5LMUT

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmuT00
4DV2T 1FJGT 4JI3T 4JI1T 4B3TT 5BR8T 1XNRT 5LMNT 4DR3T 4B3RT 4DR7T 4DR4T 4DR5T 1HNZT 4LF5T 4JI2T 2UXCT 4DUZT 1IBKT 1I94T 4JI6T 2UXBT 4DR1T 2UUBT 4LFCT 4X65T 2HHHT 3T1HT 4DV5T 4LFBT 2E5LT 1HR0T 4NXNT 1N33T 4JV5T 4GKJT 2UUCT 4LF7T 1HNXT 4GKKT 4X62T 5IWAT 4B3MT 2UUAT 4JI7T 4JI5T 4YHHT 2UXDT 4DV4T 5LMUT 4AQYT 1N34T 2VQFT 4DV0T 4JI8T 4LF4T 4JI4T 4YY3T 4LF9T 4B3ST 1N36T 4X66T 3T1YT 1IBLT 4LF6T 4DUYT 4NXMT 4DV3T 1XMQT 4X64T 2F4VT 4LFAT 4JYAT 1J5ET 4LF8T 4JI0T 4DV1T 4K0KT 2VQET 4DR6T 4DV6T 1N32T 3OTOT 4DV7T 1XMOT 1IBMT 4OX9T 4KHPT 4DR2T 1XNQT 2UU9T 1HNWT 2ZM6T
chains in the Genus database with same CATH superfamily
4JI3T 5HXEA 2W62A 5JDNA 1XWMA 4OFZA 5ABFA 1XNRT 3RRCA 2DWGA 3P7IA 4C91A 2BG9B 4H9PC 4LF5T 5EK4A 2W61A 3RLFF 3CX7B 4PJMA 3ONJA 2VWAA 2WDVA 2FJEA 2A2FX 3PUZF 4CXWA 5HAXA 5FY0A 5AQRB 1FEWA 4AQFC 4XBFB 3EAMA 3FZLB 4IDZA 2J4GA 3N9MA 4I55E 5FMNA 2WAUA 3UQ4A 5AQKB 2WWUA 3TLVA 3AE1A 5IWAT 2UUAT 4JI7T 5IUXA 2NW7A 3LSVA 5FVLA 3NZQA 2VKJA 2XQ6A 1SA0E 3FZHB 2YN6A 5LGTB 3MZKB 1I6ZA 3CQGB 2N1GA 4MLKA 4KBMB 1Y64B 2KT9A 3ZT5A 4KX6A 4F8HA 4HWCA 3IEEA 2ODVA 2ZLYA 3NKZA 5LHIB 3AE8A 1JNRA 3N2OA 1J5WA 2DWKA 1SE7A 3HA4A 2NTYA 3ZEFB 4H63V 3VRBA 3ABVA 4IE0A 2V6XA 4HFCA 1B7TA 5HXCA 3NWIA 3UULA 2VB6A 2WB5A 2W67A 3N5LA 3I9YA 2XSBA 3AE3A 4YTPA 4V1Av 4JI2T 2XQ4A 3F31A 4EZ4A 4WNKA 4QKNA 5C3JA 3DJBA 5JDHA 3AXJA 3Q5WA 4WZXA 3FBLA 5KX5E 4CN1A 2Y6XA 2JIWA 2K5BB 5HCMA 4JV5T 1W9RA 4FJOA 2D5UA 3PUAA 3VR8A 3MACA 4HWDA 3V5UA 4X62T 4HFDA 4BJNA 2ES0A 2H88A 3PUQA 5HCJA 1MMNA 2RPAA 3ZMVB 2VKOA 5AQUB 3E0ZA 1LKXA 3K3OA 2LJLA 3HL6A 1W0AA 4ILAA 1NWMX 4I0UA 2NP9A 1GQEA 4HN9A 5A1LA 2EHOA 4UELA 3SS1A 5FP3A 2F4VT 1LVFA 1D1AA 4LFAT 1OEDE 5JREA 1M62A 4KI0F 3RQWA 2Q9QD 2V26A 2UU9T 3ETUA 4QH5A 5JH7E 2B1EA 4AKLA 2KLQA 4GYRA 2ZM8A 2CWOA 4IE4A 4UIGA 3F2EA 3UFEA 2XAFB 4UVAB 2QYWA 4DR5T 4E7SA 2CMRA 1UX5A 2KWIB 1I94T 4DBRA 3ZMZB 3EDVA 1X9BA 3ZLIA 2M67A 3HKDE 3P50A 2PG8A 1X79A 3B5MA 4OHFA 3P4RA 2KZ7B 1V9DA 3ZPOA 4P0AA 3C51A 5LJNA 2E9XB 4O2AE 4A97A 1L0VA 5LNKA 4GK0E 4YLHA 5HEJA 1U5PA 4IE7A 3VHLA 5JR9A 1MMDA 3GA8A 5L4EA 1OXZA 3H37A 5ABHA 4FI5A 4PFPA 3AE5A 5AQNB 4ZEYA 3TKLB 2VURA 1BR0A 2ODUA 4U2YA 1OEDC 2LSGA 2Y8DA 4J2CA 3RYIE 4PJNA 4EXTA 5HXSA 4K0KT 1MNEA 2VVSA 3OTOT 4DV7T 4X1KE 4YJ2E 4Z8XA 3LK42 3K3QC 2XJ7A 3LJCA 1M7KA 4COFA 2LOSA 2XAGB 2WDRA 5AQGB 2X68A 5FYMA 4H9SE 1NEKA 2XQAA 3VKHA 1T8BA 4CQIA 5IYZE 3O9XA 4JUYA 3O1JA 3UUXB 1WFDA 2HPJA 2A9UA 2UXBT 1ZOYA 3HR0A 5AQLB 4YFSA 5CGMA 2BVLA 5LOVE 3AVRA 4YSYA 3AEDA 2YU2A 4X1IE 2LEHA 1KNPA 3UU4A 2V7KA 5FVKA 3PUSA 4QX8B 4DNDA 2H7OA 4YJ3E 3EVYA 2FJAA 1UURA 4DIDB 4EZHA 3ZYKA 3KV4A 2WM9A 5FY7A 1KEYA 3PU3A 3EDUA 4LF9T 1Z8UA 2MBGA 3EI0A 4JEUB 1D0ZA 1IAPA 5LGUB 4ILCA 1D1CA 4UVBB 2Q9QA 2DCFA 4DV1T 2PJQA 4WYVA 3FB2A 1US7B 2LKHA 3GN5A 5L3GB 5H6RB 1WCRA 4PJLA 1IJ6A 3I0QA 4AKIA 1MMAA 2G0UA 2W4XA 2WS3A 3RGLA 1SHZC 2VVNA 3RYCE 3PJAA 3RPUA 4O4LE 5JDQA 4XAXB 1VCSA 2UXCT 