5LN4A

Crystal structure of self-complemented psaa, the major subunit of ph 6 antigen from yersinia pests, in complex with choline
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFNDKQSTVINSKDVSGEVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Myf and Psa fimbriae-mediated tropism of pathogenic strains of Yersinia for host tissues.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
molecule keywords pH 6 antigen,pH 6 antigen
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ln4A00
4F8NA 4F8PA 5LN4A 5LNDA 4F8OA 5LN8A 5LO7A 4F8LA
chains in the Genus database with same CATH superfamily
2VDLL 4Q58C 3C09B 1AG6A 4CL7A 4XNXL 5JHLA 5GS0L 5LGHH 4DK6A 1PY9A 3R4RA 1N4XL 4YPGA 5DMKB 1ID2A 2QQNH 1P5UC 4G6FD 4H8UA 4QXTA 1MVFA 3HEIB 4GO9A 4JQVA 1XAKA 1F4YL 1QFWM 3HLKA 1AHWB 1SHXA 3WUZA 3SCMC 2ROYA 2RGSA 4KJPD 1QI3A 5IJCC 2Q8BH 1HH9B 2K7PA 2VB5A 4PJBB 3IJ8A 1Y07A 3QC6X 2GQHA 4JDZB 2B9AA 1Q9LB 2R69H 5DI8A 4Q4IA 3SPJA 1Q0YH 2WNWA 3DI3B 1OCOB 4GMSL 3C60A 3VXTA 3ULUE 5D72L 3BWUF 3LS4L 4O51A 4ZG1A 4P3DB 5MEOB 4WI0B 4QXWA 1EQWA 3MV8E 2TSAA 4HBQA 2QFPA 3HI6H 1N18A 3G7TA 3QUXC 1XGTA 5H94B 5MP6H 2EEBA 3DVFA 3NCWA 3MUJA 3VCLB 1TIUA 2Z64C 2Y1VA 3EO0A 4AKPA 1BZ8A 4J2XA 2HJKA 3IS1X 4J7RA 5EOQH 4L0PB 4MJ6B 3ISWA 2ATAA 2FJHA 1BZ7A 2HP4A 4MMZB 2KH2B 1L5GB 3TYGH 2FEJA 1IM9D 4YHLH 4OUUB 2DYPB 4Y4HC 2FYYA 4EI6B 1KY7A 3QR2A 1BV8A 1LMKA 3M1BA 4BH8A 4K3GA 3UTQB 4F57H 3BEWB 3E80A 3U48A 3P30L 4X99A 4GG6B 3HIZA 4HH8A 1TEFA 3T6ZA 4XP4L 2YGNA 5C6WH 1LEKA 2XV2A 4KDTC 2WLKA 1DSFL 1XH1A 3M45A 3LDBC 1NGPH 1BEYH 3RURA 5F9WC 5E4OA 4OF5A 1L0YA 2J88L 2WVSA 2YXWA 2RH0A 4Y9FA 4JM2F 4FZ8H 4UTCA 4MMYA 3DSFH 5IT2L 4UQDA 3DX7A 3X3GH 4CNIB 2PCPB 4UMSA 3X3FH 4NQSA 1WUNT 4ANXA 3K71B 1ZE3H 4F15B 4YDLC 1V8HA 4X5XB 3MRRB 3L1GA 2H1PL 3FMGL 3H9SE 3NA9L 4Z7UB 1LGVA 1XF4A 3CVDA 5C07A 1A4KB 3IEAA 1TVBB 5G5DB 5HHMD 1UG9A 2AJVH 4AQ8C 1GH7A 4GUQA 4XWOD 2H9GB 1E5YA 3MJ8B 5I71C 1A7QH 2APXA 4YDJB 3EGSA 4F9PA 2YKKA 3F04A 4N2MA 3L2LA 5EB9A 2MQ0A 5E00B 3FONA 5EEVA 4Y1AD 4HEMA 4MS8C 1HEZB 2RFXB 3E6HA 2A74C 5EWIL 5TF0A 4WWNA 3D6GA 2XZCH 4M7ZC 3VU1A 2PPFA 4NZJA 3DX0A 3U2JA 4CMMA 5HXMA 1IAKA 4GMSH 2Z9TA 3MNVB 1E28B 1HKLL 2JB5H 3JWOC 3U1SH 1UD6A 3WIHL 1CICC 2WWKT 3F85A 2GITB 3O6KL 4IHBA 2ATKA 3GTVA 5AD0A 2JSFA 1CBVH 1NC2A 2DIEA 1QPPA 4FZEL 2C5DC 2IDTA 5TH2B 1J11A 2QR0B 4MTMA 4JFFD 5F0MB 5B7EA 5E08L 4PJCB 3HG1D 3AADB 2DMBA 4NFCA 2JELH 3IETB 3O3AA 2OP4L 4QHUB 5IV2A 5EU4B 1FAIH 1OSZB 1TTCA 2WLIA 2BM3A 2OZNA 4N3TA 4PRDB 3GQFA 2NY1C 4WI2A 4X7TA 4YDIL 2FT7A 1GJUA 4YGVA 1KTLA 2X88A 5KTEH 2IG2H 4LCWB 3EH1A 4KDVA 3JUZA 4XNBA 5JIDA 1RERA 3LRGA 1FFOB 3W11C 2K78A 3VDCA 1SY6L 4JJHA 1H15A 4LHUD 4QRSA 5DR5H 2CGYA 1PSKH 3A47A 5DUMH 5DUML 4ZW7A 2F54A 4YFLI 4YJZL 1TQBB 1SJEB 2EILB 3TIEB 4XO8A 3PLYA 4WEBH 2DEWX 4ZNEA 2X6VA 2X3BA 4JB9H 3B7SA 4X5PA 4JHZA 3MLSL 4L4TB 3N50A 1N64H 4TULL 5DXWA 1MWAA 3NFPB 4L1HA 2E47A 5DD1H 2I24N 3R1GH 4NQVB 2IG2L 1B9KA 1AO7D 2XZAL 3MXWL 5CLZA 4QHUA 4J6RL 5IV2B 2AJ3A 4XMKH 4W9CC 4ODWB 4N2OA 3Q5TA 4HSAC 4M7KH 1TQCC 2NXZD 4NKMB 5AEAA 4OZGF 3F83A 4WSKA 4G9FE 3BKCH 1NANH 4LNVA 4AC2A 1JMXA 2C3VB 3VYOA 3DVNA 3AXHA 1F45A 2ESVD 4X4MA 4KZEL 3II1A 3F2LA 1H0DA 3HE6A 3Q3GB 4ODVL 5CU5A 5GRYA 2MKWA 1RZKH 3IFNH 1U92B 1Z0MA 3F62A 2WLHA 3B9DA 4YAQB 1K5NA 3RWJA 5DLML 4G9DA 4MD5B 1YECL 5FGSA 5EG6C 3UROR 2XIDA 4A68A 3BMWA 1XGUA 2A77L 3WKYA 1JNNH 3LEYL 4DP8X 4CU6A 4NHUB 2FNWA 3TZVA 5IWLA 2EH8L 3KDMA 3BAJA 1E50A 5K33A 3SCMB 4ALAL 5IQNA 4F24A 1IC0A 4I18B 1EHLL 4QHMB 1RKRA 1CD1B 4NUGL 1EJOH 4B9FA 5ECGA 4KK5D 1SVZA 4C4BA 4FQCH 4PJ6A 5DJ6B 4UIMB 2UV3A 1TEYA 2VLLA 2ZWSA 4MNQA 5E8OB 4UILL 4YSCA 1XCXA 4NP9A 2ZCLH 4WENB 4O02H 4M43H 4MJ6A 4K71C 3BT0A 3VFWB 5CGYD 5HDRA 3PWNA 4ZAKC 5IB4B 1GTNA 1AZCA 1X9UA 2NZ9C 3WGUB 1NBZA 2A73A 4K7FA 4AL8H 1EDHA 1KJ2H 3VFVA 4J3OG 4MDIA 4OLUH 1HSBA 2B1OA 1BF5A 4J8RA 5ESQA 2X70A 3D39A 4B9IA 1GGTA 1TYJA 5HYJE 1YMME 2WZ6A 4LGPB 1ECYA 3M6DA 5I1HH 3CBKB 3U1PA 4I9XA 4P2QB 4A7SA 1H19A 4CDGC 2DPKA 4AEIL 4AYFB 5T33L 1L7TH 4JRXA 2EUZA 4TQ8A 1G87A 1I7ZB 6FABL 4G43B 5TPWL 1AAJA 2CH8A 1S5IL 3AWEA 4K23L 2OYLA 