5LMUO

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 5lmuO00
5BY1A 4JI7O 3OTOO 4JI3O 4DV5O 1XMOO 4DV3O 4LF8O 1FYJA 2F4VO 4AQYO 5BXZA 2ZKOA 2UXBO 3J7AU 5BR8O 4LF9O 5LMNO 5IWAO 4DR5O 3RT3C 2UUAO 1XEQA 2UUBO 4JYAO 1F7YA 5LMUO 4B3MO 5FLXN 1N33O 3T1YO 3M8AA 1A32A 4K0KO 4LFBO 1FJGO 2Z0AA 1XMQO 4LFAO 1IBKO 1HR0O 4YHHO 4DR3O 2DJVA 5IT9N 4LF7O 2FKXA 4DUZO 4NXMO 1AB3A 2AGAA 1HNWO 2UXCO 2UUCO 2VQFO 4LF5O 4JI1O 5A2QN 1HNXO 4KHPO 4DR4O 1D2DA 3SDLA 4DR7O 1KUQA 3JAMN 1HNZO 2HHHO 4JI0O 1NS1A 5H5NA 1R1BA 3J80N 4LFCO 2UXDO 1DK1A 3J81N 1FKAO 4DV4O 2UU9O 1J5EO 4JV5O 4JI5O 4DUYO 2DOSA 4DV2O 4B3SO 3F5TA 4OPAA 2JRIA 2E5LO 1X59A 2ZM6O 4B3RO 1YZBA 1XNQO 4B3TO 4DV1O 4A5UB 4JI8O 3T1HO 3O65A 2LW7A 2N74A 1N34O 1I94O 4X65O 4DV0O 1N36O 1R6TA 3R66A 5LL6Y 4OX9O 1G1XB 2VQEO 4OPHA 4LF6O 1XNRO 4YY3O 4DR6O 4JI4O 1AILA 1IBMO 4JI6O 4GKKO 4DR1O 4JI2O 4DR2O 4NXNO 4GKJO 4X64O 1N32O 4X62O 4DV6O 4DV7O 1IBLO 4LF4O 4X66O
chains in the Genus database with same CATH superfamily
1WB8A 5BY1A 3H01A 2E76B 3IFXA 2QR4A 2EZPA 4PDVA 1JR9A 1KD1W 1GM9A 2V4DA 5EBWC 1XHZA 4PA6A 3CHXA 4W4LA 2EILC 1XEQA 2EIJB 5FPRA 3WB1A 5LMUB 3LUTB 4B3MO 4X1IA 1G8MA 4IIJB 5H2FZ 4NYKA 4X88A 1OZ0A 4X1YB 4LFAO 3OAAG 1HR0O 1OCCB 2DJVA 4UCUA 2AGAA 3S3WA 3MDSA 1W0JG 3CMEV 2EIMC 5GONB 3ZS8C 4EB6A 3E8HA 4FLXA 2QTOA 4C7UA 2YC0A 4DR4O 4TSFG 3H1IH 1HNXB 5EK0A 1S72V 3OUFA 3CRRA 1YJNV 4XDLA 1WN7A 3RVYA 3FB5C 1GTOA 1VEWA 4LFAB 4BR6A 2R70A 5CBFA 1K8AW 1HR0B 1AI4A 3GB7C 4FIPC 3M99B 4OXSA 1HW7A 4RAIA 1MOFA 3RW0A 5KHIA 3SYOA 3W7SA 2IH1C 1ZWIC 2CGNA 4H33A 4DV0B 4WFGA 1QVGU 1KU9A 1SS3A 4MW3A 3U0ZA 1KKDA 4X1KA 3T4DA 3TXQA 5D5PA 2GV9A 1VQOV 5IY5B 2E3CA 2BE3A 2AW9A 4GKKB 1NVPD 4FLYA 1M9NA 2CGOA 3WU2Z 4JPRA 3OGCC 4X66B 2XTAA 4CH3A 4JI7O 1NR1A 4NTXA 3ZHTA 4DV5B 1XMOB 4MTGA 4HBNA 3AK2A 2JJ2G 2DYRC 5L3GA 5IWAO 4XDJA 5JQGA 4UVAA 1R3LC 4LNUA 1SKVA 2Q69A 1VQPV 2HG5C 1QBZA 3CYOA 1B3QA 1Q81W 1Y74B 1FJGO 4K0KB 3G4SV 3JSLA 4PI0A 4JI7B 2QDOA 3OUSA 4DR3B 3BEHA 1PPJH 5E1AC 2EINB 3AG7A 4CH5A 2G38A 2UUCO 1YXBA 3BAAA 4OGQB 1NTKH 5B1OA 4QIWF 2UXNA 5CBHA 2QM7A 1IZ3A 3OT7A 4JI0B 4PA9A 2JGDA 4MSWC 2L6LA 3K5MA 4HZ3A 4L87A 1FJGB 2ARHA 2FTKA 5KMGA 2EIJC 5EYPA 2ZQMA 1YZBA 2P06A 3JD4A 4Z1VA 1FXKA 4I4TA 1PM9A 3W7UA 2UUCB 3MAQA 1OCCC 4JI8B 3VQWA 1ZSPA 3N27A 2QWNB 3JASB 1BGYH 1EM1A 4O4IA 5EBMC 1DF5A 2W6JG 3QNEA 2QJ1A 3B8NA 4RUEA 3Q4HB 2D3OW 3GVMA 4JI6O 2NN4A 1SF9A 4FZ0A 3E8GA 1F51A 1Q6IA 3HR0A 5J2UA 1SRYA 1N32O 1PL4A 2ITDC 1JMKC 5EZYB 5LHHA 1VQ9V 3RYFA 5B1BB 2OIEA 4DV7B 4O4LB 3BHPA 4GYCB 2WA4A 3JCZA 4WBNB 3VOUA 5B3SB 3CCLV 5CA1B 4PJ0Z 2VS0A 1S0VA 2PYJA 5LMNB 1JFFA 3ZEDA 4GZRB 4AI8A 2F66C 1YJWV 1I08A 5DN6G 2AZ0A 4AILC 2ZDIA 3JATA 4J7ZA 4AHCA 3T1YB 2WWWA 3AG1C 5IY5C 3JARA 1WA8A 1P84F 2P4VA 2HP8A 4FFKA 1H38A 1ZTEA 4JAAA 3QO5A 4QE9A 3CCJV 1SQBH 1GRJA 4JTCB 2GTSA 4NKGB 1CP9A 3RYFB 3OR6C 4GX5A 1KKCA 3H9VA 4G28B 1T5EA 2KB1A 1HNZO 3CSXA 5H6QA 1TUBA 2B1IA 2Y4UA 3ZRVA 3K58A 2QM8A 1J5EO 3ICXA 3FKSG 3LNMB 3K9AA 3FB7C 1BS3A 1PNLA 3EHBB 1S77D 3K3WA 3HKCA 3H1KH 1SA0B 1AJPA 1CXZB 1GK9A 1GM7A 4DW1A 1MSDA 2ZM6B 1Z2GA 4U3JA 2QWRB 3NR7A 2X7RB 1SZXA 2CK3G 4P2ZA 1SQGA 5JH7A 2EINC 5LL6Y 3DXRA 3ZBHA 2HJDA 3ZIAG 3MD0A 1J5EB 1THZA 3FAVA 3ZCCA 3HKBB 3G71V 1SC5B 4G27B 5KAIZ 4B7KA 1BCCH 2IJKA 4NR1A 1VF5B 4J11A 4O4JA 4JAVA 4P9PA 4I7ZB 2LFSA 3K5NA 1TAEA 3ETQA 5LHIA 4TV9A 2HVJC 2M7WA 3JAKA 4LF9O 1Q6UA 3S3XA 4MVSA 2QTSA 4DR5O 1F4NA 1JPXA 2A79B 3BA9A 2PGGA 4DRXB 2PUSA 5JH7B 2FMLA 4F6RA 4X89A 3DXRB 3FD9A 1Q8IA 3M8AA 3RFRA 4X9QA 2JDIG 4ASUG 3E2EA 3SPCA 1AB3A 1SQVH 1L8DA 4K35A 5B1AB 4MT8A 2KG7B 1D5AA 3I55V 1VARA 4P30A 4DR5B 3K79A 4KHPO 3FYIB 1NTZH 3CCSV 1FPOA 2Q7GA 2QKCA 3HKDB 3TJTA 3H1LH 3CCUV 3H1HH 4TT3G 1RPOA 1IDSA 2CTPA 4XBFA 2VRZA 3ZHRA 4R7CA 4YIOA 3X2QB 2KSDA 2Q67A 5E79Z 1NR7A 4KHPB 4CS4A 1Z5WA 4TV8A 4IT5A 3CCVV 5IYCO 3E83A 1RM1C 3W7TA 3D36A 3STLC 2H3OA 3CRAA 3JALB 1H8EG 2KKWA 4ZI7B 1AILA 3TGUH 4ZOLB 2M6YA 1MABG 4FJCC 1VQKV 3A2FA 2B9ZA 1FFXA 5IJ0A 3IGAC 2B5UA 2ZR2A 3ZHUA 2CTWA 3ABUA 3PN1A 4LP8A 2IJJA 4FLTA 5ITZB 2QWQB 2JEUA 2ZDIC 4ABMA 1NKDA 2RJZA 4IYHA 5KA5A 3SPHA 2YDEA 3UCSC 2R9IA 1QLNA 2UUBB 1BHAA 2WLLA 1Q43A 1Z5VA 1KP2A 1N33B 4LFBO 4FM1A 3ASNB 2ZE7A 3BCCH 3E89A 4O2AA 5L3CA 4NXMO 1LR1A 