5LMUT

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 5lmuT00
4DR4T 4JI4T 2HHHT 4B3ST 4DR3T 4X64T 4GKKT 4DUZT 4DV7T 5IWAT 4LF8T 2UUBT 4JV5T 4DV2T 1I94T 4X65T 4JI7T 4X66T 1IBKT 4LFCT 4NXMT 5LMNT 1IBMT 2E5LT 4YY3T 4DUYT 4GKJT 1HNZT 4NXNT 4DV5T 4DR5T 4DV6T 4YHHT 2VQET 4JI5T 2UUAT 1N34T 1XNQT 4LFAT 4B3RT 1IBLT 4JI6T 4DR6T 4JI8T 4KHPT 1J5ET 2ZM6T 4DR2T 2UUCT 1HNXT 2UXCT 1N32T 3OTOT 4DV1T 2UXBT 4DV0T 4LFBT 3T1HT 4DR1T 1N33T 4X62T 4JYAT 2UU9T 4DR7T 4B3TT 4JI0T 4JI1T 4LF6T 1HNWT 4LF4T 4B3MT 2F4VT 4JI2T 1HR0T 1XNRT 4LF7T 4DV4T 2VQFT 4AQYT 1XMQT 1XMOT 4LF9T 3T1YT 4LF5T 4OX9T 1FJGT 5LMUT 4K0KT 4DV3T 4JI3T 1N36T 5BR8T 2UXDT
chains in the Genus database with same CATH superfamily
3I9YA 5HEUA 2WS3A 3L39A 5HXCA 4ZZBA 1DU2A 3RI5A 5LHGB 3FXEB 3RIUA 3P8CD 5HXSA 2XAHB 3QB5A 3NZPA 4A56A 5KDMC 5L3GB 1BR4A 4TUYE 4DV7T 2MOZA 4GOUA 4Z91A 1NAFA 2CMRA 3KV5A 3MKDA 3N2KE 3ZMVB 4CN1A 3UTKA 2I6HA 5LG4A 4E7SA 5FKYA 5IWAT 2LSIA 2R6GF 5BMVE 1HS7A 3WAJA 3I0OA 1J5WA 5LYJE 1YW0A 2LT3A 4DV2T 4X65T 3V5UA 5JTGA 4CI3B 2BG9E 3FBZA 3KVAA 3RQUA 1ZP0A 3PE0A 4AKLA 4WBOA 3C50A 3UUNA 2I59A 3AXJA 4X1KE 2K3WA 1KNRA 5DQVA 1WR6A 2XAJB 1VCSA 5CB4E 2YN6A 4ZI3C 3FZHB 2CBIA 4PAGA 4EYUA 4NXNT 2JJ9A 3A5XA 4MHCA 4P1NA 4UF0A 4HFHA 4KX6A 5C3JA 1G73A 3RIUC 1XZYA 2NTYA 1MIVA 2DL1A 2Y8DA 3AAEB 3LBXA 3ZJ1A 2W63A 5HXEA 2Q9QC 2QGSA 3NBXX 4YTMA 2MPKA 5FY0A 1CHUA 1I6ZA 5JRCA 1NENA 2JRKA 1HG5A 2VB6A 3ZYMA 2UUAT 5IHYA 1N34T 4NPPA 4U7IA 5HEOA 1JNZA 3CQXC 2X67A 5AQQB 5JDMA 5L3DB 2LRLA 3ZJ2A 4A97A 2D9DA 4LFAT 4F8HA 4IL4A 4HFDA 4PK6A 2XQYA 3MACA 3DP7A 2WDQA 2XZEA 3EHZA 3ESLA 4YSZA 2XQ8A 3ONJA 2IIUA 2CM0A 3TLWA 5LJMA 1IBLT 3H37A 2W61A 3RQWA 3RKOA 5JR9C 5ABFB 3OYXA 2CHNA 1Z8UA 3HI2A 3KV6A 3ANWA 3RLFF 5AQMB 4ZS2A 4H9OC 2DNXA 4I50E 3UFGA 3VR9A 2CHOA 4COFA 5L3CB 4U3CA 2WB5A 4YJ2E 4YJ3E 1E2AA 1X9BA 3DJBA 4L5GA 4UVCB 1CUNA 1OEDB 2BBJA 2C5KT 4UVAB 3R84B 3QNUA 1N32T 2BG9B 4JEUB 4UR9A 5LBQB 4CN6A 1T8BA 4U74A 2XAGB 2XQ7A 5FVKA 3AVRA 5FY7A 3ZKRA 3P50A 4LFBT 3T1HT 2WSSV 1D0XA 2OA5A 2W62A 4K0UA 5HWXA 1N33T 3PV0F 1MMNA 4X62T 1IAPA 5LA6E 3O1IA 3PDYA 3KBUA 3AE2A 2XM2A 1B7TA 2AE9A 4GK5E 5EZYE 5FL0A 5L4HA 2IAKA 2WDVA 4LF6T 1HNWT 4LF4T 3O4XE 4IIJE 2E2AA 2V7JA 3ZMUB 3RRWA 4EYYR 3ZMSB 3B13A 4ZI3D 5AQNB 4EOZB 4WNKA 2NWBA 4U2ZA 2X68A 3AA1B 5AQTB 4JI2T 2WM9A 3SOLA 2V6YA 3IF8B 4DMVA 5JR9B 2X0LB 2X9WA 3JCFA 2KXPB 4TN7B 2L3LA 2XPKA 1HF8A 3QUJA 2E9XB 1WYBA 2BZBA 5E0OA 4UIGA 4G2AA 1HR0T 1XMOT 3T8OA 5HWYA 5ABHA 2XHEB 2CCQA 4DVDA 3E22E 3EVYA 3ANWB 3BQIA 3AEFA 1W09A 4CZZB 5LMUT 2X66A 4NUVA 4TWFA 2OV9A 2XSBA 4ZS3A 4JLEA 4CI1B 4XAXB 5AQOB 3BK9A 1T7SA 1EZ3A 2BVLA 1UURA 2X9HA 2K48A 3JAEA 3KBTA 2WMNA 3N9MA 3AEBA 4HFIA 5DJQC 1SUMB 3RIFA 2H7VC 3RIAA 3C4ZA 1QLBA 1VOMA 3N9NA 4KHZF 4KBMB 4QX7B 4TZ4C 3TLTA 2BKOA 4HWDA 4QXBB 3OYZA 3UUBA 4CQIA 3ZEFB 3EI0A 4OK0A 5AQUB 4ANJA 5LHHB 1W9RA 2QA7A 4PNIA 2HHHT 2JQQA 3KV9A 2JQKA 3AA0B 3F57A 2OLTA 2IHR1 1D0ZA 1XDOA 5HEHA 3UUXB 4ZHQE 3CQCB 4JBWF 4AKHA 5C2TA 3NZQA 1ZV4X 