5LN1A

Structure of ubiquitylated-rpn10 from yeast;
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
188
Chain Sequence
MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQLLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome regulatory subunit RPN10
publication title Structure of ubiquitylated-Rpn10 provides insight into its autoregulation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule tags Ubiquitin-binding protein
total genus 58
structure length 188
sequence length 191
ec nomenclature
pdb deposition date 2016-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13519 VWA_2 von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 5ln1A01
1N9ZA 3FCUB 5HDBB 4Z7QB 5LN1A 2VDOB 4IXDA 1IJBA 3FCSB 3ZDZB 2I6SA 4DMUB 1ZONA 3ZE2B 2M32A 1JEYB 4G1MB 1JV2B 4MMXB 1JEQB 1QC5A 4IGIA 2X5NA 2I6QA 3EFOB 2IUEA 4Z7OB 1MJNA 3HI6A 2NUTB 1TYEB 3NIGB 3HXQA 1L5GB 3NIDB 1PT6A 1PCXA 5KYUA 3EGDA 1CQPA 4C2AA 2QTVA 5E6UA 3V4VB 5E6SA 1SHTX 2WW8A 3EG9A 1M2OA 4FX5A 4C29A 4UM9B 3EH1A 3RAGA 2ADFA 4UM9D 5KYYB 2VDLB 3K6SB 1XUOA 5BV8A 2XWBF 1BHQ1 1MQAA 3ZDYB 5ES4B 5E6RA 4JDUA 1ZOPA 4UM8B 5KYWA 3K72B 4NENB 4HQNA 3EOAI 4A0QA 1DZIA 3EH2A 2O7NA 2XGGA 1OAKA 2ODQA 3E2MA 1T0PA 3IJEB 1CK4A 4PN7A 3GXBA 3PPVA 4IHKA 2VC2B 5KYXB 2VDPB 3BQMB 3BN3A 1RRKA 4BJ3A 1M2VB 1JEQA 1SQ0A 4F1KA 3HXOA 3EFOA 1MHPA 3ZDXB 1M1UA 4M76B 4XW2A 4Z7NB 2NUTA 2ICAA 3PPXA 4G1EB 2VDMB 3Q3GE 1DGQA 1LFAA 4WK0B 3NIFB 3V4PB 3VI4B 1MF7A 1PD0A 1IJKA 3EGXB 1SHUX 1U0OC 4WK2B 1YVPA 3TXAA 1IDN1 1QCYA 2B2XA 1FNSA 3PPYA 3K6SA 1M1XB 1XDGA 1YVRA 1ATZA 3T3MB 2VDRB 2WINI 2NUPB 4HQLA 4O02B 2VDKB 3VI3B 1AO3A 1U8CB 1T6BY 1MQ9A 1JLMA 4NENA 4CN8A 4CN9A 4F1JA 3EOBI 4HQKA 3F78A 4C2BA 3QA3E 1JEYA 4HQFA 1IDOA 2XWJI 1UEXC 3PPWA 2VDQB 1RD4A 4MMZB 3T3PB 3TW0A 3IBSA 3K71B 2I91A 1XDDA 1BHO1 1NA5A 1FE8A 1QC5B 1U0NA 5HGJA 1M10A 1MQ8B 5KYXA 3F74A 1M2VA 2NVOA 4HQOA 5KYUB 3EGDB 1PD1A 5HJ2A 5E6UB 5E6SB 3ZE1B 2ODPA 3EG9B 1AOXA 3ZE0B 1V7PC 5KYYA 1RS0A 1AUQA 3TCXB 1N3YA 5KYNA 3EGXA 1Q0PA 4WK4B 4NEHB 3BQNB 2VDNB 3N2NA 3TVYA 4CNBA 4WFQA 5E6RB 1RTKA 3ZQKA 5KYWB 1ZOOA 3M6FA 2NUPA 4MMYB 4WJKB
chains in the Genus database with same CATH superfamily
3FCUB 1W9MA 2TMGA 4Q01A 1SG0A 1Z83A 3BHJA 3KWJA 4WZ6A 4E32A 1KYYA 1VLMA 1UBEA 2IGTA 4JCOA 1IG3A 4A8HA 2QLLA 2BGWA 1BHJA 4GAEA 3PXEA 1RHUA 1Q16A 4D3SA 2Q4DA 4IG4A 1X6VA 4NBNA 3ZV6A 1OBCA 4WX2B 5C52B 1G17A 2OK7A 4XZ3A 5EHQA 4MVJE 3EIHA 3FSGD 4IMPA 4LKRA 5GZ3A 2EHDA 2JCVA 2NGRA 1LPOA 1Z4IA 3AFNA 4DMFA 5TQ0A 3GPBA 3KBOA 5IEBA 1N3IA 4QHYA 4PWZA 3BH6A 1A77A 3SFVA 4BEVA 2CEAA 1Z7EA 2PSJA 1EX1A 5A5VA 1G9XA 2ZSDA 4XUDA 3OQPA 4N6GA 2K6GA 3GBPA 5GWXA 3LUJA 4HJRA 1SHLA 5LOVB 4A36A 4Q9LA 2AVNA 1L7AA 1NW8A 2R25B 3FPLA 4JLNA 3T9CA 3Q7PA 3T9BA 3EZLA 3TG2A 1N1EA 2B6NA 3KQUA 1IL0A 2EFHB 4YQYA 1WP9A 4B76A 2CLKB 2V7QA 5EP2A 2VSNA 4D9FA 3NC1C 1OILA 5FWAA 3IOEA 1MIOB 1QWOA 3W79A 3IODA 4BUCA 4PYJA 1HDXA 3GUZA 4BL5A 4YMUA 4QICA 4CEIB 3I32A 4C6TB 2IHJA 1Y1QA 2RGNC 5EWMB 4EKIA 5J58A 5LJIA 2NVUA 1EFDN 3O6VA 1VJ0A 4ENVA 5AQ1A 3KUCA 5C8YF 1LWOA 5JNVA 4F9GA 3WGJA 2WV9A 1L5ZA 3NYWA 3SZGA 4MB0A 2PKXA 3NIFB 4QVKA 3DBRB 4DNOA 5CK4A 3T5GA 4U1RA 1CLEA 3ZVRA 1XDZA 1DINA 2HDWA 3I2KA 1PEKE 1C81A 1GGFA 4KO2S 1LXCA 1GPWB 4MINA 3H7AA 3NBQA 1UDAA 1AHHA 4IP0A 3L7DA 4OU5A 4S35A 4U02A 2VHZA 4RE6A 2ZSHA 4YJ3B 1VFPA 4O02B 2PNJA 4DDWA 1HXHA 1E99A 1PWXA 1NYQA 2ISCA 4CMKA 1KZHA 4KTVE 4JA0A 4JXXA 4HQFA 3CURA 2QGNA 3CEMA 1MC1A 4CG3A 3OLZA 3WGHA 5K0LA 3EZNA 1QK4A 1GXSB 5E7QA 5MFPA 3A9CA 1G5PA 1MOPA 3X1DA 5IF3A 5JJKA 4WLFA 3NDIA 2PX4A 4C0XA 1J00A 2UYCA 5KQMA 5F2EA 1GSHA 4R7TA 2OT3B 3L0CA 2AOWA 2VUHB 2IBSA 2I7TA 3QIVA 3ZV7A 3FYUC 1LK5A 1QO9A 2H29A 3O5AA 3S2SA 1TU3A 4LYJA 3KPUA 4B6GA 1R6VA 4IJ6A 1G2QA 1JLLB 2CLMB 4KQXA 3AL2A 4IMRA 1ISJA 5DXAA 3WGUA 3MINB 4YV7A 2OO7A 5KC9A 2Z8YM 1NE7A 2AJDA 4YDHB 5T4FA 3BS4A 3KCQA 2A2ZA 2COKA 3Q98A 4G37A 4F60A 3UB4A 1IZ9A 2V0GA 1KORA 4A92A 2QG9A 2WVHA 2W2KA 3DL2A 2Y0CA 5FOWA 4DMHA 3UMYA 1YCHA 1B43A 3FPFA 1WLSA 3D54D 4FEAA 5C3MA 2B4YA 1FUIA 1R6BX 3ZY2A 1JDUA 2GAAA 3IKMB 4IFEA 2X4GA 4DZTA 4M9XA 4GKAA 1E2BA 3BL8A 4PSDA 5JCOC 4KHPB 1U7ZA 4OMFG 3UMRA 3VBCA 3WWDA 2QQ0A 4Z0PA 4KW7A 3V1KA 4BO2A 2ZDQA 3HXTA 3THWA 2MHCA 1Z68A 1DOAA 2HA5A 1REQB 1IEWA 3MT0A 1NKVA 3D8BA 2PZJA 1A2QA 1L7MA 1ZUNB 4WNIA 4DRXA 2WOOA 2YVAA 2A4KA 3L18A 1HE1C 1GL9B 4DB4A 1UPAA 2I4OA 2ZRLA 3P20A 2GRUA 2XY4A 3W5UA 4LBZA 1X7ZB 2QVLA 4Z2YA 4FJ0A 1TLTA 3TZCA 2A1TS 1A5TA 3IYLW 4TXJA 3VV3A 2P3OA 4JMLA 2DMRA 2NYVA 2BJHA 3AESA 3INNA 2VQFB 1AJEA 4JQCA 3PEUA 1WXIA 2OZEA 3M1LA 1ISSA 4HHEA 3TQCA 1G19A 4JT4A 5BP7A 3Q8LA 3WOHA 3H0EA 1NW7A 4JBXA 4OGKA 4B3BA 4WJZA 3GRZA 1SC9A 4YFVA 1T9ZA 4F3NA 5LC1A 3KQNA 2A8YA 3IERA 3HSYA 5BR1A 1QH1B 5IU6A 4U0JA 3UJ9A 1A82A 2HJHA 4GNKA 4TM8A 3E35A 4R1OA 4BO5A 1E6WA 1L5HB 3OFKA 4FYIA 3CPHA 4AZ3B 2ZVQX 4CM5A 2FR0A 3N87A 5A7HA 2YOGA 3HB7A 1WZEA 1A7JA 1RVV1 2Y1GA 3QP9A 3PPXA 4YO7A 4DSUA 3GLHE 3FRHA 4HRXA 3T95A 3K6RA 4YRMA 1ISGA 5ALIA 1LPPA 3ND5A 2O5VA 2KWIA 2FI1A 4JNKA 2ZJYA 1IRIA 3ORRA 2XNKA 2GNAA 3TXAA 4B9EA 5FWXB 4D26A 2PAAA 1U1IA 1INLA 1C9MA 