2C2AA 1XQ8A 3FB8C 5KHKA 3HKEA 2Q0AA 1ZL8A 3DGEA 5CA0A 2X6CA 5HFMA 4LC1A 5BMVA 5JVDA 4FFBB 1VQ4V 2XOKG 4H44B 4B08A 2UXDO 5C8YA 2PY5A 4DV4O 4EKWA 4F4LA 5K1PA 4JI5O 3OGIB 4LFBB 1M93A 3L75H 4UB6Z 4DUYO 2GHYA 3N2KA 3LDEA 4NVPA 2YXHA 3BRCA 4NXMB 2BSKB 3FYEB 4KXRA 3RGBA 4B3TO 1YDXA 1AI5A 2OCHA 4PDLA 1GN2A 3CC2V 3E22A 5EC1C 2IU0A 2ZE5A 2WLJA 1UPGA 3DSQA 2ETNA 1BT8A 2ZXWB 4FMTA 4JYYA 4DO2A 4U7OA 1VP7A 2KQXA 1V9PA 4JI4O 1IBMO 1MG1A 4DR6B 1ZUQA 2JVDA 4KUMA 4MTXA 4TUYB 2Y4TA 3EFFK 4GX1A 4N21A 1GO3F 2QSAA 5EBLC 1XILA 3ABMB 3ZMVA 1VQ5V 4JI3O 4JYCA 3F7VC 2WLHA 4IIJA 2RDCA 2XAHA 3X2QC 4X1YA 5JCOC 2CTRA 4RO2A 1G6UA 2ZINA 4JI4B 1IBMB 5EC2C 5GONA 2ZE8A 5LMUO 3AG4C 5H9CA 5FLXN 5LOVB 1A32A 4J7JA 2Z0AA 4K8XA 4PI2A 4JI3B 1KBHA 1F23A 2QKAA 4MTOA 2EULA 2OIGA 2Q5ZA 2UXCB 2EIKB 1HNXO 1Q86W 4LF5B 3J80N 4TOIA 4L8JA 3CB2A 3CRQA 3K06A 4B7EA 1VIBA 4QPJA 1YSCA 4J7KA 4EFBA 1B6QA 4PA7A 1BSMA 4YJ3B 1YTFD 2DMXA 4DXWA 3D36C 1BE3H 2FB5A 1RFYA 2N74A 1NBMG 3ASNC 4DV0O 4X65B 1K9MW 3SPIA 1SETA 4FZ1A 1F4MA 3JD3A 2F23A 4GT1A 2Y48A 1YEWA 1DTOA 5KHHA 3P32A 4GKKO 2N05A 2CH7B 5LXTB 1D5NA 2N04A 3SJCC 1PV0A 4HAMA 4CZZA 4X62B 4X66O 2QE7G 3OTOO 5LYJA 4DV5O 1XMOO 1VQ6V 3IC7A 2ADPA 1QU7A 4DV3B 1AI6A 1Y74A 4FK5C 5FNVB 4JZ2A 1YITV 3JD1A 1RP3B 3KKYA 4BW5A 1GN4A 1NI8A 2YEVB 4GLXA 3LSUA 5GTIZ 1MMMA 1S5HC 3LSQA 4QJFB 1YJ9V 3AK1A 3RVZA 4K0KO 5LGTA 2PYLA 4DR3O 5CA3A 4ZHQB 1LUVA 4NTWA 3OTOB 1AR4A 3CC7V 2FKXA 1K5SA 2DN9A 2Q0OC 2X6BA 1R3IC 1HNWO 1ORQC 1K73W 2CAZC 3ABMC 4GCZA 1V55B 4JI1B 2YIDA 1KUQA 4J9YB 4JI0O 5LYJB 4DR7B 2HHHB 3E8BA 2Y0IA 1FKAO 4WFEA 3JASA 3GWOA 2ITCC 3E8FA 2MK3A 3L72H 2F43G 1M4UA 3W7WA 4O2BB 3E35A 2DWDC 1LUWA 1M57C 4FM0A 4UCOA 3OEEG 3Q4HA 2JGUA 1HNWB 4JI8O 2YIBD 1RSOB 1L1FA 2LW7A 4RUFA 4CC6A 3B09A 4MS2A 3SYAA 4IHJB 5A9GA 3R66A 2RNBA 5EZYA 5LP6B 4LR3A 4O4LA 1VF7A 4R50A 3AK3A 4LF6O 4JASA 2EIKC 5LA6A 4WBNA 1FS0G 4EFEA 5IYDO 2Q7EA 2A0LA 5CA1A 4G2KA 1XL6A 4DR1B 3ZMUA 4DV7O 4NXNB 4GKJB 1TVKB 1JJ2U 2ZD9A 5EIBC 2PF4E 5F2VO 5IYZB 4J10A 2FL4A 2ZT9B 4Q20A 2E75B 2F4VB 2X0LA 4LF6B 1ENVA 5LMNO 3CWBH 1GH6A 4RQFA 4LH7A 4WF9V 1URFA 3G80A 3OMNB 5L3BA 3T1YO 1P7GA 2Q7HA 2L35A 1AP5A 4O4HB 4DYLA 2YXLA 2W6IG 1IBKB 1MZEA 5LA6B 2PI4A 4I50B 3ZX6A 1DLBA 3JAWB 2NR5A 2QWOB 5IJ9A 1SERA 5CBGA 4FVMA 4RQEA 4UCRA 4H13B 1SA0A 1D2DA 3SDLA 3K57A 1GAXA 2ODMA 1DF4A 1YTFB 5J2TB 4X20B 4D7TA 2JS3A 4R8CA 3RYHB 4I55B 2DOSA 1QR9A 3QO7A 2ZNIA 1WPXA 2ZIMA 3ABLB 4B3SB 4DV2B 4UCSA 2HLDG 3AG2B 1XL4A 2ZM6O 2QA4V 4B3RB 3L71H 4QE7A 3HKBA 4GX0A 1XHXA 2H8PC 2AHZA 1SESA 5CN0A 4OPHA 2GDSA 3BY6A 1EN4A 3SPGA 5IJ9B 5B66Z 1XI1A 3CCEV 1AJNA 1EN5A 3R65A 4QGPA 3RWRD 2YS8A 2WLNA 1GN6A 3C90A 3SJBC 3MHHC 1NVPB 3AEIA 4DRXA 1CPYA 2HR3A 3CCMV 1N0NA 1FYJA 2ZKOA 3SPJA 1YHQV 2OCCB 1PL0A 2CUGA 3ZMTA 3ETGA 5LP6C 3SYCA 2KG7A 4R6ZA 4JYAB 3N2GB 4HNAB 2QEXV 1AP6A 3EVKA 4BIUA 3HKDA 2QM4A 1NTMH 3SYPA 2P4KA 4CS2A 4DUZB 3EXAA 3ETDA 1IURA 1YIJV 3CMAV 3CRCA 2GBOA 3A0HZ 4F6EA 1M5IA 1H2NA 4YJ2B 4JGSA 1BMFG 1J95A 2JK5C 2P67A 3TK1A 2YUAA 5JCOA 4KP4A 2YXYA 3WFVA 1DK1A 1BQ0A 2ZNJA 4LFCB 3OW2U 2Q6AA 1U97A 2YI9A 2JJ1G 1OCZB 4CS3A 4U7NA 3ABKB 3JALA 1PP9H 5B1BC 1QLEB 2UXXA 4ZI7A 2GSMB 1OV9A 3DTUB 1OCRB 4ZOLA 2DQ0A 3O9OA 1VQ7V 2XAJA 5B3SC 1W2BU 2DWEC 2NNUA 5L3DA 1QHTA 2EJ7A 1QNMA 4I5SA 4BIZA 1XBLA 2NLJC 1XNRO 2AHYA 1AR1B 3K03A 1GKFA 1H2LA 1TA8A 2GUZB 5ITZA 1H2MA 3K0DA 3LSSA 2F95B 1XDCA 1Y67A 4DV6O 1Q82W 2XNDG 3JSNA 1ZX3A 5KA6A 3AG2C 4LF8O 1FFTB 2QGNA 2YIAA 3BVOA 3ABTA 1XNRB 3RBZA 5KX5B 4NB5A 2UUAB 1NJIW 2UUBO 4D7SA 1I5YA 4DV6B 1N33O 4BWAA 4FFBA 4UCVA 3LNNA 1JA8A 4LF8B 4LF7B 1P49A 1I5XA 3IC9A 1JQ0A 1YF2A 3ETEA 3QF7A 3CX5F 5A2QN 1XUQA 2BSKA 5BZBA 3JAMN 2BTQB 2EX3A 1HP8A 3C3TA 1IVSA 2WPDG 5LHGA 4JV5O 2CDYA 3A0BZ 2JRIA 2QWPB 2PI5A 2WLMA 4ZBMA 3RYIB 3FFQA 3FX7A 2W0XA 2WLIB 3D3IA 3BFRA 3UO3A 5DM6V 1YI2V 5B1NA 3AG3B 4TQFA 4TUYA 1R6TA 3QVNA 1G1XB 3G6BA 1GM8A 1K4DC 1Y6XA 2QKSA 5FPOA 1N4CA 4DW0A 4JV5B 2Q4PA 4UV9A 4LWSA 4DR6O 4UCTA 1HDJA 3P3PA 4MVRA 5KUKA 3ASOB 2A3QA 4MVUA 2IW5A 1O9GA 1OCZC 5B1AC 2OTJV 3ABKC 5KUMA 4GUNA 2EJRA 3VQXA 5LOVA 1QLEC 4FLZA 3ZRSA 3QO8A 2V7QG 4PA3A 3RYCB 4J80A 4AQYB 1VF6C 3L70H 1AR5A 4N23A 5J9PC 2D2CB 1WAZA 3UT5B 3VBBA 5AG2A 4IYIA 2VWKA 1FD9A 2P7TC 3OMIB 2FYUH 3IAYA 