2LV4A 4M7LT 3IDIB 5CIPH 2JIXD 4MS8D 2X4TA 4YSQA 3MVSA 3PV7A 3QQ9D 4MYPA 3IDMB 1Q1JH 5AOKA 1FUNA 3GEFA 3EOBA 4G83A 3QUYC 2HT2D 1V27A 4K7PY 5CGYC 1JDAA 1QVOB 1HEZA 4Z7NF 4QY8A 4HX1B 1R5VA 2ICWA 2IVFC 1C5DB 1Q94A 1HHJB 2EO9A 4L5FL 5HI4D 1FNGA 3WNMA 1WZ1H 4K2UH 3QCUH 3SGJA 1P5VB 1BBJA 5CKGA 4YZFF 4KZCA 5ISZA 1L0PA 1SDDB 4NGHL 5D1ZI 4J1UB 3TN0A 1DCLA 4HCFA 1WQVT 3PGFH 6FABH 5HYSG 1U58B 2WVUA 4EN3B 1NCWH 5FO9A 3FTGB 3D07A 2P8MA 3BZFB 3RGVB 1ZTXH 4WJG3 3PS6A 4AV4A 1OO2A 1EERB 4M93B 2FBJL 3LY6A 1AHMA 1D6VH 1VZHA 3MJWA 1PFOA 4XI5C 5HY9B 3ULVH 3BRGC 5D7JB 2HVJA 1E27B 5DUJA 1IBGH 3LTVA 4MDRA 1QNZL 4LPTA 3SQBB 5C0AE 4FQLL 4HLZH 4IQHA 1A25A 5BV7H 2A38A 3DMMA 4PJHF 1V3MA 2FQGA 5AVSB 5ICZB 2OMVB 1RZ8A 3IFOB 1SRDA 2VERA 3Q2NA 1BXAA 2AQNA 3Q6FA 4I2XA 2ZYHA 3BUPA 4IJ3C 1F11B 1YJDL 1YN6A 3TNNA 4OZIA 2DQUL 2O1AA 2J71A 4GXFA 3VFNA 1T5XA 3M1OA 4NNXB 4UIKH 1FL5B 4N2KA 5I15L 1A0QL 2ZX5A 4PRHB 2IANE 1EHLH 4EN3A 2LAGB 3AROA 1ONQB 5EH1A 1Q9OA 3AXLB 5FUZH 4JY6A 5T3ZL 5EZJB 1CFVL 1S5HB 3I6LE 2NW3A 3LEYH 2GBUA 3V10A 3KM2A 4GAYA 3SEPA 1BREA 4OJYA 1IAMA 4ABQA 4AJYV 4ELME 3O6ML 4QAWA 4APQC 1AGCA 1GS6X 3QORA 1DJYA 4KTEH 3K8LA 1ZT1B 1TENA 4LCIH 3QDMB 3LKQB 5MERB 3ERXA 2Y23A 4XVJH 1NM4A 1LJMA 1OAUH 1G7MB 1AGBB 1S7VB 5EUOB 4Q97A 5I75B 4NKMA 3SGJC 4RAHA 2BO0A 2Y1ZA 4YL9A 5IVXF 5B38G 5HTSA 5G2NA 1MJUL 3DVNB 2CBMA 4PJ9B 1VFBA 2BY1A 4AQZA 5TQ2H 4KMQA 3QDJA 4PGBB 3V6BR 4QRTA 5DMKA 4X9FA 3V95A 1JRHI 1T5WB 4RSYA 1N68A 1WITA 4F7EA 2G5RA 4XC1H 3KPMA 4ZMVA 1WCBA 2MOVA 5E95B 2NTFB 2OSYA 1DVSA 1JIBA 2ZJSH 2VXSH 4PS3A 3IMVA 3KLLA 4PJ9C 5C0IB 3AUVA 12E8H 3R06B 4JL2A 4E9WA 1N64L 4HWBL 1PDKA 1JL8A 3NJHA 2F1AA 5DJ2A 4EDWH 2UYLB 2YARA 2V8MA 1NGWA 4LESA 3ZYZA 4ELMA 4WNSA 3HJEA 4PG2C 4DO5A 1T21B 3RY6A 2W07B 4MCNA 2RCSL 1WD8A 1IE4A 2VR6A 5I8CB 2FWLB 4GRLC 4PJHA 3DJTA 5EORL 3MOQA 4FG6C 3H9HB 3TFKD 1F4AA 5DUBB 3BPCB 3EYQC 2H32A 3KR3L 4J3UA 4XPHH 5E5UB 4Y9EA 1UUSA 2DQGH 2X6UA 4GRWF 5FM4A 3V0VA 4DN3L 2MNUA 3V8OA 4ZPVA 5D1ZA 4P4KA 2YUVA 1RZGA 2LTQB 3LXAA 2DWTA 4HBCH 5E2WH 3CZEA 3VXMB 4FNSA 1H6FA 4LSRH 2LT9A 1AR2A 4HUWB 4X6FB 3ILPB 2G3ZA 3C2SA 4RA3A 3VI4E 4ELKB 1XB6A 5AOLA 3STLA 2FL5B 2GC4C 1DVFB 3FHQA 3G9VA 1RL1A 3NCBB 3QUYB 4FTDA 4PUBH 5E9DB 1I9RL 1KXQA 4IRJB 4ZODA 4YBLC 1XBRA 2VAJA 2J8UF 5DD3H 3ZJAA 3WFEL 5DHVB 1PG7W 3D4ZA 4RFEA 1P7QA 5I18H 4ELMB 5I6KA 4I1RA 4OZ4B 1ZJAA 4JFHD 1Z9PA 1AXSB 1CK0L 3BP5B 3QDGA 5LNGA 3T0DA 4NBXB 2FX9H 4JO2L 1KJVB 5AVVB 1OSPL 5GGUA 2W5PA 4NRZB 3RWHB 2FTAA 2R4RL 4R7LA 3FB5A 1TYRA 4W6WB 2HN7B 3BD3A 3LRSB 4XCYA 4A7GF 5IMKB 4H1LG 2FT8A 1RIVL 4EJ1C 5D1ZB 3DX7B 4E9TA 4PY7B 4KPHL 1SOSA 2F5BH 4NKIH 5D4JA 2NY4B 3V7MA 4YR6B 1OGAB 3HB3D 5D7SL 3X1NA 1FZKA 5FOBA 5EU5B 1FGNL 2XBDA 3HRPA 4LCVA 2ISDA 1KLGB 4N26A 4R90L 1KXQE 3NYKA 2I69A 4Z9KB 3IVKB 2J1WA 4PGZA 5LQBL 3UFIA 2GIXA 4KUZH 2FO4A 1CLYH 3RVXC 1C16B 2Y06L 3FUKA 1J0JA 2Y2YA 3GYRA 3DHJA 1S8DA 4ZX4A 2W9DH 2PP8A 4YS4A 3DGGA 3A22A 4PRHD 3QDGE 3ZW3A 1AZBA 5D1XB 3CFDB 2B1AL 2YEQA 4XPAL 5H35A 4XNZB 4PVMA 4BQ6A 1J0ZA 4KKLD 2D0HA 2HJKB 4WHYG 2O6DA 2YO3A 2IWKA 3AACA 4OQTA 5EDSA 1U8KB 5EF2A 2PCXA 1T5XB 5BVPL 1H3PL 3CVIH 2Z7WA 3B8SA 1VEPA 1ANUA 2OYKA 5E2UH 7PAZA 3DJZA 3IMTA 2G0KA 2F18A 4RZKA 1S4IA 3VXME 1QHOA 4PRPB 4NO0A 1KIQA 4UDTB 4QJ5B 2R8SH 2WPGA 3VGFA 2VDRB 1CFTB 5LXGH 1DLHB 1TZHA 4GT7A 4B95C 4HPHA 2DWYA 1AGFB 3HHRB 5MEQA 3WXVH 4FGMA 4JDZA 1D5BA 2XG5B 1OK8A 2EABA 2NSQA 1RLBA 4I88A 4YL4A 4ZFOL 1ASQA 2YAQA 2ARJB 2JCWA 1KYFA 3MRKB 2UY6B 5AUMB 5I30H 4RZCA 4V1DD 4NNXA 3E3QC 1T0MB 3WS3A 1JYXA 1EJ6A 2QGEA 4E9SA 3CTTA 2OJZH 3RFZC 3L8QA 3NRFA 3BFOA 3ZPDA 3RRQA 5HBBA 2OMZB 3MPCA 1Q0YL 2VN5A 3WJJC 1JDCA 1HHGA 2JIXA 3ULVL 3MTRA 1A64A 3SE9H 1VGEH 4C55A 2IF7A 2MTPA 3AABA 1OGSA 2BVPA 4QXGL 5IB2A 1UA6H 1HYSD 1M1XB 2NNCA 4M8RA 4WWKB 1CU4H 2R7EA 2R2EB 4M7KL 1MHEB 4R7VA 4OQ1A 3MXVL 3CZKA 1BECA 2Z7ZA 1JGVH 1MKFA 3SDAB 4P3DA 5MEOA 3QQNA 4EZMA 1TYEB 5FYJE 1UA3A 4OKVA 4DJMA 1Q9WA 4LEXL 4JFTA 5F9OH 1TZGL 5DMYA 1MCWM 4G6JH 2VDOB 1CK0H 5F1IB 4LBEA 3WD5H 3KDPB 3B6SA 5B1JC 2WXGA 4Y4KA 3QQDB 3BXNA 5D7IF 5F6HI 5IQ7L 1KC5H 3HI1A 3QI9C 2AKRA 1CDIA 2JCCA 3FT4B 4AQAB 2QZ5A 