3J7AC 3D4IA 2VTEA 1K27A 4DJFC 5IUJC 1NZFA 3PD1A 1GGKA 1HDGO 3GFTA 3CX4A 1SCKA 3MD0A 4IR7A 5JALA 4IH1A 1G3RA 4Z9YA 3BXFA 4U2CA 1EFUA 4EGAA 4ES6A 1AV7A 1ZLXA 1G2PA 4D9JA 3PFWO 4BMYA 4F1JA 4ZVSA 1FB5A 2AJ8A 2GZSA 2ZTMA 4RXUA 4U3JA 1UWCA 3WB1A 4RTQA 4CMIB 2VWGA 4CT4B 3KZVA 4ITVA 3EYAA 3LL4A 3FCXA 3TFQA 3MS7A 2ZIUB 1BJRE 4IEFB 3COZA 2PKRA 4LF5B 3EOZA 4BNZA 1ZU5A 3DVQX 5T41A 1QE3A 2RKBA 3HR4A 2O0JA 2GN9A 2EQ5A 4GL4A 3ZH2A 1GFIA 4PZDA 1RYEA 2J41A 2QTVB 3CH6A 3K0EA 4KGZA 4QQNA 3TNYA 3CF4A 1K7FB 1RYDA 1YBFA 3AK4A 3EG9B 4P82A 4E51A 4GT1A 4R2IA 2FDCA 3LP5A 3ZS8A 4EUNA 1JPNA 2QF7A 3DVAB 2MWMA 3GG2A 3HXKA 2GZ3A 1U7DA 4GDMA 1AX9A 2P9YA 2XDWA 3SIXA 2A14A 3LQ4A 4JC4A 4ZYZA 2ECKA 1TL7C 3KE9A 4JELA 2ONCA 1XTPA 4ZDJA 4MW0A 4UHHA 3ID6C 4MUNA 4B7AA 3TG8A 5IM4A 2X0JA 4HDQB 3I76A 1A5SB 3QYAA 1Y3HA 2Q62A 1FFAA 2EHJA 2FPGB 2WJJA 3KQWA 5EXDA 1B3BA 2ZYVX 4F4HA 3RKSA 5EUQB 4W9RA 2GPWA 1NXOA 2PL5A 2OGWA 1JEEA 1R8QA 4F8JA 1JAZA 2BZ0A 2HHAA 2V7GA 3SZUA 2UZ1B 1YI1A 5EN4A 2P5UA 4KO3S 4CM8B 1TJ3A 3L3BA 2PKCA 4AROA 3UK2A 4J03A 3IO3A 2QUZA 4OB6A 2ODTX 2PXAA 4PINA 4EYQA 5DNCA 3T3GA 2IXAA 1NR7A 1GCIA 1BU8A 1ZLYA 2AX4A 3CEPB 1Y9DA 2QE6A 4M1WA 4XWYA 1RCTE 1QGYA 4YH1A 3NB0A 1J9ZA 5DLPA 1H0KA 2YC4C 2D2VA 3FOAA 4KFTA 2OZPA 1ZN2A 4B3IA 4LYDA 3F3YA 1JHDA 3CY6A 2NTEA 3C5CA 3HJUA 3LZ6A 3MGCA 3LQKA 2CVPA 1YZUA 2HMWA 2IEBA 3AY3A 5ESWA 3B20A 3L5KA 2ST1A 1G7CA 4WXEA 3RJ9A 3HSSA 1WPRA 1NMQA 4QODA 4B4KA 4MGEA 3OIWA 2I9KA 3GFOA 3H2JA 2HNKA 3A6HA 3NXKA 3H87A 4IS3A 3LPCA 5CGQB 3QQPA 5HIMA 2WF8A 3SSNA 1NXQA 3SS7X 3UUEA 1WUJS 2RHCA 2XOXA 3IUEA 3ZUPA 1L7RA 2FSHA 2HPAA 2CLOB 4GQBA 4A8TA 2ORYA 2H9IA 3T4PA 4D4IA 1Z2CA 3X1XA 4R54A 2VBGA 1DGQA 5BV1A 4QUIA 1ORTA 3AF5A 4PAGA 2DPLA 4RPKA 2IIQA 1FYVA 2F2TA 3K0BA 1A5AB 2P4HX 4NYIQ 4OXKA 1D09A 4WUTA 4EDFA 4I1PA 4GICA 4FZ3A 3QA9A 4DDTA 4PICA 5T3UA 4LXGA 1NVMB 4IIGA 1OT5A 1PG2A 4L4ZA 4N82A 2REQA 3U39A 2BVNA 1IK6A 2AN1A 2C4WA 1NJ2A 2F1KA 2AOVA 2ZBRA 4WKGA 3J81k 1V9CA 4HDNB 4IY1A 1A69A 3IUPA 3LUCA 1HF3A 5CLJA 3I62A 1LF0A 2D62A 4AKEA 1TVCA 3WK7A 2ZQYA 1AH2A 2QGFA 1OYOA 1OLUA 3C8UA 3UGKA 5K0TA 2CB0A 1VYHA 3ME5A 3IBCA 4LXIA 4RW0A 3HACA 4QJ3A 1JQBA 1E4YA 4H0FA 2H17A 3ESXA 3L43A 1CJBA 3L7CA 1B6RA 1DEHA 3C2QA 4IGEA 1NP6A 1FIUA 4AJ1A 2QX8A 4LRWA 3NNDA 5IKEA 1WB5A 3IO5A 3HVIA 3UKDA 5EG5A 3B9RA 4XJSA 1J8YF 1DQPA 3E3LA 2JGLA 2ZQ5A 1CVRA 2VRWA 3EDRA 5AW0A 1ACMA 4HB3A 4QEZA 3QSGA 3NWBA 2X42A 3H1FA 4Y6SA 2WTUA 5TPZD 3WGTA 3F96A 1N3YA 2CHEA 1V71A 3OBIA 1VL0A 4UCQA 3G8BA 3RTGA 5B6JA 2DEUA 3HE3A 3I5XA 2EKPA 1ESEA 1ICIA 1IPEA 4KSYA 1Q0LA 4ZOAA 1E2KA 3MFQA 1R5BA 3OCXA 3TDKA 2P65A 4GR9A 3IUYA 4M9CA 2C1EA 1JBQA 1GA1A 3NBFA 2R79A 1OR8A 2XSZD 5EZSA 1PJBA 2WNIA 5IBQA 2Q6KA 4QUGA 1Y1SA 3TQFA 1VYVA 2VCEA 4CM1A 4RSGA 4F7WA 3TOCA 4G2TA 3EG5A 4RANA 4TKVA 3CRZA 3SHTA 1GAWA 2OCKA 3H5LA 3GUHA 1P9RA 3OM9A 5A1JA 4DSZA 3E9DA 4O63O 5EZQA 5FPPA 1KYIA 3U19A 3ACBA 2A7XA 3ZR4B 3HUEA 4KFCA 1XEFA 4M0LA 1TLLA 4RIFA 4WL0A 4AP5A 2JGMA 3QEOA 4B71A 4EUEA 1PNRA 2VAMA 1VGRA 2BP7A 4FYXA 1GUBA 5B1EA 4NCNA 4CMJA 1RI5A 2Q8PA 2WPNA 4Y1EA 2H1LA 3ND7A 1MH1A 3C8HA 2W6NA 2ZLBA 1RTTA 3RHZA 3C7AA 5AKHA 1SHZA 3DLAA 1H1TA 2OO3A 1EAYA 3HCBA 1I4WA 4HUTA 4F12A 2JFFA 1UZNA 3CX8A 4TT8A 4YDSA 5TJHA 1TD9A 1EJ6A 4NBSA 1IN4A 2BDUA 1EX7A 2FX3A 4JKIA 4NENB 4UU1A 4EPWA 3VH1A 4G4JA 4B7XA 3H13A 3I72A 2C7VA 4H35A 4U6NA 2H4WA 4TSFA 4PLZA 1H22A 2I2XB 1V1JA 5E1MA 2RH4A 2PZFA 1ADFA 4GKBA 4Z3KA 3W4JA 1WW3A 1X2EA 4L5IA 4PHHA 1PHRA 3ZD9A 4FE4A 4D79A 1ZMTA 3GD7A 4I19A 4KRYA 4YCSA 4Z6KA 5E9JA 5EJIA 2Q7XA 3KYJB 2PLFA 4BO8A 5FOQA 4BJ3A 2HIAA 1E61A 2VSOA 3GJ6A 3ZDXB 1AT1A 3QLUC 2CMDA 4K9QA 5AVKA 3PP8A 1V3VA 2HA3A 5JMOA 5BQ3A 1SIOA 4BVBA 3Q3GE 4LXHA 4BFYA 5HKKD 3U80A 2ZAIA 6REQB 3LVFO 4MNTA 1XLVA 3TO5A 2ZUTA 3EEQA 4PW0A 1AA6A 1NMSA 2JIQA 4JIGA 3AG6A 1YQTA 1UM9A 5JDCA 1HT0A 1YVRA 2OESA 2DX7A 4DA4A 4QSHA 2EQAA 1NI4A 1OMOA 1VHTA 4O5OA 4ZREA 1KXZA 3WJAA 2CGEA 2ZWAA 3QUSA 5E3JA 5ADVA 2VA8A 4MW2A 5H7XA 1Z47A 2SKEA 3C1UA 3OIYA 2BLLA 3O2NA 3HO6A 5K20A 1ZFNA 3TLEA 3DMRA 4C0WA 1VZ2A 3OHMA 2QN2A 5DI3A 5AVTA 4JXZA 3Q6IA 4RO0A 3JQBC 1JMYA 3LTNC 1YOVA 3WAGA 1EK5A 1Z5UA 2DE0X 2QI9F 3K6JA 2A57A 4HGRA 4HL6A 2CXSA 3E7FA 3LG2A 4FE3A 4NWIA 4XVUA 3TOZA 1K5GA 3HCAA 1FVHA 3LBIA 5MGNA 2GCPA 5DM2A 4TLLB 4ZU6X 1OQAA 3AP3A 5ECGC 1E64A 2OKGA 3AQ4A 5JNRA 2SKDA 4QWWA 3IAAA 5C18A 1O0CA 4N49A 1RMQA 1ZRHA 1QCDA 2ORVA 4MYSA 3D8TA 4YAFA 3CH7A 1R00A 2B0CA 3IR7A 4A6XA 4BNXA 2AKEA 3TVYA 4TV8F 3N7AA 2AJBA 5JO9A 1Z29A 4AG6A 1X7HA 1DI0A 3TRJA 5F77A 4ZCMA 4LI3X 1GTRA 1U0LA 5JSHA 4EJ6A 2VJPA 2HWXA 3HKEB 5FI1B 1S2MA 1SRRA 2JGEA 3R0QA 3CTPA 4OXIA 2Y27A 3L1JA 3C6MA 4UTOA 4AWAA 4L76A 4ARBA 3D6JA 2C7BA 1ITZA 1PQ4A 2WSLA 4YRFA 1PJTA 3UJCA 4IXNA 5K6TA 5IC5A 5A3JA 2P7HA 1D7OA 3AUFA 3E6AA 5AKKA 1KZGB 4II3A 4UHKA 1AMOA 4EB0A 1EDOA 3VHQA 2WUEA 3JQAD 4EY3A 1PS9A 1ZM2A 5LXTA 1NBHA 1IYZA 1IQRA 1CP3A 1H0RA 1A3CA 4QHTA 4RDCA 3LW7A 3X2SA 2HHCA 3SF8B 3DJFA 1N9GB 3QLVA 1AKWA 1T1GA 3VOTA 1P45A 4UHFA 1YO6A 5LKAA 2OQIA 2VQDA 4YMIA 4UBMA 4A8JA 5CVDA 3PFHA 2VK2A 2AEEA 1VBMA 3PVZA 1RWQA 3COVA 3LLUA 3G9QA 3L6EA 4RK1A 3BT7A 