5LN4A

Crystal structure of self-complemented psaa, the major subunit of ph 6 antigen from yersinia pests, in complex with choline
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFNDKQSTVINSKDVSGEVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen,pH 6 antigen
publication title Structural basis for Myf and Psa fimbriae-mediated tropism of pathogenic strains of Yersinia for host tissues.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ln4A00
5LN8A 5LN4A 5LO7A 4F8LA 4F8OA 4F8NA 5LNDA 4F8PA
chains in the Genus database with same CATH superfamily
5GS1C 5DQ9A 4NFCA 5L6YH 1J9SA 1LDPH 3OX8A 5GS0C 4UNUA 2F15A 5T1KD 5J89A 3LOWA 5F1NA 3S36L 1YNTF 3GBNH 3BIAX 1MH5B 2W81C 5MHSD 5D7EA 5FYKL 2RCSH 5EU4A 3FF8A 5ADPH 2BH0A 2YC1A 4E41B 1FPTH 5D7JB 1Z0NA 3ESOA 4K07A 2R1XA 3N41B 1OCCB 3IFOB 5J56B 2XZAL 4JKMA 1D6VH 2WGNB 1KFAL 1GZQB 2QFPA 2BHZA 4UILL 1NCAL 3L5XL 5KG9B 3HB3D 4RGNC 1IAOB 4L1LA 2H6PA 1SM3L 5SX5H 5LGHH 4LCCC 4O2EB 1KIQA 2X7LA 1G9MH 2HMID 1WHOA 4QRRD 1CPUA 4JREC 3VFVA 5C0CD 1MCRA 5I15H 1MFCH 5CSZB 2WIIA 4JHZA 3GPSA 5BCAA 4ONFH 4E2OA 5FFLA 3OF6D 3F58H 3SPGA 2JELH 5MENA 3SKNA 2Z7ZA 2HRLA 3BRGC 1HILB 1WJ3A 2OMYA 3V5DB 1TQWA 4KI5E 4XNUH 4PJXA 3NCMA 2GBUA 2CH8A 1N0LA 1W0YT 1ETZB 1KNOA 1WFMA 3G5YB 2YD8A 2FBJL 1SYVA 1U8HB 1ETJA 4F2ME 1JZIA 2R2BB 3WAJA 3P30H 4RWYH 2XV2A 3TO2B 4EMZA 3FSOA 2FYYB 4D9RD 1BFOA 2OXGA 3HMXL 3F7KA 1ACCA 3UTZB 3D25B 5CM1A 1OAXH 2F7PA 4WFGD 1UWGL 5A43C 5F9OH 5I76B 1EHLH 3AY2A 2B15A 2Z9TA 2YR3A 3U1SL 3W81A 1P69B 4PRIB 1YJDC 5C0RH 5LXGH 4MMYA 2ZPKH 4JGNA 3GMPA 1B0RB 3C12A 1JHTA 2WYHA 2BP5M 3WNOA 3O3EA 3MGTA 1EUUA 2I24N 4C4KO 5D9SA 3V9CA 5I1JL 4Z7NE 2YMXH 3S3JA 1IM3B 3VD3A 3F5WA 3ZHNA 1KY6A 1O5DT 4GKNA 4JR9L 4ZI8A 5AZEH 4WGKA 2OAAA 4Q7DA 1GMIA 3FYEB 4XX5A 3NEOA 4HOZA 4Q2ZA 1N64H 5E1AB 4BK5C 5F7DA 4KX8A 5IGXH 4WK2B 2EYTB 3QHFH 3B3IB 4OZIA 1AMXA 1EMTH 5D72L 4NWUH 4PJEA 2NXYC 5AWNL 4KUZH 1S7UB 2X70B 4XVUC 1P9MA 4OVVA 5G55A 4UOQA 2X12A 3UC0L 2EEAA 1KLFB 3VXOA 1YA5A 1BXAA 1MFEL 1QI5A 2YSSA 3RDTD 2Q7AA 3KVQA 4H7VA 5CZVL 1CLOL 4CC1A 3MUY1 2VM4A 4X7TB 1YO4A 2AJYH 4D9QD 5BW7C 1J5OL 1JXKA 2BY0A 2AEQH 4PJ7F 1G1OA 2B39A 3L1OH 3WIFB 2FJGA 4F58L 3O4OB 4KO5A 5KZCB 3MCLH 5L6YL 1A66A 1LDPL 1JAEA 2Y6SD 1GC1H 2R0ZH 5EO1A 5T1MB 3QDHA 1N8OE 4NQCA 4PPTA 4OB5H 1YPZB 1MW0A 1WIPA 3DSNA 3GBNL 3LNEA 4HJTA 1P4IH 2NY1C 4Y4KC 3B34A 2RCSL 4U05A 3DPBA 3QRLA 1ZV2A 3TIEB 5ADPL 2CLRB 1FPTL 3GDCA 3GSOB 3K6IA 3QISA 4HKZB 4FQHA 4NX0A 5FYLE 3ZLQC 1SJHA 3CE1A 2BZDA 3RGVC 3I9AA 4JFEA 5GRYA 5T3ZE 3MV9E 3V0GA 4MYPA 3FRUB 3OKEA 5KS9B 4XCEB 3GXTA 1V5JA 2IAMC 2FIKA 1G9ML 3MKGA 4PJDB 3VXMD 3F6LA 4P8QA 1AO7A 3LZRA 4MMZA 1HNYA 1PZ3A 3CPUA 2DH3A 3VU2A 4ADJA 2NW3A 3D2TA 1MNUH 4ONFL 1ML0A 3F58L 4GRLC 5HJ3A 3UL4A 3IWUA 4WWPA 1LEIB 4M48H 2UWEA 4HIIB 4UDUB 2JELL 3I3BA 2AGJH 3OSKA 1UUNA 4PRPE 1S7XB 4MJIB 3SQOH 4XNUL 3OMIB 3WKMH 3CCHB 2Y7NA 2GAZA 1CZ8H 1Q1JH 8CGTA 4PU2A 1N70A 4XBGA 4Z7UB 1NJ9A 2MEJB 7TAAA 4QTHA 5JPNB 3P30L 3F6IA 5D5MA 5LG6A 4NQQA 4RWYL 1MI5B 3ARWA 4QRQB 4DGVH 4FQXA 3L08A 2J7LA 1LO0H 2W9DH 1OAXL 4RSYA 1IEAB 4E5XG 5IVZA 2FL5B 1FIEA 5F9OL 2OYKA 1INEH 1WBYA 3ZE2B 3QQ9C 1KOAA 2O5YH 3UDWA 5AYQA 1UASA 4JFWA 4MZ2A 1IRAY 5C0RL 1JMZA 5LXGL 1JXFA 2ZPKL 1MCWM 2H4EA 2UUDK 3VFOA 1EJ8A 4TSBL 1A8JH 4LHJB 1RZKH 2KLTA 1GOGA 3JV0A 2YMXL 3NSXA 2A73B 3TJPA 1RKRA 1QMUA 1A9BB 5KSBF 3QUZA 1EERB 4X6DB 1QSZA 1N64L 3AFLA 2Z8WC 3E3QC 1YUHB 4J8RB 2X4QB 5IGXL 1BBJA 4GOSA 1G7HA 1EAQA 2VRKA 2HN7B 3QHFL 3BKYH 3BIKB 3T2LA 5CFAA 1RK0A 1EMTL 5FXCH 5C0DB 4RX4A 4YHMH 3L13A 3CFNA 3S3DB 1MHEA 4KUZL 1AR2A 4ZUUB 3IXTB 4JG9A 5IEKB 5E2TH 1T80A 1KEMH 3JYBA 1CFMA 1G0DA 1M05B 4Z7VE 3DXAD 1C9SA 4JX0A 5CP7A 3K4DA 1R9FA 4XB7A 1M6OB 3QZMA 3FT0A 1F41A 2AJYL 12E8H 3IRZA 4N6QA 3HN5A 1TNNA 4XNAA 3L1OL 5I2IB 3HAEG 1IQDB 3A24A 3QEQB 3QW9A 1BMGA 2Y1ZA 3MCLL 4JG1H 3U7YH 1GC1L 3DETD 2R0ZL 3LIUA 2OTWB 1A22B 1QQDB 5EU3A 4OB5L 2CIKB 1JDCA 3RIAF 2IOMA 1P4IL 4OLZH 3D39B 2F08A 5DCCA 4D0BA 4OQTA 1LM8V 5EUOA 3AWFA 3EH2A 3UZEA 4B41A 3WSQH 3IJSA 3NK3A 4OLWL 5D7LA 1VF5C 3QIUB 4I1PA 4Q4IA 3QNFA 4HS3A 5HJGA 3MRFB 1KXTA 4BQBA 4EI6B 1PDKB 4Z7OF 4NUQA 4L5FE 1KPRA 4OLVH 3QFJB 1J9CT 4WO4C 4XPAH 4EUPG 1D6EA 3OPZH 3T77A 3MACL 1BVKA 3RFZB 1RV6X 2XN9E 1KTDB 1WHPA 2VWEE 4H1LA 2APBA 4HHAA 4UYPA 5EOQH 3RVUD 3ZL1A 2ENYA 5E2WH 3MZGB 4WFFD 2A74A 4Y5XC 5DU7A 2WMPA 4U49A 1WZLA 4HC1H 3SYCA 3GZQA 4ZUVB 1T83C 1TJHH 3OAYH 5J6GB 4HS6B 2M1KA 4OQTH 2DL2A 2XN2A 3SKOA 5C70A 3N42B 1USZA 4M48L 2RALA 1NOFA 1E5ZA 2AGJL 2DTMH 3C09C 2CBQA 3B8SA 5C07B 3SQOL 2MCAA 3U2SA 4PJGE 5DURB 4N2DA 3WKML 1CZ8L 1Q1JL 3LIZA 2ED6A 4ZPTA 5F89A 4YPJA 1UZ8A 4ZFOL 1A4JA 3PWLA 1HQ4A 4WKZA 1KBWA 5I9QC 2KLRA 1LO0L 2YPKA 3ASWA 3DVGA 3QXVA 5HYSA 5JW5B 2GJ6B 2W9DL 1XAKA 5HDBB 3P0VH 1KB9K 1INEL 3MNWB 4AYBA 2CHDA 3S98A 5B7FA 2O5YL 5DZVA 4HGWA 2H0PA 3OZKA 4FQLH 4AYEC 1QFWI 3T4AB 3HW7A 4N2CA 3QIWC 4YC2B 1XGRA 1UZ6E 2ZONA 5E9DB 2XVBA 3SO3C 4JY5H 1QKZH 3BUBA 4FABH 1DTUA 2BWQA 4GPVA 1H0DA 5J6HA 1U36A 4GRWB 3VGEA 1N12A 2BLFA 2NUTB 2XIDA 2XWJA 2JQAA 2J55A 3MHZA 4JFYB 4V1DD 3S96A 