4CSSA 1WAPA 4PGEB 1D7CA 3KJ4C 3L13A 3FHEA 4JGJA 1II4E 2GKIA 1NEZG 2G9KA 2O5ZH 1TOXA 4PP2B 5EV7A 4PS8A 3UO8B 4B9GA 4WFGD 5JPMC 2FBOJ 5KSAC 1HNFA 2WQUA 4G8GE 3L3OB 4Y4HA 2R2HA 2ITCB 1I8IA 4IRJA 4TVPE 2XQYG 5B7FA 2AJZB 2IOMA 3BIBX 4Q9RL 5ITFB 2IDCA 3SPGA 4A63A 3HUJE 3RWGA 2PPEA 5A3IC 4O51B 4C56B 1KXVC 5DD6A 4L05A 4Y2DB 1TEGA 5F71A 4EO5A 2E9WA 1ZA6A 1MFMA 1UXLA 3WUWB 2Z0BA 2WWMD 4FG0A 2DIAA 3HN8A 2MNJB 4P4KB 5FM8A 35C8H 3G5ZB 3TO2B 5K93A 4HW6A 4KI5F 4PTUA 2C3VA 5J4MA 4OI9A 1U95B 1AZNA 3Q48A 3HOGA 1OD7A 1QLRB 1RH8A 3IJHB 3MRNB 4FYSA 3C6EA 1MWAB 3F7LA 12E8L 3FC8A 4I3RL 5C0FB 5CAYB 5EWIH 4GAGH 2BX5A 4UNVA 1W6WA 3EDDA 5CLTA 1OGAA 2MIZA 4W81A 2LW3A 1Q38A 2ENQA 3B2MA 2DKSA 3PJSA 3NZHH 5DEFA 4AYFA 5C1MB 1P4UA 2X4RB 4I8DA 3HBGA 5DURB 2QDWA 3O45A 3KDMB 4G8GA 3SCMA 5TQ2L 1OW0A 5E6ID 8FABA 1E6JL 5D1QD 3SBRA 4JQVC 1A4BA 5E08H 2C1PB 5DRWA 4W9KC 4P3WA 1IZKA 4UZGA 1OLZA 1M3JA 1E65A 3MV9B 4LGSB 3QUGA 1FO0L 3LSOA 2W0KA 1BZDA 3DX8A 4OZHA 2P5EA 3WL9A 4K55A 1GY2A 1IGTB 3CZLA 1K5NB 2QMKA 4WUUD 5CEYB 5E23A 4DP5X 5IW1A 2AVFA 1BIIA 2G9HA 1AKJD 4PJ5B 4XNYH 3MLXH 4F1SA 2CU9A 2DM2A 3N2JA 2AI0L 1XHHA 1XZ0A 3IJHA 4IHOB 4HCGA 3DUUA 3SQOH 2YPLD 1KLGA 5GGSA 4JHUA 1O7VA 4Z7UA 3DX2A 5JA8B 5EO0B 3V0IA 5HI5C 1VENA 3UBXB 1F02I 4HF5L 4PMEA 4FCHA 2QQKL 3ZHLA 2X40A 4E9VA 2YAEA 1DEDA 5A2CA 1WLHA 3GHEH 1QTSA 1X5YA 3B43A 3UZEC 4G3YL 2QVIA 2J8OA 3G5XA 1GVIA 2EH7H 4JCWA 4Z7QF 2OL3L 1KB5H 2GAZB 5T1DH 5GRJH 1HE8A 1PLGL 1NOLA 1RUAL 2W60A 4PJHE 3S34L 1HWGB 2DM3A 2O5ZL 3ZTNL 3HZVB 3KLHD 4NQDA 2W1NA 3LKOA 5DK0B 1QAWA 3OGCB 4HC1L 3SGDI 1JHTB 5I1IH 4AM0Q 2BINA 3ULVD 3RUGB 2VMJA 5FYLL 4R4NC 4BRVA 5F8QC 1T03L 3OG4B 3GUTB 1JV5B 3F58H 4QD2E 4QMEA 1F3JB 3VFSA 2QSCH 4YHOH 1ZT7A 4YHZL 2XWBA 1XZ0B 2DTSA 3GS4A 4FG2A 3ATAA 1FVCB 2XT1B 4HSQA 4IHOA 3TONA 1S7WB 3TA3B 3ATDA 3D87B 1BAWA 2K6YA 3MRLB 1E4WH 4XP4H 4JY6B 4RDBA 4I4WB 3C8DA 5LQBH 5EU4A 4WWKA 3GXUB 3S88H 1JWUA 5DJ8B 3WYRA 2YZ8A 1DBJH 1OWWA 3PRZA 4URTB 5ESAB 1MDAA 1WBXA 1OE1A 1CIDA 1QEWB 2XCMC 5KSVB 1MFVA 4PREA 4H88H 1IAIH 4FFVC 4KRPD 4JZJA 3MCLH 3QIBD 3QC5X 2EDEA 1PKQE 1DZBA 2LVCA 2IBZX 3U4BH 3OAYH 4HXBL 4F5CA 3KJ6L 3TCLA 5D7LD 2C1OA 4KKBD 5I1CH 4RNRB 3UMTA 4PJ9A 3Q9QA 2ZOUA 1G7HB 2IANB 2OMVA 4FLOA 2Z92B 4P2QE 1N4XH 1NFIA 2BNQB 5FO9B 4RRPA 4AVJA 1OP3H 5BO0D 1IRAY 2Q3XA 1P5UB 4R5VA 1NLBL 4HGMA 3HZYB 3JWNH 5A40E 4I89A 4JHWH 5JPMA 1U4EA 3C5XA 3RNQA 4RH4A 4WKZA 3Q0HA 3LPOA 4YNYA 1TJGL 4W4OC 5CS7A 4HIXL 1Q9OB 1T20B 4PJ7B 1JZ6A 3QWQB 1MHCA 1HCFX 3P3RA 5F1IA 5BRQA 4FF9A 4HWZB 5KJRL 5F7FA 2WTRB 1MCSA 4Z76A 1OE2A 3U46B 1RZ8B 1YEHL 2Q76B 3N40P 1DVTA 5CEZL 4EZKA 1MY7A 2VLJB 3KJ4B 4NAMA 3U9UB 3LCYA 4NO0D 1HNGA 2R0KH 2WVVB 4BA8A 1VGKA 3DX3A 3EOBB 4QTIH 5AB9A 3ZGIA 1RZJH 2R51A 1NICA 1UB6B 1MF2H 5KYWA 4JO4H 3N9GH 1Q94B 4B97A 3KWTA 3FQ2A 5BW7C 3RWIA 1U8LB 1KENL 5J6GA 4ZUUA 3MTXA 1UM5L 3QIUD 2GJ6D 2IEPA 5IKCB 1MELA 4LPYA 1IBBA 3EBGA 5AAWC 1U33A 3TYGL 2YPKA 4Y9BA 4DF9A 2H2PD 1KIUA 3UERA 4DFIA 3MV9D 1AACA 4M5YH 4H44C 2X0VA 2AEOA 3I6KA 4YNYB 3BAEL 3L1OH 4PJ8D 4FQXD 1WBZB 3RE0A 2PCFA 3HA0A 1IGIL 5KVGL 1MHCB 1N8OE 2J73A 3JTBA 5GS1B 4NQCB 2HT3D 4TSBH 5FOJA 4X6CA 4L1LA 1J88A 3E2HC 3CIAA 4QY8B 4KFZC 5SWQA 4LKCA 3BKML 2OJ1A 4PLKC 3S36H 1X7QB 2FT6A 2X2HA 4LSTH 4F7CA 1CFBA 2Y7MA 1S9WB 3P4NA 2FECI 2D3NA 3BIKB 4LL1A 1M1SA 2ZWZA 5GGUB 3KLHC 2CHXA 2VDNL 3GT6A 1CGYA 3H3BC 1SGKA 3PABA 3QNXA 2X89A 1HNYA 1GAFL 3FTGA 2DQEH 5ID0A 1JYNA 2L7JA 1NEUA 2ZCZA 2GY5A 2CNZA 3MRHB 3RFZB 3W9DB 1KXHA 2HUEA 4KHXH 1IC5H 4PY7A 2R4RH 5CZVH 4OAWA 4OFKA 2LU3A 5IKCA 3U79A 3EDFA 2NSXA 1RFDH 4LNRB 4ES8A 2GJJA 2JTYA 3LZPA 3M1BB 4LCUA 4BH8B 1HC1A 4GRMA 4X7SL 4MX7B 2BS8A 1EGJA 3NIDB 2BSTA 1NMBH 3ILQC 3HS0A 4NDMA 4H0IA 5HYIA 4JFEA 3ZT5A 5CP7A 1WH0A 4LLVB 4FHBD 2CLVA 3DARA 1LWJA 2FO4B 1C16A 2CHDA 2ZYRA 2BHUA 5KEZA 1K4CB 4NHCH 1BXVA 2V9TA 3P4LA 4XHJC 3UC0L 2ITEA 2HG5A 3IXAB 4N90D 3CN3A 4WGWB 5DMIL 4F2MA 5B8CC 1BA9A 4ZOBA 5BXFA 3JVGC 2XPGB 2YBGA 4TV3A 2F8VA 1EGJL 5EBLA 3RG1C 4XVSH 1P6AB 1HESA 2OV0A 4R7NB 4G6KH 1KGUA 2DKUA 2Y07H 4PB9L 5IQ9A 5GS2D 2OFQA 5FXCH 5C2BH 2DQDH 4NPJA 3ZTCC 3QIWC 2XPYA 3VSTA 5CN1A 1U8MB 1J48A 