1MPTA 2GLUA 1R10A 3GRAA 4FB5A 2EVWX 3FAKA 3M9LA 1NQWA 3OCVA 4NVRA 3K0HA 3JAKB 4BGIA 4L4UA 4KWCA 1ZOPA 2R6CA 1O7JA 1R15A 2WKPA 2CXTA 2VCYA 1T3LA 3LZCA 1FP2A 4HRAA 4H60A 2G7MC 2X7XA 2YW2A 2VHQA 3VKUA 2MYNA 4B4UA 5TS2A 3GLUA 3OZFA 5DHQA 1XTZA 5ER6A 4Q7JB 2P9GA 2Z2XA 4JYBA 2CZGA 2BBWA 3R7NA 2OYSA 5DHAA 1PT9A 5AI9A 1RYNA 2C9CA 4ZK6A 4IUCS 2PKYX 4GIBA 2ZT8A 2X86A 1SVWA 3NHZA 5L51A 4XDHA 2WNHA 1ONOA 4DYDA 2JZNA 1BDJA 4NX2A 3W8DA 1E3DA 2GCGA 3NALA 4AULA 2QX9A 1BEZA 4UTPA 4QGFA 4U6QA 5EUMA 1K6IA 5H9WA 5IUNC 1FRZA 2Y71A 2E55A 2I2WA 3IP1A 4UHEA 4BZPA 1FU8A 3MCWA 3M6XA 4GX0A 3V7WA 4MGZR 5HF5A 3ILHA 3BEOA 7MHTA 3WLSA 1Q3HA 3GEHA 1AUPA 5KB3A 4G5RA 4M8NE 3G2HA 5A5EA 2NZWA 2OM6A 5D7BA 1UXHA 1W4AA 4K9OA 3TTUA 4EA8A 2R1TB 2LE0A 1P7CA 1FTGA 3QY9A 4QDJA 3KQPA 4KO4S 5HJEA 2DLNA 4KH1A 4BVKA 4ZT3A 2V4MA 1Z25A 1GAQA 1SC4A 4PG5A 2H2GA 5FTWA 1WQ4A 2LPMA 2MSLA 2Q41A 4NBTA 4BJ5A 1H6DA 1WUTA 2H11A 2F48A 2NPIA 2QSYA 4KWTA 4MMZB 5F76A 5SZIA 4HRVA 4PZLA 2ZIXB 2YC2C 5D8DA 1NKTA 2MYPA 1D6JA 1M34A 4O2BB 3FF4A 1QYXA 2GUGA 2KLHA 3RFFA 1M2NA 5AP9A 4LYYA 2EGGA 3K53A 1NN0A 1SZJG 3H5OA 3GMSA 3Q5DA 4MWDA 5ESRA 5ITZB 2BIFA 2R2AA 2RHGB 5BUSA 4IIJB 1XMIA 3K9QO 4D4JA 5KYYA 3HPQA 4D4HA 1OJLA 3TRKA 1VE5A 3EW9A 1FFCA 4ZKDA 2EATA 2I2DA 3EY4A 2JGRA 3KU1A 1WOYA 3LWZA 5E0KB 2Q6IA 4L75A 1O8BA 4G3XA 5BYKA 2NQTA 3ELWA 2OXCA 4RIHA 4RV9A 1T8UA 4JXKA 2MSEB 3WMEA 1NQOA 3LLSA 4ID9A 1MQSA 1Y9AA 5CVTA 1UEJA 3G9XA 3K2QA 2GK6A 4UEKA 4IXDA 4HWKA 2YRWA 1KSHA 2IOFA 1Z6PA 1YZTA 3WBBA 4C1NA 3SMVA 4WCFB 5HUQA 4W8OA 3BZWA 4MUYA 2VYFA 4F0JA 4PG7A 3W2EA 3K15A 3ZCUA 3K9NA 1JDNA 2WTAA 2H4ZA 1SCIA 1JVSA 1S01A 4CTOA 1XZBA 2C31A 3WHKA 4C4OA 3FA2A 1NATA 3TTTA 1W73A 4OY3A 5KDOA 5JXJA 3EZ2A 5ETJA 5E38A 5AOBA 1RW4A 1VRWA 1X86B 1P2DA 3FRJA 1ZICA 1FDOA 1XCLA 2CHVA 1B2LA 2F9FA 3K1AB 3EUWA 3TLGB 3LQYA 4K8RB 4NYMQ 3DHVA 4TTAA 1CULC 4LXXA 5EMNA 4RTMA 1AHNA 1YR3A 2AKAB 5I9MA 4M9ZA 3OZCA 1SY7A 5IAOA 5CA0B 1SURA 2ZB8A 1XIVA 4HDRB 4JVMA 4JLSA 1ID1A 1D4AA 1FU4A 5EINA 5ADHA 5DV9A 5JMWA 2E5LB 1WHSB 4Y6GB 2J5QA 3Q2KA 4K9DA 4HP8A 1QH8B 2HRDA 3QEMB 4R9UC 3RO7A 3M4XA 4WDRA 4Y2RA 2DTEA 3ZHSA 1V9LA 2R7MA 2Z5FA 3UWKA 2P9QA 3QLTA 5HIKA 2NZXA 5TQ2A 1X1SA 1SPBS 3NJRA 4OBWA 4X1YB 5FL3A 5AIBA 5J4KA 5K3EA 1Y37A 3U6BA 4CR8A 2X58A 3DEYX 4ZHSA 3NOXA 4AY4A 5A4KA 4B3RB 3I1JA 3Q88A 2W22A 4MRPA 4YR9A 4W4TA 3JD4A 3ZY4A 1HT2E 4JJFA 1D9XA 2HRRA 1PSDA 1W85B 4UMDA 5KNBD 1O97C 3TL3A 4GOND 2B3TA 3ISJA 3HJAA 3BORA 4JD5A 4QUAA 1JIXA 4WXHA 1P75A 1I6MA 1R74A 1U3VA 2J09A 1QG0A 3FR7A 3SEQA 3HA2A 3LS2A 2BMEA 5GJWC 1KEKA 2MSKA 4KN6A 1PV4A 2NSDA 2OHXA 3RIMA 1SJ9A 1XMSA 1G8PA 3WK8A 4GP9A 5AVWA 2K2QB 1JFRA 1OASA 3FMFA 3PJFA 4JC5A 3TX6A 3P9XA 4GX2A 4JOSA 3T3DA 3UWDA 4LQCA 3SKVA 2ON6A 2VJAA 4WOJA 2FQQA 4UHDA 1EVQA 5TMEA 4EFDA 1XEWY 1U81A 1WG8A 1Y6QA 1YJXA 1MRSA 2NXJA 3A7DA 3GRPA 4IF4A 5G4KB 3X2FA 1YFJA 5KX5A 2G08A 2P0AA 1XAGA 2ID7A 2BSAA 3H11A 4KO8A 1ZZEA 3RVBA 5DYGA 5BNTA 4X61A 1UBFA 1ZUD1 3BWDD 1DRWA 2PMDA 1TDJA 4XGRA 1Z8FA 4L85A 1Z8DA 1Q19A 2PSEA 2QY9A 3DZHA 1SUSA 5JY6A 1J4AA 4F85A 2GF9A 1NBMD 3PQEA 4GPBA 5JXWA 1QHIA 3ZE8A 1Y7HA 3PB3A 1C9JA 4B6PA 3CH4B 5IZCC 1HE8B 3L01A 3KPJA 5LZ4A 3D02A 5DGTA 4OJKA 3L2OB 1M0SA 2D00A 4B5KA 1VE7A 2WBLC 5G1NA 4G85A 3BFJA 1H6CA 4YYZA 2AMYA 4DIMA 1JR2A 4S1OA 3V8PA 4PQYA 4X64B 1AZLA 2EEZA 1SUDA 1E0KA 2J9GA 4HAIA 4OP1A 4ZQCB 1H1LA 3HVKA 3JQAA 2X0IA 3GAMA 4FXOA 3IHKA 4RV4A 4MLCA 4TV9A 5TF4A 4B43A 1PT6A 3HXQA 3TBFA 5KTOA 4GM0A 3M70A 4BS9A 5ICEA 4AICA 5E6SA 3M5WA 4IS2A 4C01A 4F6LA 5ADUS 4AWXA 4MQMA 2O2IA 1GQQA 1J2EA 3IILA 1Z3IX 1NAIA 2X0RA 4MV4A 1YS2X 4OHPA 5HF9A 2WHXA 1QRDA 1XRSB 1X7WB 2ZKLA 3DLPX 4ZOLF 1QIHA 5KEIA 5EQDA 2O8CA 2B4AA 2P9JA 2O07A 2Q3JA 4KITB 3DDWA 4IBOA 4EFKA 5FPKA 2PX0A 3A25A 3SLKA 3I0ZA 3N0VA 2CL6X 2DCUA 2FR8C 2CUZA 2EL7A 3F7OA 2H2WA 2CMKA 4N8EA 5IANA 2D0IA 3DXZA 1M0WA 1WY7A 1IBMB 1E3EA 1N57A 1XP8A 1P5RA 4D2IA 2F8TA 4YAOA 5H4GA 3MQFA 1BGWA 3BXGA 1GTJ1 4KJXA 4CMAA 4F1WA 5A9SB 5CYGA 1RKVA 1YE8A 4NCXA 2CFRA 4N0QA 1V48A 3DMTA 1I6WA 2Y4OA 4OJMX 4FT2A 2V5AA 4BGEA 4M86A 3AB7A 1I7SB 4GZ3A 1UBKS 3C43A 1FVFA 2IS2A 3EGXB 4C0HA 4FYVA 2EYQA 4XVCA 2OLEA 2FPLA 1IAVA 3NRCA 1XP5A 3RBXA 4V24A 3L0BA 3T1QA 4EKYA 4EELA 4NH0A 4A2CA 5TR9A 2QRLA 4BXOB 3CLRD 4GOOD 5CT5A 2BKVA 1SKBA 3G2KA 5JSZA 1SCUB 4NZYA 3HO8A 5LB4A 5FP0A 1T29A 3II6X 1N33B 3TQSA 4HQKA 2O57A 4YBRA 1IHXA 1VIMA 2C8VA 1DBIA 2JJYA 3GLTA 3HKBB 3T3PB 1IOVA 1Z28A 4GXQA 2BHNA 5LYYA 1HE5A 2P5TB 1MH9A 1RPAA 3A1TA 4M0MA 2J7PD 3N3BC 4BECA 3W7AA 3CF2A 1WVIA 4X6XA 2XUJA 1UBUS 3DP9A 3OA0A 4BE9A 5CFPA 3V8NA 1KXJA 3UC9A 1ZWKA 2PGXA 2P69A 2J3IA 2PH1A 4N0MA 3DOCA 5K0FA 1YIDA 4JB2A 3MBKA 4K9LA 2QN8A 5JRDS 3CF4G 4Q66C 1J20A 2GHTA 4G1FA 3UT0A 2HPVA 1FFYA 4G4GA 1QZUA 2GVNA 1USUA 3CBGA 3RVKA 2BGMA 2HT6A 4K87A 3VNUA 3IA7A 4E3ZA 1I13A 1R6TA 2A88A 3NHJA 4OQYA 1FYEA 1S3FA 1J21A 2X1LA 3FCSB 4FFOA 1HA3A 1EBBA 3GQBA 2Y1XA 3QFCA 3R5TA 4KKXB 3WS7A 4UEWA 5K0ZA 2RGNA 4AJ9A 5KOHA 4LXUA 1TYBE 1S89A 2FXVA 5CB4F 2O0LA 2X5XA 1PNQA 3R7LA 3EFOB 1XD2B 4UUPA 3O8NA 4Q4CA 2YYSA 4AJIA 6ABPA 3CNNA 3Q2IA 1QRRA 2D1RA 2H18A 4M89A 5T4BA 5IABA 