The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
191
|
structure length |
188
|
Chain Sequence |
b'MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQLLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPII'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of ubiquitylated-Rpn10 provides insight into its autoregulation mechanism.
pubmed doi rcsb |
molecule keywords |
26S proteasome regulatory subunit RPN10
|
source organism |
Saccharomyces cerevisiae (strain atcc 204508 / s288c)
|
molecule tags |
Ubiquitin-binding protein
|
total genus |
58
|
structure length |
188
|
sequence length |
191
|
ec nomenclature | |
pdb deposition date | 2016-08-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13519 | VWA_2 | von Willebrand factor type A domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | von Willebrand factor, type A domain |