5KSAD 1BQUA 3IPFA 1NEZA 3EKCA 1P7QB 5GZND 1I7RB 1B2YA 1RZ7L 3GHEL 2HJLB 1D5IH 2E27H 3VD9A 4EQ2A 4OLVL 3BZ4A 2QTEA 2YRZA 4BELD 3KYKL 5AENA 4ATWA 1BFOA 2FJFA 3PXHA 3Q8CA 1YSOA 4I0PA 3MLUH 2DLHA 4Y2NA 4OU3A 2BFGA 4NLAA 3ZRCC 2X0UA 3H42L 2DF3A 4XCYB 1KCKA 5EOCJ 3ZL2A 3VFSB 2QGDA 3LMJL 1N19A 1QW9A 3W82A 3WG7B 2DKMA 5KVEL 1C1EH 3AW5A 4JKKA 4JFWA 3I6GB 4FNUA 2AK1L 1KGWA 1UWEH 2QSVA 3BD5A 4UYPA 3WXWH 4X5QA 4HFWA 1QNIA 4ACPA 3VXSA 5C0IA 5J89A 3NEEA 2WLLB 4LCYA 7TAAA 3H2WA 2X38A 2D0FA 2Y22A 5DJ2B 5I6XC 3KPSB 3F5WB 3HPJB 3QA3A 4BZ1H 4YMPA 3UGUA 4BUQA 4BE5A 3RKPA 3ZYJA 4YDVB 4FE9A 4UOQA 5I6NA 4JO4L 1E4XL 3CK0L 5SX5K 3X17A 4TN9A 4YLCA 5GS0D 1G7IB 5DWUH 5HHVL 2WXFA 3QI9D 5HPMA 4U1KA 2NR6C 5E2JA 2M8XA 1NFDA 3EADA 4FFYL 2L7EA 4FDWA 2K6WA 4KGJA 2NY0B 3TBSB 3WLBB 3L5HA 1S7SB 4RMQA 3IPEA 4B7LA 3P0VL 3DETD 3LNEA 2A99A 2Q9OA 4PJGB 5AKTA 4U7SA 1F1GA 3ELAT 1OAXH 1ADWA 3BH9A 4Y4HD 2AV1A 4KZDH 1WBYB 3SPIA 4YEFA 1JPTH 5I8EB 4ETQA 4UIKL 2AMUA 2IWEA 1B2WL 1HZLA 3RILA 2W0LA 4LASH 1SMDA 3HTLX 1FYTB 3GJFA 4KKCD 1X7SA 4A55A 2IO5A 3CGTA 4EMZA 3MRMA 4D0DB 4OGZA 5DK2A 2C4XA 3Q13A 3D85B 4M9PA 3G6JA 5DZJA 1MAMH 1GAFH 3GUFA 1WFNA 1KBGH 5CJ8A 2YRBA 3CNKA 5DTFA 4NQCE 3QJXA 4YBQD 4RMWA 5HHXH 1M7DB 1L9NA 3ARYA 1U8QB 1EHKB 1NINA 1W0VA 3X12A 4YGAB 5KG9A 2FWOB 5SWQB 4PRIB 1GOGA 1CGUA 1A3QA 3IFPB 4DPAX 3EIFA 2CDFA 2XFGB 4G8GD 5E5LA 4I2XE 3VG9C 4XP5H 4KK6D 4AGNA 4XBPB 2YRLA 2VMEA 4ODHL 5TDNA 2EDLA 4BEIA 4IJ3B 4LPCA 4WVRA 1ZE3C 3GMPB 1E5AA 1B3IA 2L3BA 4Y89A 2CKBH 1CFQA 5C0FA 2IDSA 3LN5A 4UOZA 3AU1A 4XVUC 2VZOA 3BGFB 3WY2A 1UZGA 4HVBA 3QZWB 3REWB 3IJYB 4P3CL 4Q56A 5CJBA 1Q9WB 3G5YA 4IM8A 2BVYA 5EBWB 2EINB 3LH2H 3SGKA 1U3NA 1A1MB 2EZ0C 2WKGA 4KI1A 4LLVA 3BISA 1L7IL 2MFNA 3IN2A 6CGTA 3IGUA 2Z93B 4KKLC 2YD3A 1T1ZB 2BNUA 1BVNP 3B6SB 3RWGB 1CN4A 3LYRA 1Z32X 4YHYB 1SBSL 4LAQL 2FZ3B 2HT4C 3US1A 2CLZB 4AUUA 4W4NA 3BE1H 4F1ZA 1XL4A 3MFFA 5F3BB 4YHKH 2AKRB 5HGBA 2CJ3A 2HPOA 4KXBA 4EBQH 4QXUH 1CXIA 2X70B 5JHDB 2IGLA 1ETZA 3MHZA 4W9JC 4ERSL 2C8NA 3FQNB 3K80A 3U30C 4KNQA 4ONOA 2WKOA 5JXED 1EDQA 4L3EE 1I1FB 5GJTH 4KQ4H 3TH3T 1AGFA 4JLRA 4ZFQA 5J12B 1IBFA 4IMKC 1X5HA 3BO8B 4FNLL 3BT2L 3MBXL 2WYTA 4X6CF 3VWJC 2C3XA 1QTYT 3QEQD 1SFHA 2SODB 3MGOB 3MLWH 3WIIH 1BYOA 1TF4A 3DUHA 4OJCA 3TN0C 4QHLB 4KDTA 4KO6A 4TSCH 2HKHH 1ZS8A 4Q14A 3OXSB 1H5BC 4MA7L 4NPKA 2GJ6A 4W9FC 2WKOF 3EOTL 1OT1A 4ZX6A 4XI5D 2KZKA 3JV6A 4A7TA 5IHZB 2MPAL 2VIRB 1I4FA 3MLXL 5B7MA 2BZ7A 2BVEA 4K5NA 5BQ7B 4NM4L 3C8HA 1U8KA 3Q6GL 3WY4A 3TN0B 5F3BA 5HGBB 2E7BA 2WO4A 4HULB 2R59A 2AEIT 1KCVH 2VDPH 1XD1A 5IEHA 5ALBH 2ZUVA 1AQ8A 1JZHA 4R5TA 3WLWD 1U3HD 1IAII 2ZX7A 4PV1C 4PH8A 3U9PL 2GW5A 4B41A 5FCSH 2AGJH 4E5XB 2VL4A 3FW6A 4JFOA 1D5BB 2XG5A 4H20L 5E9AA 2TSBA 5FYJU 3MOAL 3POHA 5DC9B 1UQSA 1WAEA 3CG8A 3JWNG 3BP6A 3PWUA 1KN4H 2AVGA 3DIVA 4X9IA 5ESAA 3C60C 5ABZA 4RZCB 3TL5A 3S3CB 1AS8A 5C70A 1KOAA 4UNUA 5IJVA 1RJYA 1VFAB 4YH6A 3BUDA 3HG2A 3OF6D 4NXKA 2ZCKH 3QISA 1FYTD 2PKDA 3BH8B 2FSEB 3EYOA 5KS9E 2OW6A 5ANMB 5IQ7H 2NYKA 1Z5LA 3C09C 1GS8A 4EZLA 2ICWJ 1EZUA 4G5ZH 1WT5C 3BCDA 5KVEE 4YE0A 1P5UA 5E9NA 3K8KA 3BIAX 1V3JA 3TVMC 1XH3B 1E42A 4Y16C 3G5XB 4JDEB 4JE0A 1S7WA 1T4WA 1XD0A 4R0LB 1Q4NX 4ODXB 3G6DH 3GO1H 4DERA 4AZ8B 3RZCC 4OI7A 2EACA 1UACH 3VRJB 1NOFA 3CN1A 4HPOH 2W60B 3A6OA 5HPOA 5K69A 4F9LC 2ZCKL 2F74A 1ZPLA 3L45A 3QIUA 4X4XA 1SHWA 4Z78B 3D2UA 2AF2A 3HZMB 4XCCH 1XL6A 3VMOA 3UL4A 3LV3B 2D8KA 1SHMA 5EEXA 3BPLB 2OK0H 2X4QA 4FJZA 1CO1A 2VR5A 1CFNA 1N0XH 4FQXA 5DZNA 1VSCA 3CV5A 4X50A 4MZ2A 2J6EL 2JFCA 1I7UB 4X6EA 3D52A 3GRBA 3LB6C 2D9CA 4P46A 4DO6A 2BERA 4Y5VA 1IFHH 3WIHA 2BVTA 3PDDA 4BZ1L 4GSUA 3ABLB 1BVNT 3KCPB 2F9BT 2Z92A 3MJGX 3N85L 4U0RB 5F9OL 1KPUB 4MXWL 4PJ7E 2NY3D 1DQJA 1A4KA 2UYLA 1FAKT 4IRSC 2BXZA 2R69L 3N1QC 2J6EA 1RJLA 2E9IA 2VZVA 3K5RA 3OXRA 4LDEB 1MIEH 2NZ1A 1JBJA 4IGBB 1QI5A 3GMQA 1YHPA 4R4BA 3LQZB 3H3KA 2OXHA 4BD4A 1AYRA 4BZ1A 2GAZA 3FU5A 1MCFA 2HKHL 3CPLB 4XCEB 4Z8FL 2EEDA 3TBWB 2H32B 4X6DE 1J8SA 2HLEB 2R9HC 3BGFC 1NGYA 2NY0C 2VXUL 3MNVA 4JFED 4NZRH 4WV1C 5J12C 3T65A 2ZICA 3RYMA 5ISZE 3GRWH 4OT1H 2LHAA 4HC1A 5EO0A 1JXKA 1WFOA 2BC4B 5IT2H 