2ZM6B 1NMZA 1U7HA 2F1HA 2Q5QA 3TAUA 3BFKA 3C7KA 1GD1O 4JJZA 3ZWKA 4YO8A 1V1MB 3UT5A 4HB2A 4L27A 2BSQA 1VBKA 2YIVX 4B80A 3KG2A 4MI9A 3A28A 4LNUB 4ZIRA 5JCPA 3PEWA 1MU0A 3FHTA 4R9RA 3PEVA 1FK8A 1FQOA 1YQUA 2XZPA 3OQ6A 4NIMA 2X77A 4PPQA 3LUFA 2GEJA 3PKIA 5CEFA 2BYTA 3K70B 3WBKA 4Z53A 2QTAA 1K63A 4RQBA 3Q8XB 4GLLA 4WZBA 4ZVLA 1EXMA 3F7MA 4E4RA 2Q50A 3RYCA 3ZUGA 1NW3A 4JLUA 3KDPA 4QELA 4QTZA 1Y82A 3S29A 1T4CB 4JUDX 5F5XA 2NU7B 2WE7A 3EF0A 4D4KA 4R8LA 4FYYA 5JAOA 1ENOA 3UGTA 1EVKA 3PPVA 4K0RA 3U4IA 1T4MA 3N5KA 3BKXA 3PWSA 1J07A 1MX5A 3JZIA 3UO8B 5BO5A 4EKEA 1RWMA 1U8AA 1SBHA 3N6RA 5IJ0A 1Q7EA 3STTA 3HJGA 4EG6A 1EUYA 5KTNA 3FYUA 4FKBA 5IT5A 1RSZA 3A4IA 4HDSB 2KHZA 2RC6A 1SUIA 3U4AA 1PSZA 4H6WA 3TUJC 3MCZA 4NE9A 4FGZA 1FPMA 4MRRA 5LP1A 3TXXA 4CFZA 3URKA 1XZHA 2HU8A 4LJ6A 3I09A 3E1KA 1GSOA 2DY1A 1U0BB 2PLWA 3L0PA 3M5PA 2GOYA 4DV1B 1VOTA 4E0BA 4QECA 2WWFA 4OQ4A 1U4NA 5KX5F 4DW8A 4OQLA 2VNAA 1FTQA 3GLGA 1JQKA 2JLSA 1J7JA 2XNJA 1WMEA 4P36A 3FOZA 4TQGA 3LF1A 5L3QB 2G72A 3QA3E 4JVNA 1GUZA 1TPZA 3LOUA 4Q34A 1JIQA 3C0KA 4FOSA 5JCOA 4AYWA 2PCJA 3ND9A 1KZ6A 1TLFA 1QH0A 1PS8A 3STUA 2H2IA 4QJ4A 4TVOA 1NA5A 5F3DA 1TTHA 2GM4A 1ZIPA 4MS1B 5CNKA 3ROTA 2EBUA 4HGPA 4F6RA 2FWBA 4QTUB 4RTPA 3WQSB 2DP4E 1W5EA 5EHXA 2OE2A 3B12A 1PEYA 5DX1A 1GKKA 2PZ8A 4JI3B 3ZI0A 1J0BA 2SCUB 3G5AA 1ZZGA 2IYQA 3M4ZA 5C5CA 1G55A 2HNBA 3F6EX 3I4CA 4MWBA 2BDEA 2QLNA 1VMIA 2RG7A 4JI6B 4ASUD 3EVNA 1QVZA 3G2MA 4BNIA 1WPQA 2YXNA 3CRVA 3D2AA 4FCWA 2Q0QA 4TTPA 2DLCX 3ZNPA 4TV9F 3UIEA 3AHDA 2O6HA 2B7BA 4W5TA 1PR1A 4Q0MA 2YIJA 1W88A 1M1YB 4YJDA 5A1TA 2JL1A 5HZGA 1VMEA 2Y93A 2QSJA 2ZSBA 4HUQA 5DTMA 4ECAA 3SLGA 4MUKA 2H6EA 2IDKA 4R1TA 5A5FA 1GDTA 1CRLA 1VHWA 2FP4A 3G0DA 1GCGA 1GY8A 1K6EA 2HEGA 2OUKA 2V8BA 1E58A 4MMXB 1QE0A 1U90A 3RSFA 1IBKB 1BN6A 4CLXA 2FGKA 3R3ZA 3OTOB 4LYGA 2ZI6A 4WESB 2WYUA 3TE6A 3IURA 3WY9A 1JHRA 1ZGGA 3RS0A 1SAYA 1XRMA 3CRW1 4Q1FA 2MR5A 5B1IA 5EMJA 1X7XB 3RARA 3CVUA 1LLUA 2J5RA 2XUOA 3ACCA 4OI0A 4EUSA 3P9IA 3KKEA 4ZJUA 2ZAYA 1DCKA 2PRJA 3UJPA 1JWAB 1S0UA 4J90A 4R5HA 2PVPA 3ROPA 1OYWA 3E53A 3F9CA 2CF5A 2WP0A 3WL6A 3CONA 2D0OB 4HMQA 1P60A 1Z6TA 2ZRCA 3CG0A 3LYUA 3OF3A 4UNPA 3ZDYB 1L1RA 4WZZA 3UW3A 2GPJA 2GTIA 4U6SA 5HOEA 3GMIA 3HVJA 3ZZ1A 4BVEA 4OK5A 3FYCA 1CUIA 3C87A 2C2XA 1NQTA 1QIEA 4FGSA 4NK4A 3HGTA 3KVOA 3BM5A 1BDBA 1FDWA 4ESEA 2DUMA 3NATA 4BBPA 3S2ZA 5KYXB 4PIMA 3D0RA 1L4KA 1NUPA 3G2PA 3KZ1E 4URWR 5HQ3A 4F1KA 3C3MA 2V7UA 3HPRA 1PZHA 1EMDA 1BCSA 3PRYA 4XW2A 1YZKA 1CZLA 3O47A 1X3LA 3GP8A 4YYEA 3HZZA 3AJ9A 3A4VA 3TLBA 5KNLA 3G9ZA 4DV3B 3HUFA 4ALLA 2VTBA 4M1MA 5EE3A 2XGSA 3PWKA 4RY9A 4WRRA 4EWLA 2PWZA 4BZXA 4YMGA 3ESYA 2IZOA 4OGWA 1BXRB 4HLQB 3TLCA 3WRWA 1IBRA 2WI8A 4OMCA 3AUSA 2VYND 4KXQA 2WZQA 2DHQA 2GTPA 4PQFA 3ZZMA 4BQOA 1E1DA 1Q77A 1U4OA 1L5WA 1CBUA 2DHDA 4HN2A 5P8WA 3RAJA 3T5TA 2WYWA 2ZXUA 4DLWA 3KQMA 2CK3D 4UUNA 2H54A 2FW0A 1HWYA 2ZJAA 3MRTA 4ID3A 4NK5A 5I5EA 2VQSA 3PCRB 1SXJE 1VE6A 1IB6A 3OX1A 2D2IA 4RVOA 1KH2A 3Q3VA 5TNXA 2YN0A 2ZUBA 4RZUA 1WDKA 3A58B 1KK2A 4ZTUB 3GLHB 3MYYA 2JATA 3TNFA 2ESRA 5FEUA 2J7PA 2PUFA 3FTEA 3WK9A 3QLEA 4PHFA 5H1YA 2W00A 3MYRA 5ESDA 5BRNA 3LUDA 1NJ6A 1C0EA 1ODIA 2IOHA 3OM8A 8ADHA 1Y1RA 2B4KA 1KZ7B 1CUHA 2JIZA 3AEQB 4FUQA 4Q19A 1VQ1A 4TS9A 3NFYA 1KNQA 2UKDA 1UJ5A 3W9BA 3WP0A 4AS1A 3TIGA 4JUBA 1ZM7A 3KYDB 3VGPA 1JUDA 3FXAA 1LK7A 3CUUA 4YRNA 3G7UA 4NG5A 4E14A 4Q4HB 2GDZA 4NATA 3U7IA 2WU3A 2ZR9A 3GDHA 2DSNA 3VJLA 4AJNA 3QK7A 4KXMA 4KWHA 4WIAA 1G6Q1 2E1RA 3KYCA 3FZGA 4B83A 4W1QA 5ARCA 1Z45A 4DIFA 3GJ4A 1E6EA 2PEZA 2WUGA 2X3UA 1BS9A 3EF1A 4KQFA 2YNMD 4YC7A 3PGLA 1HG0A 4J6EA 1EWVA 2ZSEA 3WKDA 4CMEC 4DN6A 3ZJUA 1V7QA 4GEGA 1KJIA 3A0RB 4G8CA 5K8LA 5SZJA 3A6PC 3QXCA 4NZNA 4EGCB 3I8XA 1I1NA 4RY2A 1N34B 2B8EA 3H17A 4JOCA 4QWMA 4EJ0A 4U39A 2QQFA 1OVMA 3NIDB 1MD9A 1L5SA 1JIIA 3A6JA 2BV3A 4YAUA 2C98A 3K5IA 4FE7A 1JT9A 2IP2A 4N3NA 1MNAA 4A6PA 3DBLB 1MZPA 2PT9A 2FSIA 5EIFA 1LBHA 4TN5A 2JFGA 3JWGA 4FIZA 3OU7A 4ZAYA 4GS5A 2JHFA 5E9AA 1DX9A 4PC3A 1RI4A 4GWGA 4RKYA 3JRNA 4IFIA 2H8KA 4QPZA 4LWOA 5AJXA 3KVNA 3SG0A 5CGZA 5CX1B 3MOGA 1R4NA 4HXGA 3NLLA 3WIDA 3DZFA 4CTJA 1U2SA 4M0KA 2FF5A 4YMLA 3OUZA 4KV7A 3H5NA 2G88A 4C0QC 3K7EA 5INTA 3KKPA 1ABEA 2YQ4A 5EJ2A 1EX6A 4MW1A 1OH7A 4QM6A 1FZQA 3I6YA 4S1VA 1KJNA 5L9AA 1VHLA 2XVYA 2XB2A 4J7UA 1BE8A 1G3IA 2ZSKA 2XKAA 2W6JA 3NHKA 3NPAA 4RPHA 2FWNA 2W37A 5DVZA 1UWLA 3T1VA 4AF8A 4AIRA 1YR1A 3G5MA 2Z9DA 3I6ZA 4ZJYA 4WE3A 3HEMA 4UUQA 1E1RD 1TF5A 2I80A 1XTBA 3VU9B 1QFMA 4GRIA 5F5LA 4RGVA 3D6AA 3RM3A 1TMKA 3IEKA 3NP7A 1OIWA 1RXSA 1F2UB 3MLBA 4BNKA 5C8ZA 3IPYA 1VI2A 2RCYA 2ZUFA 3KZKA 2AG8A 3ESAA 3R0XA 2O2CA 3DO8A 2WJ3A 1QG2A 3ETDA 1HE3A 4MUHA 1RLOA 3WMWA 1MQ9A 3HP7A 3D4LA 4AB1A 3S7TA 3EOBI 5D3MA 4AUEA 1JG6A 2DXIA 4NJMB 2Y1WA 3ZCVA 4YPVA 1JIJA 2W43A 3PICA 1UBLS 4AG5A 5KAMA 2YMMA 2O59A 2K7FA 2C0CA 1TTTA 4Q7MB 3V3TA 1SXGA 4YRKA 4QUDA 3U44B 3DFIA 3OTIA 1JVNA 2VZ8A 3OOJA 4WCFC 5FL7A 2QLFA 2X8AA 1SQ5A 5F21A 4BQPA 2D7CA 2HDHA 2XA2A 4FGWA 4RIIA 4UU7A 1IN6A 3UM9A 3K5PA 3WLEA 2F3RA 2OFXA 1DC3A 1RQ2A 1D0IA 1UPTA 1RXCA 2JKVA 2RGYA 5B57C 5IN5A 3WMFA 1OB2A 