1KJ2B 2ZG1A 3B9KD 3KNBB 4CKVX 3P54A 4ZNEE 3CHPA 1ETB1 1RJYB 2NY3B 3HI6H 3AQXA 3ULVF 4XOAA 3BKYL 1HQRA 3A4FA 4LKCA 4YHML 2ESVA 2ITEA 5FGCE 3EBGA 4PD4J 1Z66A 3NSDA 5E2TL 5TQ0H 1KEML 2W0PA 4OF3A 4YZFE 3VXRB 4KROD 4L8CB 1UH2A 4H8WH 4JZOA 2ZYRA 4X6FA 4F80A 4PWFA 5DTFA 4KVNH 12E8L 1H3PH 3WLBA 3KPTA 2BCKB 4YBLC 1OSEA 4E9SA 1FH2A 3X1NA 2ROYA 3U7YL 4JB9H 4B9FA 1MFUA 1KGXA 2AEWA 2J4WH 5DD5H 3VAEA 1TEYA 3C60C 1DE4A 3SYPA 3BAJA 4OLZL 3HUJF 1WZMA 4DEUA 3VMPA 4FXKC 2KHAA 1MFAH 2WLYA 3WSQL 5MEND 4P9MH 5HI4C 3WY1A 1AAJA 2G75B 4UI2A 4YK4B 4F5CA 2MQ3A 1ZLDA 3CFIC 4I0PC 3WJMA 2H32A 1B3IA 3CX2A 4OLVL 3WCYA 3AABA 4KUCF 4Q6YA 1W8NA 1Z9PA 2FRGP 3DMMA 2WXPA 4XPAL 4OIIH 3OPZL 1HWHB 3B7RL 5HGDB 4W6XB 5FAAA 2J56A 3H3KA 3LQAH 1LGVA 2XWBA 5M7QA 3IXAA 5EU6A 4F8PA 4JKPH 4UQ2B 3QK0A 4RESB 5E2WL 5L2KB 1T1XB 5GIRB 3RWEB 1XR9A 2NY0B 5F7YC 1DBJL 5FK9B 5K1VA 4G82A 4HC1L 4S1SH 4GI6A 3IKCA 1TJHL 3PG2A 4XI5D 4OQTL 1AGEA 4C57C 2K8QA 4HZLB 1VLXA 5BUAA 1G6VK 5CGTA 1SXCA 2D0GA 2R83A 3F7YB 2DTML 4JGMA 4HIJB 5GS2H 4BQCA 4NQEA 1JXDA 2WLIB 3M1OA 4MKTA 4PS8A 4AH2A 2MH4A 3VB8A 4M5SA 1FVEB 1KFGA 5HHME 4ETQA 1NFIB 4X5WA 4WJKB 5LNGA 2UY7B 5HXMA 1AG0A 3MLVH 2V9RA 2NNAB 4LPVA 5FDWB 3MBXH 3RPIB 3RWHA 1HJCA 5F9JB 2XXMB 4I8DA 5AW5B 3JXAA 3JTSA 1LMIA 5FLVA 3X1BA 1KBVA 1NUGA 5DRNA 3MBEA 1O7SA 1BP3B 3P0VL 1EEYB 1NUNB 3T71A 3WLWD 4FQLL 3G08B 4QIRA 4ABUA 4N2EA 2PCPA 2OMWB 3C08H 4XAKE 5I6OA 4A7SA 1QKZL 1NKOA 4U1SB 5C6TL 2B8OT 3IGAA 4WU7B 3JYCA 4ONHB 4LRIC 3ARZA 3SKMA 4C4KT 2F7QA 2FTAA 3BVWA 4I3SH 4QRRB 4ZXBC 1A3RH 3BUDA 1XB8A 3QDAA 2JIXD 1ZRUA 4OUUB 3ILQC 1HH6A 2LLLA 1AGFA 3HI6L 3VA6A 3N41F 5JLZA 4IRJD 3K7UA 1QEWB 3EJUA 1M71B 5IMKA 1IAIH 1YC8A 5ID0B 3MRGB 4GKZB 5ANME 5TQ0L 3S37H 4OZHA 3W0WE 4NM4H 2I5YH 4QRFA 4RIRB 5KTEH 4PJHA 3VGGA 1MFDH 4H8WL 4JFED 1LLAA 4TVPD 3AS2A 4JPIB 3WD5H 4LNRA 2B59B 2XSKA 4YBHA 1H3PL 1ZVHA 2WCGA 3A67L 3GS0A 3L4VA 2QSQA 2GEQA 4PHXA 2YMOA 3SD5A 3U0TA 3LRHA 4JB9L 3ZO0A 4BHUI 2WLJA 5F3BB 2J4WL 2ATPB 5JIMA 1WWAX 1QRKA 1XL4A 3PAUA 1J0IA 2XFXA 4HSQA 3T6QC 3FT9A 1MFAL 2VR9A 4P9ML 5BS0D 2AQTA 2UX7A 5G4NA 2OMZA 1LD9A 5GGVY 3OB0H 4Y4HC 5JNYA 4O02H 1BQLL 1WO2A 5D4IA 3U30C 3DJ9A 5GZNC 5FO7B 4LLMA 3DJTA 3NQIA 4IW4C 1NIBA 2Z4TA 4ZUTB 4PRAB 5IR1B 1MLCB 4OIIL 1X3DA 2NY6C 1OT1A 3KPPA 3TTYA 3ULSB 3DIFA 3LQAL 2FNWA 3HG4A 4FQXD 1QI3A 3C75A 4KI1A 4LLQA 4PUBH 4JKPL 3RWFA 5E08H 3R8QA 1VEMA 1A02N 4WI4A 5HI5C 3OKKB 2YWYA 1LQBC 1YEWA 4R5XA 3ZZLA 4OGZA 1Z6JT 4S1SL 3QDMD 1O9ZA 4FTVA 4JVPA 4TTDC 2GVYA 4TV3A 5DHVH 1GGIH 3LKRB 4XO4A 2FLBT 1I1FA 2PN5A 3RDTB 2N0MA 1ZEAH 3C2SA 4U0RB 32C2A 1AFVH 1A1NA 3NMEA 3IMVA 4J3SA 2PETA 2EYRB 3RA7L 5MERB 3VXUA 3U0WH 3BT0A 2HT2D 1WZ1H 2ICEA 2WLLA 2NXZC 2OA9A 1DZBA 3GZPA 3K6DA 5JTWA 3CH1B 2VL4A 1H3GA 2G9HB 3TPUB 2XWRA 3MLVL 4ZW7A 4LL4A 3MBXL 4M6OH 1NPNA 2LW3A 4LP8A 3L17A 2C7UB 3ZR5A 1CQKA 1CE6A 4KV5E 4ZMQA 4KBPA 1GKOA 4L8SC 3BO8B 4RX4D 1S9YB 1KTLB 1Y6NR 3VSQA 4OUOA 2H26A 3VG0H 4EZMA 3P9LB 3EYOB 2DWYA 4HWBA 5H37H 1TTGA 1JGLH 4PB9H 3C08L 1J8RA 4PJBA 1F18A 1KJMB 3DHMA 3WOVA 3K6SA 4PJIE 5TGBB 1T7YA 3BDXA 1TQBC 1JGDA 3K0WA 3LRGA 4DSYA 4UM9A 2EVFA 1YPZF 2A6IB 3G3LA 5D7KD 3GSRA 1NCWH 2G60H 5FCSH 2HWZH 3MUUA 3VWKA 5AEAA 4OF7A 3VCLB 1A3RL 4NN7B 1FSKC 1F3JA 4AXWA 3BPOB 2JKSA 5L0QB 4X8GA 3FB6A 4I4WB 2B2XH 3AU1A 3ULVC 2WYTA 2VDNH 4JL2A 2UZXA 3CFMA 3V4VH 1IAIL 4YR6A 3MX0B 3CFDA 2FZ3A 4UQIM 4K94H 5IHZB 2AKRA 2IH3A 3FULA 3S37L 5KS9F 4PJ9C 5A3IC 1S4IA 2BWIA 2VT0A 2I5YL 3IE9A 3LV3A 4NM4L 4RMBA 4JEGB 5KTEL 1MFDL 3DX8B 4PJDF 3WD5L 4NBZB 1P7QA 1QHPA 2E7BA 4DWHA 3RTQC 4YSQA 1M7IA 1WAAE 2FVNA 5F2FA 3MO1A 1UQSA 1ZDSA 2GW5A 2BK8A 1L3NA 5IQNA 2XC8A 3OKMA 4JFFE 2IO5A 2APTA 1VADB 3JTTB 3QDGA 1P5UB 3R4DA 4J28A 3UCRA 1KB5H 2WBJC 1EAPB 2EXYC 1VA9A 4P5KA 4ELKB 3FONA 4IMKA 5E6IA 4Z7UF 2Y2YA 2AVFA 5J06A 3RUGE 4OCMC 3OG4B 3BPLB 4O02L 3EXLA 4GNKB 5DJ0A 2J6EA 4LVHB 3PL6C 4LEOB 2WSPA 3QDJD 3CN3A 4PUBL 3ZE2F 4Z0XB 5KSAC 1LEGB 2YBGA 3EGDA 4Y1AE 5D93B 3PY9A 4QHMB 3IAGC 2FEEL 5SWSA 1VPOH 2VDLB 3ZTNH 4KNTA 3M7FB 1GGIL 4TPRH 4PYHA 3DXAB 3GMNA 4OY9A 4W70A 1YMHB 2X0VA 2VLKE 1HX0A 1ZEAL 2I9LA 5FYJD 3NJMA 4G6KH 1AFVL 3AXHA 4X6DF 1P84J 3U0WL 5IHWA 4KMLB 1WZ1L 2J6EH 3CVBA 1JNJA 1D5XB 4PJ5A 4F37F 4M7KH 4JANB 1DLHB 5MI0B 1FGNH 4BUHA 4K3JH 3RL1B 5ITFB 1DQMH 4UAOB 4KJWC 4M6OL 5GGSA 3C8DA 3D4YA 4Z5RA 1IC0A 3PJLA 1FV1B 4G8GD 1FRGH 1MHCA 3BWAA 4PCSA 4LDEB 5CU5A 3ES6B 2ESVD 4RZKA 3QJUB 3ZSSA 4S1RH 3VG0L 4BYHA 2NNXA 3MJ6A 4HU2A 5E6YA 3PS6A 3KPLB 1PEZA 1JGLL 5H2BB 2WQUA 4PB9L 2PWEA 1R17A 3ZVVA 2FT6A 5IHHA 4A2HA 3B37A 1XX9C 1MJUH 1AMYA 2OMUB 3NIGE 4W9ZA 3AGWA 4A7UA 1UURA 1NCWL 1IL1B 2G60L 2P42B 2C9RA 4WHCA 1X5YA 1AIFA 3U4BH 5H94B 4RGNE 1XR8B 4S2SB 4G72B 1J5HA 1OARH 2OXHA 2P52A 3IPBA 5D7JC 1TETH 1A7BA 1XV8A 1PY9A 4YHNB 2UY6B 2KQNA 2B2XL 1DL7H 2CGYA 4WIQA 2WXRA 2VDNL 3RNKB 3B3BA 3UJJL 5IB2A 1CDJA 4I2XE 3IAPA 4JCMA 4XNYL 5DT1H 1HINH 4G8IA 4K94L 3RHWK 3J27A 3N6YA 1VFAA 1JF6A 3IMWA 2BXYA 4OJYA 3QZNA 4HS8H 2DJSA 1NC2B 5DR5H 2VMCA 1F6AA 4YSPA 3EFOA 2R9HD 1GZHC 2Q6WA 1KB3A 2IH9A 3UZVA 2ZXQA 4JDZB 3DUSA 1OT4A 2COVD 2AK4E 1UT1A 