3CWZB 3L8RA 3RYFE 2DLRA 5FXXA 3UQ7A 2UUBT 1WR0A 2SPCA 3K3QC 3SRZA 4O2AE 3Q2MA 1D0YA 2FJAA 3KV4A 5KXJA 4Q25A 3MA9A 3B5MA 3LG7A 4YY3T 4JI7T 2WWUA 1VCTA 2HPJA 3O1JA 4AKGA 3UQ4A 2LHNA 1IBMT 3N9LA 3Q5EA 3P7IA 3AEGA 4ADZA 2CE7A 1LRZA 3AXJB 3IA3A 2BS2A 4IE5A 2J4GA 1KK7A 1HG2A 4ILUA 4OYKA 4AQFC 4CXWA 4F6RC 1KEYA 3ZMZB 4HWHA 2E5VA 2JQ9A 3OBVE 4TNWA 3P4RA 5H6QB 2BS4A 2E9XA 2VVSA 3CIRA 4NIQA 3O9XA 2E5LT 3NRYA 5AQFB 2M67A 2LM2A 4AQGA 2BS3A 4IE6A 2DHRA 2WP9A 2JPFA 5KX5E 3LBXB 5LP6E 4BJNA 1BR1A 4UELA 4TWHA 3L3PA 2VVNA 1UUSA 2XASB 2LSJA 4IE7A 4YFSA 4ZXLA 4ZI7E 3AE3A 2H89A 2YDQA 1OEDA 5DQWA 4EAHA 2KSRA 2P9BA 2J1DG 2WBLA 3C64A 3RYCE 4PW8A 2N9DA 3SWHA 2CXDA 5JDQA 4X5TA 4B3RT 1YQ3A 4HE8A 4HEAA 3PURA 4CXYA 3TKLB 2A9UA 5H6RB 2WAUA 2WZIA 4JI8T 3C51A 2YU2A 4KHPT 4L9IA 1BR0A 4YSXA 2CRBA 3FZKB 4DR2T 2C5IT 4B6XA 2FJBA 4YHJA 4IL9A 2WCAA 3CKDA 3OPCA 3AECA 4IDNA 5LGUB 1HNXT 3U3IA 2UXNB 3JAFA 5ADXL 1US7B 3AEDA 4PJLA 3OTOT 2MYSA 4QH4A 5JQGE 4DV1T 2UXBT 2KNDA 3AE8A 4UVBB 5IUXA 1LKXA 5JDFA 5FXVA 3ZPOA 3J9X1 3AAIA 3N9OA 3LK42 2ZM8A 5A1LA 2ZM0A 3AAAB 5HXHA 4ZI2D 3PUQA 3CQGB 4DIDB 4B3TT 3L09A 1JNRA 4Z8XA 3NWIA 4PK5A 2L9QA 2WZHA 1D1BA 2XSAA 4U72A 5GONE 5HCJA 3S4UA 3UFEA 2DCFA 1YD8G 5AQJB 4HTEA 4M1PA 5CGMA 4WZXA 5FNVE 3CX6B 2J62A 4HFBA 4QH1A 3ZT7A 4B3MT 4AKRB 1UK5A 4CXXA 1YKEB 2F4VT 3LK2B 2VK9A 4QKNA 3VKHA 5L4EA 4YSYA 3VRBA 2LE8A 3VHLA 4QXCB 4LF7T 3ABVA 5JH7E 3N9PA 5LBMA 4WBNE 1SA0E 3OVUA 3HKEE 3AVSA 2LOSA 1T72A 3FXDB 3N9QA 5HCMA 4AQYT 2YU1A 2EHOB 4PJMA 4LF5T 2KMFA 4LF9T 2D0TA 1MIYA 5ABFA 2Q9QA 5AQVB 3PJAJ 2ZLYA 3EDUA 4DMWA 2B76A 3ZMTB 5CJ5A 1FJGT 1MMDA 5HEJA 3E08A 4GYRA 4K0KT 4H63V 2PTFA 3JC6C 4JEHB 3UU4A 2WU2A 5AQLB 3ZN1B 4GYSA 4TNVA 3PUVF 4H9SE 4ILCA 4TWDA 1FMWA 5AQIB 5FXZA 1H7CA 2WMOA 3FHNA 4GIWA 3A7MA 3C4XA 2M6BA 2X9XA 4IE4A 1HFAA 4U33A 4FJOA 4UV8B 5F8PA 1LVKA 2B1EA 3RPUA 3SS1A 3P4PA 2KZ7B 2HN2A 2XJ7A 3R6NA 5CA1E 4JI4T 2NTXA 1WLXA 2YDSA 3RH3A 3FZMB 3SFDA 4YTNA 5M4YA 4B3ST 4MFRA 4EB6E 4OHFA 4AQFA 3J7Yq 4DR3T 2Q9QB 5AQPB 5FP3A 2ACZA 3KDSE 2MTQA 4LF8T 2VL8A 4AISA 1ZKEA 2BKPA 4YT0A 5LGNB 4BAYB 5F5WA 3ZCIA 1OXZA 2VKOA 1XDPA 1QSDA 3RRCA 2G0UA 2AXDS 3HKBE 2RA1A 3H3AA 2XQ3A 4OYJA 1UX4A 1R8IA 2VKHA 4X66T 4LFCT 3RYIE 1U4QA 4QWNB 2V5CA 4HKAA 2CXFA 4O4LE 3ONXA 4YLHA 2XQ6A 2E8IA 2NW9A 1YQ4A 4QXHB 4UF0B 4HWCA 5JR9A 4IDOA 4MLKA 1HNZT 3OKQA 4GKJT 1IJ6A 3D0TA 2LOPA 3G06A 4HWIB 4HN9A 5LB7B 2JMKA 4HWFA 2PJQA 4DV6T 4ISSA 5AQSB 2FUPA 4YHHT 2D5UA 4AXPA 3AB3B 2FBWA 1UCUA 2QRXA 2ODVA 3K3NA 3ONLC 2XY8B 4ZOLE 3UT5E 5JRCB 3N2OA 3EABA 3QC9A 3RYHE 5IYZE 4I0UA 3F31A 4X1IE 4PFOA 2BG9C 3FB2A 4G63A 1KFYA 1S35A 4KI0F 5FYMA 4KMCA 3UUMA 4YTPA 2NW7A 2IW5B 3QB5K 2LLYA 3PUSA 5LCYA 2QVAA 2V6YB 2LEHA 3RX6A 3U78A 4CI2B 4JI6T 1AJ3A 1T98A 3VRAA 4JUYA 2V6XA 5J1GA 3QOFA 1J5ET 3GN5A 3RHWA 4DBRA 3EAMA 3PUXF 2ZM6T 4DO0A 1VRBA 5DABA 2W66A 2I0MA 3IHRA 1WFDA 4PJJA 2CLYC 2V7LA 2Y48B 4TV9E 2K24A 2KLQA 4LMLA 2CPTA 4DNDA 4P0AA 1OEDE 3CX7B 4N78D 3NRXA 2NOXA 2X0YA 4PJNA 4IDQA 3O1HA 3CX8B 