2G3MA 5EUKB 3N40F 4MLSA 1FIGL 1T2JA 3ZUNC 2XKSA 4M7ZB 3RWFA 2GHZA 1IGYA 1FG2B 5I5JA 5DHVA 1INQB 2D4FA 1RD6A 2J12B 4BZ2L 3C5ZA 3L7FB 1SEQH 3RGBA 2H3KA 5BRZA 3D25B 4MZRA 4YHML 4LSQH 2R0ZH 3V5HB 4YVUA 4BFBD 3U7AA 4MJHA 3SN6N 2NY5H 4ZTOL 4DOHE 3BN9C 3F84A 1ZIAA 1XTLA 2R29A 3MJ6A 5KVFE 3P2TA 3FUFA 5IBUG 2Y06H 4JMXA 4A7QA 3ZMEA 2H26A 4RDQF 5KSAA 5L2JA 2R1YB 2ADIB 4ZAKD 4APXA 1BD2D 1ZGLP 2YAFA 5GGRB 3IE9A 5GZNA 2A74A 4XHJD 2F5BL 2QMJA 3PWPA 4FQQB 1U3HB 5AQ0A 5C9KA 4HJSA 1V05A 1KLUB 2MQ3A 4Z0XB 3W39B 3ML9A 1T04A 1J0HA 2XPGA 3MBED 3O0RH 4QYOB 4BSWA 1YPZB 1EZVY 1T7WA 5FGBC 1CICD 2A1WL 3EDKA 1E9OB 4L2LA 4LSVL 3F6IA 4WO4D 1S46A 5F7DA 4RGMB 5FYLE 3FO1B 4NKIL 5LXVA 4J27A 5AB0A 4PJAF 3VTTA 2OS7A 1TFHA 3WBDA 3VACA 2VLMD 1KZQA 2ZD0A 4ABVA 1NIDA 5K59E 2LGNA 2JJTA 4GO6B 1HZKA 5ES4B 4OGXH 5I66A 1J5IA 4JANB 4LKXB 3QQ3A 2W8CA 3VXSD 4OCYH 2X4TB 4WTQA 4H13C 3JV6B 3BESR 4Y2OA 2ZNXA 4W93A 4DW2L 1C7TA 1KIRA 2WXJA 3UAJA 3FOLA 5CP7B 1KACB 1PD6A 1BZQK 5I30L 2YGPA 4NQTA 5B1KA 2CLRB 4AYSA 4HSCX 1HQRB 2WQVA 3N55A 4K2UL 4L8BB 3SDXB 1NFDF 1F8TL 5DRXB 5JOEA 1KG0A 4PJ7F 3OKYA 5HHQA 5ISZB 2EYSB 4PI0A 4XCCL 5E99L 4MYWB 4GXVL 5D2NA 3MV8D 4M5SA 2EEXA 3FTVA 3HN3A 4QTFA 4ZUUB 1O5DT 2B7DT 2LQRA 1TZHB 2HUHA 3O3UN 5IF0A 3C5JB 4C56A 1UWXK 4PGDB 4P57A 3UTTA 2IWGA 4OLZH 3L95A 5I1LB 5JOPD 5EF3A 1G0YR 1V7NH 2WXLA 3G3LA 4MRCA 4ODSH 4UT6L 3TO4D 1KTCA 3T2NH 2KLSA 4KTDL 1V55B 5F72S 2F15A 3JBG7 4DZBB 3I6KB 1FZMB 4ONGH 2IADB 4K8RH 2CO6A 3H9YA 3R8QA 3UJIL 1O7DE 1WCQA 2NQ3A 4HF5H 5LGYA 1BG1A 1U3YA 4K4KA 4UTBA 4S1QH 3ASOB 4AOFA 3WY3A 1T0MA 3MODH 4B9CA 2CGRL 2QVTA 4L9DA 1OGTB 1KCSL 4MDJA 2F68X 3PWNB 5AZ2H 4R26L 1OSYA 3RWIB 4UV7H 3W2DH 4P5KA 5FO7B 5DHMC 3U2SA 4YHNA 3AUWB 4NNPH 4PJIB 4GUCA 2ZSWA 2A73B 3HC0A 3HC4L 5C7XL 1W72H 3QEQA 4P5SA 2V3EA 3D34A 4EXPX 4YDZA 1Z3RA 2WVTA 5E8PA 4JQXC 1IEAB 4QRRB 5FW8A 3WHE0 4JPWL 4PWFA 2ETWA 1PVHA 4L37A 4W9DC 3RB5A 2OR9H 2FEDC 3FO2A 4AGQA 1X3DA 3T1WA 5F0JB 2J3SA 5B1AB 2FEEI 1I7ZA 4XVJL 2LU5A 5E0QA 1J7VR 2FLRT 2UZIL 1SEBB 1DL7L 3T4AA 4FXTA 2OTPA 9PCYA 5MENE 1JAEA 3KJ6H 2DV6A 3WTSA 3ARGB 4OV5A 4BQCA 4ZMWA 1YDPA 1T2QL 4FYRA 2Q76A 4WU5A 1CL7H 5CEXA 4H88L 3HRZA 5D1XC 5PCYA 4Y5YB 5KBMA 5FKAA 3MREB 1J5CA 3ZKQD 1RIHL 3QNFA 5FECA 2FB4H 3NTCL 1IARB 4GKZB 4NLHA 4U1JA 2YIHA 4MD5A 4UDUB 3OB8A 1M9SA 3ISRA 1NBCA 2XTSA 4OM1H 43CAA 4PGJA 4KNTA 1KFAH 3C6SA 5GISH 1G9MH 5I8EA 3WI9A 3FQWA 4RVBA 1OQOA 2CXKA 5KVDH 1SDAB 4S1RL 1I8MB 4RBPK 4YDKL 1CB4A 2D4DA 3QJQB 1FVDA 4MKTA 1F8TH 5D6CA 1EGJH 5HJDA 2XWJB 2NNXA 4JRXB 1NFDB 3L5WB 4XN4A 3ZL1A 2P5WE 2P28B 1GGCH 3WDJA 2QQQA 1QO3B 2WWNA 4ZTPL 1ZLSH 3TBTA 1TQTA 3H56A 2E75C 4JO5A 4UQEA 1V10A 4GW1B 3NIFF 4K7FB 2D03L 3H9HA 1JZDC 4Q0XH 4PLJD 3V9CA 3INUH 3INUL 3QXDB 1A6PA 4XO3A 2ICES 5CINH 3KPSE 5L7XH 2W91A 1XV8A 1G7LB 3WDIA 2QQLL 4EDWL 2HFFB 3LPPA 2J57A 4PY8I 1UH3A 5CILL 3VXMA 3CC5A 3OHXA 2WINB 2FDBP 1NBQA 5ERWB 5CBEB 3ES6A 1TJIH 2BWQA 3HPLA 4LCYB 1PMYA 3D85A 3QUMH 5JW4R 4EXKA 4M03A 1MHPL 4MCYB 3BAXA 1MSPA 1ITBB 3IT8D 3NPSC 4FLRA 3NJXA 2JKTM 1IJ9A 3UIYA 2R0WH 1FAIL 5I19H 1W0YT 1WFMA 2Z8WC 1CDJA 4KWUA 3KXFE 3KZ8A 1D6VL 2Y1YA 3MR9A 4XX1G 3QVAA 5FWQA 3ZT6A 2DQ6A 2J8UA 2BRRL 3T0BA 3FFCA 4K7PH 1ZLWH 1NL0H 4KQ0A 2R2BB 4H0GA 3I6GA 3FQ4A 3PUUA 3HG1A 5F6IB 3CD4A 4YC2B 2V5SA 3EXJA 1XQ4A 1BIIB 1WZ1L 2CDEA 2G9HB 3MN8A 1U93B 4PJ5A 1JI2A 1NCIA 3U7YL 1F11A 1YN6B 1KCLA 3IKCA 4JFQA 3MV7D 1YY8B 3U0TA 3NIGF 2ZAIA 4XWGL 3TJEL 1CFVH 2BCKB 1T0NB 2Z31C 3GBNH 1JWSB 3LNGA 4KU1A 4RISH 4YUEL 3WN5B 2VKXA 1FFNA 5E1AB 4JY4B 1KV3A 5IJDC 5FR3A 1WISA 4U3SA 3UJTL 3SE4A 3SQBA 3W11D 2OL3H 4DN4L 3MLWL 2F58L 4IGBC 3GS7A 4FFTA 2EDTA 5DVMA 5H37G 4GAYB 2Y7QA 5T1MA 4PS4L 1HXMA 2WJ5A 3FPYA 3LRMA 3V5KB 3X11A 5ACZA 3UZVA 3SKNB 4ZZFA 1E3XA 3CHQA 1GKEA 1CPUA 4R0LC 3BDYH 3MLVH 1A4AA 1CS6A 2E59A 2YS4A 5GRZA 1K8DA 3V4VA 2X4OB 4M61B 2V3DA 1QKZL 3GGWA 3LVTA 4PLOB 5GGTA 2DJ4A 4QRRD 2IJ0C 3L3JA 3PV6B 1VLXA 3MBWB 3ULSA 1CF1A 2Y7SA 1QFWH 4JEGB 1G9NL 4WDIA 3CLEL 1ONQA 1AZUA 2K9UA 5FO7A 1RVFL 4QRQA 5EBGA 4FQIH 1Z3GH 5KBPA 1FNSL 5H94A 2VLME 2ZCLL 5T3XE 3RVVD 1AQKH 5FEBA 5L4FA 3ELQA 3GTNA 2W9DL 1L7IH 1O6TA 1MW3A 