1Y18B 2C1PB 2CRIA 3QA3A 1PY0A 4MJ5A 4BFOA 1BQHB 4KO9A 2F1BA 1B6UA 1ZHNB 5ETUB 5I1LB 3N42F 5DHDA 2WKLA 2YRLA 3TCTA 1JGEB 3EJZC 2J25A 1A6ZA 4XCNB 5I16A 4HGMA 3V0JA 1KB5L 2AQPA 4YHZH 5DUPH 5C0EA 2WO4A 3CIQA 5HGHA 2SEBA 4YDKH 2IPUK 1GPOH 3MRMA 1A9EB 5J12B 1A6AB 2I9TB 2QADD 3PP4H 1QO3B 3C5ZB 4AENA 1A6TA 4ES8A 3F7VB 1F97A 3Q8BA 4HQQH 1E6JH 3TO4D 1FN4B 2H2PD 2X3BA 3GXDA 4V1DB 5HDBF 2R2HB 3L1FA 4XCCH 3B9KB 3QNYA 1AYRA 4X4XB 1KLUA 1UHVA 3L81A 4NC2B 4PREB 3NFNA 3BUYA 4UDTB 5CKAA 4FMKA 3BP4A 4LLWA 4OCWH 1X5LA 3WJLC 1TO4A 3GRGA 1UGNA 1E4XI 2JCCE 3ZTNL 3MRPB 2P26A 1YN7A 1N8ZA 3OXSA 1B2YA 2R29A 2VLLA 3MUZ1 4I5BA 5BO0D 4HIHA 4TPRL 1RD6A 4GRWF 1L5GA 1QUNA 4S1QH 4U6YB 5T33H 4RRPG 2N1TE 2NY4D 1TZ8A 4G6KL 2BSSB 1VAHA 4CRPA 1GZPA 2J6EL 4DKAA 1JRHH 5PAZA 2EXWC 2Y7QA 2C34A 4F27A 4M7KL 2W0FB 2YBRB 3X2QB 1FGNL 2HTKD 1EHAA 3Q6GH 3CZFB 3FQNA 2BSEA 4HUWB 3ARED 3T8VA 4NUJB 4N26A 2XQYA 1OPGH 5T5FA 3RVTD 3RWDB 4TULH 3UTTE 1FRGL 2VR4A 4FA8A 1VFBA 4S1RL 1MCOH 4NAJA 1T2JA 2WVTA 2PF6A 5C0GB 1SLUA 4P2CG 1W0WB 5E95B 2LHAA 1T4WA 2HYMA 1RSFA 2Y25A 3NQKA 4CADA 1DFBH 4B9KC 5J8OA 1MJUL 4Y4FD 1TZHB 3MNZA 4XVTH 4AM0Q 1A4CA 1WGVA 1CXEA 1AGBB 4FL4B 3RKDC 1QW9A 1YLBB 3L5WA 5TF0A 3WENA 1JZ8A 3WGUB 4D0CB 5KN5A 4DW2H 3U4BL 1ZK5A 1OARL 1T20A 2D03H 2XTSA 1CBVH 1DL7L 3DV6B 3PAYA 4GW5A 4CVXA 1IC1A 4O2CA 4X5XB 5DT1L 3LPWA 4PJ8D 1HINL 2ZAHA 3CN0A 2EACA 5J1TC 5CAYB 1OHZA 1OD9A 3MOQA 3P9MB 1UM5H 1I3RA 4HS8L 4X99B 1GW6A 5H8DA 4ZMZA 5I71C 5DR5L 2WXJA 3W37A 5B3SB 3TBWB 2WCSA 3Q5OA 2P48B 1T21B 3O3AB 1J7VR 3TVMA 4N2GA 1JNNH 4IDLA 4NO3B 1PL3A 3GSUA 2E76C 3EJYD 4KNQA 4R0LB 1M3JA 3US1A 4X4ME 4XXWA 3EHBD 3ZGHA 3IFPB 2OL3B 3TEWA 3SGJA 3EGXA 1CXHA 1MAJA 1I8IB 1UWFA 3MROA 4FYSA 5E6UB 4OD1H 3H9SD 4LFHD 5DUPL 3RVWC 4EJ1C 2VDPB 4Z23A 3LNFA 1QWUA 4H4NA 1YEJH 1NAMA 2JI3A 4RMWA 4XXDA 3L3HB 5IUCA 3HI1A 5K5YA 2J8OA 1NGZB 5JPNC 1ONQA 3PP4L 5IK3A 3VXUD 1P0SE 5IJVB 2R1WA 4UTAA 2WXHA 3PWUB 3HC3H 3OR7A 1UVQA 2VN4A 3JWDH 1QBAA 2K78A 4QNPF 3UEQA 1MKFA 4HQQL 3OD3A 3UBHA 4GQ9H 3PIQB 2ITFA 4XCCL 4YHPA 4S10A 2ZP8A 4FERA 4TYUA 2W0LA 4UYQA 4MNGE 2JIXB 3GTNA 4OCWL 2WQVA 3O9WD 1XF3A 2ARWA 3QWRA 4IRJB 4UQ3B 1DLFH 3CUPA 4HV8A 3E3QE 3ILPB 4M6AA 1WE5A 5TDNA 2ZYHA 2CBPA 4XP6H 3FB5B 4TS6A 3PXLA 1NAMH 3JTBA 1CD1A 3OHMB 3S9DB 4S1QL 5T33L 5H37G 1NOLA 1XGQA 4HUMB 1FYHB 1DVFA 5KBDA 4YFLI 5TK2A 4UTAH 1GA2A 1S9VB 4N2KA 2VGLM 3DX6B 1ZA6B 5DHEA 4Z7VA 1JRHL 4Q6IA 3DX1A 4HP5A 4UM9D 4BKSC 5KYXA 1ZLUK 1R3LB 3BYTA 3VH8A 4MD4A 1VFUA 1CF8H 3Q6GL 4G8EB 1A0QH 4M1CD 4G6ML 4OI9A 3BFQG 3CG8A 1AD9B 4QYOA 2VM9A 1OPGL 4KK5D 4TULL 1ITCA 5D71H 3DX4A 1IU1A 1FFPA 1P7KA 1U91B 3VI3B 5I6XB 4BM7A 2A6DB 4ZUWA 4IOSA 5DJAA 1E4HA 5BS0B 2R29L 1NCJA 4JQIA 1MCOL 2YGPA 5BV7B 1FDLH 2R7EB 5CGMA 3SPJA 2E4FA 1ID2A 3J2PA 3SN6N 2JVUA 3OL2A 1GJIA 1ORSA 3QZLA 1DFBL 5FECA 1P7QD 1TFPA 4XVTL 2V17H 5HYFA 2CUIA 1IFHH 4Q0XL 1D2OA 5CN1A 1MEXH 1O9WA 5HI3D 2F5BH 2JH2A 4QKXB 2C4FU 3EOBA 3KG5A 1U8MB 4KRPD 1CFVH 1GGUA 4DW2L 1XH3B 1AS8A 4K15A 2P24A 4G9FE 1BX2B 4S1DC 2XN9A 3KPQB 3FQTA 2CCWA 5T5FL 1PZUB 2D03L 4H26B 2KDGA 3QDMB 3UYRH 2QLYA 4R90H 1CBVL 5DS8A 1PD6A 1TSRA 1IAMA 3D08A 1K3IA 5DDHB 4HD5A 2RACA 1ORQB 2OYPA 3VFNB 1UG9A 4LSSH 1GH7A 1UM5L 3TBYA 4NRZA 4WUKH 3RFZC 3EJSA 3VI4B 4N9GA 1ADQA 5JQ6H 3D4GA 4FLRA 1ZVSA 1LO4H 3J8F7 3KH3A 4KKAC 5CEZE 2H1PH 3HZMB 1OIOA 3BVTA 1JNNL 4PJGA 5SWQA 4RGOH 3QBTB 3EXJA 2DQMA 2ZYSA 2MKWA 4GMSL 5E94A 2CLZB 2OKMA 2X4RB 4HOWA 2P80A 3L2LA 3FU7B 2WLMA 2WLNA 1DJXA 1ZPUA 5BZWB 5SWSD 1DFXA 1MUJB 1RURH 2ERJB 4OD1L 2VIRB 4MD5A 4U2ZA 5D7IB 5KWYC 5ELIA 1YEJL 2DDQH 2ALWA 5DK0B 4IQHA 1RHHA 3MV8B 2DD8H 1DP0A 4LHQB 1LYQA 4JY6B 2VXTL 3GM0A 3Q1EA 5DMJB 4G8FA 1MJ7H 1NSNH 2DV6A 3COOA 3KGSA 2Q20A 4KXCA 2XRAH 2F18A 3HC3L 4PJ5D 3D12B 4XODA 4UUJB 3JWDL 1S78D 1W91A 3SQBB 1OGAE 2JKIS 3T3PE 4GQ9L 1F2XK 1NOAA 2N7BA 1U8LA 1MWAB 1P6AB 2ATKA 2HLAB 1UB5B 3M8OH 4ZQKB 3WE6B 5EZJB 2HJFB 5F88A 3CDFA 1Q9LB 3T4AC 1DLFL 3K3QA 4YC2C 5GRJH 3SE3C 4URKA 2LV4A 3EJPA 1TVDA 4ZNEA 1EEZA 1RZGB 4N2HA 4XP6L 3ARBB 1SHMA 1NAML 2EE6A 3GJFB 4AIZB 4MDIA 2VN5A 4IK7A 3V4PH 5LGYA 3FUEA 4UTAL 2GQHA 3AROA 4TLUA 4EI5A 5K93A 4A7TA 3QH3B 3DRTA 2OSLA 2ZXDA 1FQ9C 3PQYE 2NY3C 3E6HA 2BIOA 1W8OA 1CF8L 1DDTA 3WN5A 2FUQA 2VQ1B 3L6FB 4PG9B 4PJ7E 3TNMA 1RZJC 2CKNA 1X5AA 4GP4B 4PQXA 4QJ5B 5D71L 4NHCH 3MRCA 4LCWD 3PGCA 4RDQG 3VXPA 2MPAH 4MD0B 1AZRA 5E8OB 1QLRA 1NLDH 2UZIH 2YGQA 2NCMA 3ISRA 4Z78B 3BGMA 3B6SA 4QCIB 2OX5B 3F7LA 1FDLL 3B9DA 2ITDA 3GLDA 5I0WA 5SWZE 3CFJB 4WUUB 4JCWA 4KI5D 1UXWB 5AOMA 2V17L 3QDJB 3RGBA 1IFHL 4L9DA 4GW1B 4I1RA 2MOQA 1MEXL 2W91A 4LSPH 3SGDI 2F5BL 1TQSA 2OPCA 3T0EC 1KXQE 5EEUA 1R47A 1CFVL 2VXUH 2FGWH 4NQTA 5FW7A 3BP7A 1FVDA 5K33A 3H85A 3QJVB 3WIHA 4BE6A 2X1WL 3UYRL 4R90L 2ARJB 4KK9C 4YK4C 4PRDB 3U25A 2K70A 4PGDB 1FP5A 3GFUA 4E42A 2IALA 2VMFA 4L4VE 4WI8A 1QEXA 2AITA 3CFKA 4LSSL 4PIRF 4WUKL 3VDAA 2P28B 4UU9A 2APVA 5L2JA 4AGNA 5I17A 3MR9B 1BLNB 5JQ6L 4AVJA 4FQQA 1LO4L 1NBCA 3BAEH 3FFCB 2H1PL 2YA1A 4MWFB 2NY0C 1NEZB 3QR0A 4X7EC 4BZ2A 4DPRA 3OJDA 3TBVA 3MMEB 3RVVC 3L3DB 4G8GB 4WHTA 1S46A 2YAFA 2OFQA 