3STZC 1AROP 2RQ6A 2LGWA 1Y4MA 1M90W 4ZKIA 4LWSB 5IT9N 4YHHB 1EZVH 3TCUA 5L3FA 1GN3A 2R9AA 1TGOA 2WLKA 3E22B 4UXNA 2UXCO 3B40A 4LF5O 2DW4A 3CJHB 3CPWU 5IE9A 4UB8Z 3SYQA 4YJ3A 4D6TH 2R72A 1NS1A 3KCXA 2X6AA 1Y76B 1S5JA 3F5TA 4JAUA 2JEXA 3ZJZA 1SQPH 1SQQH 5KHJA 4E2LA 2YI8A 1O9HA 4A5UB 2MW2B 3D8CA 3ZRWB 5JJEB 1JOYA 1XREA 1UJWB 2DQ3A 4X65O 2CH7A 5LXTA 2K9PA 4J41A 3K04A 5LBQA 4H0LB 4OX9O 1IXBA 4JF3A 3CXHF 2VQEB 4I0XB 1MNGA 4E4EA 5FNVA 3JCUZ 4MW8A 3SGIA 4JI2B 4X62O 4UUJC 1VQ8V 4LCUC 2YEVA 3B4SA 5LGUA 2ZR3A 3UO2A 4TWKA 1H2KA 2IBZH 4DV3O 2LGQA 1W59A 2F1MA 5CB4B 2XAGA 4OX9B 1WNSA 3TXSA 3PJSK 4YXWG 4ZHQA 4J42A 3AG3C 3RT3C 1B04A 3CCRV 2LFRA 1PNKA 2H94A 1QVFU 4WCEV 3M7MX 4MTFA 1K5QA 4B3MB 2Q73A 4TQDA 3OD4A 3CEIA 5CMUA 1U96A 2HFEC 2LP7A 5JWPA 4RWUA 3ASOC 4PV1B 2OTLV 1JVMA 4O2BA 2VQFO 1KQSU 4JI1O 4IL6Z 4K8ZA 4X1IB 3CRMA 4MVOA 1BQZA 3ZMZA 1VQNV 4DR7O 2DYSB 4DR4B 2HHHO 1R1BA 1RSOA 2ZXWC 4DK0A 1L0NH 2OT5A 4KL1A 3E86A 3SJAC 4IHJA 3ZHVA 4EB6B 2IU3A 4FM2A 5LP6A 2E5LO 3AG1B 2GTAA 1K4CC 1GMGA 2LJ2A 2A06H 4PD4F 3I5DA 4WFHA 2VQFB 1N34O 1SQXH 4ICGA 1E79G 3BPZA 3LDCA 5GW7A 2BOBC 1V54B 2XT9A 1TVKA 5IYZA 1NQTA 3G67A 3K59A 2A9HA 2E5LB 4DR1O 1OCOB 4NXNO 4GKJO 4X64O 4WFAV 1E1RG 1OHHG 1VMGA 1N34B 4X1KB 1K97A 4PELA 2Q8VA 4UVBA 1HWYA 2E74B 2F4VO 2IJIA 4O4HA 2LQTA 3OM3B 2F93B 3WB0A 4KFMA 4I50A 1KECA 5IWAB 2XHBA 3JAWA 4I9QA 2Q9LA 4X64B 1YCIA 1X4TA 5TISZ 2IH3C 4MVMA 3K0GA 1IBKO 5J2TA 4X20A 3ZMSA 5JQGB 2W0FC 3RYHA 4LNUB 4ZIBA 1KB9F 4I55A 2Z3YA 1TUEB 1W0KG 1EN6A 4JZGA 2HJFC 3K5OA 1EBOA 2ADQB 5H5NA 3OMAB 3BABA 4PDRA 2P90A 1R3JC 1H2SB 2ZE6A 4Z2WA 4B3SO 4DV2O 1MA1A 4MVZA 3T2MA 3DC5A 1X59A 4B3RO 3ZHSA 4Q6GA 1NH2D 3UKMA 2WA3A 3W7XA 2B1GA 1QQCA 2A7WA 2JGDB 2JS5A 1R6NA 1KC8W 1H2GA 4EEQA 1N0JA 5KMGB 2LW1A 1ZLZA 3CCQV 1RPRA 5EYPB 1K92A 1FXKB 4I4TB 1OJHA 1PKXA 2DYSC 4GX2A 4PDMA 4JI6B 2EZOA 2DE0X 1M56B 2Y69B 1N32B 4O4IB 4LF4O 3ZHQA 3HB3B 3B77A 3HPLC 4FPPA 4IGGA 3MHSC 3N2GA 4HNAA 3P30A 1SZTA 5BXZA 1S76D 1V55C 5IYBO 5BR8O 4I9WA 5J2UB 3TETA 1RM1B 4HYOA 2PTMA 1US6A 1I7FA 4XDKA 3ZRXA 3P3NA 4JYAO 1BHBA 1V54C 4NTYA 3JD2A 3DC6A 3KCYA 3OEHG 4LF4B 3JD0A 4YJ2A 1B06A 1JX9A 4X8AA 1XMQO 1S5LZ 2Z5UA 2YIBA 4DUZO 1OCOC 1JFFB 4BIOA 4DK1A 5L3EA 1PD3A 2BTOA 3RN4A 5BR8B 5D5QA 1ROPA 1NU1H 1EZJA 3JATB 1AI7A 1MSWD 5KLVH 3CP1A 1I0HA 2Y0PA 1DGSA 2XASA 3JARB 1VF6A 1WA8B 1HNZB 4LFCO 2UU9O 2PZSA 3B8MA 2K1EA 1XMQB 3U11A 5JJNB 3GWKC 1NZ6A 3OR7C 3F5WC 1XNQO 3NXSA 3QG5A 1WJZA 3IJ4A 1MZFA 3H1JH 3T1CA 4DV1O 3CC4V 1TUBB 2GUZA 3T1HO 3WG7B 1I94O 4LH6A 4UFZA 5C93A 4K3AA 2ZIOA 2AZ2A 1N36O 1L0LH 3A0RA 2UU9B 3HKCB 3K5LA 3B2EE 4U3JB 4P9OA 5KHGA 2YSUB 1FXHA 2P5OA 4UV8A 1XNQB 5KX5A 3CD6V 4DV1B 3D3QA 5H6RA 4U3FH 4FLUA 3T1HB 1XOUA 3C3SA 5FL7G 1I94B 2BCCH 1R3KC 2BOCC 3FAVB 1N36B 3ZN0A 1VQLV 2RN9A 4LF9B 4O4JB 5K1XA 2UUAO 2OYQA 1K33A 3K9SA 1IXMA 3OTFA 1JCHA 4TV9B 2YICA 4CBCA 1PNMA 4JTAB 4MVQA 1SQFA 3ABLC 1FXKC 2HVKC 4JTDB 2BTQA 3OE7G 4UVCA 3JAKB 2P22C 3VQYA 1IX9A 3L9DA 4LF7O 1QCEA 2ILMA 4BW9A 2Q68A 1M56C 2Y69C 2IJHA 3CXCU 1G4YB 4F6RB 4FLVA 3RYIA 1K3EA 1WB7A 3APQA 1NT2B 3T4ZA 1NH2B 2WAMA 2LO1A 2WLIA 4CH4A 3AG4B 3APOA 5EIBD 4WFBV 1COWG 3UQ8A 3K08A 2VWJA 4OPAA 4FLWA 4H37A 2O57A 2XUMA 2JIZG 2V1DA 1AVMA 3I56V 2EILB 2OCCC 3QTCA 1Y66A 3L73H 3ZN1A 2HEPA 4YY3O 3THOA 2OWOA 2CTQA 4CH6A 2IM9A 3RYCA 4DR2O 4TV8B 3L74H 2EIMB 1IBLO 2HKOA 3BA8A 1KMIZ 3UT5A 4Z1MG 4PA4A 1BZKA 3OFNG 4AQYO 3KG2A 2ATKC 2UXBO 3J7AU 5DEDA 4CC5A 2R9RB 3WG7C 3JYCA 1FXVA 4YY3B 1Q6HA 1FFXB 5IJ0B 1R6KA 1K7DA 3KZIZ 5HFLA 1P7BA 1F7YA 4QPKA 2WSSG 1Q3EA 3F7YC 4DR2B 1N8RW 4W4KA 3CJHA 1IBLB 4J9ZB 3A8TA 4YHHO 2AXTZ 2RMKB 1Y76A 1OCRC 2XAFA 1Q7YW 2UXBB 2WLLB 1WP8A 2ZCEA 3CS5A 3WB2A 4BAYA 2XAQA 3SR2C 1S3JA 3G6EV 1LNQA 1ZAUA 1YVWA 4QNHB 1QR8A 3UM7A 3ZRWA 4O2AB 3J81N 2UXDB 2RCVA 1WPBA 4DV4B 1AJQA 3U10A 1VQMV 4PHZA 1E1QG 4JI5B 3HKEB 4DUYB 1ZL8B 5CA0B 3SJQC 5JJJB 5BMVB 4I0XA 3ML0A 5GTHZ 5JVDB 5LGNA 1EFRG 1K34A 3O65A 4B3TB 2DYRB 5C8YB 1Q5OA 4LBEC 1BL8A 4YIPA 1M1KW 5KAFZ 1FAFA 1R73A 3N2KB 3VQVA 3CE2A 3FB6C 1KYOF 2VQEO 1Q90D 1WLEA 5IDJA 1KP3A 5DECA 1H8HG 3LDDA 5CB4A 4WFFA 4JYBA 4JI2O 1P4RA 1WP7A 1JJOA 1UFIA 5B5EZ 2EBOA 1M57B 2CE4A 2P6JA 1CEZA
chains in the Genus database with same CATH topology