1QS0A 1PAUA 2MJLA 1CJCA 2CFCA 4L7QA 1XLTC 3CCBA 3ML1A 3DFFA 3H4TA 4R1QA 2YWHA 3FKQA 3FNRA 1EH5A 4G41A 2H51A 2ZUWA 2X3YA 4TOIA 1PHPA 5B12A 3AR5A 5DLEA 1YFKA 1QZ3A 3DG9A 4ASUA 1EVJA 3E8XA 1PGPA 5A06A 2PHZA 2PO5A 4W1SA 2FPWA 3OZDA 4GOLD 1Y63A 3PT9A 5AYVA 1TF7A 3ROMA 2G80A 2P1RA 1TX4B 1WEHA 1Q7BA 5CVUA 5CJJA 3QLUA 1Q1AA 4J1TC 4MKXA 4RHTA 4E5PA 5A4FS 2WTEA 1JFLA 3I6QA 3NTVA 4Q3EA 3ABIA 4ZXFA 4KAAA 4AWBA 1DQYA 3HDJA 1GT91 3PTZA 1J5XA 2O8DA 2H5EA 1C50A 3GOQA 5AKEA 4YUWA 3O4GA 4R7GA 3R3UA 4QBHA 3O9ZA 4QDUA 3RYFB 2PL1A 1UT5A 3A4TA 3QE3A 5BW8A 4Y1RB 3DBVO 4YUZA 2GN2A 1RT9A 2VDLB 2CD7A 2QW0X 2WA2A 2QW1A 3I52A 1UPXA 5T64A 2Q7OE 5KPDA 1HYEA 1SGWA 1SBCA 5LIPA 1IOZA 4GKJB 1T2FA 3AF1A 4N0PA 4X1IA 2HD4A 2RIPA 3JWEA 4FOTA 5JXHA 1W76A 2E1PA 2BUBA 3AEYA 4KSBA 4KLNA 4OUDB 2FSVC 3R7FA 4ND8A 1JQ5A 1T6YA 2DR3A 2Z3WA 4KQJA 1TXGA 2C5LA 2VLBA 1UKBA 3PEEA 2GCIA 4RVFA 1SUWA 4US0R 3EVFA 3IVRA 1X1TA 3JQBA 3B2QA 3IJEB 2HCJB 4FCVA 2G09A 1LD3A 2WICA 3UJ8A 1A0OA 1BAPA 3O8QB 4TTTS 5C80A 4QXMA 3AHJA 4QQRA 2YWXA 4UFPA 2ZJ3A 3QFTA 3WHIA 1IVSA 2IOQA 5JH7B 3T9EA 3GNSA 3K9HA 2EZ9A 2ZW9A 4U0KA 5ALZA 1C4OA 4C05A 4BCDA 4B82A 4UTXA 3QV2A 1BX1A 2C3YA 2IHTA 2LW7A 2VH2A 3NANA 3W8NA 3FYDA 3ROXA 4O3MA 4QRDA 2P1ZA 2J3JA 3DZJA 4OQFA 1ZW6A 5C1PA 3R20A 3AJRA 5I8WA 3RSZA 3U17A 1T2AA 2X2EA 4KNWA 4D0GA 5TQVA 1S4QA 4CGZA 4M9RA 4B3CA 2C7QA 1N25A 4KIJA 4KIUA 5FR1A 1TUBA 2ECQA 5JAQA 3KTDA 4NZZA 2VYNA 2C4MA 4L5BA 3TXYA 1IY9A 2JASA 4IDPA 1R88A 3OIDA 4DSTA 3ZNNA 5G41A 2HA6A 2PU7A 5BYJA 3JATB 4DIKA 1L7NA 3GX1A 5K2OA 3QBJA 5AVVA 2WWYA 3ER6A 2A1UB 3K16A 4QDKA 3ZHXA 4DG5A 4IKEA 1YVDA 3UG7A 1RLTA 4WNCA 2YWFA 1IXYA 2YV2A 3FZNA 4F5DA 3FMGA 1UMCA 3INYA 5L53A 4EYSA 1QUEA 1F2TB 4KK3A 5FO0A 1ZXBA 4D82A 3S99A 5BWCA 3DZCA 4YQEA 1YDMA 4R2HA 3HDTA 4N5MA 1DTWB 1JKMA 4UNIA 4CTMA 3DTVA 1DT3A 1MB0A 3FLEA 1SUBA 2QMZA 4K88A 1Y89A 4J0KA 1KP2A 5FBWB 3M1AA 1G6KA 3NONA 1NVWQ 2JH9A 4DR4B 3TLXA 1ML4A 5IDYA 1XXHE 4C88A 4BNFA 5KYWB 3H2IA 3GW8A 3M6FA 2LVBA 4AF7A 3A05A 5I9IA 3RFUA 4OHFA 4LWQA 2WTXA 1COZA 2QTFA 3C3KA 3DEKA 1EFVB 3BICA 1D1SA 1EUCA 2FAXA 1U0EA 2CNOA 2UYGA 5LQRA 3P19A 4ZAZA 3UTCA 3HHEA 2IPLA 1TW2A 1TK9A 1VG1A 1VZ3A 4TLEA 5G0SA 2IA5A 2L2QA 3ZW9A 1P81A 1YKFA 3LCCA 3U4GA 3ZLVA 2RHMA 1I7DA 3KFVA 4UMEA 5A6SA 2YNMA 1XPRA 1MENA 3AF0A 5JI3E 4F4FA 4GMXA 3NDRA 1IWOA 4AUMA 3QVTA 1G38A 3RC9A 5HBGA 2LCFA 5REQB 2W2MA 5U4QA 3EIXA 4CEHB 4RTKA 1HSOA 1XWWA 1PWZA 5J2TB 2I03A 3H2ZA 3RVSA 4RCVA 3S1LA 4JA2A 5AVSA 3HY6A 3FHOA 3M9XA 3MWYW 1QRSA 1DWQA 3U9SA 1BQ4A 1NUAA 1SG9A 2B37A 4RMGA 2GBGA 4HDKA 3BGIA 3TW8A 3AUAA 2POQX 4PYQA 2P8JA 1VCNA 1E5XA 2XIQA 2KPOA 3BZBA 4YRTA 1EFAA 2Z9BA 5DF1A 3N2LA 2W93A 2NXEA 5IVIA 5KTPA 1EUDA 2V03A 1VL8A 1QHFA 3E7PA 1IZZA 3C8MA 4L50A 4O3FA 3V4FA 1JEOA 2VJYA 3FFXA 2QVGA 2Z56A 3NKFA 4J0DA 2EKQA 2FMHA 1THGA 1JF8A 1ZKDA 2C1XA 2QD2A 2WSSD 3SQXA 1WR8A 3EXG1 1DIGA 4IDAA 1MOQA 2E4WA 2K5UA 2AL7A 2N0SA 2W0SA 4MROA 4ZVQA 2WFLA 4RD6A 1FMLA 1GVNB 1L4YA 3NDBB 3GLRA 4BKQA 1CR0A 2QTRA 4TVBA 1ZJJA 2G04A 3CE6A 5IULC 3V4RA 4DLVA 3VM6A 1TU0A 3BKWA 3IT2A 3LGSA 5CYFA 3VNVA 3JQ6A 5KUTA 1FP1D 1E1RA 1TQHA 2ERYA 2GJ8A 4V0OA 3LYHA 3DAFA 3LNCA 2W0MA 5LOVA 4L5JA 4TXHA 1DNPA 2IK8A 1RHMA 4WN9B 2XV1A 3HJTA 3LCUA 4G86A 4JR2A 3QX9A 4NJEB 2X6TA 1LGYA 4OXNA 4S0ZA 3REFA 3RSGA 3OKAA 2AGVA 2I2AA 5ALTA 2H3EA 5I51A 4HDAA 4XASA 4HNSA 1GM5A 4C7KA 2VTKA 1DIHA 2OILA 2D4HA 2CDNA 1P2GA 2GM9A 1KKLA 3G2LA 4F96A 2HYIC 3WLRA 1NVUQ 1MIOA 4JBIA 3Q8WA 4IH4A 4CEIA 4PFJA 2GM5A 3EVCA 1YBAA 3JQQA 5HGJA 4U4AA 5EWMA 2WQ6A 3V4LA 5FBKA 4ENTA 3N2GB 3BSYA 3UKOA 3ZZNA 1G21B 3M3HA 3LF2A 1N6NA 4BFUA 4CGYA 1U8EA 1KEEB 2C3MA 4QXAA 2GRJA 4XM2A 3DYBA 4MR9B 4OXRA 5K1ZA 4LI0A 1I14A 5EMHA 3HMKA 5AW3A 4Q02A 4TTRA 3DBRA 4L78A 4NDAA 2Q29A 1TTPB 1I2ZA 4ZQBA 6LDHA 1AMUA 3OP1A 4I66A 1NSTA 3N2NA 1KH3A 2KB0A 3GHYA 5CLIA 5IC6A 5IXSA 1O1YA 2GBCA 3HABA 4KPUB 1JFTA 1ZNXA 2JA2A 2WLTA 3BWCA 1SD5A 2GAOA 4LSMA 4YJ3A 3K70C 5B2FA 4Q9JA 3FPBA 2R85A 4GU5A 5CBKA 2CCKA 5LQKA 1J8DA 5BR7A 1CTQA 2VDOB 4DR5B 1BXZA 4X8MA 1LU9A 1HDOA 4MAFA 5KWSA 1UDCA 2W8BB 2Y1CA 2IODA 2Z4TA 5IT9A 2D59A 3PR2B 3AVOA 4U5QA 4IICA 3TZQA 4BRUA 3R74A 5IDQA 1GXSA 3G2IA 2FW6A 1QTQA 4KLRA 2P9FA 3V8VA 5KJFA 4IDEA 4G4SP 2IZ1A 1RRFA 1CUAA 5IFLA 4UZSA 1WXWA 4XJXA 5E4JA 1GZUA 3QFHA 2FJPA 2H06A 3RAFC 2OFFA 1KQFA 3R3SA 2OB2A 2J0UB 3OEWA 2JIDA 3CZ9A 4X97A 3CRQA 4TM7A 4MQ6A 3PD7A 4G0NA 3S40A 4ACBA 1VL1A 1JLLA 4BUJA 2NV0A 3PHJA 1DEXA 4LHWA 3MINA 2WYHA 4V3CA 1N2CE 1AXEA 3AUYA 3EC2A 4YFYA 4B7CA 1K0UA 5AHRA 5EP3A 2WIBA 2I6GA 1BA2A 1DEAA 3RROA 4QVGA 4LY3A 5K3FB 4Y2VA 1T24A 5B4UA 1FNMA 1DBPA 4DS3A 2D2XA 1JEAA 4PAWA 1RLJA 4JL5A 3KJHA 3BMCB 2CLFB 3BIXA 3GDFA 3RUDA 4AI6A 3NG1A 1K75A 5JARA 3MHTA 2M2IA 4NS4A 4PBTA 4OBXA 2CBZA 3HSKA 4LJ8A 2Y67A 1GR0A 1ZP6A 2VNSA 3R5SA 4MPPA 4ND7A 1PJZA 1RZ3A 5BV0A 4XIJA 3GN1A 1REQA 3BCRA 3IUQA 3FDFA 2ICAA 4HAZA 3NEPX 2XJ4A 5IW8A 3IVGA 5C1BA 5ICSA 3TFWA 3PNQA 1Y1TA 3TJRA 4D9CA 3RR2A 1THTA 5KZMB 1R50A 1IJKA 4E12A 4TWAA 4CG0A 3PX7A 2ROQA 1X7ZA 1TEXA 2IGBA 2LV8A 4KWEA 3FKSD 2Q7DA 3TVTA 1ZM4A 2ZSFA 2ZANA 3KELA 2F59A 4JR0A 5IZCA 1DIBA 4R2MA 