3PUXF 4AIUA 3LG7A 2J62A 3UQ7A 2CLYC 2X66A 2LRLA 5H6QB 3GN5B 3EUHA 3B57A 2V5DA 1W0BA 3FZFB 2WMOA 2VK9A 5ABGA 3CKDA 3WI3A 3C98B 4IGUA 2AE9A 2IUBA 4GOUA 5L3FB 3ZSTA 1N34T 2A72A 3LBXB 2OV9A 2H3RA 3I0OA 3RHWA 3ZT6A 3TLWA 4NIQA 4LMLA 4UR9A 2MTQA 2W00A 3T1YT 1D1BA 1EZ3A 2RA1A 2CM0A 4ZZCA 5JTGA 1DU2A 2LKGA 4DO0A 4E7ZA 5EK3A 4IHJE 2LRKA 4ZHQE 1S35A 5HEOA 4OX9T 1WRDA 2I59A 2K48A 2X67A 1T72A 2KSRA 3GMIA 1FJGT 3RQUA 2KINB 5FL1A 5J0ZA 2DLRA 4ISTA 2LM2A 4ZI3D 3JAEA 3RIFA 3LK3B 4PW8A 4DBQA 3MKDA 3ZCIA 2V5CA 4IDPA 3OYZA 4DUZT 1E1HB 4PK6A 1LVKA 3CQCB 2WDQA 5KMGP 5AQOB 2YOEA 2UXNB 5LJMA 3FZKB 5J2UE 2E9XD 1ZHCA 3UT5E 3RC8A 5HEHA 3Q9DA 4IL9A 1WR0A 2MPKA 5JDMA 4ZI2D 3K8PC 4U7YA 3OVUA 3RIUA 1XDPA 3SFEA 2WZHA 3N9PA 1HX8A 2V8SV 2DNXA 1FMVA 2V6YB 3L8RA 3R6NA 2V7IA 4IL4A 5KDMC 5FY1A 3ZKRA 5AQFB 5F8PA 4JI8T 2ZMAA 3D0TA 4KP3C 3RIAA 2X0LB 2XQ9A 3RC3A 5LB7B 2K3WA 3W15B 1W09A 3AAAB 2XPKA 3AEBA 3PTRB 4IE5A 3VKGA 2IIUA 4HWHA 2LM9A 3PUGA 1UK5A 3PV0F 3U78A 1OEDB 3LK2B 4H9OC 4GIWA 2NW9A 3UU5A 3N9QA 2HN1A 1FIOA 4I50E 2VKHA 3ANWB 4CI1B 5HWYA 3RX6A 2C5JA 1AJ3A 2XZEA 3VRAA 2HN2A 5CA0E 3MA9A 3DP7A 3JAFA 5FXWA 2IW5B 4TNWA 2CCQA 3P8CD 4IREA 2OA5A 4HEAA 4HE8A 3H3AA 2UUBT 4L5GA 2OLTA 1QUUA 4NXNT 2KXPB 1G8XA 4HTEA 3RI5A 5AQJB 3G06A 3ZC0A 2LHRA 1D0XA 2YDQA 2QVAA 3SOLA 5HXHA 5FXVA 4JI5T 1Z0PA 2D9DA 4X5TA 3V5SA 3KDSE 3AE6A 3UFGA 1G73A 3AE9A 3R84B 2VQFT 5JDFA 3A8YC 4JI4T 5LBQB 3ESLA 2BS4A 1N36T 4UEMA 3FXEB 1KNRA 2Z6EA 3AA6B 4TN7B 1BR2A 5ABEA 3CWZB 3UTKA 3WAJA 2V7LA 4QXHB 2XASB 2BG9E 4B6XA 4YTNA 5LHGB 3RKOA 4TX5A 1IBMT 4DR2T 1MMGA 4ZZBA 4A5XA 4DV2T 3PDYA 5JDLA 4TWHA 3K1SA 3CQXC 5AQPB 3B13A 4U72A 5BR8T 1S94A 2PTFA 4LMKA 2W2UA 3QUJA 5AQSB 3JC6C 2CEAA 3O1IA 3AAEB 4MBQA 2WY2A 3CX6B 3ZN0B 4KUMB 4AXPA 4DR1T 2FJDA 3AB3B 2E9XA 3RH3A 4EYYR 4U3CA 3N9LA 3T1HT 5LG4A 2YU1A 1MIYA 2E5LT 2BVMA 4WBOA 3BQLA 2UUCT 2HPLA 4GKKT 5JRCA 3WAKA 1WYBA 4PAGA 2WWVA 4AQYT 1D0YA 3AA1B 3ZJ1A 5LXTE 2DI4A 2X9XA 3HKCE 4AI6A 3ZCJA 3P4WA 2BG9C 4TNVA 5DJQC 3IF8B 2IHR1 2JQHA 2HH7A 1J5ET 1UUSA 2BDEA 5CB4E 2X51A 1N32T 5JRCB 1VOMA 2JRKA 2BS3A 4TV8E 4ZOLE 2YK0A 2JQ9A 5AQVB 4AQGA 4ZS2A 5AQIB 4TV9E 3CVRA 3PUVF 4C90A 2YDRA 3KBUA 3AEFA 4I43B 3I9WA 4N78D 2WSSV 4AISA 3CIRA 2M6IA 4AQFA 4X65T 4TUYE 4LFBT 2WBLA 3O4XE 4A98A 2IMLA 3Q5XA 3UUMA 1VCTA 2XHEB 3LDQB 5KXJA 3PURA 4UXNB 3RYFE 1T7SA 3ZYLA 5ETWA 1YXRA 2P9BA 3KV9A 1KF6A 5ADXL 4AKHA 1HG5A 1HX1B 4EAHA 4QWNB 5FNVE 3ZMUB 3AA7B 3FXDB 4M1PA 4B3ST 1NENA 1U4QA 2ZM2A 2LT3A 4GK5E 4P1NA 3ZN1B 3HKEE 2XY8B 1E2AA 1XMOT 2CXLA 4QXCB 4NPPA 1XNQT 5C2TA 2MAWA 5C8YE 5L3BB 2WQYA 2J47A 4ZXLA 3MXZA 5HWXA 1BR1A 4O8SA 1XZYA 5LMNT 4DR7T 5CA1E 1VRBA 2LE8A 4HKAA 4U74A 3JCFA 5AQTB 1BR4A 2NOXA 3UU8A 3RF1A 3KV5A 4O2BE 3EABA 3QB5K 2YEVC 4U2ZA 3MJXA 1HCIA 2IC6A 3LBXA 1HG2A 4QHOA 3EHZA 3ZSSA 4MALA 4TWDA 4X20E 3ZC1A 5LMUT 2IDOB 2YINA 3QK6A 4IDQA 1CUNA 3J9X1 3CX8B 4EOZB 3PU8A 3H3MA 4O4JE 3HI2A 1IBLT 2D0TA 3HKBE 2XAHB 2EHOC 2CXDA 3DTOA 4MHCA 3QB5A 5TAOA 3A7MA 1E7PA 4L0RA 4IIJE 