5BY1A 4JI7O 3OTOO 4JI3O 4DV5O 1XMOO 4DV3O 4LF8O 1FYJA 2F4VO 4AQYO 5BXZA 2ZKOA 2UXBO 3J7AU 5BR8O 4LF9O 5LMNO 5IWAO 4DR5O 3RT3C 2UUAO 1XEQA 2UUBO 4JYAO 1F7YA 5LMUO 4B3MO 5FLXN 1N33O 3T1YO 3M8AA 1A32A 4K0KO 4LFBO 1FJGO 2Z0AA 1XMQO 4LFAO 1IBKO 1HR0O 4YHHO 4DR3O 2DJVA 5IT9N 4LF7O 2FKXA 4DUZO 4NXMO 1AB3A 2AGAA 1HNWO 2UXCO 2UUCO 2VQFO 4LF5O 4JI1O 5A2QN 1HNXO 4KHPO 4DR4O 1D2DA 3SDLA 4DR7O 1KUQA 3JAMN 1HNZO 2HHHO 4JI0O 1NS1A 5H5NA 1R1BA 3J80N 4LFCO 2UXDO 1DK1A 3J81N 1FKAO 4DV4O 2UU9O 1J5EO 4JV5O 4JI5O 4DUYO 2DOSA 4DV2O 4B3SO 3F5TA 4OPAA 2JRIA 2E5LO 1X59A 2ZM6O 4B3RO 1YZBA 1XNQO 4B3TO 4DV1O 4A5UB 4JI8O 3T1HO 3O65A 2LW7A 2N74A 1N34O 1I94O 4X65O 4DV0O 1N36O 1R6TA 3R66A 5LL6Y 4OX9O 1G1XB 2VQEO 4OPHA 4LF6O 1XNRO 4YY3O 4DR6O 4JI4O 1AILA 1IBMO 4JI6O 4GKKO 4DR1O 4JI2O 4DR2O 4NXNO 4GKJO 4X64O 1N32O 4X62O 4DV6O 4DV7O 1IBLO 4LF4O 4X66O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BY1 A;  4JI7 O;  3OTO O;  4JI3 O;  4DV5 O;  1XMO O;  4DV3 O;  4LF8 O;  1FYJ A;  2F4V O;  4AQY O;  5BXZ A;  2ZKO A;  2UXB O;  3J7A U;  5BR8 O;  4LF9 O;  5LMN O;  5IWA O;  4DR5 O;  3RT3 C;  2UUA O;  1XEQ A;  2UUB O;  4JYA O;  1F7Y A;  5LMU O;  4B3M O;  5FLX N;  1N33 O;  3T1Y O;  3M8A A;  1A32 A;  4K0K O;  4LFB O;  1FJG O;  2Z0A A;  1XMQ O;  4LFA O;  1IBK O;  1HR0 O;  4YHH O;  4DR3 O;  2DJV A;  5IT9 N;  4LF7 O;  2FKX A;  4DUZ O;  4NXM O;  1AB3 A;  2AGA A;  1HNW O;  2UXC O;  2UUC O;  2VQF O;  4LF5 O;  4JI1 O;  5A2Q N;  1HNX O;  4KHP O;  4DR4 O;  1D2D A;  3SDL A;  4DR7 O;  1KUQ A;  3JAM N;  1HNZ O;  2HHH O;  4JI0 O;  1NS1 A;  5H5N A;  1R1B A;  3J80 N;  4LFC O;  2UXD O;  1DK1 A;  3J81 N;  1FKA O;  4DV4 O;  2UU9 O;  1J5E O;  4JV5 O;  4JI5 O;  4DUY O;  2DOS A;  4DV2 O;  4B3S O;  3F5T A;  4OPA A;  2JRI A;  2E5L O;  1X59 A;  2ZM6 O;  4B3R O;  1YZB A;  1XNQ O;  4B3T O;  4DV1 O;  4A5U B;  4JI8 O;  3T1H O;  3O65 A;  2LW7 A;  2N74 A;  1N34 O;  1I94 O;  4X65 O;  4DV0 O;  1N36 O;  1R6T A;  3R66 A;  5LL6 Y;  4OX9 O;  1G1X B;  2VQE O;  4OPH A;  4LF6 O;  1XNR O;  4YY3 O;  4DR6 O;  4JI4 O;  1AIL A;  1IBM O;  4JI6 O;  4GKK O;  4DR1 O;  4JI2 O;  4DR2 O;  4NXN O;  4GKJ O;  4X64 O;  1N32 O;  4X62 O;  4DV6 O;  4DV7 O;  1IBL O;  4LF4 O;  4X66 O; 
#chains in the Genus database with same CATH topology
 1WB8 A;  5BY1 A;  3H01 A;  2E76 B;  3IFX A;  2QR4 A;  2EZP A;  4PDV A;  1JR9 A;  1KD1 W;  1GM9 A;  2V4D A;  5EBW C;  1XHZ A;  4PA6 A;  3CHX A;  4W4L A;  2EIL C;  1XEQ A;  2EIJ B;  5FPR A;  3WB1 A;  5LMU B;  3LUT B;  4B3M O;  4X1I A;  1G8M A;  4IIJ B;  5H2F Z;  4NYK A;  4X88 A;  1OZ0 A;  4X1Y B;  4LFA O;  3OAA G;  1HR0 O;  1OCC B;  2DJV A;  4UCU A;  2AGA A;  3S3W A;  3MDS A;  1W0J G;  3CME V;  2EIM C;  5GON B;  3ZS8 C;  4EB6 A;  3E8H A;  4FLX A;  2QTO A;  4C7U A;  2YC0 A;  4DR4 O;  4TSF G;  3H1I H;  1HNX B;  5EK0 A;  1S72 V;  3OUF A;  3CRR A;  1YJN V;  4XDL A;  1WN7 A;  3RVY A;  3FB5 C;  1GTO A;  1VEW A;  4LFA B;  4BR6 A;  2R70 A;  5CBF A;  1K8A W;  1HR0 B;  1AI4 A;  3GB7 C;  4FIP C;  3M99 B;  4OXS A;  1HW7 A;  4RAI A;  1MOF A;  3RW0 A;  5KHI A;  3SYO A;  3W7S A;  2IH1 C;  1ZWI C;  2CGN A;  4H33 A;  4DV0 B;  4WFG A;  1QVG U;  1KU9 A;  1SS3 A;  4MW3 A;  3U0Z A;  1KKD A;  4X1K A;  3T4D A;  3TXQ A;  5D5P A;  2GV9 A;  1VQO V;  5IY5 B;  2E3C A;  2BE3 A;  2AW9 A;  4GKK B;  1NVP D;  4FLY A;  1M9N A;  2CGO A;  3WU2 Z;  4JPR A;  3OGC C;  4X66 B;  2XTA A;  4CH3 A;  4JI7 O;  1NR1 A;  4NTX A;  3ZHT A;  4DV5 B;  1XMO B;  4MTG A;  4HBN A;  3AK2 A;  2JJ2 G;  2DYR C;  5L3G A;  5IWA O;  4XDJ A;  5JQG A;  4UVA A;  1R3L C;  4LNU A;  1SKV A;  2Q69 A;  1VQP V;  2HG5 C;  1QBZ A;  3CYO A;  1B3Q A;  1Q81 W;  1Y74 B;  1FJG O;  4K0K B;  3G4S V;  3JSL A;  4PI0 A;  4JI7 B;  2QDO A;  3OUS A;  4DR3 B;  3BEH A;  1PPJ H;  5E1A C;  2EIN B;  3AG7 A;  4CH5 A;  2G38 A;  2UUC O;  1YXB A;  3BAA A;  4OGQ B;  1NTK H;  5B1O A;  4QIW F;  2UXN A;  5CBH A;  2QM7 A;  1IZ3 A;  3OT7 A;  4JI0 B;  4PA9 A;  2JGD A;  4MSW C;  2L6L A;  3K5M A;  4HZ3 A;  4L87 A;  1FJG B;  2ARH A;  2FTK A;  5KMG A;  2EIJ C;  5EYP A;  2ZQM A;  1YZB A;  2P06 A;  3JD4 A;  4Z1V A;  1FXK A;  4I4T A;  1PM9 A;  3W7U A;  2UUC B;  3MAQ A;  1OCC C;  4JI8 B;  3VQW A;  1ZSP A;  3N27 A;  2QWN