1U5PA 3AE1A 3K1SA 3MZKB 4O8SA 3HL6A 4DV0T 3CMLA 2EHOC 1ZOYA 4GKKT 4I4TE 1NWMX 2Z6EA 4IE0A 4JYAT 3B57A 2VURA 4UXNB 5EK3A 4C90A 2W2UA 2RPAA 3FZFB 3KFWX 4I43B 4EEBA 5JDLA 4JI0T 4JI1T 1M62A 2LKGA 3AEAA 4DV5T 3PUYF 3GWHA 5J2TE 3MXZA 2WU5A 4NXMT 2A3DA 4UV9B 2J47A 2LSGA 2XUEA 3UULA 3SFEA 3ZN0B 4AI6A 5AFUL 2YEVC 3TLVA 3MK7C 5HEGA 2KT9A 4KP3C 1XNRT 2DWGA 5L3EB 1MNEA 3BQKA 3UU6A 4IDPA 2V26A 1YXRA 1MMGA 1UGOA 1XMQT 2A2FX 1Z0PA 3N2GE 3A8YC 5JDHA 1M7KA 4PK4A 3VR8A 2LRKA 1QUUA 2KWHA 2X0HA 4H9QC 5TAOA 4AIUA 4I55E 4EV6A 4OX9T 5AQRB 2YKSA 3PJAA 2KWIB 2VWAA 4OFZA 4QH5A 5L3FB 1FIOA 1UX5A 4IHJE 2W67A 4TX5A 1KNZA 2LHRA 5JVDE 1L0VA 4YXDA 1ZHCA 3JADA 4HGAA 4DV3T 4HFEA 3ZT5A 2PFVA 2L8KA 3AE9A 3JC6D 5LOVE 3ZYLA 5CFBA 5FXWA 1N36T 3C4WA 4XBFB 2IC6A 4UEMA 2PG8A 2V7KA 3X1DA 3PTRB 1SE7A 5ETWA 2XAQB 2Y6XA 2YOEA 4ASKA 3HR0A 2UXDT 2ZM2A 2C0SA 3TLSA 5AQGB 2JIWA 4DR4T 2C5JA 1ZEEA 3H3MA 2D0UA 3Q5DA 4H9NC 3RF1A 2YK0A 3ZLIA 5C8YE 2MAWA 2H7OA 3VU7H 2IDOB 3PU3A 4X64T 1MMAA 2GK9A 3AE7A 4DUZT 1KNPA 1MIWA 2W4XA 5LNKA 3Q5XA 2XTLA 4O4JE 2H3RA 2X9YA 4QX8B 2MBGA 4JV5T 1I94T 2BDEA 1HX8A 3EDVA 3PU8A 3P4SA 3PUWF 3DTOA 1HTJF 4HFVA 4U7YA 3P4WA 3RC3A 3ZT6A 3FZLB 4X1YE 2V1DB 1E1HB 2XAFB 1D1AA 5ABEA 1W0BA 2ACXA 3Q5WA 5LMNT 4ILAA 1IBKT 3M3ZB 1G8XA 2EHOD 3KINB 1FMVA 2V5DA 2QYWA 3IEEA 1O3XA 3W15B 4DUYT 3AA6B 1HX1B 3EUHA 2KINB 4GK0E 4E7ZA 5EK2A 1Y01A 1MNDA 1D1CA 1FEWA 2ES0A 3K8PC 1Y64B 5JDGA 1SHZC 2E9XD 3ZCJA 2BKNA 3N5LA 4EEDA 4DR5T 3CK6A 4MALA 4EZHA 1W0AA 3WI3A 4ZI2C 2VQET 2JMHA 4JI5T 2V7IA 2N1GA 3OJAA 3PUAA 3ZSSA 5J0ZA 2NR4A 2RP4A 4CN4A 5JDNA 1BR2A 5FL1A 3RC8A 4IT4A 1HCIA 2XQ4A 4WYVA 5FVLA 5FY1A 1XNQT 1KF6A 4O4HE 4BA9A 1J1JA 2YDRA 1E7PA 2HN1A 3HKCE 2ZMAA 3CPZA 3M65A 2XQ9A 5HXRA 4U2YA 4U31A 4EGWA 3AE5A 2CXLA 5ABGA 3K3OA 4A5XA 5L3BB 5L2LA 3AEEA 4L0RA 3PUZF 5AQHB 4H9PC 4BJMA 2N2NA 4MBQA 4DR6T 2CLYB 2V8SV 2HH7A 5LHIB 4AKIA 2BVMA 2W00A 3NKZA 2LJLA 4ZZCA 2ODUA 4TV8E 4DBQA 5LXTE 2EHOA 2LSKA 1XWMA 3F2EA 4XZCA 4LMJA 2WWVA 3RGLA 1WCRA 2BG9A 5HAXA 1OWAA 2UUCT 1IJ5A 4ZEYA 3LFMA 2UXCT 3MJXA 5LJNA 1YKHB 3PUGA 3AE6A 4ILBA 2IC9A 2K5BB 2W0GA 3NVOA 2FJEA 1OEDC 2JQHA 1GQEA 2LM9A 2VL0A 4LMKA 1IZNB 2WY2A 4P0BA 2V7MA 3AA7B 3E0ZA 3P4QA 2X51A 5BR8T 1S94A 3CVRA 5CA0E 4DR1T 3FBLA 2IMLA 2XQ5A 5JREA 2XM1A 3ETUA 3UU8A 2UU9T 4DR7T 4KUMB 2VKJA 2E9XC 2UXXB 1V9DA 2YINA 5FMNA 2K9AA 3UU5A 3V5SA 4EZ4A 4IREA 4QHOA 2FJDA 3TLUA 2DI4A 3C98B 2H88A 3I0QA 5L47A 5LGTB 2DWKA 3ZC0A 1WRDA 2LKHA 2Q9QD 2VKDA 3HKDE 3I1AA 2IUBA 4PFPA 3GMIA 3RKGA 1NEKA 3ZC1A 5F3JA 4ERRA 5LG3A 3LK3B 2D2SA 4WW0A 3ETVA 3I9WA 3LDQB 2NW8A 3QK6A 4FI5A 5AQKB 3UU3A 3AE4A 2CWOA 4DV4T 2CBJA 4X20E 2A72A 2M6IA 3ZYKA 4O2BE 5EK4A 5KMGP 2HPLA 2VQFT 3GN5B 4HFCA 4IGUA 4EIWA 3VKGA 4C91A 4ISTA 3KVBA 3T1YT 2WDRA 2CEAA 2CWYA 2NP9A 4NUUA 4O4IE 3BQLA 3LSVA 3ZSTA 3LJCA 2PBIA 2VASA 4Z90A 4V1Av 3Q9DA 4EXTA 1X79A 2BBHA 2LSYA 4H63H 3GA8A 5HYAA 4H9RC 4P09A 4A98A 4JI3T 2CA5A 3IBPA 4J2CA 2WQYA 2XQAA 4IDZA 1WYCA 5J2UE 1LVFA 3HA4A 3WAKA