3C64A 5EZYE 4JI0T 2VKDA 4YT0A 2XM2A 5DQWA 1XDOA 4AKGA 4H9RC 5EK2A 4YHJA 5J2TE 1MIWA 5F3JA 2E5VA 2WMNA 3L3PA 1YQ3A 2M6BA 1YKHB 4P09A 4B3RT 4Z91A 4JBWF 1HTJF 3E08A 3TLTA 2LLYA 2MYSA 2XTLA 4QH4A 3N2GE 4O4IE 2KMFA 3L39A 4LFCT 5IHYA 2NTXA 1H7CA 1UX4A 4IE6A 4LMJA 2X9WA 5FL0A 2V6YA 1MNDA 2N9DA 1HNXT 3N9NA 4YHHT 3FHNA 2R6GF 4DV4T 4O4HE 5JR9C 4UV8B 3LFMA 3CK6A 3P4QA 4HFEA 2YKSA 3KVAA 2CBJA 3M3ZB 5DQVA 4YSZA 4IT4A 2CRBA 1OEDA 1KK7A 1LRZA 5HEGA 2CE7A 4U31A 2B76A 4CI3B 4HWFA 4X66T 2KNDA 4A56A 4DV3T 3ZYMA 3M65A 3ANWA 2LSKA 3PUWF 3PUYF 3QOFA 2VQET 3CPZA 5L2LA 1ZP0A 3J7Yq 2PFVA 2LOPA 3K3NA 4ASKA 3VR9A 3NRYA 2WCAA 4G2AA 5FXZA 4CN6A 2XQ7A 4JI1T 5DABA 4DVDA 2XQYA 3MK7C 4DR4T 4IDNA 2MOZA 4PK4A 1O3XA 2D2SA 3SWHA 4DMWA 1WLXA 5J1GA 2QRXA 5ABFB 1HR0T 1N33T 3ETVA 2XAQB 5L3DB 3JADA 4OYJA 4ERRA 3QC9A 3SFDA 2NW8A 2W66A 4TZ4C 2L8KA 2DL1A 2BZBA 3OYXA 4I4TE 5HEUA 3N9OA 3ZT7A 2CXFA 5JDGA 3KBTA 3E22E 4LF6T 4NXMT 4XZCA 1XMQT 4QXBB 4PJJA 3TLUA 4LF8T 4DV6T 2Q9QC 3F57A 2NWBA 2K9AA 4ZS3A 2XM1A 2FJBA 3CMLA 3FZMB 3BK9A 1YD8G 4KMCA 5GONE 2LHNA 5FKYA 3KV6A 2XQ8A 4ISSA 3AVSA 2WP9A 5HYAA 3RRWA 5CJ5A 4HGAA 1JNZA 2E2AA 4JEHB 2GK9A 3GWHA 4QH1A 2IC9A 3AECA 2XUEA 3AXJB 2BKPA 3AAIA 3C50A 5LP6E 4JLEA 5L3CB 3OBVE 3RKGA 3UUNA 2X9HA 4MFRA 2AXDS 2BBHA 1J1JA 4P0BA 3NRXA 2CLYB 4LF4T 4GYSA 3ZMSB 4DUYT 2XSAA 3P4SA 4X64T 5LYJE 2WU2A 2FBWA 1R8IA 4PFOA 1UCUA 4EEDA 2CWYA 2EHOB 3UUBA 4HFVA 1HNWT 4YXDA 4PNIA 3C4ZA 2NR4A 4OK0A 3BQIA 4NUUA 4YTMA 3JC6D 4QX7B 2CA5A 5CFBA 1IBKT 2I0MA 5JQGE 2IAKA 2D0UA 2HHHT 4DV5T 2JQKA 4HFIA 4WBNE 1YKEB 3ZJ2A 1IJ5A 3A5XA 5LA6E 4G63A 4NUVA 3PJAJ 4HFHA 5AQQB 5L3EB 3P4PA 4K0UA 3RIUC 3OKQA 2CPTA 4CN4A 2K24A 4DV0T 4ILBA 5JR9B 2ZM0A 3OPCA 4UVCB 1Y01A 2LSJA 4TWFA 4AKRB 1ZV4X 2XQ5A 2XQ3A 2QGSA 2W0GA 2YDSA 1WYCA 4JYAT 1KFYA 4EB6E 4EEBA 2XAJB 4DR6T 5LHHB 4U7IA 1SUMB 5M4YA 1KNZA 4UF0A 2CHOA 4OYKA 5LG3A 3L09A 2ZM6T 1IZNB 2A3DA 2JQQA 4BAYB 4PK5A 4CXXA 4ILUA 3O1HA 2L3LA 2FUPA 3IBPA 3T8OA 4B3TT 3UU3A 5E0OA 4DR3T 1YW0A 2PBIA 3VU7H 4H9QC 3TLSA 3AE4A 1HNZT 5L4HA 1ZKEA 4ADZA 2E8IA 4JI6T 2KWHA 5LBMA 4ZI7E 3C4XA 3AEAA 3Q5EA 4BA9A 4EGWA 3UU6A 2H89A 3ONXA 4UF0B 4GKJT 5F5WA 1QLBA 4H63H 3QNUA 4B3MT 2CBIA 1HF8A 1ZEEA 2RP4A 4CXYA 2JMHA 4U33A 2W63A 2H7VC 2V7JA 3Q2MA 2WU5A 4UV9B 3KINB 4HWIB 2ACXA 4F6RC 2ACZA 4YY3T 3AE7A 5BMVE 4EV6A 3KVBA 3NZPA 3AEEA 1FMWA 2L9QA 2JMKA 3FBZA 2JPFA 3I1AA 3PE0A 4EYUA 3N2KE 3X1DA 3IHRA 5JVDE 3C4WA 2VL0A 3AEGA 3SRZA 3Q5DA 2CHNA 3RYHE 4ANJA 2Q9QB 3AA0B 4ZI3C 2BKOA 3U3IA 1MIVA 1UGOA 3OJAA 5LGNB 3NVOA 5HXRA 4Q25A 2VASA 4IDOA 4EIWA 5LCYA 2X9YA 1HFAA 3ONLC 4X1YE 2V1DB 1CHUA 4CI2B 3NBXX 2V7MA 2E9XC 2N2NA 2C5KT 1WR6A 2LSIA 4LF7T 4ZI2C 2C5IT 5AQMB 4BJMA 1HS7A 5AFUL 4H9NC 4KHZF 2LSYA 2UXDT 3IA3A 2WZIA 4YSXA 4DMVA 2Y48B 2DHRA 4L9IA 1QSDA 5L47A 1NAFA 2C0SA 2UXXB 4WW0A 3KFWX 1OWAA 2BG9A 2SPCA 2JJ9A 2BBJA 1T98A 1YQ4A 2I6HA 2QA7A 2EHOD 3AE2A 3BQKA 2X0HA 2J1DG 2BS2A 2BKNA 3S4UA 2X0YA 2VL8A 4CZZB 4KHPT 5FXXA 3ZMTB 5AQHB 4Z90A 4HFBA