5IVXA 2E56A 5FYJD 5G5DA 2F19H 5C2UB 4L0ZA 2DH2A 2RACA 1HQ4A 1CGSL 2H9GA 1YEGL 2CO7A 4J3OH 3VXTB 2YKLL 1NAKH 4XBEL 2DQFA 1ET5A 2GC7C 3NJGA 4ODXA 3JV5A 4HFUL 3CVHB 4MJ4A 3ROOB 1T1WA 1JF1A 1J9CT 1DVZA 4FNQA 3K3QA 2CJSA 4KJQC 3KXFB 4MA8H 4PWGA 4JFOB 4PJIA 3V4PA 3QWRA 3TVMB 5J0BA 2WLZA 2IOOA 3L4TA 5K9KB 1DQVA 1KELH 4GPVA 3MKGA 3I3BA 4LVHB 5FAAA 3PAVA 4EVNB 4Z7OE 2AXJA 5H37H 4PJGF 1E43A 3H1ZA 1FNLA 3UYRH 3VGGA 4AQEA 1C08A 4MAYB 3DROB 1OCWH 4V2BA 4P8QA 4K15A 1E9QA 4E0RA 1IC7H 1SUHA 5JLZA 4TQPA 4PJEA 4CN1A 4OGYL 1QMUA 1S3KH 4K73A 3BEWA 2E0PA 3IDYC 1XCTB 3FQNA 1AOHA 4RFOH 4GINA 1YDPB 4JPSA 3CSTA 5LUMA 2E5EA 1NUDA 2DLIA 4DVBA 1NGQL 3O0LA 1U91A 1RMFH 1E7UA 2K3HA 5C07B 3CQPA 4HWZA 1IM3B 5EBMA 1X7TA 4YX2H 5A1AA 3VFUA 5I8OH 4PUBL 3BVUA 1XT5A 5J8OA 5EN3A 1QUPA 2I85A 4WTZA 3T6WA 2VDLB 3MGOA 3RJDA 2VLJA 2MOQA 2FATL 2E8YA 3ARPA 1ZHNB 1L3WA 3KPPB 3PGCB 4NFBA 3TVMA 3BHBA 1JF6A 1BQ5A 4AJWA 1MJJA 4F33A 1CT8B 2YAMA 3FTXA 4JUTA 5KYWB 3S5LA 5BRZD 4EOWH 2HSIA 2CCLA 3VFWA 1M3IA 4N2LA 3RVUD 5EOTB 4JHAH 3BSHA 2WCGA 3L6FA 5IHBA 4CSZA 1AHKA 4Z5RA 2WP3T 3QO1A 1ZOXA 1KIPB 2OYPA 2D3LA 4JE4B 5CUSL 4PJEB 2YPKB 4IU3A 1IO4C 2I9TA 3DX6A 4MCMA 1MG3C 4XWGH 1IFRA 2Z31D 1LEGB 4QAMB 5AVRB 5B38A 3VI4B 4KXDA 1L3NA 3Q6GH 3HFMH 1M4KA 4ZFOB 3HG5A 1FFPA 4OBRA 1S9VB 1OAXL 1ZXKA 3KYMB 2GJ6B 4JR9L 4KVNH 4DFHA 4NUQA 4NT6A 1D5XB 4N0YL 4H40A 2NXYD 2WBXA 1X7QA 2QADD 3QPXL 4XMLH 2Y7NA 5AOIA 2IPTH 3VGHA 1NUFA 2ZNWA 3ETBF 4JPWH 4LARL 4QOKA 3V7AE 3KPPA 1BFSA 3RLSA 4XBMA 3WFBL 3IK2A 2R1YA 1U92A 3SE3C 4APXB 2C9PA 3S37L 4RGMC 3LHPL 3VGBA 2EJ1A 4DEWA 1A66A 2ZX8A 1NCDL 1E8ZA 4WHTA 2JIXB 1JPGA 1SOQA 1F2XK 5F9AC 1QBBA 2VRQA 4FQ2H 5IHWA 3AT8A 2VQTA 3QUZD 3SPHA 4P46C 3ZE1F 4ICWA 3PNRB 2P45B 4YSDA 4EKXA 4Y16B 5I2IB 3K2UL 3EYVA 3AZUA 3ZKMC 3S4SG 4A04A 1GZHA 4FQHB 3FO1A 3DV4A 5HDQH 1AR1D 1MCKA 2AQSA 2NY5C 4K07A 4B9PA 3RWDA 3OXRB 2AJUH 3N91A 4LSPL 3RAJH 5IMMB 5IROA 5KUMA 1IKFL 1AGEA 5CHNB 3HB3C 4XMVA 3RB7A 3VB8A 2DOCA 4Q0XL 1KPRA 5ICXB 4TS6A 2A6KA 4GRWB 5DJYA 3VWJA 5J1AA 1NUNB 5E70A 3O4OB 3X2QB 2JQZA 4UU9B 2VM4A 1YNTB 2UXVA 1QHPA 3QZNA 3QQ9C 5AW8B 1ZLUK 4KOBA 3UDWC 2FVNA 2E7HA 3TO4A 1R6VA 3FO0L 3VQLA 2ICCA 2V5TA 4QHNB 1WT5A 2A9AA 5L2JB 4BFRA 5DD3L 4Z3EA 3ZHFA 5JUEH 1YYCA 1N0XL 3KHQA 4C83A 2I07B 3CZJA 4OZGB 4PTTB 2DH3A 4L4JA 2ARWA 1UVQB 4HZ1A 3GHBL 5CEZH 4OQTH 3BQUA 1OAYL 2ZCHL 2J1ZA 1Z1WA 2FSDA 4NQVA 1JN6B 1YAZA 4P5MB 2DQIH 1HI6A 4NN7B 4KUZL 1PX8A 1FHNA 2M26A 3I50H 2YOCA 3KXFD 3O2WH 4FA6A 3U36A 4MASA 1CXKA 1OARH 4DKEL 4PJFE 1OALA 4NXSA 1M6OA 4UOW1 2GTWB 5JIPA 5JZ7D 3WMSA 3TCXA 1KWKA 2NNAA 3ZX1A 3FDWA 1ED3B 1F6LL 2DMCA 2IC2A 3MBWA 1CD1A 3GD1C 1VACB 1MRCH 3JWNE 3LZNA 1VIWA 2K70A 1LXMA 5INDA 2XJKA 3SDXE 3D8MA 1RP8A 4MVBC 4N2FA 4PRBA 4LRIA 2XWRA 4J4PD 4Y19B 4CGTA 3D9AL 5SWZE 1FF5A 1FL6A 1RIUL 4QHNA 1LO3H 3CFJB 2AS5M 5EU6B 2X4NA 3MQIA 2OQJB 1ILSA 3QDJB 4PGBA 4LQ1A 1OSPH 5IOPA 2WJ7A 2FJUB 1UA6L 3PIQA 3PDGA 1KN4L 1WCBB 3H4HA 5EIQA 2W92A 4FNTA 3EBHA 2HRPL 2DRUA 2H1LM 3NDZE 5AW0B 5CR8A 4OGQC 2BIOA 4XAKD 5IW6B 1TQWA 1PAMA 2VDKB 2BSED 1BXUA 4G59C 2AEWA 1I3GH 1NFAA 1AO7E 1S7SA 3OWRA 2CGRH 2Y4SA 3VH8A 3KPQB 5M7QA 2CQVA 5DA4A 3H2PA 5JDJA 5HYSA 4JM2C 4Y4KB 4XMZA 1AQDB 1KCVL 1BPLB 1K3ZA 1SNRA 3K6OA 3QZLA 4HJJL 4IOFC 3OLIA 1ASOA 1BG9A 3G5ZA 1ECZA 2GTZB 1J9RA 3NSDA 3VFRA 1A9EB 1X6NA 1MFAL 1KPVA 3WFHB 3SODB 4ZPVB 2B3RA 4X4ME 4K8RC 4PP2A 3FB7A 3HR5A 2C9VA 4J12A 5EOTA 4NWTH 4NWTL 3RTQD 4JM0A 3VNYA 1MAJA 5JW4M 3O6FA 4KK9D 3FQWB 1KV7A 4U7KA 3ZKMD 5B8CB 1HK6A 1NDGA 4FA7B 4IU3B 1YQ2A 4XNZC 4G6FB 3FH5A 4QRRA 5TE6L 4EDXB 5J56B 4QCIB 3B8YA 1HYRC 5EU3B 4JFEE 1MLBA 4H1LA 2F5AL 3FTZA 3LQAL 4QJ4B 2W9EL 5GS2H 2EXWC 4ZXBB 3H42H 1NCCL 3KYMA 3E1ZA 1G5AA 1YEHH 5IVZB 4OCSL 2ZKYA 4W9LC 3WJJA 2G75B 4NT6B 5HHPB 1Z6JT 4MNGE 5CP3A 2B9BA 4LLUB 5AOMA 5C0NC 2BFVL 3BVNB 3KPRE 4HWNA 5CCJA 4JX0A 2Y6TE 1GC1C 2K7QA 2XWTA 5FB8A 2A6DA 3CHXA 4HIXH 2O61B 2PW1A 4LO9A 3K6NA 4N8VG 5DQ9A 1KIPA 1IU1A 3T77A 5LKNA 2I9TB 4KI5E 2P8MB 4AIOA 1DP0A 5IHHA 2CDGA 1I31A 4JJ5B 3VFNB 4CSTA 3H2QA 1QA9B 2LTQC 5JHMA 1K3IA 4J4PC 1Q0XL 4WY7H 2ZOOA 3O3EA 3VDBA 4GG6F 3QQ3B 2GUYA 4XVSL 5DSCB 