5J1AB 3U2IA 1HXMB 1CS6A 3EDEA 3WIHH 3CN4A 2YWZA 1CU4H 1E8ZA 2HJLA 5TK4A 5CILH 1RURL 1JV2B 1A6VH 2X44D 4NKDA 4CILA 1ZV5A 3GJEA 3UBXG 2DDQL 4GSQA 4BFBD 5IB5A 4JQVC 2DIAA 3FO2B 4CKQA 1RSYA 3EH4B 2DD8L 1AVAA 1E65A 1H6EA 2HFTA 1BEYH 1G7PA 1MJ7L 1NSNL 2WWMD 3FU9A 3KCPB 1ADQL 5BOPA 2XRAL 5EO9B 4FLOA 5JO5B 1ILSA 5LBSA 4AEEA 5CZKA 4NRXA 4XO9A 3VSVA 1CXFA 1IO4C 2DI9A 4X4KA 4XWGH 1E40A 4KZDH 2VN6A 3M8OL 3VFSB 1EBAA 2DMCA 4LSQH 2BHUA 2WXKA 1XDTT 2FQDA 3KLAB 5FO8A 1UB6B 2Z93A 5GRJL 2H1LM 4Z3JA 3CQPA 4LLUB 4JGUA 3EDKA 1JGIA 4K9EL 4B5ZA 4FULA 1SN0A 2A9DA 3X14A 5JOEA 5EUKB 3CDGB 4I89A 1CGTA 3DO7B 2WXGA 5AVRB 1WRFA 3V4PL 5ANMA 5FYLD 2Z91B 3CHOA 5AKVA 5EN3A 1T66C 3I6KB 1J9RA 3C6LD 4XWOC 3WFDH 2CBOA 4K8RH 4A39A 3L4WA 4XP1H 2C5DC 4ZX3A 5MEPA 5T3ZD 2FWUA 3MV9D 1U3ZA 2ODIA 4I18B 2J88H 2EIDA 3N5AA 4KKBD 4H0LC 4YFDB 1FBIH 1FLRH 4PLKD 3S2CA 1CDHA 2XQYG 5AVVB 4NHCL 1J8SA 2NSQA 4KJYA 2MPAL 1A7OH 1QSFE 3SE4A 4AL8C 1NLDL 2UZIL 3V0VB 3QPQC 3BEWA 3WUWB 2IBZX 3NACL 5I1CH 2Q3AA 1XEDA 3CK0H 4JRXE 2HVBA 2APFA 3BVUA 4Y7MA 3LEVL 3QZWB 1O6SB 1AC0A 4GT7A 5JW4Q 4HLEA 1YEIH 2WXLA 3BXNA 3TO4B 4PRPD 3TVMD 4MXVE 4LSPL 2MCPH 3BPCB 3BQUA 1HL5A 5G4OA 3LKSA 4Y16D 1KPUA 2DWDB 2BO0A 2VXUL 3TJHC 1B4TA 1TXKA 5EU5A 4D0DA 3EYFB 3FQ1A 3Q8FA 2RHEA 3AY4C 3S34H 3AG2B 1BVZA 5GZOC 3MGOA 4J3VA 2WXIA 3ECBB 5DI8A 5HGGS 3FSVA 3QEHA 5BZZA 4H0HB 3N1MC 2C7FA 1PNDA 3BAEL 1JL8A 2QMKA 3SDYH 4AT6A 2VOTA 3JUZA 4MJ2A 4N2AA 4YGVA 3AREB 5G4MA 4PY7B 3RL2A 4RAVB 3QUMH 4HX1A 5FM8A 1A21A 3RDTC 2OI9B 2HRHA 3WIHL 4A7GF 1CU4L 4HUVB 4HAGA 1ESOA 2VE6B 4KC3B 5CILL 2EIMB 5DQDH 1I7UB 1A6VL 3JQOB 4UBDD 4WV1C 3B2UD 1AQMA 4QYAA 3ABGA 4JM2C 2H3KA 1EXUB 3V0WH 5IG7B 1LK2B 1FFOA 3VFWA 2VDRH 3VE0B 1FNAA 2EDNA 3N9GH 4BRVA 2Y6SC 4Y4FB 1BEYL 1U8PA 3ZKMD 3S8FB 2GFBA 4FG6C 2YEQA 1NIDA 2JWYA 2P8LB 2Z0BA 1A6PA 2CG9X 3FB8A 1NANH 4P23C 4R3SB 3L9RA 2ICWB 3P3TA 4WU5A 4KZDL 5DA4A 5KAQG 3HC0A 3KLSA 3SBWC 4LSQL 5FEBA 3RPBA 3BN9D 4ZAKA 4XOEA 1QYGH 4PJ8B 4IOSD 1DANT 3IGFA 3ULVE 1FFRA 1NM4A 2GYSA 4LHUG 5J9PB 2XG5B 3GINA 3WNLA 3V7AG 4Y2LA 1HCZA 1LDSA 2DWXA 4M8VA 4BSVB 3RJDA 1YY8A 4JAMA 3X1GA 2R0LH 4IIZA 4NN7C 4WRLA 1E5CA 2I26N 2RBLA 5LBSL 5L0QC 3WFDL 4K8RL 4MSWB 3HBQA 1TTRA 1ES0A 4XP1L 3ZIYA 1I8LC 2J88L 2A4EA 3EHBB 3FFDB 1FBIL 1FLRL 5DRWB 4RBPK 1N5YH 2BW5A 1I1AB 4UTCA 1AH1A 3DOHA 3O6KH 4YDNA 3H9SB 1A7OL 1A3LH 4HIEA 3WELA 4DGYH 2BOCA 3PWPE 3RKPA 3TCXA 4JFFA 5I1CL 3CK0L 3HUJE 1RXLA 5J0BA 3H4FA 5IMMB 2BDNL 3QULA 1KEGH 1FJ1B 1JV5B 2Z64C 3EAKA 1Y6MR 3QCTH 3TZVA 1YEIL 4L3FA 5CSBA 4CSZA 2ICWI 3OJ2C 1IAKA 1YEKH 4CN1A 2WZ5A 1ILUA 2MCPL 1VACA 1Y0LA 3U7WH 3MXWH 1JTOA 2G3MA 4F1SA 1PVHA 3O9WB 1RP8A 4DP6X 2QVIA 2Y24A 4V2BA 2VZ1A 1E7UA 3DVIA 2WZ6A 4R4BB 1QFUH 2DYPA 4GSRA 3QS2A 5EDXA 2YXFA 4Y1AA 3BPLC 2Z1KA 3S34L 1RZJH 3IRCA 4YAQA 2QGCA 1OTTD 1SXSA 4LVHC 1M56B 1PQZB 3MBWA 4U7KA 2WNGA 4PS7A 4UT7H 3IKKA 1SOSA 1B90A 1OSZB 1MCLA 4JKKA 4XOBA 5D93C 3SDYL 4HFUH 2AERT 4OKVA 2R4RH 3D1MC 3FO1A 4DKFH 3ALXA 3TH4T 2BIMA 5CKGA 4GP8B 2Y3NA 2BZ7A 1W72B 4CNIB 3NJIA 5EEXA 3U6XA 2O6CA 4DZ8B 3IBOA 3RP1A 5DQDL 3CLEH 5GS1A 3LXAA 4X6CB 5E0FA 4AY0A 1TQVA 5DMGD 3UBFA 1D5MA 3F85A 1MELA 3O11B 4UTBA 3V0WL 3P73B 4MBRA 5MI0C 1DSWA 3BSZH 3N9GL 4LSTH 4UAOC 3SDCB 1T5WB 4QRPE 1AD0B 3OR6B 3QE5A 3QXAB 4HSAC 4UOW0 2ZNXA 2ED9A 3BT2H 3VI3F 1DHKA 1OEZW 1U3HD 1U8CA 4KRPB 3OHXA 3MYJB 1B0GA 2YRBA 4YUEH 3OQ3B 2KPNA 3VMOA 2F8VA 5CD3A 3KM1A 3FMGH 2ADGA 1TIUA 2E8ZA 1KXVA 4IOIB 4OFYA 1CFNB 3BOVA 3WTVA 4LOUD 1QYGL 2IMMA 4E41E 2E59A 2IG2H 2EDDA 2WD0A 3N40F 4LCCA 1MFMA 1U8IA 5CWSB 5AW7B 4WNJA 4OLXH 1XT5A 3TH2T 2AJVH 3OBAA 4UTBH 2OCJA 3NPZB 2QTVA 4I2XA 2PO6B 4PRHB 3NFPA 1CD0A 2DMKA 5D8JH 3IYLW 1X7QB 5KVGH 3C5SB 4Z7WB 1JZ5A 1JWUB 2R0LL 1ROWA 4ZMOA 5J3HC 3I50L 5EBMA 4ZSOE 2ADIB 4FEIA 2ZKYA 1CJYA 4QO1B 2PXYD 4QF1A 3L9YA 4PBVC 3CDZB 1DSFH 1G7LA 3E9TA 3PWJB 4JJOA 1N5YL 1RVFH 2EXSA 1C5DB 3OC5A 4GKOA 1UWYA 1A3LL 4KDVA 4B3VA 4DGYL 4PY8J 3E2HB 3VI4F 1WCBA 4FCHA 4L9LA 2FX9L 1RIVH 4W6YB 4BFKA 4U1KB 4BFGA 1TJXA 1YQ2A 1IBDA 1T1YB 4PTUA 4Y1TA 4MX7B 4X2UA 5G5DA 1ZLUH 5IQ9A 1HWWA 4MMXA 1KEGL 3B7UX 1ZT4B 1TNMA 3KR3H 3QCTL 3QJSB 5I30L 5FUOL 2ITCB 1YEKL 3OKOB 2KZ1B 4TSAH 4TUKH 3U7WL 3BYYA 3MXWL 4H5SA 5HHMD 5TTRA 4X8XA 3DX7A 4K7FA 5D7IF 1J1OH 3SJVE 4J3OD 1C5CH 4L48A 4YBQC 3UTSB 3MPCA 4PP1C 3O6FD 1QFUL 4QXTA 3DVNA 1EO8H 2W92A 2ZUYA 1SY6H 4U1NA 5CBEB 4FFVD 3UBXI 3C5ZC 2EDLA 4XE5B 1C12A 1MREH 5F9WB 4UT9H 4BK5A 1LQSR 1LJMA 2OW7A 2XKNB 3WEBA 3HZ3A 4UT7L 3UP6A 3H6JA 5BXFA 5K9KB 1C8PA 2YA0A 3HZVA 2BMKA 4U1MB 4P2QD 4XAKD 4NQDB 3TBSB 1EHXA 2C9UA 5DD6B 2NZ9C 5FGSA 3TYFB 2LFGA 4HFUL 4GSXA 1ZIAA 4RNRB 2R4RL 3JT2A 4DKFL 3WTSA 2DQEH 1OALA 1M9WA 2YPLB 3RB7A 4IMLB 1JK8B 3MRIA 4LCWB 4K5OA 3LEXB 4ZFZA 4AQZA 2EC9T 5BW7A 2A9AA 4DVRH 2PWDA 1RJLA 1G7IB 3LDBB 1A1MB 4HWUA 4LLYB 3CLEL 3GSNB 1N0XH 2ZT9C 1J10A 3UTTA 3WMPA 4ODUA 1UTDA 1MIMH 1JK9A 3CD4A 3MNVA 4U1HB 5L88H 3P9WB 3JVFC 4L3CB 2YKKA 2Z92A 3BSZL 3GJFK 4RAUB 1CFSB 2WTRB 4LSTL 5DGQA 3W0WD 4FTDA 3VG9B 2APXA 4QY8A 4NOFA 3RZCB 3UTPE 4CW1A 4F7CB 4PJAB 3KHOA 1OB1A 3BT2L 2BFVL 3KLQA 3R18A 