chains in the Genus database with same CATH topology
4DR4T 4JI4T 2HHHT 4B3ST 4DR3T 4X64T 4GKKT 4DUZT 4DV7T 5IWAT 4LF8T 2UUBT 4JV5T 4DV2T 1I94T 4X65T 4JI7T 4X66T 1IBKT 4LFCT 4NXMT 5LMNT 1IBMT 2E5LT 4YY3T 4DUYT 4GKJT 1HNZT 4NXNT 4DV5T 4DR5T 4DV6T 4YHHT 2VQET 4JI5T 2UUAT 1N34T 1XNQT 4LFAT 4B3RT 1IBLT 4JI6T 4DR6T 4JI8T 4KHPT 1J5ET 2ZM6T 4DR2T 2UUCT 1HNXT 2UXCT 1N32T 3OTOT 4DV1T 2UXBT 4DV0T 4LFBT 3T1HT 4DR1T 1N33T 4X62T 4JYAT 2UU9T 4DR7T 4B3TT 4JI0T 4JI1T 4LF6T 1HNWT 4LF4T 4B3MT 2F4VT 4JI2T 1HR0T 1XNRT 4LF7T 4DV4T 2VQFT 4AQYT 1XMQT 1XMOT 4LF9T 3T1YT 4LF5T 4OX9T 1FJGT 5LMUT 4K0KT 4DV3T 4JI3T 1N36T 5BR8T 2UXDT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR4 T;  4JI4 T;  2HHH T;  4B3S T;  4DR3 T;  4X64 T;  4GKK T;  4DUZ T;  4DV7 T;  5IWA T;  4LF8 T;  2UUB T;  4JV5 T;  4DV2 T;  1I94 T;  4X65 T;  4JI7 T;  4X66 T;  1IBK T;  4LFC T;  4NXM T;  5LMN T;  1IBM T;  2E5L T;  4YY3 T;  4DUY T;  4GKJ T;  1HNZ T;  4NXN T;  4DV5 T;  4DR5 T;  4DV6 T;  4YHH T;  2VQE T;  4JI5 T;  2UUA T;  1N34 T;  1XNQ T;  4LFA T;  4B3R T;  1IBL T;  4JI6 T;  4DR6 T;  4JI8 T;  4KHP T;  1J5E T;  2ZM6 T;  4DR2 T;  2UUC T;  1HNX T;  2UXC T;  1N32 T;  3OTO T;  4DV1 T;  2UXB T;  4DV0 T;  4LFB T;  3T1H T;  4DR1 T;  1N33 T;  4X62 T;  4JYA T;  2UU9 T;  4DR7 T;  4B3T T;  4JI0 T;  4JI1 T;  4LF6 T;  1HNW T;  4LF4 T;  4B3M T;  2F4V T;  4JI2 T;  1HR0 T;  1XNR T;  4LF7 T;  4DV4 T;  2VQF T;  4AQY T;  1XMQ T;  1XMO T;  4LF9 T;  3T1Y T;  4LF5 T;  4OX9 T;  1FJG T;  5LMU T;  4K0K T;  4DV3 T;  4JI3 T;  1N36 T;  5BR8 T;  2UXD T; 
#chains in the Genus database with same CATH topology
 3I9Y A;  5HEU A;  2WS3 A;  3L39 A;  5HXC A;  4ZZB A;  1DU2 A;  3RI5 A;  5LHG B;  3FXE B;  3RIU A;  3P8C D;  5HXS A;  2XAH B;  3QB5 A;  3NZP A;  4A56 A;  5KDM C;  5L3G B;  1BR4 A;  4TUY E;  4DV7 T;  2MOZ A;  4GOU A;  4Z91 A;  1NAF A;  2CMR A;  3KV5 A;  3MKD A;  3N2K E;  3ZMV B;  4CN1 A;  3UTK A;  2I6H A;  5LG4 A;  4E7S A;  5FKY A;  5IWA T;  2LSI A;  2R6G F;  5BMV E;  1HS7 A;  3WAJ A;  3I0O A;  1J5W A;  5LYJ E;  1YW0 A;  2LT3 A;  4DV2 T;  4X65 T;  3V5U A;  5JTG A;  4CI3 B;  2BG9 E;  3FBZ A;  3KVA A;  3RQU A;  1ZP0 A;  3PE0 A;  4AKL A;  4WBO A;  3C50 A;  3UUN A;  2I59 A;  3AXJ A;  4X1K E;  2K3W A;  1KNR A;  5DQV A;  1WR6 A;  2XAJ B;  1VCS A;  5CB4 E;  2YN6 A;  4ZI3 C;  3FZH B;  2CBI A;  4PAG A;  4EYU A;  4NXN T;  2JJ9 A;  3A5X A;  4MHC A;  4P1N A;  4UF0 A;  4HFH A;  4KX6 A;  5C3J A;  1G73 A;  3RIU C;  1XZY A;  2NTY A;  1MIV A;  2DL1 A;  2Y8D A;  3AAE B;  3LBX A;  3ZJ1 A;  2W63 A;  5HXE A;  2Q9Q C;  2QGS A;  3NBX X;  4YTM A;  2MPK A;  5FY0 A;  1CHU A;  1I6Z A;  5JRC A;  1NEN A;  2JRK A;  1HG5 A;  2VB6 A;  3ZYM A;  2UUA T;  5IHY A;  1N34 T;  4NPP A;  4U7I A;  5HEO A;  1JNZ A;  3CQX C;  2X67 A;  5AQQ B;  5JDM A;  5L3D B;  2LRL A;  3ZJ2 A;  4A97 A;  2D9D A;  4LFA T;  4F8H A;  4IL4 A;  4HFD A;  4PK6 A;  2XQY A;  3MAC A;  3DP7 A;  2WDQ A;  2XZE A;  3EHZ A;  3ESL A;  4YSZ A;  2XQ8 A;  3ONJ A;  2IIU A;  