B;  3JAS B;  1BGY H;  1EM1 A;  4O4I A;  5EBM C;  1DF5 A;  2W6J G;  3QNE A;  2QJ1 A;  3B8N A;  4RUE A;  3Q4H B;  2D3O W;  3GVM A;  4JI6 O;  2NN4 A;  1SF9 A;  4FZ0 A;  3E8G A;  1F51 A;  1Q6I A;  3HR0 A;  5J2U A;  1SRY A;  1N32 O;  1PL4 A;  2ITD C;  1JMK C;  5EZY B;  5LHH A;  1VQ9 V;  3RYF A;  5B1B B;  2OIE A;  4DV7 B;  4O4L B;  3BHP A;  4GYC B;  2WA4 A;  3JCZ A;  4WBN B;  3VOU A;  5B3S B;  3CCL V;  5CA1 B;  4PJ0 Z;  2VS0 A;  1S0V A;  2PYJ A;  5LMN B;  1JFF A;  3ZED A;  4GZR B;  4AI8 A;  2F66 C;  1YJW V;  1I08 A;  5DN6 G;  2AZ0 A;  4AIL C;  2ZDI A;  3JAT A;  4J7Z A;  4AHC A;  3T1Y B;  2WWW A;  3AG1 C;  5IY5 C;  3JAR A;  1WA8 A;  1P84 F;  2P4V A;  2HP8 A;  4FFK A;  1H38 A;  1ZTE A;  4JAA A;  3QO5 A;  4QE9 A;  3CCJ V;  1SQB H;  1GRJ A;  4JTC B;  2GTS A;  4NKG B;  1CP9 A;  3RYF B;  3OR6 C;  4GX5 A;  1KKC A;  3H9V A;  4G28 B;  1T5E A;  2KB1 A;  1HNZ O;  3CSX A;  5H6Q A;  1TUB A;  2B1I A;  2Y4U A;  3ZRV A;  3K58 A;  2QM8 A;  1J5E O;  3ICX A;  3FKS G;  3LNM B;  3K9A A;  3FB7 C;  1BS3 A;  1PNL A;  3EHB B;  1S77 D;  3K3W A;  3HKC A;  3H1K H;  1SA0 B;  1AJP A;  1CXZ B;  1GK9 A;  1GM7 A;  4DW1 A;  1MSD A;  2ZM6 B;  1Z2G A;  4U3J A;  2QWR B;  3NR7 A;  2X7R B;  1SZX A;  2CK3 G;  4P2Z A;  1SQG A;  5JH7 A;  2EIN C;  5LL6 Y;  3DXR A;  3ZBH A;  2HJD A;  3ZIA G;  3MD0 A;  1J5E B;  1THZ A;  3FAV A;  3ZCC A;  3HKB B;  3G71 V;  1SC5 B;  4G27 B;  5KAI Z;  4B7K A;  1BCC H;  2IJK A;  4NR1 A;  1VF5 B;  4J11 A;  4O4J A;  4JAV A;  4P9P A;  4I7Z B;  2LFS A;  3K5N A;  1TAE A;  3ETQ A;  5LHI A;  4TV9 A;  2HVJ C;  2M7W A;  3JAK A;  4LF9 O;  1Q6U A;  3S3X A;  4MVS A;  2QTS A;  4DR5 O;  1F4N A;  1JPX A;  2A79 B;  3BA9 A;  2PGG A;  4DRX B;  2PUS A;  5JH7 B;  2FML A;  4F6R A;  4X89 A;  3DXR B;  3FD9 A;  1Q8I A;  3M8A A;  3RFR A;  4X9Q A;  2JDI G;  4ASU G;  3E2E A;  3SPC A;  1AB3 A;  1SQV H;  1L8D A;  4K35 A;  5B1A B;  4MT8 A;  2KG7 B;  1D5A A;  3I55 V;  1VAR A;  4P30 A;  4DR5 B;  3K79 A;  4KHP O;  3FYI B;  1NTZ H;  3CCS V;  1FPO A;  2Q7G A;  2QKC A;  3HKD B;  3TJT A;  3H1L H;  3CCU V;  3H1H H;  4TT3 G;  1RPO A;  1IDS A;  2CTP A;  4XBF A;  2VRZ A;  3ZHR A;  4R7C A;  4YIO A;  3X2Q B;  2KSD A;  2Q67 A;  5E79 Z;  1NR7 A;  4KHP B;  4CS4 A;  1Z5W A;  4TV8 A;  4IT5 A;  3CCV V;  5IYC O;  3E83 A;  1RM1 C;  3W7T A;  3D36 A;  3STL C;  2H3O A;  3CRA A;  3JAL B;  1H8E G;  2KKW A;  4ZI7 B;  1AIL A;  3TGU H;  4ZOL B;  2M6Y A;  1MAB G;  4FJC C;  1VQK V;  3A2F A;  2B9Z A;  1FFX A;  5IJ0 A;  3IGA C;  2B5U A;  2ZR2 A;  3ZHU A;  2CTW A;  3ABU A;  3PN1 A;  4LP8 A;  2IJJ A;  4FLT A;  5ITZ B;  2QWQ B;  2JEU A;  2ZDI C;  4ABM A;  1NKD A;  2RJZ A;  4IYH A;  5KA5 A;  3SPH A;  2YDE A;  3UCS C;  2R9I A;  1QLN A;  2UUB B;  1BHA A;  2WLL A;  1Q43 A;  1Z5V A;  1KP2 A;  1N33 B;  4LFB O;  4FM1 A;  3ASN B;  2ZE7 A;  3BCC H;  3E89 A;  4O2A A;  5L3C A;  4NXM O;  1LR1 A;  2C2A A;  1XQ8 A;  3FB8 C;  5KHK A;  3HKE A;  2Q0A A;  1ZL8 A;  3DGE A;  5CA0 A;  2X6C A;  5HFM A;  4LC1 A;  5BMV A;  5JVD A;  4FFB B;  1VQ4 V;  2XOK G;  4H44 B;  4B08 A;  2UXD O;  5C8Y A;  2PY5 A;  4DV4 O;  4EKW A;  4F4L A;  5K1P A;  4JI5 O;  3OGI B;  4LFB B;  1M93 A;  3L75 H;  4UB6 Z;  4DUY O;  2GHY A;  3N2K A;  3LDE A;  4NVP A;  2YXH A;  3BRC A;  4NXM B;  2BSK B;  3FYE B;  4KXR A;  3RGB A;  4B3T O;  1YDX A;  1AI5 A;  2OCH A;  4PDL A;  1GN2 A;  3CC2 V;  3E22 A;  5EC1 C;  2IU0 A;  2ZE5 A;  2WLJ A;  1UPG A;  3DSQ A;  2ETN A;  1BT8 A;  2ZXW B;  4FMT A;  4JYY A;  4DO2 A;  4U7O A;  1VP7 A;  2KQX A;  1V9P A;  4JI4 O;  1IBM O;  1MG1 A;  4DR6 B;  1ZUQ A;  2JVD A;  4KUM A;  4MTX A;  4TUY B;  2Y4T A;  3EFF K;  4GX1 A;  4N21 A;  1GO3 F;  2QSA A;  5EBL C;  1XIL A;  3ABM B;  3ZMV A;  1VQ5 V;  4JI3 O;  4JYC A;  3F7V C;  2WLH A;  4IIJ A;  2RDC A;  2XAH A;  3X2Q C;  4X1Y A;  5JCO C;  2CTR A;  4RO2 A;  1G6U A;  2ZIN A;  4JI4 B;  1IBM B;  5EC2 C;  5GON A;  2ZE8 A;  5LMU O;  3AG4 C;  5H9C A;  5FLX N;  5LOV B;  1A32 A;  4J7J A;  2Z0A A;  4K8X A;  4PI2 A;  4JI3 B;  1KBH A;  1F23 A;  2QKA A;  4MTO A;  2EUL A;  2OIG A;  2Q5Z A;  2UXC B;  2EIK B;  1HNX O;  1Q86 W;  4LF5 B;  3J80 N;  4TOI A;  4L8J A;  3CB2 A;  3CRQ A;  3K06 A;  4B7E A;  1VIB A;  4QPJ A;  1YSC A;  4J7K