chains in the Genus database with same CATH topology
4DV2T 1FJGT 4JI3T 4JI1T 4B3TT 5BR8T 1XNRT 5LMNT 4DR3T 4B3RT 4DR7T 4DR4T 4DR5T 1HNZT 4LF5T 4JI2T 2UXCT 4DUZT 1IBKT 1I94T 4JI6T 2UXBT 4DR1T 2UUBT 4LFCT 4X65T 2HHHT 3T1HT 4DV5T 4LFBT 2E5LT 1HR0T 4NXNT 1N33T 4JV5T 4GKJT 2UUCT 4LF7T 1HNXT 4GKKT 4X62T 5IWAT 4B3MT 2UUAT 4JI7T 4JI5T 4YHHT 2UXDT 4DV4T 5LMUT 4AQYT 1N34T 2VQFT 4DV0T 4JI8T 4LF4T 4JI4T 4YY3T 4LF9T 4B3ST 1N36T 4X66T 3T1YT 1IBLT 4LF6T 4DUYT 4NXMT 4DV3T 1XMQT 4X64T 2F4VT 4LFAT 4JYAT 1J5ET 4LF8T 4JI0T 4DV1T 4K0KT 2VQET 4DR6T 4DV6T 1N32T 3OTOT 4DV7T 1XMOT 1IBMT 4OX9T 4KHPT 4DR2T 1XNQT 2UU9T 1HNWT 2ZM6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 T;  1FJG T;  4JI3 T;  4JI1 T;  4B3T T;  5BR8 T;  1XNR T;  5LMN T;  4DR3 T;  4B3R T;  4DR7 T;  4DR4 T;  4DR5 T;  1HNZ T;  4LF5 T;  4JI2 T;  2UXC T;  4DUZ T;  1IBK T;  1I94 T;  4JI6 T;  2UXB T;  4DR1 T;  2UUB T;  4LFC T;  4X65 T;  2HHH T;  3T1H T;  4DV5 T;  4LFB T;  2E5L T;  1HR0 T;  4NXN T;  1N33 T;  4JV5 T;  4GKJ T;  2UUC T;  4LF7 T;  1HNX T;  4GKK T;  4X62 T;  5IWA T;  4B3M T;  2UUA T;  4JI7 T;  4JI5 T;  4YHH T;  2UXD T;  4DV4 T;  5LMU T;  4AQY T;  1N34 T;  2VQF T;  4DV0 T;  4JI8 T;  4LF4 T;  4JI4 T;  4YY3 T;  4LF9 T;  4B3S T;  1N36 T;  4X66 T;  3T1Y T;  1IBL T;  4LF6 T;  4DUY T;  4NXM T;  4DV3 T;  1XMQ T;  4X64 T;  2F4V T;  4LFA T;  4JYA T;  1J5E T;  4LF8 T;  4JI0 T;  4DV1 T;  4K0K T;  2VQE T;  4DR6 T;  4DV6 T;  1N32 T;  3OTO T;  4DV7 T;  1XMO T;  1IBM T;  4OX9 T;  4KHP T;  4DR2 T;  1XNQ T;  2UU9 T;  1HNW T;  2ZM6 T; 
#chains in the Genus database with same CATH topology
 4JI3 T;  5HXE A;  2W62 A;  5JDN A;  1XWM A;  4OFZ A;  5ABF A;  1XNR T;  3RRC A;  2DWG A;  3P7I A;  4C91 A;  2BG9 B;  4H9P C;  4LF5 T;  5EK4 A;  2W61 A;  3RLF F;  3CX7 B;  4PJM A;  3ONJ A;  2VWA A;  2WDV A;  2FJE A;  2A2F X;  3PUZ F;  4CXW A;  5HAX A;  5FY0 A;  5AQR B;  1FEW A;  4AQF C;  4XBF B;  3EAM A;  3FZL B;  4IDZ A;  2J4G A;  3N9M A;  4I55 E;  5FMN A;  2WAU A;  3UQ4 A;  5AQK B;  2WWU A;  3TLV A;  3AE1 A;  5IWA T;  2UUA T;  4JI7 T;  5IUX A;  2NW7 A;  3LSV A;  5FVL A;  3NZQ A;  2VKJ A;  2XQ6 A;  1SA0 E;  3FZH B;  2YN6 A;  5LGT B;  3MZK B;  1I6Z A;  3CQG B;  2N1G A;  4MLK A;  4KBM B;  1Y64 B;  2KT9 A;  3ZT5 A;  4KX6 A;  4F8H A;  4HWC A;  3IEE A;  2ODV A;  2ZLY A;  3NKZ A;  5LHI B;  3AE8 A;  1JNR A;  3N2O A;  1J5W A;  2DWK A;  1SE7 A;  3HA4 A;  2NTY A;  3ZEF B;  4H63 V;  3VRB A;  3ABV A;  4IE0 A;  2V6X A;  4HFC A;  1B7T A;  5HXC A;  3NWI A;  3UUL A;  2VB6 A;  2WB5 A;  2W67 A;  3N5L A;  3I9Y A;  2XSB A;  3AE3 A;  4YTP A;  4V1A v;  4JI2 T;  2XQ4 A;  3F31 A;  4EZ4 A;  4WNK A;  4QKN A;  5C3J A;  3DJB A;  5JDH A;  3AXJ A;  3Q5W A;  4WZX A;  3FBL A;  5KX5 E;  4CN1 A;  2Y6X A;  2JIW A;  2K5B B;  5HCM A;  4JV5 T;  1W9R A;  4FJO A;  2D5U A;  3PUA A;  3VR8 A;  3MAC A;  4HWD A;  3V5U A;  4X62 T;  4HFD A;  4BJN A;  2ES0 A;  2H88 A;  3PUQ A;  5HCJ A;  1MMN A;  2RPA A;  3ZMV B;  2VKO A;  5AQU B;  3E0Z A;  1LKX