2CM0 A;  3TLW A;  5LJM A;  1IBL T;  3H37 A;  2W61 A;  3RQW A;  3RKO A;  5JR9 C;  5ABF B;  3OYX A;  2CHN A;  1Z8U A;  3HI2 A;  3KV6 A;  3ANW A;  3RLF F;  5AQM B;  4ZS2 A;  4H9O C;  2DNX A;  4I50 E;  3UFG A;  3VR9 A;  2CHO A;  4COF A;  5L3C B;  4U3C A;  2WB5 A;  4YJ2 E;  4YJ3 E;  1E2A A;  1X9B A;  3DJB A;  4L5G A;  4UVC B;  1CUN A;  1OED B;  2BBJ A;  2C5K T;  4UVA B;  3R84 B;  3QNU A;  1N32 T;  2BG9 B;  4JEU B;  4UR9 A;  5LBQ B;  4CN6 A;  1T8B A;  4U74 A;  2XAG B;  2XQ7 A;  5FVK A;  3AVR A;  5FY7 A;  3ZKR A;  3P50 A;  4LFB T;  3T1H T;  2WSS V;  1D0X A;  2OA5 A;  2W62 A;  4K0U A;  5HWX A;  1N33 T;  3PV0 F;  1MMN A;  4X62 T;  1IAP A;  5LA6 E;  3O1I A;  3PDY A;  3KBU A;  3AE2 A;  2XM2 A;  1B7T A;  2AE9 A;  4GK5 E;  5EZY E;  5FL0 A;  5L4H A;  2IAK A;  2WDV A;  4LF6 T;  1HNW T;  4LF4 T;  3O4X E;  4IIJ E;  2E2A A;  2V7J A;  3ZMU B;  3RRW A;  4EYY R;  3ZMS B;  3B13 A;  4ZI3 D;  5AQN B;  4EOZ B;  4WNK A;  2NWB A;  4U2Z A;  2X68 A;  3AA1 B;  5AQT B;  4JI2 T;  2WM9 A;  3SOL A;  2V6Y A;  3IF8 B;  4DMV A;  5JR9 B;  2X0L B;  2X9W A;  3JCF A;  2KXP B;  4TN7 B;  2L3L A;  2XPK A;  1HF8 A;  3QUJ A;  2E9X B;  1WYB A;  2BZB A;  5E0O A;  4UIG A;  4G2A A;  1HR0 T;  1XMO T;  3T8O A;  5HWY A;  5ABH A;  2XHE B;  2CCQ A;  4DVD A;  3E22 E;  3EVY A;  3ANW B;  3BQI A;  3AEF A;  1W09 A;  4CZZ B;  5LMU T;  2X66 A;  4NUV A;  4TWF A;  2OV9 A;  2XSB A;  4ZS3 A;  4JLE A;  4CI1 B;  4XAX B;  5AQO B;  3BK9 A;  1T7S A;  1EZ3 A;  2BVL A;  1UUR A;  2X9H A;  2K48 A;  3JAE A;  3KBT A;  2WMN A;  3N9M A;  3AEB A;  4HFI A;  5DJQ C;  1SUM B;  3RIF A;  2H7V C;  3RIA A;  3C4Z A;  1QLB A;  1VOM A;  3N9N A;  4KHZ F;  4KBM B;  4QX7 B;  4TZ4 C;  3TLT A;  2BKO A;  4HWD A;  4QXB B;  3OYZ A;  3UUB A;  4CQI A;  3ZEF B;  3EI0 A;  4OK0 A;  5AQU B;  4ANJ A;  5LHH B;  1W9R A;  2QA7 A;  4PNI A;  2HHH T;  2JQQ A;  3KV9 A;  2JQK A;  3AA0 B;  3F57 A;  2OLT A;  2IHR 1;  1D0Z A;  1XDO A;  5HEH A;  3UUX B;  4ZHQ E;  3CQC B;  4JBW F;  4AKH A;  5C2T A;  3NZQ A;  1ZV4 X;  3CWZ B;  3L8R A;  3RYF E;  2DLR A;  5FXX A;  3UQ7 A;  2UUB T;  1WR0 A;  2SPC A;  3K3Q C;  3SRZ A;  4O2A E;  3Q2M A;  1D0Y A;  2FJA A;  3KV4 A;  5KXJ A;  4Q25 A;  3MA9 A;  3B5M A;  3LG7 A;  4YY3 T;  4JI7 T;  2WWU A;  1VCT A;  2HPJ A;  3O1J A;  4AKG A;  3UQ4 A;  2LHN A;  1IBM T;  3N9L A;  3Q5E A;  3P7I A;  3AEG A;  4ADZ A;  2CE7 A;  1LRZ A;  3AXJ B;  3IA3 A;  2BS2 A;  4IE5 A;  2J4G A;  1KK7 A;  1HG2 A;  4ILU A;  4OYK A;  4AQF C;  4CXW A;  4F6R C;  1KEY A;  3ZMZ B;  4HWH A;  2E5V A;  2JQ9 A;  3OBV E;  4TNW A;  3P4R A;  5H6Q B;  2BS4 A;  2E9X A;  2VVS A;  3CIR A;  4NIQ A;  3O9X A;  2E5L T;  3NRY A;  5AQF B;  2M67 A;  2LM2 A;  4AQG A;  2BS3 A;  4IE6 A;  2DHR A;  2WP9 A;  2JPF A;  5KX5 E;  3LBX B;  5LP6 E;  4BJN A;  1BR1 A;  4UEL A;  4TWH A;  3L3P A;  2VVN A;  1UUS A;  2XAS B;  2LSJ A;  4IE7 A;  4YFS A;  4ZXL A;  4ZI7 E;  3AE3 A;  2H89 A;  2YDQ A;  1OED A;  5DQW A;  4EAH A;  2KSR A;  2P9B A;  2J1D G;  2WBL A;  