4K71B 4DNLA 5HPMB 4F2MB 3WNMA 1CE1H 4RGMB 4YUEL 3JV6B 3AMKA 1WFTA 3FQWA 5GGSY 3CIAA 2PPCA 2BHFA 3RGVA 1YPZE 4XMWA 4DUWA 4Z7QB 5GRZA 3FMGL 3IPEA 4BFJA 2WZ0A 5D2NA 2J2ZB 4GAYB 2BWDA 3N91A 4JRLA 3RX8A 1N3NB 3ZX1A 2IG2L 5AB2A 2IAMA 1R6VA 3QUKB 5CHNA 5IB4B 4OLXL 2AJVL 4UTBL 5D1XD 4FL4C 3QRGL 2AC0A 2IXQB 3Q5TA 2CDEB 2RD0A 1KYFA 3MRRB 5D8JL 5GRVL 4HHGA 3RRQA 4DJMA 5KVGL 5IQ7H 5JORB 5HVWA 3RWGB 5JXED 1MFVA 4EVNA 4GRLA 4PP2B 5KS9E 2FO1A 1F02I 1G7QB 3BVNB 4Q56A 4AKQA 1WD8A 3BUPA 1UADC 2A9CA 3CFBB 4Q9CA 1MVUA 3AWGA 1QA9B 4PJDE 1RHFA 5H4ZA 1R3JA 3UBGA 4NYLA 4U0QB 1JNHB 3K74B 1YUKB 2DL9A 1G1YA 1DSFL 1NGXB 1RVFL 1S7WA 3MUGB 4OF6A 1C8QA 4X4MA 3CXDH 4UZUA 1J8KA 3S48A 2GITB 4UZSA 3ZHFA 3BZFA 3HG1E 1DJHA 4HKBA 1RJCA 1ZTXE 2YJQA 1RIVL 3G6AB 2V7NA 4MQSB 5BVJA 4HJEA 5J11C 2PWGA 2YJLA 1IGCH 4XC3L 5DD0H 3K6OA 4GSDH 3KR3L 5SX4I 4XMUA 3HZKB 4C47A 1HESA 5JR1H 4X9BA 1MI5E 2X4SA 4TSAL 2PW1A 1J05A 5DZJA 3TA3B 3UADA 3KEDA 3MJ9A 1VKXA 1J1OL 4RRPM 1C5CL 5DJYA 3IU4H 5I24A 4A2GA 1J88A 4OV5A 5B4MD 1SNRA 3W9EA 4F8NA 1KN4H 4MNGA 5F7BA 3ZE2E 4M4RB 1EO8L 4MA3A 1SY6L 3MRDA 4TNWF 3RNQB 3INUH 3V6ZB 3APMA 4I87A 4IBTA 2BNQD 3STLB 1MREL 2X4OA 4UT9L 3HS0B 5JIPA 4DCQB 1HE7A 1L0QA 1YMMB 1A7RH 2FEDD 3MV01 2NUPA 4A2EA 1V3MA 4F92B 3KWWB 1SJEA 1XO8A 5TD4A 3C6LB 2G3ZA 1H6UA 1NKGA 3QARA 3WNPA 3P40A 4X6DE 3MV9B 4JDVA 3WXVH 2OZ4H 1S9WB 1IAIM 2DQEL 3RIKA 3VXSA 2GG1A 5I1KH 2VERA 3SPIA 3MJ9H 1HHKA 5C3TA 2FGZA 3CQFA 8FABA 3NSJA 4XPGH 1MW3A 1TZOA 3BMWA 3WBDA 5FKAB 5F1KC 1XGPB 2B1OA 4DVRL 2A9BA 1KGCE 2FQGA 4N1HB 4P46D 3VXNB 1K4DA 5IVNA 2PR9A 1N0XL 2CKBB 1MHHB 3RX7A 2FHBA 2K4WA 2HRGA 1BAFH 3VD4A 1MIML 3TCLA 1ZY9A 5L88L 3B1UA 5FF6A 1N2RB 4YWGH 4KKPA 3CPLA 5IEHB 1YSOA 1YNTA 2J8UE 4PRPB 2P5WD 4AE1A 3KDMB 4U3CA 4TKWA 2F8OA 4JM4H 2EDHA 3ROOA 5IJBC 3QEQE 3U6RB 4Y16B 4CMHC 1BDYA 5I6XC 1CE1L 1IEBA 3QS3A 4F8TA 5D1ZA 5C9KA 2K6WA 3ZN6A 3S5ZA 5IMLA 2EE2A 5HYQA 3D39E 1ZLEA 4WO4A 5BV7C 4XR8C 3GHEH 3K8KA 1JF5A 5FM4A 5DWPA 4QEGA 4JFFD 3KL0A 2AQNA 5C08D 2V5SA 4HUXB 1VFMA 2DLTA 4Y5XA 1YECH 3PAVA 3QFJE 3TZVD 4QWWC 5IQ7L 5KVEE 3IAQA 3PU7A 4JZNA 4NZUH 1S7VB 3FU3A 3HE7C 3LB6D 4LBEA 1CD8A 5LN8A 1KIPA 2V5MA 1IZJA 1LK3H 1NEPA 4AIOA 1YVLA 4FNPA 5LJYH 5DJ8A 1KCWA 1WTLA 3QAZC 4BH7A 3BH8A 2PCFA 2XLLA 3QFDB 1DUYA 4PGEB 1EZLA 2HTLD 4Y1AD 5IB1A 3LS4H 3VQ1C 3CXDL 2CRMA 1AANA 5HD8D 4R6UA 2A9MH 5CLYA 5C07E 1T7XA 5I1EH 2HKHH 4NXSA 1IGCL 3GMMB 5DD0L 1KG0B 1I1CA 3PGDB 4DP1X 2VLKD 4GSDL 3B9EA 3IB4A 2W5PA 5EPMA 4Z0BH 5JR1L 3VGBA 5ICXB 1TTFA 2NT0A 2ZF9A 2PP7A 4E9XA 2GSGA 5T3XE 4B6ZA 4GG6B 3ARXA 5B39G 4J6IA 3LN5A 4NPKA 1Q9OB 2YD3A 3L3JB 1FHGA 4JFDA 1OGAA 2GJ6E 2XG4B 4PBWD 1SJMA 4EIGB 1Q4NX 3IU4L 2ZOKA 1NIEA 2HFEA 2CDFB 3FCSA 2BINA 1CIUA 4ODXB 3IJEB 1E30A 1KN4L 4E5XB 2FH8A 4XN5A 2X6MA 4HJ0C 4G5ZH 3D48R 3KBHE 3INUL 5JPMB 5KVFH 5D2LE 1T0MA 5GS0D 4XOCA 5I1AA 2GK2A 1H3TA 2APSA 5E9DE 2DN7A 1CUOA 1G1KA 3IDYB 1ZHBA 3N55A 1SF5A 4QRAA 4DFIA 1A7RL 4A68A 3NDZE 4GRWE 3QWQB 4U4IA 1XCWA 4XT1C 3F62A 4QT5A 4DZBB 5FHAH 2NTFA 4HDIB 4JN2B 5FOBA 3WXVL 4GINA 3GD1C 1IGTB 1R5VA 4HK3J 5I1KL 1Q9KB 5HYIA 3MJ9L 3Q0HA 3FJTA 3PQYA 3OB8A 3FQRB 4QHLA 4XPGL 3ARBC 5C0JB 3IN0A 1T7VA 1Z9MA 3SDAA 4RGND 3W5NA 3GGWB 4PJ7A 5LAPA 3A4EA 3AQZA 4PR5B 5B3JF 5I75C 1BAFL 2DWTA 4WKXA 3VXRE 3L4TA 3BN3B 4GS7B 2G5UA 2VC2H 4YWGL 1TFHA 1FO0A 2IF7A 5I6NA 5T1JA 2H1XA 4YJZL 4MQXC 3R06A 3IF1A 1PZAA 4JM4L 3A3YB 3QIBA 4L0PB 2PYEE 2AVGA 4KX9A 3CX5K 2O6PA 4X98B 3DX9A 5TH2B 4J7RA 1IM9A 5E4OA 5H35A 3H0TA 5ESAA 4B9CA 1I8KB 3DURB 4BDVA 5F7UA 1B4LA 3OKDA 2AK4D 4I0PA 2FX7H 4GP5B 4DERA 2I7OA 3MFFB 1U21A 1KXQA 3LN4B 2O5XH 3MUJA 1K2DB 3LQZA 2NSMA 3GHEL 4LIQH 1NAKH 3MA7B 4BINA 1Y07A 2W1NA 4IU3A 2RB8A 4WNQA 4YSTA 2X89D 1G9HA 3GXUB 1F3DH 3MRQB 3T2QA 2AAVA 4GI9A 1AXTH 2NCEA 2YPVH 4HF5H 1HH9B 1LE9B 4OI8A 4H13C 1YECL 1FO0H 4L4VA 1PKQA 1IGYA 3AG4B 4ODHH 4NZUL 1L9RA 5K69A 2IH1B 4LQFL 3FUHA 1UXLA 4Y7OC 6PCYA 5T1DH 4EUPB 4HKXB 4K0OA 3F7PC 4POYA 1LK3L 1UJ3B 4ZMNA 2MHAB 4H44C 2FATL 1ZT7B 2I07A 4Z6AT 5L2KE 4PWEA 3WHE0 1FL3A 1I9EA 3TOPA 1EX0A 2D31A 3LS4L 1XWVA 4I13B 1YNKH 1DBAH 3ETSA 5GGRA 2JB6A 5FGCB 1AYOA 2A9ML 4XMLH 4Z18A 1J8HA 3EADA 3GK8H 1U8KA 5KBMA 1EWHA 2FD6H 5I1EL 2HKHL 5AALA 1G6RA 1DQKA 3OGCB 3GMRB 2EEXA 3O4LA 3KPRB 1U3HB 4Z0BL 4NKOA 3QNZA 1ZHKA 5A2LH 2CHXA 2NYKA 3Q8CA 2WSKA 4Q6KA 3RE0A 3ARFA 4X6CF 3FSWA 4YLQT 4QNPE 3UCQA 1BVLB 2F61A 2LLNA 3M46A 4P4KC 4LRIA 4RSVA 3ZSTA 1D7FA 1XF5B 4PRBA 3D50A 4AC2A 1T4KB 2CR6A 1FZJA 3EJQA 4G5ZL 5DFTA 4ORZC 1F0LA 3GYRA 5DEFB 5KVFL 2RMNA 2YRPA 3L7FA 5KSBA 3NA9H 4ZXBA 2FJHB 2ZUSA 4N0UA 2ZICA 4N8CH 3T6VA 3DX2A 4LAJH 4FXGB 2V4LA 5ESQB 5A7EA 2NY1D 15C8H 1BZEA 3AS1A 3ZQXA 4Y4KD 5AVUB 4NNYA 3STZA 1JF1B 4ZW3A 1E9PA 3WI9A 3B2XA 5FHAL 1AHKA 4QRRE 3ARDD 1AJ7H 2PXYB 2BSRB 2B5IB 1QNIA 1FLTX 4PJCE 4BH8A 2UXVA 1DVTA 1NDGB 2NY5C 4FG0A 4RMQA 1WFNA 1BXVA 4GMTH 4Q9QH 3RILA 1SMOA 4JHVA 4C56A 2IAMD 4Z7WF 3H2WA 3ZL4H 3BZ4A 1TSHA 4LPTA 1RZ8B 1LE5A 3N40P 4APQA 1MCSA 3UAJC 4WWNA 1QTPA 4OFVA 2VC2L 4MBOA 5JMRA 1BG1A 2DBJA 1ZLVH 3G04A 4I18C 4MNHA 3VXTA 3U0PB 2Q3ZA 4GRLD 3WTXA 5EO0A 43C9B 4GIOA 