A;  3K3O A;  2LJL A;  3HL6 A;  1W0A A;  4ILA A;  1NWM X;  4I0U A;  2NP9 A;  1GQE A;  4HN9 A;  5A1L A;  2EHO A;  4UEL A;  3SS1 A;  5FP3 A;  2F4V T;  1LVF A;  1D1A A;  4LFA T;  1OED E;  5JRE A;  1M62 A;  4KI0 F;  3RQW A;  2Q9Q D;  2V26 A;  2UU9 T;  3ETU A;  4QH5 A;  5JH7 E;  2B1E A;  4AKL A;  2KLQ A;  4GYR A;  2ZM8 A;  2CWO A;  4IE4 A;  4UIG A;  3F2E A;  3UFE A;  2XAF B;  4UVA B;  2QYW A;  4DR5 T;  4E7S A;  2CMR A;  1UX5 A;  2KWI B;  1I94 T;  4DBR A;  3ZMZ B;  3EDV A;  1X9B A;  3ZLI A;  2M67 A;  3HKD E;  3P50 A;  2PG8 A;  1X79 A;  3B5M A;  4OHF A;  3P4R A;  2KZ7 B;  1V9D A;  3ZPO A;  4P0A A;  3C51 A;  5LJN A;  2E9X B;  4O2A E;  4A97 A;  1L0V A;  5LNK A;  4GK0 E;  4YLH A;  5HEJ A;  1U5P A;  4IE7 A;  3VHL A;  5JR9 A;  1MMD A;  3GA8 A;  5L4E A;  1OXZ A;  3H37 A;  5ABH A;  4FI5 A;  4PFP A;  3AE5 A;  5AQN B;  4ZEY A;  3TKL B;  2VUR A;  1BR0 A;  2ODU A;  4U2Y A;  1OED C;  2LSG A;  2Y8D A;  4J2C A;  3RYI E;  4PJN A;  4EXT A;  5HXS A;  4K0K T;  1MNE A;  2VVS A;  3OTO T;  4DV7 T;  4X1K E;  4YJ2 E;  4Z8X A;  3LK4 2;  3K3Q C;  2XJ7 A;  3LJC A;  1M7K A;  4COF A;  2LOS A;  2XAG B;  2WDR A;  5AQG B;  2X68 A;  5FYM A;  4H9S E;  1NEK A;  2XQA A;  3VKH A;  1T8B A;  4CQI A;  5IYZ E;  3O9X A;  4JUY A;  3O1J A;  3UUX B;  1WFD A;  2HPJ A;  2A9U A;  2UXB T;  1ZOY A;  3HR0 A;  5AQL B;  4YFS A;  5CGM A;  2BVL A;  5LOV E;  3AVR A;  4YSY A;  3AED A;  2YU2 A;  4X1I E;  2LEH A;  1KNP A;  3UU4 A;  2V7K A;  5FVK A;  3PUS A;  4QX8 B;  4DND A;  2H7O A;  4YJ3 E;  3EVY A;  2FJA A;  1UUR A;  4DID B;  4EZH A;  3ZYK A;  3KV4 A;  2WM9 A;  5FY7 A;  1KEY A;  3PU3 A;  3EDU A;  4LF9 T;  1Z8U A;  2MBG A;  3EI0 A;  4JEU B;  1D0Z A;  1IAP A;  5LGU B;  4ILC A;  1D1C A;  4UVB B;  2Q9Q A;  2DCF A;  4DV1 T;  2PJQ A;  4WYV A;  3FB2 A;  1US7 B;  2LKH A;  3GN5 A;  5L3G B;  5H6R B;  1WCR A;  4PJL A;  1IJ6 A;  3I0Q A;  4AKI A;  1MMA A;  2G0U A;  2W4X A;  2WS3 A;  3RGL A;  1SHZ C;  2VVN A;  3RYC E;  3PJA A;  3RPU A;  4O4L E;  5JDQ A;  4XAX B;  1VCS A;  2UXC T;  3PUX F;  4AIU A;  3LG7 A;  2J62 A;  3UQ7 A;  2CLY C;  2X66 A;  2LRL A;  5H6Q B;  3GN5 B;  3EUH A;  3B57 A;  2V5D A;  1W0B A;  3FZF B;  2WMO A;  2VK9 A;  5ABG A;  3CKD A;  3WI3 A;  3C98 B;  4IGU A;  2AE9 A;  2IUB A;  4GOU A;  5L3F B;  3ZST A;  1N34 T;  2A72 A;  3LBX B;  2OV9 A;  2H3R A;  3I0O A;  3RHW A;  3ZT6 A;  3TLW A;  4NIQ A;  4LML A;  4UR9 A;  2MTQ A;  2W00 A;  3T1Y T;  1D1B A;  1EZ3 A;  2RA1 A;  2CM0 A;  4ZZC A;  5JTG A;  1DU2 A;  2LKG A;  4DO0 A;  4E7Z A;  5EK3 A;  4IHJ E;  2LRK A;  4ZHQ E;  1S35 A;  5HEO A;  4OX9 T;  1WRD A;  2I59 A;  2K48 A;  2X67 A;  1T72 A;  2KSR A;  3GMI A;  1FJG T;  3RQU A;  2KIN B;  5FL1 A;  5J0Z A;  2DLR A;  4IST A;  2LM2 A;  4ZI3 D;  3JAE A;  3RIF A;  3LK3 B;  4PW8 A;  4DBQ A;  3MKD A;  3ZCI A;  2V5C A;  4IDP A;  3OYZ A;  4DUZ T;  1E1H B;  4PK6 A;  1LVK A;  3CQC B;  2WDQ A;  5KMG P;  5AQO B;  2YOE A;  2UXN B;  5LJM A;  3FZK B;  5J2U E;  2E9X D;  1ZHC A;  3UT5 E;  