3C64 A;  3RYC E;  4PW8 A;  2N9D A;  3SWH A;  2CXD A;  5JDQ A;  4X5T A;  4B3R T;  1YQ3 A;  4HE8 A;  4HEA A;  3PUR A;  4CXY A;  3TKL B;  2A9U A;  5H6R B;  2WAU A;  2WZI A;  4JI8 T;  3C51 A;  2YU2 A;  4KHP T;  4L9I A;  1BR0 A;  4YSX A;  2CRB A;  3FZK B;  4DR2 T;  2C5I T;  4B6X A;  2FJB A;  4YHJ A;  4IL9 A;  2WCA A;  3CKD A;  3OPC A;  3AEC A;  4IDN A;  5LGU B;  1HNX T;  3U3I A;  2UXN B;  3JAF A;  5ADX L;  1US7 B;  3AED A;  4PJL A;  3OTO T;  2MYS A;  4QH4 A;  5JQG E;  4DV1 T;  2UXB T;  2KND A;  3AE8 A;  4UVB B;  5IUX A;  1LKX A;  5JDF A;  5FXV A;  3ZPO A;  3J9X 1;  3AAI A;  3N9O A;  3LK4 2;  2ZM8 A;  5A1L A;  2ZM0 A;  3AAA B;  5HXH A;  4ZI2 D;  3PUQ A;  3CQG B;  4DID B;  4B3T T;  3L09 A;  1JNR A;  4Z8X A;  3NWI A;  4PK5 A;  2L9Q A;  2WZH A;  1D1B A;  2XSA A;  4U72 A;  5GON E;  5HCJ A;  3S4U A;  3UFE A;  2DCF A;  1YD8 G;  5AQJ B;  4HTE A;  4M1P A;  5CGM A;  4WZX A;  5FNV E;  3CX6 B;  2J62 A;  4HFB A;  4QH1 A;  3ZT7 A;  4B3M T;  4AKR B;  1UK5 A;  4CXX A;  1YKE B;  2F4V T;  3LK2 B;  2VK9 A;  4QKN A;  3VKH A;  5L4E A;  4YSY A;  3VRB A;  2LE8 A;  3VHL A;  4QXC B;  4LF7 T;  3ABV A;  5JH7 E;  3N9P A;  5LBM A;  4WBN E;  1SA0 E;  3OVU A;  3HKE E;  3AVS A;  2LOS A;  1T72 A;  3FXD B;  3N9Q A;  5HCM A;  4AQY T;  2YU1 A;  2EHO B;  4PJM A;  4LF5 T;  2KMF A;  4LF9 T;  2D0T A;  1MIY A;  5ABF A;  2Q9Q A;  5AQV B;  3PJA J;  2ZLY A;  3EDU A;  4DMW A;  2B76 A;  3ZMT B;  5CJ5 A;  1FJG T;  1MMD A;  5HEJ A;  3E08 A;  4GYR A;  4K0K T;  4H63 V;  2PTF A;  3JC6 C;  4JEH B;  3UU4 A;  2WU2 A;  5AQL B;  3ZN1 B;  4GYS A;  4TNV A;  3PUV F;  4H9S E;  4ILC A;  4TWD A;  1FMW A;  5AQI B;  5FXZ A;  1H7C A;  2WMO A;  3FHN A;  4GIW A;  3A7M A;  3C4X A;  2M6B A;  2X9X A;  4IE4 A;  1HFA A;  4U33 A;  4FJO A;  4UV8 B;  5F8P A;  1LVK A;  2B1E A;  3RPU A;  3SS1 A;  3P4P A;  2KZ7 B;  2HN2 A;  2XJ7 A;  3R6N A;  5CA1 E;  4JI4 T;  2NTX A;  1WLX A;  2YDS A;  3RH3 A;  3FZM B;  3SFD A;  4YTN A;  5M4Y A;  4B3S T;  4MFR A;  4EB6 E;  4OHF A;  4AQF A;  3J7Y q;  4DR3 T;  2Q9Q B;  5AQP B;  5FP3 A;  2ACZ A;  3KDS E;  2MTQ A;  4LF8 T;  2VL8 A;  4AIS A;  1ZKE A;  2BKP A;  4YT0 A;  5LGN B;  4BAY B;  5F5W A;  3ZCI A;  1OXZ A;  2VKO A;  1XDP A;  1QSD A;  3RRC A;  2G0U A;  2AXD S;  3HKB E;  2RA1 A;  3H3A A;  2XQ3 A;  4OYJ A;  1UX4 A;  1R8I A;  2VKH A;  4X66 T;  4LFC T;  3RYI E;  1U4Q A;  4QWN B;  2V5C A;  4HKA A;  2CXF A;  4O4L E;  3ONX A;  4YLH A;  2XQ6 A;  2E8I A;  2NW9 A;  1YQ4 A;  4QXH B;  4UF0 B;  4HWC A;  5JR9 A;  4IDO A;  4MLK A;  1HNZ T;  3OKQ A;  4GKJ T;  1IJ6 A;  3D0T A;  2LOP A;  3G06 A;  4HWI B;  4HN9 A;  5LB7 B;  2JMK A;  4HWF A;  2PJQ A;  4DV6 T;  4ISS A;  5AQS B;  2FUP A;  4YHH T;  2D5U A;  4AXP A;  3AB3 B;  2FBW A;  1UCU A;  2QRX A;  2ODV A;  3K3N A;  3ONL C;  2XY8 B;  4ZOL E;  3UT5 E;  5JRC B;  3N2O A;  3EAB A;  3QC9 A;  3RYH E;  5IYZ E;  4I0U A;  3F31 A;  4X1I E;  4PFO A;  2BG9 C;  3FB2 A;  4G63 A;  1KFY A;  1S35 A;  4KI0 F;  5FYM A;  4KMC A;  3UUM