A;  4EFB A;  1B6Q A;  4PA7 A;  1BSM A;  4YJ3 B;  1YTF D;  2DMX A;  4DXW A;  3D36 C;  1BE3 H;  2FB5 A;  1RFY A;  2N74 A;  1NBM G;  3ASN C;  4DV0 O;  4X65 B;  1K9M W;  3SPI A;  1SET A;  4FZ1 A;  1F4M A;  3JD3 A;  2F23 A;  4GT1 A;  2Y48 A;  1YEW A;  1DTO A;  5KHH A;  3P32 A;  4GKK O;  2N05 A;  2CH7 B;  5LXT B;  1D5N A;  2N04 A;  3SJC C;  1PV0 A;  4HAM A;  4CZZ A;  4X62 B;  4X66 O;  2QE7 G;  3OTO O;  5LYJ A;  4DV5 O;  1XMO O;  1VQ6 V;  3IC7 A;  2ADP A;  1QU7 A;  4DV3 B;  1AI6 A;  1Y74 A;  4FK5 C;  5FNV B;  4JZ2 A;  1YIT V;  3JD1 A;  1RP3 B;  3KKY A;  4BW5 A;  1GN4 A;  1NI8 A;  2YEV B;  4GLX A;  3LSU A;  5GTI Z;  1MMM A;  1S5H C;  3LSQ A;  4QJF B;  1YJ9 V;  3AK1 A;  3RVZ A;  4K0K O;  5LGT A;  2PYL A;  4DR3 O;  5CA3 A;  4ZHQ B;  1LUV A;  4NTW A;  3OTO B;  1AR4 A;  3CC7 V;  2FKX A;  1K5S A;  2DN9 A;  2Q0O C;  2X6B A;  1R3I C;  1HNW O;  1ORQ C;  1K73 W;  2CAZ C;  3ABM C;  4GCZ A;  1V55 B;  4JI1 B;  2YID A;  1KUQ A;  4J9Y B;  4JI0 O;  5LYJ B;  4DR7 B;  2HHH B;  3E8B A;  2Y0I A;  1FKA O;  4WFE A;  3JAS A;  3GWO A;  2ITC C;  3E8F A;  2MK3 A;  3L72 H;  2F43 G;  1M4U A;  3W7W A;  4O2B B;  3E35 A;  2DWD C;  1LUW A;  1M57 C;  4FM0 A;  4UCO A;  3OEE G;  3Q4H A;  2JGU A;  1HNW B;  4JI8 O;  2YIB D;  1RSO B;  1L1F A;  2LW7 A;  4RUF A;  4CC6 A;  3B09 A;  4MS2 A;  3SYA A;  4IHJ B;  5A9G A;  3R66 A;  2RNB A;  5EZY A;  5LP6 B;  4LR3 A;  4O4L A;  1VF7 A;  4R50 A;  3AK3 A;  4LF6 O;  4JAS A;  2EIK C;  5LA6 A;  4WBN A;  1FS0 G;  4EFE A;  5IYD O;  2Q7E A;  2A0L A;  5CA1 A;  4G2K A;  1XL6 A;  4DR1 B;  3ZMU A;  4DV7 O;  4NXN B;  4GKJ B;  1TVK B;  1JJ2 U;  2ZD9 A;  5EIB C;  2PF4 E;  5F2V O;  5IYZ B;  4J10 A;  2FL4 A;  2ZT9 B;  4Q20 A;  2E75 B;  2F4V B;  2X0L A;  4LF6 B;  1ENV A;  5LMN O;  3CWB H;  1GH6 A;  4RQF A;  4LH7 A;  4WF9 V;  1URF A;  3G80 A;  3OMN B;  5L3B A;  3T1Y O;  1P7G A;  2Q7H A;  2L35 A;  1AP5 A;  4O4H B;  4DYL A;  2YXL A;  2W6I G;  1IBK B;  1MZE A;  5LA6 B;  2PI4 A;  4I50 B;  3ZX6 A;  1DLB A;  3JAW B;  2NR5 A;  2QWO B;  5IJ9 A;  1SER A;  5CBG A;  4FVM A;  4RQE A;  4UCR A;  4H13 B;  1SA0 A;  1D2D A;  3SDL A;  3K57 A;  1GAX A;  2ODM A;  1DF4 A;  1YTF B;  5J2T B;  4X20 B;  4D7T A;  2JS3 A;  4R8C A;  3RYH B;  4I55 B;  2DOS A;  1QR9 A;  3QO7 A;  2ZNI A;  1WPX A;  2ZIM A;  3ABL B;  4B3S B;  4DV2 B;  4UCS A;  2HLD G;  3AG2 B;  1XL4 A;  2ZM6 O;  2QA4 V;  4B3R B;  3L71 H;  4QE7 A;  3HKB A;  4GX0 A;  1XHX A;  2H8P C;  2AHZ A;  1SES A;  5CN0 A;  4OPH A;  2GDS A;  3BY6 A;  1EN4 A;  3SPG A;  5IJ9 B;  5B66 Z;  1XI1 A;  3CCE V;  1AJN A;  1EN5 A;  3R65 A;  4QGP A;  3RWR D;  2YS8 A;  2WLN A;  1GN6 A;  3C90 A;  3SJB C;  3MHH C;  1NVP B;  3AEI A;  4DRX A;  1CPY A;  2HR3 A;  3CCM V;  1N0N A;  1FYJ A;  2ZKO A;  3SPJ A;  1YHQ V;  2OCC B;  1PL0 A;  2CUG A;  3ZMT A;  3ETG A;  5LP6 C;  3SYC A;  2KG7 A;  4R6Z A;  4JYA B;  3N2G B;  4HNA B;  2QEX V;  1AP6 A;  3EVK A;  4BIU A;  3HKD A;  2QM4 A;  1NTM H;  3SYP A;  2P4K A;  4CS2 A;  4DUZ B;  3EXA A;  3ETD A;  1IUR A;  1YIJ V;  3CMA V;  3CRC A;  2GBO A;  3A0H Z;  4F6E A;  1M5I A;  1H2N A;  4YJ2 B;  4JGS A;  1BMF G;  1J95 A;  2JK5 C;  2P67 A;  3TK1 A;  2YUA A;  5JCO A;  4KP4 A;  2YXY A;  3WFV A;  1DK1 A;  1BQ0 A;  2ZNJ A;  4LFC B;  3OW2 U;  2Q6A A;  1U97 A;  2YI9 A;  2JJ1 G;  1OCZ B;  4CS3 A;  4U7N A;  3ABK B;  3JAL A;  1PP9 H;  5B1B C;  1QLE B;  2UXX A;  4ZI7 A;  2GSM B;  1OV9 A;  3DTU B;  1OCR B;  4ZOL A;  2DQ0 A;  3O9O A;  1VQ7 V;  2XAJ A;  5B3S C;  1W2B U;  2DWE C;  2NNU A;  5L3D A;  1QHT A;  2EJ7 A;  1QNM A;  4I5S A;  4BIZ A;  1XBL A;  2NLJ C;  1XNR O;  2AHY A;  1AR1 B;  3K03 A;  1GKF A;  1H2L A;  1TA8 A;  2GUZ B;  5ITZ A;  1H2M A;  3K0D A;  3LSS A;  2F95 B;  1XDC A;  1Y67 A;  4DV6 O;  1Q82 W;  2XND G;  3JSN A;  1ZX3 A;  5KA6 A;  3AG2 C;  4LF8 O;  1FFT B;  2QGN A;  2YIA A;  3BVO A;  3ABT A;  1XNR B;  3RBZ A;  5KX5 B;  4NB5 A;  2UUA B;  1NJI W;  2UUB O;  4D7S A;  1I5Y A;  4DV6 B;  1N33 O;  4BWA A;  4FFB A;  4UCV A;  3LNN A;  1JA8 A;  4LF8 B;  4LF7 B;  1P49 A;  1I5X A;  3IC9 A;  1JQ0 A;  1YF2 A;  3ETE A;  3QF7 A;  3CX5 F;  5A2Q N;  1XUQ A;  2BSK A;  5BZB A;  3JAM N;  2BTQ B;  2EX3 A;  1HP8 A;  3C3T A;  1IVS A;  2WPD G;  5LHG A;  