3RC8 A;  5HEH A;  3Q9D A;  4IL9 A;  1WR0 A;  2MPK A;  5JDM A;  4ZI2 D;  3K8P C;  4U7Y A;  3OVU A;  3RIU A;  1XDP A;  3SFE A;  2WZH A;  3N9P A;  1HX8 A;  2V8S V;  2DNX A;  1FMV A;  2V6Y B;  3L8R A;  3R6N A;  2V7I A;  4IL4 A;  5KDM C;  5FY1 A;  3ZKR A;  5AQF B;  5F8P A;  4JI8 T;  2ZMA A;  3D0T A;  4KP3 C;  3RIA A;  2X0L B;  2XQ9 A;  3RC3 A;  5LB7 B;  2K3W A;  3W15 B;  1W09 A;  3AAA B;  2XPK A;  3AEB A;  3PTR B;  4IE5 A;  3VKG A;  2IIU A;  4HWH A;  2LM9 A;  3PUG A;  1UK5 A;  3PV0 F;  3U78 A;  1OED B;  3LK2 B;  4H9O C;  4GIW A;  2NW9 A;  3UU5 A;  3N9Q A;  2HN1 A;  1FIO A;  4I50 E;  2VKH A;  3ANW B;  4CI1 B;  5HWY A;  3RX6 A;  2C5J A;  1AJ3 A;  2XZE A;  3VRA A;  2HN2 A;  5CA0 E;  3MA9 A;  3DP7 A;  3JAF A;  5FXW A;  2IW5 B;  4TNW A;  2CCQ A;  3P8C D;  4IRE A;  2OA5 A;  4HEA A;  4HE8 A;  3H3A A;  2UUB T;  4L5G A;  2OLT A;  1QUU A;  4NXN T;  2KXP B;  1G8X A;  4HTE A;  3RI5 A;  5AQJ B;  3G06 A;  3ZC0 A;  2LHR A;  1D0X A;  2YDQ A;  2QVA A;  3SOL A;  5HXH A;  5FXV A;  4JI5 T;  1Z0P A;  2D9D A;  4X5T A;  3V5S A;  3KDS E;  3AE6 A;  3UFG A;  1G73 A;  3AE9 A;  3R84 B;  2VQF T;  5JDF A;  3A8Y C;  4JI4 T;  5LBQ B;  3ESL A;  2BS4 A;  1N36 T;  4UEM A;  3FXE B;  1KNR A;  2Z6E A;  3AA6 B;  4TN7 B;  1BR2 A;  5ABE A;  3CWZ B;  3UTK A;  3WAJ A;  2V7L A;  4QXH B;  2XAS B;  2BG9 E;  4B6X A;  4YTN A;  5LHG B;  3RKO A;  4TX5 A;  1IBM T;  4DR2 T;  1MMG A;  4ZZB A;  4A5X A;  4DV2 T;  3PDY A;  5JDL A;  4TWH A;  3K1S A;  3CQX C;  5AQP B;  3B13 A;  4U72 A;  5BR8 T;  1S94 A;  2PTF A;  4LMK A;  2W2U A;  3QUJ A;  5AQS B;  3JC6 C;  2CEA A;  3O1I A;  3AAE B;  4MBQ A;  2WY2 A;  3CX6 B;  3ZN0 B;  4KUM B;  4AXP A;  4DR1 T;  2FJD A;  3AB3 B;  2E9X A;  3RH3 A;  4EYY R;  4U3C A;  3N9L A;  3T1H T;  5LG4 A;  2YU1 A;  1MIY A;  2E5L T;  2BVM A;  4WBO A;  3BQL A;  2UUC T;  2HPL A;  4GKK T;  5JRC A;  3WAK A;  1WYB A;  4PAG A;  2WWV A;  4AQY T;  1D0Y A;  3AA1 B;  3ZJ1 A;  5LXT E;  2DI4 A;  2X9X A;  3HKC E;  4AI6 A;  3ZCJ A;  3P4W A;  2BG9 C;  4TNV A;  5DJQ C;  3IF8 B;  2IHR 1;  2JQH A;  2HH7 A;  1J5E T;  1UUS A;  2BDE A;  5CB4 E;  2X51 A;  1N32 T;  5JRC B;  1VOM A;  2JRK A;  2BS3 A;  4TV8 E;  4ZOL E;  2YK0 A;  2JQ9 A;  5AQV B;  4AQG A;  4ZS2 A;  5AQI B;  4TV9 E;  3CVR A;  3PUV F;  4C90 A;  2YDR A;  3KBU A;  3AEF A;  4I43 B;  3I9W A;  4N78 D;  2WSS V;  4AIS A;  3CIR A;  2M6I A;  4AQF A;  4X65 T;  4TUY E;  4LFB T;  2WBL A;  3O4X E;  4A98 A;  2IML A;  3Q5X A;  3UUM A;  1VCT A;  2XHE B;  3LDQ B;  5KXJ A;  3PUR A;  4UXN B;  3RYF E;  1T7S A;  3ZYL A;  5ETW A;  1YXR A;  2P9B A;  3KV9 A;  1KF6 A;  5ADX L;  4AKH A;  1HG5 A;  1HX1 B;  4EAH A;  4QWN B;  5FNV E;  3ZMU B;  3AA7 B;  3FXD B;  4M1P A;  4B3S T;  1NEN A;  1U4Q A;  2ZM2 A;  2LT3 A;  4GK5 E;  4P1N A;  3ZN1 B;  3HKE E;  2XY8 B;  1E2A A;  1XMO T;  2CXL A;  4QXC B;  4NPP A;  1XNQ T;  5C2T A;  2MAW A;  5C8Y E;  5L3B B;  2WQY A;  2J47 A;  4ZXL A;  3MXZ A;  5HWX A;  1BR1 A;  4O8S A;  1XZY A;  5LMN T;  4DR7 