A;  4YTP A;  2NW7 A;  2IW5 B;  3QB5 K;  2LLY A;  3PUS A;  5LCY A;  2QVA A;  2V6Y B;  2LEH A;  3RX6 A;  3U78 A;  4CI2 B;  4JI6 T;  1AJ3 A;  1T98 A;  3VRA A;  4JUY A;  2V6X A;  5J1G A;  3QOF A;  1J5E T;  3GN5 A;  3RHW A;  4DBR A;  3EAM A;  3PUX F;  2ZM6 T;  4DO0 A;  1VRB A;  5DAB A;  2W66 A;  2I0M A;  3IHR A;  1WFD A;  4PJJ A;  2CLY C;  2V7L A;  2Y48 B;  4TV9 E;  2K24 A;  2KLQ A;  4LML A;  2CPT A;  4DND A;  4P0A A;  1OED E;  3CX7 B;  4N78 D;  3NRX A;  2NOX A;  2X0Y A;  4PJN A;  4IDQ A;  3O1H A;  3CX8 B;  1U5P A;  3AE1 A;  3K1S A;  3MZK B;  4O8S A;  3HL6 A;  4DV0 T;  3CML A;  2EHO C;  1ZOY A;  4GKK T;  4I4T E;  1NWM X;  2Z6E A;  4IE0 A;  4JYA T;  3B57 A;  2VUR A;  4UXN B;  5EK3 A;  4C90 A;  2W2U A;  2RPA A;  3FZF B;  3KFW X;  4I43 B;  4EEB A;  5JDL A;  4JI0 T;  4JI1 T;  1M62 A;  2LKG A;  3AEA A;  4DV5 T;  3PUY F;  3GWH A;  5J2T E;  3MXZ A;  2WU5 A;  4NXM T;  2A3D A;  4UV9 B;  2J47 A;  2LSG A;  2XUE A;  3UUL A;  3SFE A;  3ZN0 B;  4AI6 A;  5AFU L;  2YEV C;  3TLV A;  3MK7 C;  5HEG A;  2KT9 A;  4KP3 C;  1XNR T;  2DWG A;  5L3E B;  1MNE A;  3BQK A;  3UU6 A;  4IDP A;  2V26 A;  1YXR A;  1MMG A;  1UGO A;  1XMQ T;  2A2F X;  1Z0P A;  3N2G E;  3A8Y C;  5JDH A;  1M7K A;  4PK4 A;  3VR8 A;  2LRK A;  1QUU A;  2KWH A;  2X0H A;  4H9Q C;  5TAO A;  4AIU A;  4I55 E;  4EV6 A;  4OX9 T;  5AQR B;  2YKS A;  3PJA A;  2KWI B;  2VWA A;  4OFZ A;  4QH5 A;  5L3F B;  1FIO A;  1UX5 A;  4IHJ E;  2W67 A;  4TX5 A;  1KNZ A;  2LHR A;  5JVD E;  1L0V A;  4YXD A;  1ZHC A;  3JAD A;  4HGA A;  4DV3 T;  4HFE A;  3ZT5 A;  2PFV A;  2L8K A;  3AE9 A;  3JC6 D;  5LOV E;  3ZYL A;  5CFB A;  5FXW A;  1N36 T;  3C4W A;  4XBF B;  2IC6 A;  4UEM A;  2PG8 A;  2V7K A;  3X1D A;  3PTR B;  1SE7 A;  5ETW A;  2XAQ B;  2Y6X A;  2YOE A;  4ASK A;  3HR0 A;  2UXD T;  2ZM2 A;  2C0S A;  3TLS A;  5AQG B;  2JIW A;  4DR4 T;  2C5J A;  1ZEE A;  3H3M A;  2D0U A;  3Q5D A;  4H9N C;  3RF1 A;  2YK0 A;  3ZLI A;  5C8Y E;  2MAW A;  2H7O A;  3VU7 H;  2IDO B;  3PU3 A;  4X64 T;  1MMA A;  2GK9 A;  3AE7 A;  4DUZ T;  1KNP A;  1MIW A;  2W4X A;  5LNK A;  3Q5X A;  2XTL A;  4O4J E;  2H3R A;  2X9Y A;  4QX8 B;  2MBG A;  4JV5 T;  1I94 T;  2BDE A;  1HX8 A;  3EDV A;  3PU8 A;  3P4S A;  3PUW F;  3DTO A;  1HTJ F;  4HFV A;  4U7Y A;  3P4W A;  3RC3 A;  3ZT6 A;  3FZL B;  4X1Y E;  2V1D B;  1E1H B;  2XAF B;  1D1A A;  5ABE A;  1W0B A;  2ACX A;  3Q5W A;  5LMN T;  4ILA A;  1IBK T;  3M3Z B;  1G8X A;  2EHO D;  3KIN B;  1FMV A;  2V5D A;  2QYW A;  3IEE A;  1O3X A;  3W15 B;  4DUY T;  3AA6 B;  1HX1 B;  3EUH A;  2KIN B;  4GK0 E;  4E7Z A;  5EK2 A;  1Y01 A;  1MND A;  1D1C A;  1FEW A;  2ES0 A;  3K8P C;  1Y64 B;  5JDG A;  1SHZ C;  2E9X D;  3ZCJ A;  2BKN A;  3N5L A;  4EED A;  4DR5 T;  3CK6 A;  4MAL A;  4EZH A;  1W0A A;  3WI3 A;  4ZI2 C;  2VQE T;  2JMH A;  4JI5 T;  2V7I A;  2N1G A;  3OJA A;  3PUA A;  3ZSS A;  5J0Z A;  2NR4 A;  2RP4 A;  4CN4 A;  5JDN A;  1BR2 A;  5FL1 A;  3RC8 A;  4IT4 A;  1HCI A;  2XQ4 A;  4WYV A;  5FVL A;  5FY1 