5LMN O;  4JI7 O;  4OPH A;  3T1Y O;  1XEQ A;  4DV1 O;  3J81 N;  1IBK O;  2DJV A;  4YHH O;  4LF7 O;  4LFB O;  5LL6 Y;  1F7Y A;  5H5N A;  2ZKO A;  4NXM O;  4DR3 O;  4JI4 O;  4GKK O;  3JAM N;  5A2Q N;  1XNQ O;  4JI0 O;  5LMU O;  4DV0 O;  4JI1 O;  4GKJ O;  1R6T A;  4JV5 O;  2UUC O;  2UU9 O;  4DUZ O;  3M8A A;  2UUB O;  4K0K O;  4JI2 O;  1DK1 A;  3O65 A;  1YZB A;  4OX9 O;  4DV7 O;  4JI3 O;  4LFA O;  5IWA O;  1HNX O;  1R1B A;  4DV2 O;  5FLX N;  2FKX A;  1XMQ O;  1HNZ O;  1XNR O;  4B3M O;  2VQF O;  4DR6 O;  4LF5 O;  1D2D A;  1N34 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...