1SEBA 3K6DA 3SDDD 4KKAD 5I1EL 1WF5A 1AGDB 1ZA3B 2D7OA 1C12A 2VLKE 4LDCA 4J6IA 2KL6A 4FG4A 4XNUH 1JD9A 5E56A 3ZVVA 1TTUA 5BO1L 2BNRB 4L29B 3EHBB 3HG4A 4AT6A 3RHWK 5EMYA 4JB9L 3VX0A 1DJHA 3ET9F 4HAKA 3F05A 4FQQA 1E7VA 5JQIB 5D1XA 3BVVA 2VUOA 1MRFH 4G8FA 1L9MA 4YHPB 1TT6A 4AYDC 5TE7H 2OZ4A 3V0GA 4Q6IC 2PNDA 5TQ0H 4H2AA 2DEYX 5HHOE 1MFBH 3CCHB 4O2FA 5IFAH 4OM0H 3UXFA 3W56A 3VMPA 5HVHC 5LGJB 4R97C 5DJCA 3DSNB 4WHCA 4DGUA 4F7KA 2B08A 2EE9A 3LN4A 1A7RL 1Z9LA 3LX9A 4FA8A 3RGVC 4FI7A 1QPXA 1SJVA 2VL5B 5T1KB 1EAQA 2H0FA 2DQGL 2VLRE 3PHQA 3R0MA 5GZOC 1IX2A 2B0SH 3OKNB 4S2SA 2WTRA 2Y36L 2GJRA 2A83A 3T4AB 2ERJC 2XPZA 4FTVA 4HK3J 3V5KA 4KQ3L 3X11B 2HXAA 4MDJB 1KIRB 3FAWA 1ORQA 1E0OB 1KC5L 2X05A 4TVSa 3QEGL 2UY6A 4MMXC 2VIRA 4PS4H 4RFNB 1H6EA 4OFYA 4B5EA 4M6AA 4L8BA 5DC0A 2W0PA 2WNKA 2OA9A 1KTDA 3OKMA 4ILDA 2BP8A 2MPAH 4HWEL 3GJEA 3UG3A 4I4WA 4WEMB 4KTGA 4LPVA 4NKQB 1ZV2A 1DQLH 2PYEA 1ZHKA 2G3NA 4HKJB 2DB8A 4HJTA 4R4ND 4M3HA 2RHEA 2P8PB 2RIKA 4JRLA 5CJQH 4Q6IB 1T0NA 3REVB 4D9RE 1N7ML 4ELKA 4K5LA 3GK8H 4GBXC 3NJMA 5JOPE 3E9UA 4C56E 1NCOA 3KD4A 3CVHA 4JPVL 1SYVA 1G5GA 4GB9A 2VZSA 2X9YA 3HG1B 2XN1A 5LBVA 1J8KA 1PZ5B 1HXMB 3QJFB 4G72B 4W9HC 3CSBA 5AAWA 1A8ZA 2Y69B 4LCIL 2CBPA 4PJDB 4NCC2 5SWSB 2KQMA 3OGOE 4QXUL 5IFHL 1AXTL 2XQYA 2Z91B 3DOHA 2XHNA 3DIDA 5ABDE 3GB7B 3HI5L 1JZ3A 5KYYA 1SQ2N 4XNMB 4G9DB 3V4PH 1BZOA 3H7LA 1PLAA 1CD9B 1I3RB 3DECA 2C7UA 3FSVA 4N2IA 3STLB 1DTUA 4G82A 4OI8A 4NOFA 5HHOB 2WLLA 1KJMB 4R7DA 5FK9A 1CMOA 5FWRA 3IMUA 4M6OL 3D0VB 2QQLH 3LAFA 4LF3A 4PFEA 3WXVL 4AJ0A 5B8CA 3ES6B 2Y7QB 5T1MB 5A2LH 1D5MB 2JMRA 4JG1L 5EU5A 4LBAA 3UYOD 4JFYA 3RWEA 1T80A 3LJ3A 5KJ4A 2JNZA 2EVGA 5KBNC 4HS6A 1BZEA 5KYXA 1HQ4B 3FUMA 3Q2VA 3LVEA 4BSVB 3TJEH 4ZUWB 2XVBA 4HS8H 1A9EA 4UMGA 1LK2A 4EN2A 1ZA6B 1N59B 3KEHA 5D4QA 4YE4H 4TTDD 4N0UA 3E2HB 3N43F 4Y1TA 4HU8A 3P2BA 2DI8A 1YEDB 3QJSB 1BWMA 2J5WA 4L2YA 5JR1H 4KJYB 1PZCA 1SJMA 4X4ZA 3EW3B 3QDHA 5IFAL 4N22A 2ESVB 1YRKA 5CGTA 1CIUA 4PJCE 5DFVC 2FR4B 4BHUI 1A6UH 2E86A 5H4YA 2R1WB 3DRTB 3F58L 4GBXB 4A39A 2YGVA 3QCUL 4PJFA 5J3HD 4Z18A 4WW1B 4WUUA 3FB8A 5B4MD 1NDTA 5FV2A 4YO0A 5ID1A 2HJLA 1WTLA 3MDJA 2VDPB 5I1IL 3PAYA 5T1LD 4C4KT 3QUKA 4XOAA 1D7BA 4NWUH 2P48B 4A2GA 3N1GC 3VGAC 8FABB 3DXAE 2LOEA 2BNRE 3PYCA 4H8PA 1RK1B 1IM9A 5GSRA 2VITB 1NCCH 4PVLA 1FJ1B 1OTUD 4LASL 3VRLF 4D0BA 3QHFH 2CHZA 3X1GA 1DBBH 4GUPA 3RDJA 1KTBA 3QXDA 3CPUA 1W8EA 4WI5A 1T1YB 2F1EA 4IBYA 2EUVA 3HZ3A 4HPYH 4WI9A 3Q8EA 5FGCB 5JIIA 4HLJA 1J8HA 4OCXL 5F7HA 5J13C 5L6YL 3GSRB 5CBAA 2WXRA 4P9HH 1HIML 5FYKL 2WP3O 3ZN6A 1S7XB 4KVCH 1SXSA 3CH8A 5D7IE 1HSAB 3LQAH 4MB3A 1GC1L 4HJJH 3J7HA 2IAMA 2ZUYA 1O6SA 3PDOA 1ZJBA 3TA3C 1LK3L 3SE8L 1C5CL 1IB5A 1WO2A 3KPRD 2XNAA 2FNBA 3PWVB 1L9QA 4XC3H 2IPKA 1J9QA 4K5OA 4JFXB 4KROC 3VI3B 5I6LA 4UU9A 1FDLL 3KG5A 3OKLB 5DJZB 3ME0A 4KROD 1ZAGA 4ENEC 5IP4A 3EO9H 3L3GB 1NGZA 3SOBL 3GLDA 3S8GB 1DO6A 5GHWL 3NIFB 2VKWA 1J0YA 4BINA 4RX4A 4U3CA 1RJCA 3QFJA 4JZOB 5E8DH 4HUVB 3HMXH 4F9LA 2FGWL 4GOSA 4NCC1 1CTMA 5IB2B 3RGHA 3OKMB 1PD0A 1XGRA 3QE5A 4PJBF 1Z9OA 4HETA 3U4EB 4AIZA 3US9A 1FIEA 3LN9A 1GGBL 1I7RA 3DTUB 3L4VA 4BKSC 3TH4T 2C9RA 1FZJA 2NY6B 4LSPH 5DEZA 3RAJL 4AI7A 3PY9A 1C1EL 5L2KD 3QHZL 4UINH 4GRWE 1T1WB 2Q8AL 3U1QA 5D7IA 2VXQH 4YXHL 4LLQA 3LRKA 3LNFA 3AB0B 1H6TA 3QNYB 3HN5A 4Y2OB 2Y2WA 2OMYA 2B14A 5J11C 1CXEA 1JHLH 1NLBH 4WJKB 2WQRA 4WCYL 1UEYA 5K1NA 5D8JL 3Q1SH 1AD0B 5FUOL 4G80B 1HCYA 5HHOD 2ZP0T 2ITDA 4QHKI 1TMCB 1KCBA 4FC3E 4MAYA 1I4FB 1W72A 2X2IA 5AZ2L 2PYEB 4HCRL 3MRIB 3MLTB 4JZOA 4HUVA 3QUML 4MXQD 3EO1B 4P48A 4FL4C 4POYA 4F7TA 5L8JB 3HMWH 4B9JA 5D2NB 2K6ZA 2X1XR 2J88H 5HYQA 1YAIA 2ZX9A 5IQMA 3DVGA 2XC8A 4F58L 1PG7H 1L6ZA 1TTRA 2EDYA 3E1F1 2H32H 3LN5B 4NZUH 3ZTEA 4KKCC 4UM9A 2EUWA 2JXMB 2CO7B 2KS0A 1GW6A 3V6ZB 1D5RA 5J5EA 1WA0X 3GEWB 4DZBA 1KTKE 5D7IB 3ZE2F 5JTWA 4FQJL 5D55A 3MV8B 1U8HA 3A23A 4X9GA 2JCCF 1WJ3A 3V52H 1NAMA 3P73A 1TFPA 3GSQA 4P2YA 2WIIA 2DQCH 1VFUA 2P5WD 2UUDH 3M46A 1L5GA 3NA4A 5ILTL 1JV5A 1NCBL 4JPKH 2UXGA 5T3XL 3QDMD 1BMWA 4L18A 1FNEB 3ZSTA 4AQEB 2IXQB 3KBPA 4GBXD 3MLTA 4Y2DC 5IIEA 3ORJA 1GMEA 4XB3A 2J4WL 5DHEA 