T;  5CA1 E;  1VRB A;  2LE8 A;  4HKA A;  4U74 A;  3JCF A;  5AQT B;  1BR4 A;  2NOX A;  3UU8 A;  3RF1 A;  3KV5 A;  4O2B E;  3EAB A;  3QB5 K;  2YEV C;  4U2Z A;  3MJX A;  1HCI A;  2IC6 A;  3LBX A;  1HG2 A;  4QHO A;  3EHZ A;  3ZSS A;  4MAL A;  4TWD A;  4X20 E;  3ZC1 A;  5LMU T;  2IDO B;  2YIN A;  3QK6 A;  4IDQ A;  1CUN A;  3J9X 1;  3CX8 B;  4EOZ B;  3PU8 A;  3H3M A;  4O4J E;  3HI2 A;  1IBL T;  2D0T A;  3HKB E;  2XAH B;  2EHO C;  2CXD A;  3DTO A;  4MHC A;  3QB5 A;  5TAO A;  3A7M A;  1E7P A;  4L0R A;  4IIJ E;  3C64 A;  5EZY E;  4JI0 T;  2VKD A;  4YT0 A;  2XM2 A;  5DQW A;  1XDO A;  4AKG A;  4H9R C;  5EK2 A;  4YHJ A;  5J2T E;  1MIW A;  5F3J A;  2E5V A;  2WMN A;  3L3P A;  1YQ3 A;  2M6B A;  1YKH B;  4P09 A;  4B3R T;  4Z91 A;  4JBW F;  1HTJ F;  3E08 A;  3TLT A;  2LLY A;  2MYS A;  2XTL A;  4QH4 A;  3N2G E;  4O4I E;  2KMF A;  3L39 A;  4LFC T;  5IHY A;  2NTX A;  1H7C A;  1UX4 A;  4IE6 A;  4LMJ A;  2X9W A;  5FL0 A;  2V6Y A;  1MND A;  2N9D A;  1HNX T;  3N9N A;  4YHH T;  3FHN A;  2R6G F;  4DV4 T;  4O4H E;  5JR9 C;  4UV8 B;  3LFM A;  3CK6 A;  3P4Q A;  4HFE A;  2YKS A;  3KVA A;  2CBJ A;  3M3Z B;  5DQV A;  4YSZ A;  4IT4 A;  2CRB A;  1OED A;  1KK7 A;  1LRZ A;  5HEG A;  2CE7 A;  4U31 A;  2B76 A;  4CI3 B;  4HWF A;  4X66 T;  2KND A;  4A56 A;  4DV3 T;  3ZYM A;  3M65 A;  3ANW A;  2LSK A;  3PUW F;  3PUY F;  3QOF A;  2VQE T;  3CPZ A;  5L2L A;  1ZP0 A;  3J7Y q;  2PFV A;  2LOP A;  3K3N A;  4ASK A;  3VR9 A;  3NRY A;  2WCA A;  4G2A A;  5FXZ A;  4CN6 A;  2XQ7 A;  4JI1 T;  5DAB A;  4DVD A;  2XQY A;  3MK7 C;  4DR4 T;  4IDN A;  2MOZ A;  4PK4 A;  1O3X A;  2D2S A;  3SWH A;  4DMW A;  1WLX A;  5J1G A;  2QRX A;  5ABF B;  1HR0 T;  1N33 T;  3ETV A;  2XAQ B;  5L3D B;  3JAD A;  4OYJ A;  4ERR A;  3QC9 A;  3SFD A;  2NW8 A;  2W66 A;  4TZ4 C;  2L8K A;  2DL1 A;  2BZB A;  3OYX A;  4I4T E;  5HEU A;  3N9O A;  3ZT7 A;  2CXF A;  5JDG A;  3KBT A;  3E22 E;  4LF6 T;  4NXM T;  4XZC A;  1XMQ T;  4QXB B;  4PJJ A;  3TLU A;  4LF8 T;  4DV6 T;  2Q9Q C;  3F57 A;  2NWB A;  2K9A A;  4ZS3 A;  2XM1 A;  2FJB A;  3CML A;  3FZM B;  3BK9 A;  1YD8 G;  4KMC A;  5GON E;  2LHN A;  5FKY A;  3KV6 A;  2XQ8 A;  4ISS A;  3AVS A;  2WP9 A;  5HYA A;  3RRW A;  5CJ5 A;  4HGA A;  1JNZ A;  2E2A A;  4JEH B;  2GK9 A;  3GWH A;  4QH1 A;  2IC9 A;  3AEC A;  2XUE A;  3AXJ B;  2BKP A;  3AAI A;  3C50 A;  5LP6 E;  4JLE A;  5L3C B;  3OBV E;  3RKG A;  3UUN A;  2X9H A;  4MFR A;  2AXD S;  2BBH A;  1J1J A;  4P0B A;  3NRX A;  2CLY B;  4LF4 T;  4GYS A;  3ZMS B;  4DUY T;  2XSA A;  3P4S A;  4X64 T;  5LYJ E;  2WU2 A;  2FBW A;  1R8I A;  4PFO A;  1UCU A;  4EED A;  2CWY A;  2EHO B;  3UUB A;  4HFV A;  1HNW T;  4YXD A;  4PNI A;  3C4Z A;  2NR4 A;  4OK0 A;  3BQI A;  4NUU A;  4YTM A;  3JC6 D;  4QX7 B;  2CA5 A;  5CFB A;  1IBK T;  2I0M A;  5JQG E;  2IAK A;  2D0U A;  2HHH T;  4DV5 T;  2JQK A;  4HFI A;  4WBN E;  1YKE B;  3ZJ2 A;  1IJ5 A;  3A5X A;  5LA6 E;  4G63 A;  4NUV A;  3PJA J;  4HFH A;  5AQQ B;  5L3E B;  3P4P A;  