4JV5 O;  2CDY A;  3A0B Z;  2JRI A;  2QWP B;  2PI5 A;  2WLM A;  4ZBM A;  3RYI B;  3FFQ A;  3FX7 A;  2W0X A;  2WLI B;  3D3I A;  3BFR A;  3UO3 A;  5DM6 V;  1YI2 V;  5B1N A;  3AG3 B;  4TQF A;  4TUY A;  1R6T A;  3QVN A;  1G1X B;  3G6B A;  1GM8 A;  1K4D C;  1Y6X A;  2QKS A;  5FPO A;  1N4C A;  4DW0 A;  4JV5 B;  2Q4P A;  4UV9 A;  4LWS A;  4DR6 O;  4UCT A;  1HDJ A;  3P3P A;  4MVR A;  5KUK A;  3ASO B;  2A3Q A;  4MVU A;  2IW5 A;  1O9G A;  1OCZ C;  5B1A C;  2OTJ V;  3ABK C;  5KUM A;  4GUN A;  2EJR A;  3VQX A;  5LOV A;  1QLE C;  4FLZ A;  3ZRS A;  3QO8 A;  2V7Q G;  4PA3 A;  3RYC B;  4J80 A;  4AQY B;  1VF6 C;  3L70 H;  1AR5 A;  4N23 A;  5J9P C;  2D2C B;  1WAZ A;  3UT5 B;  3VBB A;  5AG2 A;  4IYI A;  2VWK A;  1FD9 A;  2P7T C;  3OMI B;  2FYU H;  3IAY A;  3STZ C;  1ARO P;  2RQ6 A;  2LGW A;  1Y4M A;  1M90 W;  4ZKI A;  4LWS B;  5IT9 N;  4YHH B;  1EZV H;  3TCU A;  5L3F A;  1GN3 A;  2R9A A;  1TGO A;  2WLK A;  3E22 B;  4UXN A;  2UXC O;  3B40 A;  4LF5 O;  2DW4 A;  3CJH B;  3CPW U;  5IE9 A;  4UB8 Z;  3SYQ A;  4YJ3 A;  4D6T H;  2R72 A;  1NS1 A;  3KCX A;  2X6A A;  1Y76 B;  1S5J A;  3F5T A;  4JAU A;  2JEX A;  3ZJZ A;  1SQP H;  1SQQ H;  5KHJ A;  4E2L A;  2YI8 A;  1O9H A;  4A5U B;  2MW2 B;  3D8C A;  3ZRW B;  5JJE B;  1JOY A;  1XRE A;  1UJW B;  2DQ3 A;  4X65 O;  2CH7 A;  5LXT A;  2K9P A;  4J41 A;  3K04 A;  5LBQ A;  4H0L B;  4OX9 O;  1IXB A;  4JF3 A;  3CXH F;  2VQE B;  4I0X B;  1MNG A;  4E4E A;  5FNV A;  3JCU Z;  4MW8 A;  3SGI A;  4JI2 B;  4X62 O;  4UUJ C;  1VQ8 V;  4LCU C;  2YEV A;  3B4S A;  5LGU A;  2ZR3 A;  3UO2 A;  4TWK A;  1H2K A;  2IBZ H;  4DV3 O;  2LGQ A;  1W59 A;  2F1M A;  5CB4 B;  2XAG A;  4OX9 B;  1WNS A;  3TXS A;  3PJS K;  4YXW G;  4ZHQ A;  4J42 A;  3AG3 C;  3RT3 C;  1B04 A;  3CCR V;  2LFR A;  1PNK A;  2H94 A;  1QVF U;  4WCE V;  3M7M X;  4MTF A;  1K5Q A;  4B3M B;  2Q73 A;  4TQD A;  3OD4 A;  3CEI A;  5CMU A;  1U96 A;  2HFE C;  2LP7 A;  5JWP A;  4RWU A;  3ASO C;  4PV1 B;  2OTL V;  1JVM A;  4O2B A;  2VQF O;  1KQS U;  4JI1 O;  4IL6 Z;  4K8Z A;  4X1I B;  3CRM A;  4MVO A;  1BQZ A;  3ZMZ A;  1VQN V;  4DR7 O;  2DYS B;  4DR4 B;  2HHH O;  1R1B A;  1RSO A;  2ZXW C;  4DK0 A;  1L0N H;  2OT5 A;  4KL1 A;  3E86 A;  3SJA C;  4IHJ A;  3ZHV A;  4EB6 B;  2IU3 A;  4FM2 A;  5LP6 A;  2E5L O;  3AG1 B;  2GTA A;  1K4C C;  1GMG A;  2LJ2 A;  2A06 H;  4PD4 F;  3I5D A;  4WFH A;  2VQF B;  1N34 O;  1SQX H;  4ICG A;  1E79 G;  3BPZ A;  3LDC A;  5GW7 A;  2BOB C;  1V54 B;  2XT9 A;  1TVK A;  5IYZ A;  1NQT A;  3G67 A;  3K59 A;  2A9H A;  2E5L B;  4DR1 O;  1OCO B;  4NXN O;  4GKJ O;  4X64 O;  4WFA V;  1E1R G;  1OHH G;  1VMG A;  1N34 B;  4X1K B;  1K97 A;  4PEL A;  2Q8V A;  4UVB A;  1HWY A;  2E74 B;  2F4V O;  2IJI A;  4O4H A;  2LQT A;  3OM3 B;  2F93 B;  3WB0 A;  4KFM A;  4I50 A;  1KEC A;  5IWA B;  2XHB A;  3JAW A;  4I9Q A;  2Q9L A;  4X64 B;  1YCI A;  1X4T A;  5TIS Z;  2IH3 C;  4MVM A;  3K0G A;  1IBK O;  5J2T A;  4X20 A;  3ZMS A;  5JQG B;  2W0F C;  3RYH A;  4LNU B;  4ZIB A;  1KB9 F;  4I55 A;  2Z3Y A;  1TUE B;  1W0K G;  1EN6 A;  4JZG A;  2HJF C;  3K5O A;  1EBO A;  2ADQ B;  5H5N A;  3OMA B;  3BAB A;  4PDR A;  2P90 A;  1R3J C;  1H2S B;  2ZE6 A;  4Z2W A;  4B3S O;  4DV2 O;  1MA1 A;  4MVZ A;  3T2M A;  3DC5 A;  1X59 A;  4B3R O;  3ZHS A;  4Q6G A;  1NH2 D;  3UKM A;  2WA3 A;  3W7X A;  2B1G A;  1QQC A;  2A7W A;  2JGD B;  2JS5 A;  1R6N A;  1KC8 W;  1H2G A;  4EEQ A;  1N0J A;  5KMG B;  2LW1 A;  1ZLZ A;  3CCQ V;  1RPR A;  5EYP B;  1K92 A;  1FXK B;  4I4T B;  1OJH A;  1PKX A;  2DYS C;  4GX2 A;  4PDM A;  4JI6 B;  2EZO A;  2DE0 X;  1M56 B;  2Y69 B;  1N32 B;  4O4I B;  4LF4 O;  3ZHQ A;  3HB3 B;  3B77 A;  3HPL C;  4FPP A;  4IGG A;  3MHS C;  3N2G A;  4HNA A;  3P30 A;  1SZT A;  5BXZ A;  1S76 D;  1V55 C;  5IYB O;  5BR8 O;  4I9W A;  5J2U B;  3TET A;  1RM1 B;  4HYO A;  2PTM A;  1US6 A;  1I7F A;  4XDK A;  3ZRX A;  3P3N A;  4JYA O;  1BHB A;  1V54 C;  4NTY A;  3JD2 A;  3DC6 A;  3KCY A;  3OEH G;  4LF4 B;  3JD0 A;  4YJ2 A;  1B06 A;  1JX9 A;  4X8A A;  1XMQ O;  1S5L Z;  2Z5U A;  2YIB A;  4DUZ O;  1OCO C;  1JFF B;  4BIO A;  4DK1 A;  5L3E A;  1PD3 A;  2BTO A;  3RN4 A;  5BR8 B;  5D5Q A;  1ROP A;  1NU1 H;  1EZJ A;  3JAT B;  1AI7 A;  1MSW D;  