4TLKA 1KV7A 5HHMB 5DYFA 3OWRA 3ESVF 2YEZB 5I5MA 4Y4HA 4HEPG 2BVEA 1YQVH 2DWEB 4KQ3H 5I23A 3NH7H 2FX7L 4K9JA 4X50A 3THMH 1SVZA 5GZNA 3T09A 3O6FB 4A2DA 2K3HA 3O3BA 3P2DA 5E1GA 1IARB 5JHLH 4FHJA 4YSCA 2DBLH 4LIQL 1OB0A 1NAKL 3WFHB 1SLXA 1XGYH 1M4KA 2B3RA 4LEEA 4RWHA 4XRCB 4KDTC 5HDLA 1D5BB 5BZDB 5EC2A 1AXTL 2IGFH 2YPVL 3TURA 4P2RA 3U4EB 3S3BB 1SLVA 1FO0L 4Y5YA 4FKHA 4P2QB 1PJ9A 1THCA 2YK1H 4N0CC 4HPHA 3QQ9D 4ODHL 5ID1A 4L37B 1TT6A 3CXHJ 2CIIA 5T1DL 1X5FA 2G0KA 2H6PB 2BVOA 3G5VB 2YMTA 3SB3A 3ZKXB 4WI2A 1R34A 1CTMA 2ADJA 5DGRA 3WO3B 1AGDA 4E0RB 4E9WA 1KB9J 4B95C 2W65B 3AAZB 3GT6A 4HULB 4ZW6A 3H7LA 1LO3H 3EOAB 1N7MH 4NDMA 2N4IA 1YNKL 1UWXK 4MZ3A 5FC9A 4XMLL 4ENZA 1MJJB 1KBGH 2VLRB 3GK8L 4WGWB 3LZLA 2FD6L 4D9QE 3SKNB 3W0WB 4KAQH 4MCYB 2X28A 2BP0A 2JXMB 3AREC 4L8SA 4M03A 3P69A 5INDB 3RWIA 4G8AC 2OLDA 1X5GA 3CSFA 2OI9C 4IGBA 1S2EA 5AW0B 4O2FA 3MNDA 2C3XA 3MA9H 4X7DC 4HKJA 2E8YA 4ABWA 4ZJ9A 4AYSA 5CBAA 2OJEB 2X3CA 1R5WA 1KDIA 3QJXA 4L8BB 4KI5F 1SBSH 4B60A 1RERA 1OGSA 3QQ3A 4LGPB 4OZ4B 3LD8C 4Y4FC 3NA9L 5D1XB 1Z5LA 4PJAF 5K1JA 1S9XB 2HFGH 5TFSH 4N8CL 4RFOH 2FLRT 1SXBA 2QZ5A 3WMQA 5PCYA 15C8L 4ZOBA 3GMQA 4DEWA 3A4DA 5DA0B 5ILTH 5CMAB 3HPLA 4Z7QF 1PTZA 3PHSA 4NT6A 3QJZA 2KDYA 4X6BA 3TN0C 3NCCB 1XSOA 1W15A 2VDMH 2H3XC 5CLTA 1AJ7L 3ZTJH 3BI9X 4CJ0A 5IFHH 1NDMB 4PJ8C 4B9YA 3ENEA 1GIGH 2GJZA 2VAAB 4GBXA 4N2NA 1DCEA 1KN2H 4W9FC 1J0JA 4WO4D 3GF8A 4JS7A 3VFMB 4GMTL 4Q9QL 3RTQA 4G9FD 5FOJA 1M1XA 3KPOB 5FPIA 1K5WA 1ZE3C 3EO1B 1XCXA 4MXQC 2XZCH 3ZL4L 3BPNB 3R7RA 4HG4K 4JJ5A 3O0RH 5DJXA 4PVNA 3H3PH 4H8QA 1JVOA 3L3GB 3I9IA 3D0VB 4F1ZA 2F1AA 2TRHA 4IRZH 3RI5F 3HUJA 1X5ZA 2KT6A 3DOSB 4HIQA 3MN8A 1I1AC 3CZJA 1MOEA 1FZKA 3ESPA 4PGBA 5CEZD 2QQQA 1NMCB 2H3NB 1YQVL 4B97A 4KQ3L 1RK1A 3NH7L 3THML 4AMXA 2B1HH 1S5IH 4JFZH 4GO9A 3RB5A 4U3SB 2X6BA 4G43A 3RI5K 5JHLL 2DBLL 2BNQB 3LX9A 1XGYL 4JRWA 4DT2A 5KSAA 5EU7C 4LE8A 4JFTA 4M62H 5F3HB 2IGFL 4NQXA 4EI0A 1QSED 1TZAA 1IBGH 3BHBA 1JP5A 1RPQA 1XXFC 1KYOK 4FQIH 1INDH 2LT9A 3P2TA 1PZ5B 2YK1L 2JQZA 1IILE 1J18A 1K4CB 4GRMB 4PJIB 3TH3T 5HGAB 1A4AA 2ZOWA 3QIWD 4N86A 4ZFOB 1ZA3B 2FWLB 3FQXB 3DTXB 2HVJB 4CN6A 2BIQA 1BOGB 4H20H 3UH8A 2HT4C 4ZOEA 3N04A 3MNMA 3FDWA 4P46B 4PV9B 4J12A 2J6WA 1AO7B 2ZYIA 4U3XA 1QFPA 2WSDA 2TSAA 1LO3L 3DXAE 1N7ML 3NGBB 4XXCC 2CA4A 2QSCH 4YGAB 2J8HA 3FZUC 3T8XB 2PYFB 1KBGL 2GB2A 2P5WB 4AEIH 1E67A 4KAQL 1F1AA 3PHAA 2FCBA 2OQJA 3FCTB 4W9IC 3BAKA 3VMNA 4AV5A 2VJXA 4P5TC 1EJ6A 4P5MB 1XVSA 2XYBA 2GTWA 3PQYD 3MA9L 2IH8A 2QGBA 3N1QC 3GNMH 3WKQA 3HCVB 1I4FB 1UENA 3BZDA 5IVZB 3V6BR 4X9YA 1MH5A 1SBSL 3GIVB 5CJXC 1A6UL 4XAWH 5C08B 3SDCC 2ADFH 5GGTH 2J43A 5TFSL 2HFGL 3FKUS 5I1DB 3C60D 4RFOL 4E41A 2E27H 1Q72H 5D7JA 3L9BA 1IE4A 4W9JC 3RUGB 1UT9A 3APDA 2HB0A 4XHJC 4YSRA 3IFOA 4M61B 5ILTL 3ALPA 1SDDB 3LKPB 3US0A 1T7ZA 4FADA 5SWZD 1MIEH 1GZQA 1KY7A 2Q76B 2VDML 3FTZA 2D3NA 3P2BA 5KG9A 4WFFE 1IAOA 2PR4H 3LNHA 1N6UA 1GIGL 4I0PD 3QYNA 1KUMA 4O2EA 4GG8B 1KN2L 3E38A 1HCVA 3HTLX 1OAUH 2APWA 2Z4QB 1T7WA 3V55A 5F0JB 2PO6C 1G7HB 3CHSA 4PSRA 2I85A 5CSZA 2LU5A 1UT2A 4ODWB 1T89C 3SYOA 1A5FH 2XZCL 5A2KH 1JE6A 2R56H 2F7IA 1RCYA 3O0RL 1ZKAA 1A64A 4LVNB 1WV7T 3H3PL 2VLKB 3QCVH 4NJAL 3T5WA 3WY2A 1HILA 4JHWH 5HHOD 3V5HB 4IRZL 3ARSA 3V5DA 1O75A 4KOCA 3NRFA 5IOPB 5I18H 1OANA 4WI5A 2O61B 1ETZA 3G5YA 5B22A 3DYPA 4BWUA 2R2BA 3CFTA 3EFDL 2HFFB 2ZOLB 3L7EB 5DFAA 5KYUB 3J7HA 3TO2A 3G5ZB 4GKSB 4G7VH 2B1HL 1S5IL 2FYYA 2HLEB 4JFZL 3LRLA 2NNFA 3OSVA 1OTUC 2GC7C 3UTZA 3D25A 1LP9B 4PW4A 1RZIB 2NY5H 5MEQB 1VIWA 5I76A 1XIWD 3KYOB 3ZHDA 1WAPA 4M62L 2AXGB 1F86A 2YXMA 1KT2B 3ATFA 1IBGL 4PRIA 4ECNA 3SODB 2OM5A 5C7XH 1UXSB 4GG6F 3BP5B 4FQIL 3EO0B 1INDL 1B0RA 1SFHA 4HJ1A 5A40E 2EC8A 4Y1SA 1JD9A 5DJ6B 3Q2CA 1KC5H 2MKLC 3NIGB 1IC5H 1Z7JA 4PGCB 1IM3A 1G7JB 1A1OB 3UJIH 2NZIA 2Z34A 5HHPA 4M6MH 2MOVA 4DP2X 4H20L 4RGNB 5F9WC 5T5NF 3F2LA 4JPVH 5E1AA 4C8XA 5IJKC 2BRQA 1F4HA 2EYTA 2WBKA 1SZNA 2GI0A 3B3IA 4JREB 4ZXBD 4H8PA 2QSCL 4PS3A 3JSSA 3LVTA 1S7UA 2X70A 4Y5VC 2LGNA 1AQKH 4OV6F 4YDJB 4P5SA 4MJ6B 4AEIL 1KLFA 4WHDA 1N18A 2E0PA 4L4TE 3WKPA 1TF4A 2FUTA 4QGYA 5B8CB 3L95B 4X7TA 4HCRH 1VCAA 1NFKA 1A4JB 2JKRM 2WB7A 2VQTA 4FNLH 4HJIA 3WIFA 4OGXL 3ESMA 3FTSA 3UPRB 1ZHLB 3GNML 3PUUA 5T1MA 1E2WA 4L0YA 1YPZA 2HA1A 4XAWL 3GLEA 3ELAT 1GKEA 1QSFD 2ADFL 1E4WH 3RZCC 3VG9C 3HVNA 3TIEA 4G6FD 2CLRA 2E27L 1Q72L 2H8PB 3LKOB 3GSOA 4K71C 2XVLA 1NZRA 2Z7UA 4HKZA 1BVNP 4JRXD 3REVB 2OZNA 3CBRA 1H8OA 2XT1B 2YXVA 5F1IB 1BREA 1T0OA 3AITA 1MIEL 3I6GB 4E9RA 4Y9CA 2XWZA 3ELQA 5E8DL 1X6NA 3FRUA 5KS9A 3I75B 4XCEA 2PR4L 3KYNB 4N1EA 4NIKB 1GYVA 5GZND 3K5SA 5HHXH 1OAUL 4PJDA 3ZTDC 2GEEA 2NY6D 1WC7B 1NDTA 4XH2B 5I6KA 2D8KA 2JCCB 1A5FL 4QAWA 5L4FA 2R56L 1MCJA 2Q8BH 5HI5D 1LEIA 1FNGB 3GRBA 4UDUA 4HIIA 4L8DB 3M17B 3WS3B 1X4ZA 3MAWA 3QCVL 2VUOA 4HISA 4JHWL 4I3GA 5GGUB 4TTDD 3KLHC 5AAMC 1S7XA 4MJIA 4IRSD 1BZDA 3CCHA 2WZPA 1KBBA 2O6EA 4U4BA 2N7AA 5I18L 3CVDA 4YDVB 1WLHA 1F42A 4Z7UA 4LCUB 2QQNH 3SPVB 5JPNA 1WT5A 2AQ2A 3MQIA 2XWCA 1MI5A 2NXZD 1ECYA 4QRQA 4G7VL 3ZYIA 4Z3HA 2LOEA 4QUOA 5HYJD 4YN3A 2ZX9A 3E80A 