2DFTA 3D8SA 4G24A 4RD3A 3ZQ6A 4B3JA 5I9BA 2IVZA 1NOKA 1KFCB 1TCCA 3SKXA 5B58T 1A5ZA 2DY0A 4UAJA 1YA6A 2BUAA 4C4SA 4BY9E 5DNVA 2ETXA 2X1HA 4HS9A 2DUJA 2J5XA 3I6IA 4M9QA 1R1DA 3T9FA 4RMNA 1RYZA 2ASEA 1J25A 1E1MA 3A27A 3HY3A 4HAWA 3QFRA 1QH1A 1E9FA 1JJBA 4YTEA 3OJEA 4KMOA 1EDDA 2X22A 4WNYA 3WBFA 4F3KA 3BCHA 1BH6A 4OQDA 1L5HA 4BKRA 1E8MA 1KU6A 3LUAA 4AZ3A 4C1BA 1OC4A 3IIIA 2AFHA 3HN7A 1QV6A 2YJ6A 2Y4NA 3CW9A 4N12A 4MRAA 5G1OA 2IV3A 3V7UA 2CXXA 2IH4A 4PX2A 2G83A 3CX6A 4JHLA 4Q7LA 4QGAA 1E2FA 1JHXA 5FI3A 3KQHA 1AG9A 3HZHA 3I05A 4M55A 1SBQA 3VR5D 4KE9A 4EK9A 4Y3UA 4PYOA 2VXYA 1MHTA 3NWJA 3MRSA 4WINA 5ALDA 3RANA 4F3YA 1OE0A 2VDNB 5FWXA 4DLUA 3ZBUA 4H9GA 3BJEA 3DXYA 3HM2A 4JU8A 1U1EA 1HL3A 4R40A 2DWPA 1ORIA 4DY4A 2FR8A 1PJLA 5EE0A 5FI5A 3RYTC 5CD9A 4RDIA 2BGNA 3B2NA 1J0DA 2W83A 1IQ0A 5KNBH 4GLJA 4FR2A 3FFBA 3AUKA 4UE2A 2C42A 2PWYA 3VDXA 5EQTA 3WTBA 4ZTZB 3AVYA 2NZVG 1ULBA 4CMIA 4BV9A 1JG4A 2XUKA 2YUTA 3DGEC 2GZAA 3DOJA 2HHLA 1FFEA 2Z0MA 1G291 1GPAA 3OEED 2W70A 4DDVA 3MLEA 3S81A 1J56A 1FX0B 3UWOA 2XADA 1XV5A 5FA6A 5TE9A 1L5GB 2YFYA 2AX3A 1VSQA 4GGPA 2QTVA 4F97A 3FVVA 3Q72A 4NY1A 3EG9A 1XKQA 3DULA 3VTZA 3RV3A 1WMDA 2RFLA 4HXYA 3UH0A 3AR2A 5CTJA 5DU2A 5BQOA 3DVAA 3GOHA 2PAFA 1WCIB 1P4HA 1SEVA 2VR1A 2WHEA 1PNOA 5G40A 4C5AA 1UL1X 2GPSA 2ECFA 2RBGA 3L40A 4WBNF 3ELYA 4HAYA 4J1QA 1IH8A 2PM8A 4M0FA 4HAVA 5AK4A 3WFIA 1Q7CA 3PUVA 3TZ6A 1D07A 1RJDA 3NI2A 3D7NA 4CKCB 2OZLB 4LN1A 3M6WA 1CIJA 1FNDA 4L08A 1AO0A 2XWQA 3PUWA 2FPGA 3GQVA 3NHRA 2R62A 1KK1A 2VF5X 1UBHS 4KX3A 3TIVA 3HUUA 3BRWD 5I5GA 4UVIA 5LOVF 1M2VB 2BCJQ 3ZWBA 1QFZA 4NBRA 1CHNA 4N40A 3ENKA 2UZ1A 2I8AA 4M76B 4CM8A 1ZEMA 1DOZA 4IGAA 5L7TA 4JBYA 3CX3A 1IOLA 3G85A 1G1MA 1HDZA 2CHUA 5YASA 2ZT5A 4Q05A 4G36A 4QARA 3NT5A 1ADBA 4DMGA 4X7BA 1W25A 4MVJD 1KIFA 3TZBA 4WTOA 4EEXA 2KX7A 3SX4A 1CRZA 3BB1A 1IDN1 1JU9A 4PS0A 4ENQA 2IEYA 2AXQA 3F3SA 3QBVA 3I1YA 1MJGM 5JU6A 1U3UA 2EF0A 2VDKB 5E2BA 5CT9A 3JVDA 1J9EA 1Z0JA 1M9NA 1RJWA 2FQWA 1NN5A 4G6ZA 3UAGA 4OX9Y 2D5AA 4GGOA 3GO4A 4HLUC 4BP9A 5ALYA 1TM3E 4PYMA 2UYOA 3LCVB 1Q0SA 4A1OA 4ZAWA 1S2NA 1DTSA 2VDQB 4XE5A 3OH8A 4ZANA 1XVVA 3P52A 5FTNA 4UJ3A 4DLAA 1KU0A 1BHO1 1TZJA 2WFMA 1SA0B 3E2PA 1QMGA 2EZUA 3BG5A 3DE4X 4QDOA 4TL8A 4ZVPA 3VR3A 4WNAB 4DHWA 3RQSA 1TZ2A 3PPIA 1C9YA 2WU1A 3D7SA 5EKDA 2NVOA 2Z2KA 4AMVA 4URYR 1QK3A 3CNHA 3R3HA 2WMDA 3ZE1B 5I7UA 2YJZA 1NU6A 4OP2A 4XUGB 1NVTA 1R8SA 1QP4A 1CJTC 2Y1EA 3A1CA 2QVZX 4PG8A 4FU0A 2XBUA 3AX6A 3FMPB 2F4NA 3KD2A 3GGGA 3QKSB 4WA7A 3BTSA 4MVCA 3GJXC 3DO5A 3DOHA 3KZCA 1BFDA 1J6UA 1XL1A 3E15A 3OLXA 4MGIR 4EHDA 2J87A 3GPCA 3P32A 1UJ2A 5A02A 4YCLA 2XD9A 1W0KA 2FRVA 5A0VA 4G5XA 5CEJA 4N41A 2R4QA 3VPSA 1FS4A 3NOOA 1C8KA 4HDNA 4HYTA 4RADA 4WGGA 1OH8A 1V16B 1KEUA 5CK5A 3GG9A 5C8YB 2AG0A 1Y8CA 1DJOA 3MT7A 1BE0A 4JB3A 4MJ3A 5CAEA 1I10A 3I39X 3IB3A 4JROA 2V54A 2JHGA 2P2SA 4LJ4A 3CEHA 5KSYA 1OFHA 4ECEA 5LP6B 4TWBA 2IUEA 3R23A 1EM8B 4J0FA 1GAXA 1YHYA 4HUJA 2WP8J 2MYUA 4B6RA 1UBJS 2XT6A 1ORWA 2QE7A 2YZGA 1M0TA 2YV3A 3ET4A 4J0QA 3I2YX 2F17A 4TX1A 1Q50A 4X8OA 5J63A 5L4NA 3LBFA 4HFMA 1KVRA 1E9SA 3O91A 4GXNA 3FDJA 1E92A 1GUYA 3GEGA 5B1DA 2A1TR 3C3EA 2ADFA 2YH2A 1YL6A 2AQHA 2ZE5A 1T2UA 5ALNA 3NBUA 3SY8A 5BY2A 3LPLA 2XHZA 2H9YA 2IW1A 1Z2NX 2EFJA 1F7UA 3WK5A 4MITA 5HPYB 3H9EO 3U3RA 1U94A 4JIMA 1PR2A 3SYLA 2IZ7A 4LFAB 3LO5A 5IS2A 5FCDA 3CUSA 1XNJA 2NYAA 5JZVA 3EPRA 2IX3A 4DCVA 2OCXA 1T0PA 4YXWA 5I9LA 1TAHA 3ZXXA 1VKHA 1HOTA 2VIIA 3A9RA 1EP2B 2NG1A 3BJRA 1PLLA 1BIFA 1TFRA 2WT9A 3FAZA 3HHPA 1ZN8A 2BT4A 1E3SA 1NXWA 1XU9A 3WICA 1H6BA 2J30A 3LUBA 3RJ5A 3STWA 4ARAA 5IVHA 1LRKA 3E05A 2QTTA 1Z6XA 3W78A 5FEMA 1VG0B 5ALQA 5ITVA 2QYSA 3N0TA 3WDKA 2ZBUA 1IG0A 2ZWPA 4UM7A 1XZGA 4ZEXA 2YRFA 3QM1A 3NHFA 1QIFA 5C53B 1S96A 1JLKA 3F8SA 3G8YA 4ZPJA 2C2BA 1V4VA 5EPUA 2HHHB 3K0KA 2BFEB 5HZHA 4EW2A 2BFPA 1X7YB 2CT8A 4WMLA 2VHXA 4JUCA 4ZEVA 1U0FA 3T1OA 2ZIEA 1R12A 2PMBA 3PHBE 4RFSB 5HDQA 2XMDA 4I9GA 5ENVA 3FRIA 1UC5B 4UFOA 4NENA 5CTAA 1M33A 4URVR 4YAGA 2ZB2A 2RGCA 4UAVA 4TYQA 2E87A 5JPIA 2MCFA 3R7SA 4PZUA 1UAGA 1RKBA 2TMKA 3IS3A 3N7TA 4DEXA 2YMQA 2Y9PB 5DBIA 4Z0HO 3NETA 3SFZA 3ZYZA 1NXPA 1DAOA 2ZOSA 4QL3A 1MGPA 1TJ4A 2BFDA 1F2VA 4FBLA 3LHIA 4MSUA 4BNTA 4IIVA 2P67A 3FUXA 1D4FA 1VHQA 2VG8A 4GRDA 3DCIA 4IKOA 3GJ7A 1Z38A 3EVTA 4JAVC 4WAUA 1BWPA 3BMOB 3RG8A 2FN8A 2XUDA 2ZT7A 4FSHA 5D5QA 2WF5A 3IESA 4DBVO 1EQAA 4UCXA 1ISIA 4EG8A 6REQA 1CERA 2I8CA 3RIEA 3VR5A 1Q7RA 2AN3A 5EIWA 3ZDRA 4AECA 2VUIB 2HSWA 2IDZA 3EFHA 1LTKA 5LQAA 1G3MA 5LDHA 3FX2A 1RWWA 1L5KA 5FWYB 4BQSA 3BTOA 2LRHA 3RAEC 2HQ1A 1GGEA 2NTVA 3H2HA 4U2FA 5JYCA 2F00A 1KETA 4QOHA 1Q3KA 1DWOA 1I4TD 2I6SA 4KPFC 1M8PA 1NUUA 1ZONA 3D8NA 4L9WA 3Q5GA 4FSXA 4JBWA 3RRZA 2ZCJA 3GA0A 2Q6TA 2VP6A 3GCWA 4MIYA 3R8XA 3SMQA 1K0FA 2OV4A 4BGVA 2R87A 1J0EA 1PWHA 3PNBA 4RJ2A 3WB2A 1QB7A 5EGNA 5GZ6A 3IAHA 2G9NA 3WSWA 4J8PA 3MIIA 5IM5A 4GXRA 2VNIA 2JNWA 1RFLA 1SD2A 4PLCA 1P44A 3A4MA 3OHSX 3OEEA 1GL3A 3F6RA 3FNIA 4PYRA 5FWDA 5B1YA 3KPVA 3LOPA 3KWLA 3RHFA 1CZRA 2VDUE 2EDCA 5IK2D 3TWOA 5EE5B 2ISQA 4XD7D 3RT9A 5IHXA 3S1AB 3ISVA 4RHUA 1UDWA 3GH3A 2FPRA 1QPBA 