5KLV H;  3CP1 A;  1I0H A;  2Y0P A;  1DGS A;  2XAS A;  3JAR B;  1VF6 A;  1WA8 B;  1HNZ B;  4LFC O;  2UU9 O;  2PZS A;  3B8M A;  2K1E A;  1XMQ B;  3U11 A;  5JJN B;  3GWK C;  1NZ6 A;  3OR7 C;  3F5W C;  1XNQ O;  3NXS A;  3QG5 A;  1WJZ A;  3IJ4 A;  1MZF A;  3H1J H;  3T1C A;  4DV1 O;  3CC4 V;  1TUB B;  2GUZ A;  3T1H O;  3WG7 B;  1I94 O;  4LH6 A;  4UFZ A;  5C93 A;  4K3A A;  2ZIO A;  2AZ2 A;  1N36 O;  1L0L H;  3A0R A;  2UU9 B;  3HKC B;  3K5L A;  3B2E E;  4U3J B;  4P9O A;  5KHG A;  2YSU B;  1FXH A;  2P5O A;  4UV8 A;  1XNQ B;  5KX5 A;  3CD6 V;  4DV1 B;  3D3Q A;  5H6R A;  4U3F H;  4FLU A;  3T1H B;  1XOU A;  3C3S A;  5FL7 G;  1I94 B;  2BCC H;  1R3K C;  2BOC C;  3FAV B;  1N36 B;  3ZN0 A;  1VQL V;  2RN9 A;  4LF9 B;  4O4J B;  5K1X A;  2UUA O;  2OYQ A;  1K33 A;  3K9S A;  1IXM A;  3OTF A;  1JCH A;  4TV9 B;  2YIC A;  4CBC A;  1PNM A;  4JTA B;  4MVQ A;  1SQF A;  3ABL C;  1FXK C;  2HVK C;  4JTD B;  2BTQ A;  3OE7 G;  4UVC A;  3JAK B;  2P22 C;  3VQY A;  1IX9 A;  3L9D A;  4LF7 O;  1QCE A;  2ILM A;  4BW9 A;  2Q68 A;  1M56 C;  2Y69 C;  2IJH A;  3CXC U;  1G4Y B;  4F6R B;  4FLV A;  3RYI A;  1K3E A;  1WB7 A;  3APQ A;  1NT2 B;  3T4Z A;  1NH2 B;  2WAM A;  2LO1 A;  2WLI A;  4CH4 A;  3AG4 B;  3APO A;  5EIB D;  4WFB V;  1COW G;  3UQ8 A;  3K08 A;  2VWJ A;  4OPA A;  4FLW A;  4H37 A;  2O57 A;  2XUM A;  2JIZ G;  2V1D A;  1AVM A;  3I56 V;  2EIL B;  2OCC C;  3QTC A;  1Y66 A;  3L73 H;  3ZN1 A;  2HEP A;  4YY3 O;  3THO A;  2OWO A;  2CTQ A;  4CH6 A;  2IM9 A;  3RYC A;  4DR2 O;  4TV8 B;  3L74 H;  2EIM B;  1IBL O;  2HKO A;  3BA8 A;  1KMI Z;  3UT5 A;  4Z1M G;  4PA4 A;  1BZK A;  3OFN G;  4AQY O;  3KG2 A;  2ATK C;  2UXB O;  3J7A U;  5DED A;  4CC5 A;  2R9R B;  3WG7 C;  3JYC A;  1FXV A;  4YY3 B;  1Q6H A;  1FFX B;  5IJ0 B;  1R6K A;  1K7D A;  3KZI Z;  5HFL A;  1P7B A;  1F7Y A;  4QPK A;  2WSS G;  1Q3E A;  3F7Y C;  4DR2 B;  1N8R W;  4W4K A;  3CJH A;  1IBL B;  4J9Z B;  3A8T A;  4YHH O;  2AXT Z;  2RMK B;  1Y76 A;  1OCR C;  2XAF A;  1Q7Y W;  2UXB B;  2WLL B;  1WP8 A;  2ZCE A;  3CS5 A;  3WB2 A;  4BAY A;  2XAQ A;  3SR2 C;  1S3J A;  3G6E V;  1LNQ A;  1ZAU A;  1YVW A;  4QNH B;  1QR8 A;  3UM7 A;  3ZRW A;  4O2A B;  3J81 N;  2UXD B;  2RCV A;  1WPB A;  4DV4 B;  1AJQ A;  3U10 A;  1VQM V;  4PHZ A;  1E1Q G;  4JI5 B;  3HKE B;  4DUY B;  1ZL8 B;  5CA0 B;  3SJQ C;  5JJJ B;  5BMV B;  4I0X A;  3ML0 A;  5GTH Z;  5JVD B;  5LGN A;  1EFR G;  1K34 A;  3O65 A;  4B3T B;  2DYR B;  5C8Y B;  1Q5O A;  4LBE C;  1BL8 A;  4YIP A;  1M1K W;  5KAF Z;  1FAF A;  1R73 A;  3N2K B;  3VQV A;  3CE2 A;  3FB6 C;  1KYO F;  2VQE O;  1Q90 D;  1WLE A;  5IDJ A;  1KP3 A;  5DEC A;  1H8H G;  3LDD A;  5CB4 A;  4WFF A;  4JYB A;  4JI2 O;  1P4R A;  1WP7 A;  1JJO A;  1UFI A;  5B5E Z;  2EBO A;  1M57 B;  2CE4 A;  2P6J A;  1CEZ A; 
#chains in the Genus database with same CATH homology
 5BY1 A;  4JI7 O;  3OTO O;  4JI3 O;  4DV5 O;  1XMO O;  4DV3 O;  4LF8 O;  1FYJ A;  2F4V O;  4AQY O;  5BXZ A;  2ZKO A;  2UXB O;  3J7A U;  5BR8 O;  4LF9 O;  5LMN O;  5IWA O;  4DR5 O;  3RT3 C;  2UUA O;  1XEQ A;  2UUB O;  4JYA O;  1F7Y A;  5LMU O;  4B3M O;  5FLX N;  1N33 O;  3T1Y O;  3M8A A;  1A32 A;  4K0K O;  4LFB O;  1FJG O;  2Z0A A;  1XMQ O;  4LFA O;  1IBK O;  1HR0 O;  4YHH O;  4DR3 O;  2DJV A;  5IT9 N;  4LF7 O;  2FKX A;  4DUZ O;  4NXM O;  1AB3 A;  2AGA A;  1HNW O;  2UXC O;  2UUC O;  2VQF O;  4LF5 O;  4JI1 O;  5A2Q N;  1HNX O;  4KHP O;  4DR4 O;  1D2D A;  3SDL A;  4DR7 O;  1KUQ A;  3JAM N;  1HNZ O;  2HHH O;  4JI0 O;  1NS1 A;  5H5N A;  1R1B A;  3J80 N;  4LFC O;  2UXD O;  1DK1 A;  3J81 N;  1FKA O;  4DV4 O;  2UU9 O;  1J5E O;  4JV5 O;  4JI5 O;  4DUY O;  2DOS A;  4DV2 O;  4B3S O;  3F5T A;  4OPA A;  2JRI A;  2E5L O;  1X59 A;  2ZM6 O;  4B3R O;  1YZB A;  1XNQ O;  4B3T O;  4DV1 O;  4A5U B;  4JI8 O;  3T1H O;  3O65 A;  2LW7 A;  2N74 A;  1N34 O;  1I94 O;  4X65 O;  4DV0 O;  1N36 O;  1R6T A;  3R66 A;  5LL6 Y;  4OX9 O;  1G1X B;  2VQE O;  4OPH A;  4LF6 O;  1XNR O;  4YY3 O;  4DR6 O;  4JI4 O;  1AIL A;  1IBM O;  4JI6 O;  4GKK O;  4DR1 O;  4JI2 O;  4DR2 O;  4NXN O;  4GKJ O;  4X64 O;  1N32 O;  4X62 O;  4DV6 O;  4DV7 O;  1IBL O;  4LF4 O;  4X66 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...