1M2VB 3TNNB 2I7SA 1IEAA 2NY5L 2VERN 1AR1C 2FL5A 3ME0B 5AKSA 3SYQA 2K3TA 1J5DA 2XPGB 4OZGE 5C7XL 1SXAA 1HEZB 1K85A 3TA3C 4I3RH 1BG9A 4GUPB 3ZJAA 1QWNA 2WXNA 4FJYA 1P6WA 1HDMB 3ARDB 4MA1B 1AQDB 1KC5L 2GIMA 2IDUA 1IC5L 2A73A 4JLRB 3VYNA 1CLVA 1D5RA 4ZTOL 5JW3H 2J1KA 3F7RA 1GRWA 1A9BA 4M6ML 4X6DA 5C0IB 5JYLA 3LZFH 4MNQE 3PDGA 2GKIA 4JPVL 1MCPH 1YUHA 4J8RA 3GZKA 2X4QA 2XIBA 3VQMA 2YEVB 5FUZH 2J5WA 2HN7A 4HMDA 1IX2A 3BIKA 3N44B 1PBYA 4XO3A 1JPGB 5DMKB 5C0DA 1L9PA 4ZUUA 3IXTA 1ASPA 3MLRH 2X2JA 4AIEA 5IEKA 2W60B 3ULVD 1KIRB 1K8DB 1M05A 4QTFA 3G6DH 5D7HA 1XFPA 3W57A 1M6OA 3G5XB 1D9KA 1AZZC 1KTCA 2H45A 3R0NA 4HCRL 1DANU 4PJ9D 4EO5A 3APNA 4FNLL 3ZTJG 3NJLA 5I2IA 1C1EH 1IQDA 3QEQA 1OVZA 3UGEA 1OF2B 1WAEA 4YQXH 2OTWA 1A3QA 2XJLA 5IBLC 1QQDA 3EF4A 3QJOA 5BS0E 2CIKA 2F0CA 2YA2A 3D39A 4K3HA 3ZDXE 3HIZA 1E4WL 2NRDA 3SBPA 3PWPD 5L4MA 2ARJQ 5ISZD 4NI6A 4Y16C 4BSJA 2VMJA 4TNFA 2WBJD 3QIUA 2LVCA 2WOYA 2EXYD 4M6NH 4EI6A 3MRFA 1PDKA 3TEUA 3S88H 3QFJA 4N28A 4LO9A 4OKDA 3N1GC 3RFZA 2IBBA 4M8QB 4TSCH 4P48A 3QDME 1KTDA 4NQUA 3BGFB 3FAWA 3PL6D 1G4MA 2AV7B 4KUCD 5SX5K 1BF8A 3IPFA 2ZG3A 3OJMB 1UCBH 1MVYA 2DB8A 1BZ9B 3DWTA 1U3YA 4ZUVA 3DIVA 5KSAD 5J6GA 4HS6A 1XD0A 2Q8BL 2VLJE 3QFGA 2QFRA 3VI4E 1K9TA 1BXUA 2LU7A 2NNCA 4X9GA 4Z7AA 5KBNC 3MZTA 1AQ8A 4O02B 3MCYA 1K72A 4FOMA 5C07A 1FE8H 4N5UA 3GKWH 2EECA 5I0VA 4A6YH 2QQNL 3AB0C 3BGAA 3OTTA 3L3OC 4APXB 4BWWA 4YDIH 4DP9X 1I75A 2R69A 2PUQT 5JW5A 1IAII 2GJ6A 4WJ5B 5D7IE 4N2MA 2D3VA 1JYNA 2Y7LA 2Z35B 5TDPA 2Z7WA 3V5KB 3WGVB 3MNWA 2Z31C 5DHVB 3MV8E 4ENEC 2ZWZA 5L4JA 3T4AA 3MRJB 5D7KE 3SE3A 1A6WH 1Y6KR 2M2DA 5DO8A 5E9DA 1EH9A 3LY6A 3O6MH 4WWKB 4CU6A 4KFMA 1EZVX 3K4ZA 2FYVA 4LLMB 4WDIB 4G1MB 4TLTA 4G59C 3K1KC 4QRPD 1R3HA 3MV7E 2NUTA 5JW3L 2MCMA 1N19A 4JFYA 2H0EA 3CC5B 1T1ZB 3CZUB 1QP1A 1KJ2A 3KNBA 3B56A 5KBKA 4G9FB 2DAVA 1MCPL 4FFZA 5ICZB 1RJYA 4PJ6A 4O5LH 4FG4A 2IADB 3A6CH 3QPKA 4XBPB 3T0WA 3X13B 2VZ3A 4E41D 1A7QH 3MLRL 4I48B 5D7JD 4U1IB 4KK6C 4AM0B 4NCDA 1ITBB 4UAHA 2Y22A 3JVGC 3VXRA 3G6DL 5KVDE 1NCDH 4L8CA 1PIGA 3HVDA 3C09B 3ETBF 4HCIA 4PJFE 2MMXA 4KKCD 2VSMB 3RWCB 1XGTB 3NCJH 1UZGA 3GQFA 4ODBD 1C1EL 2JJSA 4X4YB 2V8MA 5BRQA 2FEEI 3NCWA 3LKNB 5F7NC 4CAGA 7PCYA 2VSCA 1N5AB 1AS7A 4YQXL 3MC0A 1WIOA 4P2OB 2VDNB 4R7XA 3WMSA 3V4VB 1QSEB 2EUVA 3EJZD 4ZTEA 4ZODA 4WUUE 3X17A 5ALCH 5JOFB 2G75A 4M6NL 1Z9OA 1HVXA 3D18B 3S88L 3QIWB 2X2UA 1V8HA 3SO3B 1QZ1A 2DW5A 4KV5F 2E47A 4R26H 3Q5YA 3T3PB 4DIXA 5LUMA 1C08B 2OMBA 5HGDA 1OTTC 4TSCL 4UM8B 3AMLA 1U95B 4DO6A 1OO2A 4NUPA 2V3DA 3PFUA 1FIGH 3DJZA 2EEBA 4UQ2A 3SJVD 5AFAA 1F3RB 3E7JA 1T1XA 5L2KA 5GIRA 3S7GA 3RWEA 1T1WB 5D4HA 1UCBL 2GK0B 1KCVH 5FK9A 4WI0B 1KB5B 4YE4H 1QVOB 3MVSA 1N6QH 1WFUA 3QR1A 3ASNB 3VD2A 2CJ3A 4PJIF 3S97C 4HFWB 5LB1A 4HZLA 3DRQB 4HWEL 4L1HA 3CNKA 2V5RA 3MKKA 3OKLA 3F7YA 4HIJA 4WW1B 2ENSA 3FFCE 1RI8A 3KW7A 3SE9H 2WLIA 1U92B 1QFWL 1ERNA 3GKWL 4OFPA 3B5HA 1IM3D 2FBRA 3EG9B 1FVEA 3BAXA 5IJDC 1KYDA 4A6YL 1NFIA 4G8GE 1Z2KA 2E9JA 2VTFA 2UY7A 2R1YB 4R4FH 3RPIA 2NNAA 5FDWA 4KMTH 4YDIL 4MQTB 1TQTA 5F9JA 2CLVB 2VQUA 4NZRH 4YBLB 2EXWD 4ZTPH 1EAOA 2CO7B 4XPHH 5K39B 5IESL 3Q9PA 4L3EE 4NFBA 1EEYA 4NZTH 3C60B 2XI9A 2DQHH 1U3HC 1P7HL 3Q1SH 3G08A 1WAAF 1EEUA 4FXKB 1PZSA 4GXUM 2GI7A 2I27N 1A6WL 2OMWA 2EC9U 5SWZB 4D9LH 2P3YA 4WJG3 1OGTB 2Q3XA 2D7MA 3O6ML 4U1SA 2FECL 1FYTE 4WU7A 4ONHA 1QUPA 3QUXB 5EZLB 5I5RA 2ID5A 3UTPD 3EZJB 5KUKA 2YXWA 1XAUA 4QRRA 3EGDB 4NRYB 3ECUA 2MQGA 2R69L 2QKIB 2WCPA 3DJSA 3RKDD 4KVPA 2HX8A 4FXGC 4OUUA 3RUGF 5L8LB 3OF6A 3BKJH 3GSWB 2JKXA 1QEWA 3PREA 4O5LL 1M71A 3O81A 3A6CL 2YAHA 5ID0A 4QDGA 2DLGA 1A7QL 2D9CA 3MRGA 4GKZA 4NO2B 1JWMB 3WN6A 2VW4A 4BJLA 1J9TA 5HHOB 1QATA 1SEBB 2JNZA 2QPUA 3FUMA 2PXYC 4JFPB 3LZPA 2NY7H 2B16A 2B5IC 3HG5A 4RIRA 2L0DA 2KH2B 1KLGB 3VWJC 1A4BA 3HC4H 4JPIA 3LJ3A 3QJTB 2B59A 4JM0A 1F4XH 2QT6A 4OTXH 4IYKA 3INOA 1QG3A 3NCJL 5I1GH 4U6HB 2KQMA 3ARTA 1G7MB 3KS0H 1E6OH 4OZFH 5LGJB 5F3BA 2ATPA 5IW6B 1BPLB 2ENJA 1NL0H 3NSFA 2X41A 4A7VA 1XIWB 2WQAA 4HUKB 4B50A 5AVWB 1KCUH 1UWEH 3T8MA 4R5TA 1LO2H 4OLYH 3BIBX 1W0VB 3HG1D 2DS4A 4LMQI 1XMEB 2VDOH 5ALCL 2X2HA 4HETA 3AY4A 2ZJSH 2WZPD 2AJUL 3B9AA 1BJ1J 1G9MC 1BV8A 3O6FC 5FO7A 4ZUTA 2LR4A 1X9LA 2NR6C 1LP9F 4PRAA 4R26L 5IR1A 1MLCA 5T1LD 4HJUA 5IFJB 2CGZA 1T0NB 5TF1H 1MI5D 3ULSA 4WSGA 2ZKWA 1FIGL 1G9EA 3OKKA 3WO4B 4N6RB 5A16B 3BZEB 1KCVL 1RMFH 4XMPH 4YE4L 3ZHLA 3W5MA 2K9FB 1N6QL 2FIRT 3OVUB 1U8JB 5EIIB 3NIGF 2YRZA 3LKRA 2JK5B 1SQMA 4IEFB 1FL5B 3RDTA 3NBNA 4IU2B 1WFOA 1XZWA 2M8XA 5FB8B 3OLEA 3QNXB 3SE9L 2QBWA 2EYRA 5MERA 2A0LC 4BQ6A 1S7TB 1MAMH 1QHOA 2AJ3B 4Y2NA 5AZUA 3BJ91 3ZYJA 1NFDB 2Y1YA 2JTDA 5BQ7B 1E3XA 3CH1A 5CUSH 2G9HA 1MXDA 3TPUA 4R4FL 2R23B 1NCHA 1WUNT 4NZRL 1BAGA 2ZCHH 4ZTPL 1MCIA 2C7UA 1SN2A 4XO8A 4XPHL 5I0DA 3I6LE 3H1ZA 1QSFB 3K91A 1J0HA 3BO8A 4NZTL 3TBTB 1PX4A 3KM2A 1S9YA 1KTLA 4G6FB 3UBXB 3W56A 5GGRY 4MDJB 3SBWA 4JRXB 3P9LA 3EYOA 3Q1SL 4YNYB 4RA0C 4LL1A 1PLBA 3BAIA 3RY6A 5LNDA 3NIDB 4D9LL 1AE6H 1KJMA 2IVFC 1P4LB 3SCMB 1KF9B 4QHKJ 2N59A 2A6IA 4JFSA 4MAYB 4G6JH 4WNSA 4RFNB 3QXWA 3V8CA 3P0YH 3VCLA 