2DKNA 1JG7A 2ZPTX 3MCAA 2AK2A 4JWTA 4PR3A 3EQ8A 3WQRA 4B9AA 2HMTA 4P2BA 4Q93A 5LB2A 1W0CA 2Q2OA 3HKEA 2M1XA 1RBYA 1ZXXA 2I4NA 2PSDA 2PS9A 4XB6B 4KGDA 1U0SY 1RP7A 4R51A 4DUGA 1ZGCA 4V1CB 3HBAA 4DV6B 1HX7A 3P0FA 1LPBB 3BIWA 1LTQA 3ZNOA 1Z5PA 2ZUCA 3DB2A 3BC1A 1E2QA 2FDRA 4REQB 2VCHA 4Z0NA 5ADWA 3I04M 3FUCA 2HREA 1FYFA 3SF8A 1E66A 3GVPA 1N9GA 1HETA 2YZNA 4BGDA 3CVWA 3UK1A 5DDIP 5JWOA 1KMCA 5KYTA 2W2OA 4WK0B 5KTKA 1V5GA 1YC2A 1B1AA 1SBYA 2IT1A 3O03A 1B73A 5AVRA 2R8YA 5DBEX 1PL7A 3M83A 1DUIA 4EZIA 2QNRA 4CF4A 3KKMA 1RPZA 1J2UA 1PLJA 3JAKA 1K68A 3LGXA 4H16A 5CPFA 4BQRA 3THXA 1ENYA 4BCBA 4J43A 3VC2A 1A9TA 3P9SA 5HUHA 5L4SA 2OCDA 3OX3A 3O2JA 1YZQA 3VYRB 3X43A 2C2OA 1PJ2A 3VH2A 5MHTA 3NUQA 2IY9A 2O50A 4BMZA 2EJVA 4CMEA 1TZBA 2YXEA 4DR6B 2V58A 3QE4A 3QNWA 1GA4A 1HY3A 1IEVA 1MFZA 1PV2A 3DL0A 4BCCA 4A10A 4IX9A 4PN3A 4IINA 2P6MA 4WHMA 2ZRJA 1KO5A 2ZCVA 3JQFC 1A8SA 3UCXA 5JUWA 2HQRA 1GQOA 2VNKA 4FSDA 3FTQA 1QG4A 3DEFA 3L1UA 1XZJA 4Y7DA 2NVUB 4J3NA 2NO0A 4I5GA 4IOLA 1LBSA 5BV2P 3ED5A 1NHWA 3ET5A 2F6RA 1XTIA 2HM7A 2ONKA 4ALMA 3A4NA 4RE5A 1NF2A 4ITRC 3PDCA 4FHGA 4AXBA 2HRZA 3H05A 3RB8A 4QBTA 1N8SA 4RC9A 2PWPA 2IL1A 2PBFA 2R1TA 3WGQA 2XMQA 2ALJA 5GV8A 1LBEA 1TEZA 1AQLA 1SXJB 3AJEA 4JYAB 4L9SA 1FTSA 2Y92A 3RU7A 4YUXA 2C96A 4D41A 4P7FA 1VA5A 2G76A 3VVCA 3ZE2B 3MT9A 3OLYA 3DDSA 4S3MA 3EDOA 4X8HA 1MVNA 2ZIXA 4G2NA 2PYIA 2R86A 1O57A 3BFVA 3QPWA 4HGZA 4J3FA 3EXIB 2V4ZA 4CI0B 4O2BA 2V3CC 1VCHA 2C5HA 3MPUA 1SHKA 2J4FA 4V0QA 5EWJB 2VAVA 4AVYA 5DYYA 1JPVA 2XT9A 4CCSA 3T52A 2I1VB 4B81A 5C1OA 1ZRSA 4IIJA 4V0NA 1PEAA 3R76A 5HZKA 2VJOA 1SQSA 5D84A 2XTJA 5GJVC 1A4XA 2GLXA 3CMCO 1WB4A 1Z13A 3TL2A 1GVHA 2RHOA 5KDLA 2GX6A 4F4CA 3SJAA 3SQOA 2MOKA 3PLRA 3T35A 2X6RA 4UDNA 3GJYA 2VPQA 5HILA 4EF6A 4EVSA 1AKRA 2JLBA 4RH1A 3ZXSA 5BN3A 2GD2A 3CN9A 4KXWA 1RJEA 5AUOB 1J8VA 1YZYA 2FEWB 3S5UA 1QDLB 3BWMA 1BDMA 2IKSA 2QTMA 1Y8RB 5DMXA 3HB5X 3RV4A 4D9IA 5EIEA 1THZA 4GHWA 3U3KA 3LVQE 1YF3A 1WA5A 2XUFA 3PCXA 3VO9A 1MR3F 3VR2D 1I1OA 2VSYA 3OM0A 4JXJA 3MJFA 1S2DA 1DSSG 2B4RO 1X7DA 2R8PA 4J4TA 4KGVA 2C07A 5I01A 3EWSA 2O52A 4WCFA 9ABPA 2V65A 3AONB 2J9RA 3L7BA 1FYXA 1G8KA 1O96A 1I0ZA 3PT5A 4BNJA 5KOYA 2D8MA 1UDBA 1IXZA 2Z98A 4YUVA 5KBYA 2E18A 2CLLB 3S4YA 1OROA 2VJLA 4AU1A 2NNLD 3G17A 2ZIWB 1ZOSA 2WFZA 4P4TA 1N7HA 3ZWVA 1FMFA 3HA3A 1PD0A 4GR5A 3BSFA 3D7KA 3V5NA 1SB9A 1XLTA 4WK2B 5JS1A 4W9MC 3WA7A 1L5VA 1RR6A 2AC7A 4KG7A 4V0SA 4Z54A 2G3YA 1MEOA 1VBFA 3K1AA 1NVDA 3QBDA 1H5NA 3DZGA 3IAS6 3TLGA 3DLCA 4DR7B 2DOKA 3I6BA 4JGIA 4B73A 3M6VA 2BBOA 3D7MA 1CJSA 3LZDA 4YRQA 4X54A 1XTSA 4G0XA 3N8NA 1B93A 4ZC1A 4CJXA 4FFLA 4HDRA 4CDGA 4PONA 4E03A 2Z4SA 1CDOA 2UZ0A 3GK3A 5DYIA 2A30A 1S6YA 1NLZA 3HU2A 4TMTA 3RUFA 1WHSA 3K71B 2IHKA 3C3YA 4J1TA 5AI6A 3ZCRA 1PR9A 5KMGB 2P79A 1J1UA 3V6MA 1QH8A 1W46A 1EB9A 3QEMA 3WSTA 1TK2A 1U3WA 1OVGA 1EZ4A 1A98A 1NAHA 1NNSA 4YAKA 2J9FB 4X1YA 3P0HA 5D3QA 2LDBA 1ARZA 1R0WA 4H1UA 1K5HA 2QB5A 1V3QE 5IH7A 1DIOB 2PSHA 2VJQA 2YS7A 2PX2A 2XF8A 4DC9A 1CEEA 1SUFA 5JZOA 4OXQA 1W85A 3TEMA 4DIOA 1GPDG 4MWSA 1A7AA 3A3OA 5E4YA 1L8AA 2JCXA 1DHTA 3B13B 3LX8A 1B4DA 3RBZA 3SIWA 3T7SA 1MW9X 5EVJA 4ZZIA 1XMVA 2IF0A 4AG3A 4C07A 3TGWA 1KP9A 1X7GA 4ON9A 1FYDA 4W5JA 4QDTA 1EK1A 1TADA 4OFXA 2JH3A 3IP3A 3IPRA 4P2GA 1BXKA 1LB1B 3IRVA 4I99A 4BQNA 4K6KA 2GAJA 4LRQA 1AKEA 4G5SA 3GDWA 3LRXA 1RQGA 4RS4A 3PLNA 1ODSA 1SOAA 5TMPA 2H8GA 5G4KA 4V03A 2JK0A 3VR4A 1XTJA 2FW1A 2RKOA 3KKQA 4QD3A 2BEKA 3AR7A 2RGRA 1TJYA 2FPPB 4G0OA 4NYIR 1IQPA 2OD7A 1NNLA 2C9OA 3EQ6A 1SULA 4Z1MD 2E7ZA 3W5AA 8GPBA 4X8LA 2ET6A 1PZXA 3CIOA 2B1IA 2DQSA 3UW1A 1S7CA 5ERXA 2FX2A 3UMBA 2PRZA 2FFQA 1FVXA 1D2EA 5CM2Z 2JGAA 2O2XA 3PQ2A 5LBTA 3ZG6A 4JT9A 3ABRB 1MB2A 4BPRA 4V39A 1BCRB 1H8HD 3G49A 3ICWA 4XD7A 1V39A 5HFAA 5ES4B 2RH9B 4LG1A 2YBDA 2X9NA 2ZJ0A 4PQRA 3AB8A 4FR5A 3SDBA 1RJ9B 3TE7A 2FK7A 3K96A 4Q1AA 2ACEA 3AUUA 3WYFA 1JE0A 3IVAA 5EJ6A 1PW5A 3MQ2A 4AD8A 4QU5A 2IZ6A 3FJYA 2J3EA 4YP5A 5CVJA 4XSGA 4LWPA 2HIHA 5C1IA 4GUDA 3GWZA 4LSGA 4OHUA 3TD2A 2F43B 3N1UA 3OEHD 4UCWA 3W5IA 2OQRA 4DMKA 4R4JA 1VIVA 2PTHA 4NZOA 4X93A 2B36A 4PFQA 4QEDA 5FHQA 2X9LA 3O31A 3TM4A 3L77A 3EZ7A 3O3MB 1P1FA 3ETGA 4FC6A 4TV8B 4BFCA 2PVCA 5CDFA 1PYGA 2OBFA 3PFGA 1LZKA 4EECA 2AV6A 2PH7A 4F45A 1LZLA 3W90A 1ZCAA 1UOOA 3DV0B 4UBJA 4Y2TA 4EYEA 3EVBA 4BEJA 1QH9A 4QFCA 2WWHA 3OOSA 1JXAA 2GYVA 3KEOA 4P7JA 1A2KC 1QWSA 1ZISA 3VPDA 5AKYA 5FBZA 4C87A 4ZI3A 1E1NA 1EJ2A 1L4HA 2RGEA 2EJTA 3K6SA 1X7WA 3SJCA 2O54A 2Q1WA 4EVRA 1I94B 2BMWA 1HLFA 3O4HA 2NV2B 3K9CA 1MX3A 1UIRA 4KP7A 3SC3A 3L1IA 3RS3A 1BYUA 5G3YA 3KC2A 4Z9BA 2PUTA 4G1BA 4EO9A 4U9UA 2IWRA 2FUKA 3RRFA 2B9VA 4RSRA 2HWUA 3DF9A 4B75A 2R8EA 1SBIA 1S7GA 2NZ8A 3R7BA 2XUPA 1F0PA 1WIWA 4HXEB 4NP6A 1U7PA 4QRIA 3UHOA 4E31A 4Q4LA 5EJEA 5HHTA 2CLHB 4NOLA 2ZYAA 3C4QA 3IMGA 4JJ7A 4MR7B 4QPNA 1HNNA 4U2GA 5LQMA 3R9WA 1GNPA 1U7OA 2O3JA 1HR0B 4M8KA 5A9SA 5CD1A 4GWLA 4UJ5A 1WSBA 3PCTA 3PQ5A 2DBQA 3VJMA 1G3QA 1E8NA 1IZYA 1IN5A 2CF6A 4IDCA 1XMOB 1ZJWA 4IF6A 4OGGA 2Z1NA 3EGXA 2NT4A 4NFHA 1DO8A 1EK2A 1KIAA 4P22A 4YWJA 3EE6A 5JAIA 4F84A 3KT3A 1UOPA 3IPCA 4O2BF 3D81A 