A;  1XNQ T;  1KF6 A;  4O4H E;  4BA9 A;  1J1J A;  2YDR A;  1E7P A;  2HN1 A;  3HKC E;  2ZMA A;  3CPZ A;  3M65 A;  2XQ9 A;  5HXR A;  4U2Y A;  4U31 A;  4EGW A;  3AE5 A;  2CXL A;  5ABG A;  3K3O A;  4A5X A;  5L3B B;  5L2L A;  3AEE A;  4L0R A;  3PUZ F;  5AQH B;  4H9P C;  4BJM A;  2N2N A;  4MBQ A;  4DR6 T;  2CLY B;  2V8S V;  2HH7 A;  5LHI B;  4AKI A;  2BVM A;  2W00 A;  3NKZ A;  2LJL A;  4ZZC A;  2ODU A;  4TV8 E;  4DBQ A;  5LXT E;  2EHO A;  2LSK A;  1XWM A;  3F2E A;  4XZC A;  4LMJ A;  2WWV A;  3RGL A;  1WCR A;  2BG9 A;  5HAX A;  1OWA A;  2UUC T;  1IJ5 A;  4ZEY A;  3LFM A;  2UXC T;  3MJX A;  5LJN A;  1YKH B;  3PUG A;  3AE6 A;  4ILB A;  2IC9 A;  2K5B B;  2W0G A;  3NVO A;  2FJE A;  1OED C;  2JQH A;  1GQE A;  2LM9 A;  2VL0 A;  4LMK A;  1IZN B;  2WY2 A;  4P0B A;  2V7M A;  3AA7 B;  3E0Z A;  3P4Q A;  2X51 A;  5BR8 T;  1S94 A;  3CVR A;  5CA0 E;  4DR1 T;  3FBL A;  2IML A;  2XQ5 A;  5JRE A;  2XM1 A;  3ETU A;  3UU8 A;  2UU9 T;  4DR7 T;  4KUM B;  2VKJ A;  2E9X C;  2UXX B;  1V9D A;  2YIN A;  5FMN A;  2K9A A;  3UU5 A;  3V5S A;  4EZ4 A;  4IRE A;  4QHO A;  2FJD A;  3TLU A;  2DI4 A;  3C98 B;  2H88 A;  3I0Q A;  5L47 A;  5LGT B;  2DWK A;  3ZC0 A;  1WRD A;  2LKH A;  2Q9Q D;  2VKD A;  3HKD E;  3I1A A;  2IUB A;  4PFP A;  3GMI A;  3RKG A;  1NEK A;  3ZC1 A;  5F3J A;  4ERR A;  5LG3 A;  3LK3 B;  2D2S A;  4WW0 A;  3ETV A;  3I9W A;  3LDQ B;  2NW8 A;  3QK6 A;  4FI5 A;  5AQK B;  3UU3 A;  3AE4 A;  2CWO A;  4DV4 T;  2CBJ A;  4X20 E;  2A72 A;  2M6I A;  3ZYK A;  4O2B E;  5EK4 A;  5KMG P;  2HPL A;  2VQF T;  3GN5 B;  4HFC A;  4IGU A;  4EIW A;  3VKG A;  4C91 A;  4IST A;  3KVB A;  3T1Y T;  2WDR A;  2CEA A;  2CWY A;  2NP9 A;  4NUU A;  4O4I E;  3BQL A;  3LSV A;  3ZST A;  3LJC A;  2PBI A;  2VAS A;  4Z90 A;  4V1A v;  3Q9D A;  4EXT A;  1X79 A;  2BBH A;  2LSY A;  4H63 H;  3GA8 A;  5HYA A;  4H9R C;  4P09 A;  4A98 A;  4JI3 T;  2CA5 A;  3IBP A;  4J2C A;  2WQY A;  2XQA A;  4IDZ A;  1WYC A;  5J2U E;  1LVF A;  3HA4 A;  3WAK A; 
#chains in the Genus database with same CATH homology
 4DR4 T;  4JI4 T;  2HHH T;  4B3S T;  4DR3 T;  4X64 T;  4GKK T;  4DUZ T;  4DV7 T;  5IWA T;  4LF8 T;  2UUB T;  4JV5 T;  4DV2 T;  1I94 T;  4X65 T;  4JI7 T;  4X66 T;  1IBK T;  4LFC T;  4NXM T;  5LMN T;  1IBM T;  2E5L T;  4YY3 T;  4DUY T;  4GKJ T;  1HNZ T;  4NXN T;  4DV5 T;  4DR5 T;  4DV6 T;  4YHH T;  2VQE T;  4JI5 T;  2UUA T;  1N34 T;  1XNQ T;  4LFA T;  4B3R T;  1IBL T;  4JI6 T;  4DR6 T;  4JI8 T;  4KHP T;  1J5E T;  2ZM6 T;  4DR2 T;  2UUC T;  1HNX T;  2UXC T;  1N32 T;  3OTO T;  4DV1 T;  2UXB T;  4DV0 T;  4LFB T;  3T1H T;  4DR1 T;  1N33 T;  4X62 T;  4JYA T;  2UU9 T;  4DR7 T;  4B3T T;  4JI0 T;  4JI1 T;  4LF6 T;  1HNW T;  4LF4 T;  4B3M T;  2F4V T;  4JI2 T;  1HR0 T;  1XNR T;  4LF7 T;  4DV4 T;  2VQF T;  4AQY T;  1XMQ T;  1XMO T;  4LF9 T;  3T1Y T;  4LF5 T;  4OX9 T;  1FJG T;  5LMU T;  4K0K T;  4DV3 T;  4JI3 T;  1N36 T;  5BR8 T;  2UXD T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...