3BRFA 4P2AA 5FHBH 5D1XC 4HALA 4IBQA 2PW2B 2C9SA 3G6JB 1I8AA 4R2GC 4K55A 4HJSA 2EJ1A 3EH3B 4I4WA 3D39D 3BKJL 5BO1H 1MXGA 4BUGA 1I8LA 1TLMA 1MRDH 3MX0A 4S1DD 3MFGB 2D7QA 5IHZA 3TV3H 3FB7B 2EYSB 2E9IA 4IRSB 2NY7L 5B3JE 4RMSA 5DEGB 3HC4L 3DX8A 1GC1C 3H3BC 3VGFA 5JW4N 3QO1B 5EFIB 1F4XL 2VNCA 5HBBA 4JFOB 2JCCF 5I1GL 2VR3A 1E6OL 3BPNC 1TU2B 3L4ZA 5HYJB 2BHYA 4KKAD 4GFXA 2EINB 1M7DB 1OSPL 3H9SE 5AB9A 3SYAA 1GL4B 1WSST 1NL0L 2RTTA 2VM3A 1V10A 3I9PA 1VADA 3JTTA 3OKYA 1P5UA 5F7HA 2PPFA 4GIAA 1EAPA 1KCUL 1UWEL 2Y5QA 1LO2L 3U79A 4ELKA 4UB0H 3MLTB 4O4YH 3IEAA 2WNXA 2VDOL 4PD4K 5EU7E 1JRHI 3WKYA 2ZJSL 3RY4A 3QG7H 2QLVB 3HHSB 4X4ZA 1BIIB 1ZSDA 4PG2A 4OAWB 1DDHB 1WVZA 3U46B 1M42A 3FU5A 1QSVA 4LEOA 4FDWA 3NZ8B 1F4YH 1RUMH 5J5EA 1VERA 3OXRB 3QJHB 1VZHA 5TF1L 1TQBB 2XACC 4MCZB 5D6CB 3WNIA 3QSKB 4Z0XA 1LEGA 3EO9H 1GJWA 2GJ6D 4OCYH 3PHOB 4QHMA 5EBLB 2MNJB 1TJIL 4PCKA 1RMFL 4HZAA 2PMZA 1AP2B 3KVDD 2FB4H 2EZ0C 4R7DA 1X4XA 4XMPL 2EVIA 3K1DA 2COQA 1ZGLP 4JFXB 2DJUA 3DXAA 3HPJB 5B21A 1YMHA 5JIHA 2EABA 3GHBH 5E9DD 1L4IA 4BSWB 2ED8A 1CQYA 4ZPVB 1F00I 2O26U 4PJ9B 3HJEA 1MAML 4WSKA 1E2ZA 1D5XA 4OT1H 1E3FA 1OTSD 1BBDH 4JANA 1DLHA 5CUSL 4ZOAA 3N44F 3RL1A 2KLSA 5ITFA 3K81A 3GZOA 4M43H 4BGDA 4G1EB 3KWTA 2ZCHL 5D6DC 3M1CA 1FV1A 1F8TH 2NY3D 4X6CE 3OZLA 2AMUA 2C4FT 3ES6A 2VDLH 1J1PH 3PWPB 4GUOA 1T04B 1Z32X 5ISZB 2OK0H 4U7SA 5TJWK 5AW2B 2WBJB 1UM6H 4H40A 2V9QA 3KPLA 3VXRD 3A4AA 5H2BA 1P7BA 1E7VA 5DK2B 1MJ8L 1AE6L 3IJHB 1I7ZB 2ZAGA 5E0QA 3TIDB 3NZUA 2OMUA 2VSKB 2WBXA 2BIIA 4R8WL 1QR1B 2F5AH 2X87A 1CLYH 2PYED 1H19A 4G6JL 3DNKA 1IL1A 4AV0A 3PL6B 3RAJL 3P0YL 3GMLB 5FHBL 3GUTB 4QPEA 3UDWC 5H94A 4S2SA 1XR8A 1FF5A 3OAZH 2FQEA 4YHNA 1DCLA 2UY6A 4PYGA 3T0ED 5I8KH 5BO1L 4X8CA 4KRNA 4YPGA 3RNKA 4BXSV 1Q0EA 3NP3A 1MRDL 3DSFH 4PRHE 4LHUB 4G7QB 3IMRA 2WWKT 2I60H 3APFA 4Z7WE 3TV3L 1UKTA 1PMYA 5DC4B 4KK9D 1LXMA 1URIA 2PWHA 1NC2A 1YYCA 4UANA 4ANWA 1AXIB 1OLLA 4GO6B 4UQCA 1UACH 4JDZA 4RMRA 1CDGA 4KFZC 1Y18A 2C1PA 1IKOP 4WW2B 1BQHA 5F7MC 3M45A 1ZHNA 5ETUA 2NSXA 5I1LA 3D33A 3FHAA 1JGEA 4LVNC 3RIFK 4XCNA 5E5UB 2JF1A 3ECQA 4MTMA 4M5YH 3RVVD 1GXEA 2IEPA 4XNXH 4UB0L 2YIHA 1E4XH 2YARA 3GBDA 4O4YL 4G9DB 3LHAA 3NJKA 1WZAA 1NC4D 1A2YB 1A9EA 1A6AA 3FCUB 2I9TA 2BZCA 2IDCA 3F3HA 2JJUA 1QO3A 1J5OH 3ZO9A 4QRPB 3OB0K 4LNVA 3KPMB 3HR5B 1F58H 1VEOA 3F7VA 1FN4A 4V1DA 1F4YL 1RUML 2R2HA 3UTSE 3B9KA 1JPFB 4X4XA 3T9WA 4PREA 1TYJA 4UDTA 4ZDHB 3EO9L 3UZEC 4OCYL 3HMWH 3QYCA 4JZJB 1B0IA 2FB4L 3MRPA 2XWTB 2IAND 4BKLB 1WPCA 1BM3H 1YY9C 5I5JA 2HVKB 3NAAH 4PV8B 4U6YA 3GHBL 4NQDE 2ZG2A 4LGRB 4A7GA 4LLDB 1TCRB 2BSSA 2WYZA 1FVCB 3HRZB 5I74C 3O41A 2FH6A 1R24B 4OT1L 4XTRC 2YPLE 5KJ7E 2D73A 3L5IA 4ZSOB 2A74C 1BBDL 1S7RB 2W0FA 3S36X 1GMEA 3CWGA 4LCWE 4HMEA 3SPCA 4M43L 3CZFA 5C0NC 1T66D 4HUWA 5JQHC 2BNRD 2J57A 4XWOD 2CM5A 4NUJA 2LVEA 3FQ4A 3TA4D 1F8TL 3RWDA 4HBQA 2X4UB 4E9TA 4WTQA 2WO3B 3VSUA 2NX5B 4LL9A 1O6VA 1J1PL 2VDLL 4HD9A 2OK0L 1WYJA 2WGXA 2HCZX 5B8CC 5C0GA 1UM6L 4GW4B 3FUFA 3PNWB 4H25B 1W0WA 3K6FA 3QPQD 4PJAE 3V4PB 4KVCH 1KGJA 3MXVH 1TTBA 5MP6H 1TZHA 4GQQA 1AGBA 3VX1A 2F5AL 1CLYL 4Z7QE 2PCXA 1X5HA 4YHLH 2F53E 3ZW3A 4FNRA 4D0CA 2AJZB 3SJVB 3LPGA 3OJVC 4OZFG 1DQQB 2P49B 2WC7A 1QTSA 2E75C 3DV6A 5I8KL 5FX3A 3MTXA 2GCYB 4H8WC 3TJHD 4X5XA 3ARQA 3DSFL 4HAKA 3G9AB 2VSDA 5EOCJ 3T3PF 2I60L 4F57L 4TSBH 3P9MA 1JN6B 2EO1A 2F9BT 1GCFA 4UF7C 1R4XA 1U8QB 1GSKA 1P5VB 2YKLH 4FFTA 1LHZA 3TBWA 1AKJB 4B53A 5GZOD 5HY9B 1T21A 3O3AA 4EZJA 1UACL 2BC4B 4NO3A 1JBJA 4XCYB 5FIEA 2YZ1A 2EIJB 3QPXH 4F15C 2ZP0T 4R0LA 4HWZB 4V11A 3IFPA 5EOTB 1XF2B 3P4NB 2A83B 2OL3A 2O5NA 3DV4B 1BD2E 1HOCB 2EE0A 4ZS6C 5IF0B 4M5YL 1I8IA 2KKQA 2O6FA 3MRKB 4XNXL 3HRPA 2AJSH 1E4XL 3L3HA 4P3DB 5IIEB 4GYBA 2UZYB 1ECZA 3KYMB 1NGZA 5I73C 5HVFB 5IJVA 2IBZY 5C6PB 4B9JA 3LQAC 3SKUD 3NP4A 4AJ0A 3PWUA 4JM2D 2FO4B 3REWB 1F58L 4KGLA 1OCRB 4U6TA 3PIQA 2YD5A 2Y5TB 3FHQA 5IFAH 1I82A 2JIXA 2G5BB 2F74B 3M1BB 2ZKHH 4FG6D 3GSXB 2A6JB 3AM8C 5DS1A 4JDEB 4NHUB 4P23D 4NLHA 4IRJA 4QHUB 3HMWL 3FF7A 4N2IA 4MCMA 1PS3A 3ETTA 4YH6A 3AW5A 1ZS8B 1J0YA 3ILPA 4QHNB 1YMME 1JFQH 2VW6A 1J5IA 4OLWH 3FB5A 2QL1A 2VDPH 1BM3L 3ARDC 1I7TB 3MREB 1GY2A 4MA1C 4D8PB 3NAAL 3DMMC 1E5AA 3KPNB 1QBLH 4GUCA 3VXQB 5L2JB 3B8YA 4S11A 4Z7IA 1S9VA 3GIZH 1BM7A 3DX6A 1ZA6A 3MACH 3NRPA 4F93B 5I71B 1UA6H 3O2VH 3QT2A 4N85A 1R3LA 4RFEB 3S3PA 2P5EB 3KWUA 4G8EA 4W81A 1KWGA 1CK0H 4J3WA 3BH9B 1AD9A 2DQUH 4HJGB 4L29B 1BZ7A 5I0ZA 1H5BB 1KTBA 1U91A 3VI3A 2A6DA 2WVVB 4ZUSB 3HG1B 4NKDB 3U48A 3GJEB 5BS0A 1AKPA 2OMXB 3DROB 1Z9LA 4NI3A 5FLUA 1YCSA 1TTAA 2R7EA 4V33A 3S3CB 3JZYA 3IDIB 3QP3A 4TVPH 5JDSB 4KVCL 2ADYA 1QNZH 3MXVL 1RK7A 4OM0H 5MP6L 5T1LB 5AVZB 1IQWH 4RDQF 2WWOA 1KBPA 2Q1EA 5KYWB 4OCSH 3VGDA 5E70A 3QO0B 3MBEC 2CPUA 1JPTL 2XPZA 4ZW8A 4YHLL 2FT7A 1U8MA 2CR3A 1E4KA 2NT1A 3CV5A 4QRBA 1XH3A 1BX2A 1QLFB 3KPQA 4TUOB 3PJSB 4XZUB 4H26A 3T08A 3QDMA 1R33A 2D3LA 1F11B 5IB3B 2WTOA 2EQDA 2OP4H 5DDHA 4R97B 5GJSH 3IETB 1BQKA 1ORQA 3G5WA 3VFNA 2EVGA 2QVFB 4Q9RH 3VI4A 3V9EA 5AQ0A 5IBUG 2YKLL 3BGFC 1GCYA 1CICD 1QHQA 2YUWA 1FZMB 3HZMA 5F72S 1OP3H