4K0U A;  3RIU C;  3OKQ A;  2CPT A;  4CN4 A;  2K24 A;  4DV0 T;  4ILB A;  5JR9 B;  2ZM0 A;  3OPC A;  4UVC B;  1Y01 A;  2LSJ A;  4TWF A;  4AKR B;  1ZV4 X;  2XQ5 A;  2XQ3 A;  2QGS A;  2W0G A;  2YDS A;  1WYC A;  4JYA T;  1KFY A;  4EB6 E;  4EEB A;  2XAJ B;  4DR6 T;  5LHH B;  4U7I A;  1SUM B;  5M4Y A;  1KNZ A;  4UF0 A;  2CHO A;  4OYK A;  5LG3 A;  3L09 A;  2ZM6 T;  1IZN B;  2A3D A;  2JQQ A;  4BAY B;  4PK5 A;  4CXX A;  4ILU A;  3O1H A;  2L3L A;  2FUP A;  3IBP A;  3T8O A;  4B3T T;  3UU3 A;  5E0O A;  4DR3 T;  1YW0 A;  2PBI A;  3VU7 H;  4H9Q C;  3TLS A;  3AE4 A;  1HNZ T;  5L4H A;  1ZKE A;  4ADZ A;  2E8I A;  4JI6 T;  2KWH A;  5LBM A;  4ZI7 E;  3C4X A;  3AEA A;  3Q5E A;  4BA9 A;  4EGW A;  3UU6 A;  2H89 A;  3ONX A;  4UF0 B;  4GKJ T;  5F5W A;  1QLB A;  4H63 H;  3QNU A;  4B3M T;  2CBI A;  1HF8 A;  1ZEE A;  2RP4 A;  4CXY A;  2JMH A;  4U33 A;  2W63 A;  2H7V C;  2V7J A;  3Q2M A;  2WU5 A;  4UV9 B;  3KIN B;  4HWI B;  2ACX A;  4F6R C;  2ACZ A;  4YY3 T;  3AE7 A;  5BMV E;  4EV6 A;  3KVB A;  3NZP A;  3AEE A;  1FMW A;  2L9Q A;  2JMK A;  3FBZ A;  2JPF A;  3I1A A;  3PE0 A;  4EYU A;  3N2K E;  3X1D A;  3IHR A;  5JVD E;  3C4W A;  2VL0 A;  3AEG A;  3SRZ A;  3Q5D A;  2CHN A;  3RYH E;  4ANJ A;  2Q9Q B;  3AA0 B;  4ZI3 C;  2BKO A;  3U3I A;  1MIV A;  1UGO A;  3OJA A;  5LGN B;  3NVO A;  5HXR A;  4Q25 A;  2VAS A;  4IDO A;  4EIW A;  5LCY A;  2X9Y A;  1HFA A;  3ONL C;  4X1Y E;  2V1D B;  1CHU A;  4CI2 B;  3NBX X;  2V7M A;  2E9X C;  2N2N A;  2C5K T;  1WR6 A;  2LSI A;  4LF7 T;  4ZI2 C;  2C5I T;  5AQM B;  4BJM A;  1HS7 A;  5AFU L;  4H9N C;  4KHZ F;  2LSY A;  2UXD T;  3IA3 A;  2WZI A;  4YSX A;  4DMV A;  2Y48 B;  2DHR A;  4L9I A;  1QSD A;  5L47 A;  1NAF A;  2C0S A;  2UXX B;  4WW0 A;  3KFW X;  1OWA A;  2BG9 A;  2SPC A;  2JJ9 A;  2BBJ A;  1T98 A;  1YQ4 A;  2I6H A;  2QA7 A;  2EHO D;  3AE2 A;  3BQK A;  2X0H A;  2J1D G;  2BS2 A;  2BKN A;  3S4U A;  2X0Y A;  2VL8 A;  4CZZ B;  4KHP T;  5FXX A;  3ZMT B;  5AQH B;  4Z90 A;  4HFB A; 
#chains in the Genus database with same CATH homology
 4DV2 T;  1FJG T;  4JI3 T;  4JI1 T;  4B3T T;  5BR8 T;  1XNR T;  5LMN T;  4DR3 T;  4B3R T;  4DR7 T;  4DR4 T;  4DR5 T;  1HNZ T;  4LF5 T;  4JI2 T;  2UXC T;  4DUZ T;  1IBK T;  1I94 T;  4JI6 T;  2UXB T;  4DR1 T;  2UUB T;  4LFC T;  4X65 T;  2HHH T;  3T1H T;  4DV5 T;  4LFB T;  2E5L T;  1HR0 T;  4NXN T;  1N33 T;  4JV5 T;  4GKJ T;  2UUC T;  4LF7 T;  1HNX T;  4GKK T;  4X62 T;  5IWA T;  4B3M T;  2UUA T;  4JI7 T;  4JI5 T;  4YHH T;  2UXD T;  4DV4 T;  5LMU T;  4AQY T;  1N34 T;  2VQF T;  4DV0 T;  4JI8 T;  4LF4 T;  4JI4 T;  4YY3 T;  4LF9 T;  4B3S T;  1N36 T;  4X66 T;  3T1Y T;  1IBL T;  4LF6 T;  4DUY T;  4NXM T;  4DV3 T;  1XMQ T;  4X64 T;  2F4V T;  4LFA T;  4JYA T;  1J5E T;  4LF8 T;  4JI0 T;  4DV1 T;  4K0K T;  2VQE T;  4DR6 T;  4DV6 T;  1N32 T;  3OTO T;  4DV7 T;  1XMO T;  1IBM T;  4OX9 T;  4KHP T;  4DR2 T;  1XNQ T;  2UU9 T;  1HNW T;  2ZM6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...