5LWHA 3VTKA 4PZZA 1XRLA 1L9XA 2IDMA 2JD0A 3I3SR 4HBGA 2QL5A 3CTMA 1GYRA 2W2LD 1DPGA 3I2JA 3SAJA 4D9HA 5AVZA 1IBCA 4BRWA 4BXOA 1QHXA 3P45A 2ZRPA 1GAJA 1CQZA 1K7YA 1O94D 3IFSA 4IIJF 3SZRA 2AYZA 3EVZA 3U3MA 4C78A 1AF4A 1U6JA 4IILA 3D2LA 4O4LF 2G17A 3SC2B 1NNI1 3OETA 1J33A 2YN4A 1E0SA 3HKBA 4IPTA 1XI2A 3X0DA 4N8SA 2IY8A 1ECLA 1X1BA 3LQRA 3OTHA 3P27A 1P3DA 4YI5A 4MYRA 3FNHA 3LC2O 1SO8A 4CU5A 2AR0A 2HA7A 4ND1A 2UYHA 2TMYA 3PXCX 3ADCA 1E59A 4KN5A 2JHAA 1FTWA 4OKSA 2D5CA 5IFKA 1KFJB 3E22B 4Q24A 3SJUA 2JBWA 3AGQA 2IXTA 1QSGA 2AVDA 3K1TA 5DMHA 1JDBB 5ERYA 3T34A 4A73A 1RJFA 2ZRBA 3VH4A 1XXHB 3UUFA 4CL2A 2VF8A 2ZR7A 4YBZA 1WJGA 1A8PA 1IQUA 3UAZA 3NGXA 1RCFA 3MA0A 3ZH9B 3OQOA 3B48A 4BEWA 1O3YA 3K2IA 1WMBA 1OD6A 1RRGA 2GKOA 1HSZA 2JW5A 2XCQA 2QPAA 4K7JA 4D02A 1TRKA 1OV4A 1RXWA 4GYKA 3QW2A 3X1KA 3EWIA 3D1LA 4JX9A 4ZKEA 3L4KA 5F98A 1KDYA 4ZI5A 5LMNB 1MAAA 4WZAE 5C7YA 1IK4A 3QIAA 7MDHA 3KXDA 3CX7A 2OAP1 3GRYA 2QZPA 4Z9XA 3CEAA 4YGYA 3U9LA 2KMLA 1MVLA 4YK7A 5HMMA 5K3CA 2O8EA 4WFIA 5B53A 3EFOA 1XD2A 4MI3A 5U1PA 3LFUA 4UOZA 4URHA 4N1AA 5KOJA 3JASB 2D1QA 2JPDA 3VSCA 2P4UA 3P9ZA 1IN7A 2WYOA 2GEFA 4A6DA 4DBZA 2ZATA 3MJEA 4C7BA 4EA6A 5GONB 5JD6A 4GLBA 2O8NA 4RMHA 4Y1FA 3HVUA 4HRYA 4LV6A 2FUG6 2IV2X 5TLSA 2Q0XA 2ZKIA 3AWDA 3WLFA 1H8ED 3CUKA 1MX1A 3CCCA 2GN6A 1GZ3A 2H4HA 2W11A 2VH1A 1KI4A 3HP1A 4NS1A 1JPUA 3EPHA 1C1HA 4D3ZA 3AHCA 4II7A 5G0VA 1XKTA 4IJ5A 3PNYA 4NHEA 1TQ2A 4QO8A 1T4CA 2WMOB 3VQTA 4V0KA 4EUHA 2M6SA 2NU7A 3NS7A 1IY1A 1R37A 4ZHQF 4JQZA 4PLFA 5DTJA 2FWAA 3SVLA 1MCZA 5AW7A 4KVGA 4J3JA 1RFGE 1I4OA 4S1WA 3C16C 2RHJA 3TBKA 3ZKAA 1TM5E 4IX1A 3SIPA 1GU0A 1SBNE 2QN7A 3ZX5A 2J33A 5LP6C 4D81A 2KLBA 1DUSA 4YB8A 2IPMA 2YHBA 5M2QA 1E77A 1OLXA 1UINA 1V6AA 2IVFA 4FDLA 3BAZA 1M2OB 4HDSA 4J49A 3OZIA 1DQNA 1QVWA 2PNFA 2LD4A 2R11A 4MX8A 4OA8A 5GVRA 3K5WA 3RRMA 3VYWA 3EMVA 5KNDD 4MWTA 5MGBA 3MG9A 3P9CA 3UHAA 3ORSA 3ZWDA 1BJKA 3PUJA 1ZVKA 4B47A 1EFTA 2OXFA 3E1GA 3FFAA 1OUMA 1U0RA 3FWHA 3LLVA 3LXUX 4KXUA 2V7BA 1B8PA 3GRRA 3O8LA 5CDTA 1E8DA 1MO3A 5ALUA 1EGMB 2Q5OA 3OQMA 2XB8A 4YMVA 3BH0A 1SNYA 2GXQA 1N5RA 3ZOKA 1J2TA 5L3QA 1X1CA 1E4EB 1AM4D 3EA4A 1AD2A 4D9MA 2HK8A 4OF4A 4GVLA 1UZMA 4Z4EA 4MVYA 4EENA 3FR8A 2HRQA 1JEQB 2PT6A 4MS1A 4AYTA 2H65A 4GLOA 3UJDA 5FAKA 1O58A 4JITA 2AMJA 5JAHA 3OJWA 2XITA 1K7SN 4HAUA 3T38A 2HTFA 4RV5A 1HEUA 4RD4A 1OPXA 1SFRA 3G88A 4YRCA 3OUUA 1A7KA 1I1HA 4H3HB 3BXOA 4LFCB 4QNNA 3A2KA 1ONNA 4QG7A 4JI7B 1Y42X 2SCUA 4MJLA 5AXAA 3LIPA 2ODWA 1VMKA 3KPYA 4XWTA 1KQ3A 3A1FA 2H1HA 2D54A 2OL4A 4HCJA 1A96A 1U9JA 3KWMA 1E2UA 4IIEA 4R3NA 2ZUSA 1LDYA 2BFFB 2QORA 3CZRA 3D43A 1RYMA 2G4VA 3I9V6 4HMOA 4X63A 2VNHA 4XI9A 4OH7A 4ARUA 3L4JA 5KTRA 1H8HA 1L3IA 4JV5B 4NBUA 3HH8A 4EHIA 2GBLC 3O21A 2ZRIA 1CY2A 3FB1A 3WKBA 5KSOA 1OCEA 1A88A 1F3OA 4CT5A 1N2SA 3DE0X 4X94A 1UUFA 2HV9A 3IQHX 4FILA 1YIAA 1M1YA 3D0QA 3DAGA 5A04A 2Q4TA 2R1UA 3DNPA 2RGDA 3TCNA 3IP8A 1OBHA 4REOA 2P27A 3B1ZA 3P9RA 1DQSA 2H59A 1UBOS 5EIBD 2M6RA 1M72A 4UHBA 5PGMA 4U9HS 2IUUA 1J8FA 2C8KA 3N76A 3OEHA 2FZ5A 3HXMA 2D5IA 5IF9A 5K4HA 3Q9LA 4WESA 1BW9B 1QXSA 1SQFA 5L40A 4LS3A 1GTSA 4OSOA 3L82B 1FJGB 1Y7LA 2I2FA 3T5MA 1XFDA 3PC8C 4CMBA 3PDHA 1X7XA 1N2CB 2L18A 4HWTA 5IN4A 5JRJA 3EXG2 4JR1A 3SOPA 1B00A 4PANA 2GSWA 4BKOA 3BE4A 4BVHA 3OTGA 4TN1A 2H7YA 4J1NA 1AKVA 1R9MA 2D13A 3OA2A 2X7HA 3IEVA 3LSYA 4LCJA 2JGIA 1JQLB 2O2HA 4R2KA 1GSAA 4UBLA 4CMCA 1Z37A 2Z1MA 2PN1A 4B6EA 1NIPA 1WO8A 1ZD9A 2X0DA 1U2GC 3KZXA 3T41A 2VT7A 4DT1B 3PYMA 4RZQA 2FDXA 1SRQA 4J2HA 1T5DX 2I62A 3HKDB 1NV8A 3IBSA 3NHPA 3PXXA 1IPFA 3B1WA 4RK0A 1G16A 3G9TA 1FYWA 3IE1A 3PUXA 2VF2A 3FUVA 2PKQP 2X8JB 1M10A 5KYXA 3KTAB 3OT1B 3QRWA 3UWMA 1BXGB 1AURA 2DH6A 3M89A 1NFQA 5DBHX 3EGDB 5E3IA 2DWCA 4ZOLB 4EFNA 4G97A 4D96A 5AJVB 2WUWE 2VPZA 3PDJA 4X95A 3OICA 2C0QA 3VJRA 1QO0D 2JLQA 3O7WA 5IBPA 5EJ4A 2I78A 4IG9A 4NYMR 2HMUA 3GVIA 1YTLA 4RA6B 2XNSA 3K2BA 3MUNA 3VVBA 5JYDA 1BXRA 3B1FA 1VYTA 1QP8A 1TCAA 1OWMA 1UPBA 2C9ZA 3LPDA 2NZJA 5DT9A 2Q4RA 4ZAFA 5G53C 4XQ9A 1OFUX 2D5BA 1V96A 3EEFA 5A4JA 4LJLA 3GP5A 1N0IA 3BGDA 2JCBA 1YQWA 2D06A 2FOXA 4FMBB 4JBLA 2PUCA 2W2LA 4LHEA 4YV2A 5DNDA 3GIWA 1EYZA 1O94A 3PNKA 5E3HA 3WA6A 1FSFA 3S0JA 1SKAA 3MNFA 4PO8A 3EZXA 2WTBA 5BN1A 1Q0QA 2O14A 5EEGA 2PGDA 3PRJA 4Z3DA 4KRXA 3AF6A 1D1TA 1F12A 4I3HA 3GLHA 2NUTB 3WMRA 4NJOA 4KQ2A 1EXDA 5AICA 3TH5A 3K9GA 1I2MA 3DFZA 1CX9B 2ILTA 3UMVA 1ILWA 4PRLA 1CDZA 2C3PA 3WXBA 4OU4A 3OPMA 1VJ5A 4EPVA 2NYRA 3ZK9A 3AEQA 3SZOA 1NNUA 1PX2A 5BSWA 1XMPA 1E79A 1GFZA 4UM9D 4Z8XA 3HJBA 8LDHA 5KYYB 1R6DA 1P1JA 1SVMA 2QRVB 3JVUA 8OHMA 1NE2A 1E3LA 1TECE 5BQPA 4MVJM 3EN0A 4Q4HA 5TF0A 4HLUA 2CDAA 2V5VA 1EZZA 3MTEA 1RRCA 4HQNA 5AJUA 5M3BA 2PIAA 3VR5H 1GN9A 4TYWA 1JJ7A 1BRTA 2GTHA 1EINA 4AC9A 3FZEA 5C5DA 2DUWA 1HLGA 2E4UA 1QORA 2ECPA 2HMSA 4R01A 4CMGA 2B9EA 1IEXA 4DNQA 4PU0A 3CJQA 2FEPA 2E89A 1NJ1A 3L0YA 4Q3OA 4ZCRA 3DAPA 3FOWA 2YZ2A 3AIKA 3OBBA 3BBLA 4J7XA 1B0UA 1K8RA 2B1RA 1T3HA 4UNQA 1U63A 2YV4A 4WY8A 3GIDA 2BGUA 2A6PA 4FDAA 2D2FA 4XGIA 4C0SA 4H1TA 4Q6WA 1Z35A 3H6KA 1YZHA 4HLCA 2H9AA 4K9MA 5DN6D 3I37X 3AVWA 2IUTA 4NC9A 2IH5A 4CV3A