3RPIB 3WFHA 2EADA 3TA3A 5B1JA 4LSSL 4D0DA 4IOFD 2WOYA 2YQ3A 4AEHL 4DGWC 4KHXL 1QI4A 5GISL 3D30A 4Y4FC 3UPCA 3GMPA 1UWXH 3O6FB 3T09A 3GRWL 5F9DC 3ZR5A 4C57C 4DVBB 2X6MA 3CSGA 1UD5A 1WV7T 2EIEA 3AQYA 1CC3A 3HHMA 1MVYA 5FO8A 3SJVD 4G6MH 1TG8A 4GG6E 2UWEF 3RDTD 3MBEC 1I1RA 4ZUTB 3SDCA 4AMKH 1IUZA 3B2XA 4UI2A 5LLIC 4FTVE 2V8LA 4IYKA 3T3PF 1AXSA 1FRGH 3MRCB 3NH7L 1KJVA 3TF4A 2XKNB 4N8CH 3QK0A 1AFVL 5AVXB 3RNKA 2G75A 2F08A 4GKSB 2Q8AH 4I1NB 3JQOB 1DN0A 1QRNB 2ADJA 1FL6B 2Q6WA 5I71B 2IIJA 3BX7C 3VXPB 3ETBJ 2BNQA 4KRLB 3I9GL 3SOBH 1JYVA 1AMYA 2EIJB 3HC3L 3CVHH 2EYTA 5C0BA 1WZKA 1PJWA 3S5ZA 2MCPH 4PJFB 4ZFFB 4DQOH 2LLLA 1IGML 1OAZH 2QLYA 2Q3ZA 4XP6L 1JZIA 3BQUB 3DURA 5HD8D 4Q6KA 3FT3B 3FB7B 1RZQA 2CKBA 3WV0A 2R69A 4RGNE 1AIZA 1KBBA 2NX5B 3GSNH 4P06A 2NQDA 1A1MA 4OB5L 3S2CA 2IH9A 2Y6SC 4OZFH 2IBZY 1QLEL 3MODL 1U6AL 2AEPH 1DQDH 3IRPX 2AERT 4KHTL 5HGAB 2ZWYA 2ZUSA 4IGBA 1Z9NA 1MLBB 1TJMA 3RUGA 3ZE0E 2AQPA 1LO2H 5BVJA 1FV1A 1FG9C 1BW8A 5D1QE 3SE4C 5CZRA 4AL8L 3CVBA 1PZBA 1N67A 5FHAL 3AGWA 4DP6X 4D0CB 1V7NL 1NGYB 3MNMA 4LU5L 1JPFB 1G1CA 1JK9A 2ZOWA 1E6OL 3ZHNA 1CGVA 4DEUA 3IETA 3QQ4A 5GRUH 4LLWB 4QRAA 1E5UI 2QHLA 4MWFB 2WZ5A 3DGDA 4U1IB 3AB0C 1P53A 4DGYH 2OQJA 4I0PD 4KMTH 1KXTA 3IDGB 3O41B 4EZJA 1MIEL 2XXGA 3NFPA 4AGLA 4AQ8A 2E7MA 1KGCD 2GSIA 4ODUB 1JCKA 5GS3A 2X9WA 3OMZA 5JXAL 5AW5B 5DWPA 2ATPB 1U8MA 4GFTB 4OD3L 3UJTH 1JS4A 3D09A 5E00A 1ZDQA 2QLVB 2YMOA 5LNEA 2R23B 1VACA 4FQ1L 2F74B 3VWJB 3DV6B 2WUBH 3OKOB 5I5MA 1JNNL 2PYED 4JL1A 4LVHC 2CGZA 2D7MA 3OJ2C 2XN0A 4CBZA 1MWAL 1J8RA 2FJFB 1F4XH 1EH9A 3AU0A 1CG9A 4XBEH 4N0UE 1B9ZA 3ZIYA 2YHGA 3P9WB 3BP7B 2N7SA 3WJLC 1UOWA 2NXZC 4ELMF 4HQQH 3AC0A 2XN2A 3I75A 5TGBA 2J1KA 2OAAA 1I9RH 4C83B 3KW8A 5BS0B 1Z7JA 5F88A 5GPRA 5DQJA 1JWSA 4LSVH 3WN5A 5ALBL 4FCAA 1BVZA 4TUKL 2FHBA 3ZDZF 2DBLH 2WLIB 1NCNA 5EC2A 3DDGA 1X5JA 4IEFB 2WUCL 4Z3HA 1UM4H 2UZYB 5DRNB 3HNSH 5F6HJ 1G7JA 2XVKA 2VH5H 3MI6A 4HKXB 5TDPB 4B9ZA 4EQ3A 2CD0A 1RJLB 3WNNA 4BZ2A 4JDEA 3QWNA 4RGNB 5IJVB 1EEUA 1HVXA 1RJYB 1T22A 3IDXL 3ZE0F 1I53A 5AOJA 1YY9C 1RUAH 1IBHA 1T66D 5I1HL 3APDA 3NABL 3QUXA 2D7QA 3VXNB 5C9JA 5HDBB 5L7XL 4MMXA 2B8OT 3E38A 1O6VA 1RVFH 4K23H 1RV6X 1WZLA 2WYZA 5C0EA 1JGLL 2XVLA 2ZTBA 4F7CB 3NPSB 4HKZB 1B4JH 2DDQH 3EOAB 3MRPB 1EXUA 3ARVA 1CWVA 4UM9B 2P5PA 2GABA 3RDTB 4FRWA 3V6ZA 1OXYA 1T83A 3QFDB 3CFBB 1WS8A 3RTQC 5E24E 4I85A 1SLUA 1B0IA 3L3OA 4Y4HB 1XSKA 5I75C 1MPAH 3AMLA 3HRZC 4CDHA 4E9QA 3A4EA 1ZHKB 5I1LA 1FCGA 2IH3A 4WJ5B 4FKKA 2E4TA 4LCUB 3BZ4B 1WWWX 2NT1A 4KRNA 1MG2C 5CR1A 3QAZC 4RMUA 5K39B 4K7PL 1MVUA 3KL3A 3REVA 3P4NB 2P5EE 5KN5A 2EDWA 3LKRA 1NCAL 3D48R 4G5AA 1E6JH 2ZUWA 2IBBA 4UZUA 1WA1X 1JV2A 2HZHA 2ZOTA 3IM1A 3PABB 3QNXB 2VLLB 3EJTA 4KXAA 4XCFL 5DVLA 5G4OA 3OBAA 4XHQA 1FFRA 4JQXA 2E7LA 2VQ1A 5DCCA 5JPNA 1UKQA 3HC0B 5KJ7E 3EOTH 1DANU 3CH1A 2XICA 3LD8B 2MMXA 3OJMB 2OMXB 4FMVA 5L8LB 1GKOA 1C5BH 1M57B 1HSBB 4ZMAT 2DQHL 3QFDA 3MMEA 1YMMB 3TJHD 2YA2A 3K4DA 2PO6A 2BSSB 4A2LA 2LU4A 3OKKB 3ABMB 2LFGA 2NMSA 4MAYD 1KSRA 4PBVC 1G9EA 3B1TA 1P84J 4AZUA 9CGTA 2OMTB 1QFHA 4P23D 1NC2D 2WGNB 1A7RH 1KBPA 3V5DB 5K39A 3BKCL 2O4EA 1GPOH 3QIWB 2J7LA 3TEYA 1ZHNA 2WUBL 3PGCA 3KYNB 2K4WA 4LLYB 1SXNA 4FQLH 4X80L 4ZK8A 4GW4A 5D5MF 1ORQB 2WHVA 4AQ1B 1Z66A 3MU3A 4MD4A 5EUKA 3VX1A 3FQUA 3B2PA 3QUHA 2FZ3A 1TETH 2AP2A 1GW0A 3BDBA 2BP3A 3H9SA 4S1RH 3UEZA 3LKNA 4Y2DD 1QA9A 3NP3A 2VR7A 1AR1C 1F3DH 4UQAA 1H3VA 4XE5B 5D1ZC 8CGTA 3EF4A 3GLZA 4K71B 3GSRA 3SJVE 1E9PB 4LHUA 4LIQL 5BRZB 1R17A 1SVBA 3C5JA 1KXTB 3IDGA 1WA2X 1N8ZB 4LEXH 4NGHH 3VXRD 1FSKC 5C08D 3OKEB 5MI0B 4PM1A 3P30H 4RX4D 4UT9H 2C3HA 2BHYA 4P5TC 1F4HA 5GRVL 2NQCA 5FF6B 1BZ9B 2OXGB 1XO8A 4JANA 2XX1A 1ORSA 2YUZA 3CAFA 3ULUH 3D4CA 4EUPH 2VDKH 3QZMA 3QEUB 1U6AH 2AHIA 2VXTL 3LKOB 1VADB 1KFAL 1QYGL 1T66C 1LQSR 4I48B 5I5RA 4NRZA 2AGJL 4A7GA 4F80A 5FGCE 1RK1A 1MH5A 2CUAA 4YBQC 4JM4L 4JQIA 4WHDA 4YC2C 3I84A 2EDHA 1ZLDA 1OAZL 1BWWA 1NC4B 1KF9B 1S7UA 5E5MA 3SDCD 4PJBE 1BJ1J 4G9FD 5EORH 5C0ND 4HJ0C 4DQAA 2EYSA 3UCQA 3NCEB 2R1WA 3O6KH 1BVKA 3EJPA 1ZIBA 3QXVA 2BMKB 2ORBL 2VR4A 4M62L 2DLEA 2G5BA 3K74B 5IG7A 4XXCA 5FPIA 3VUAA 4V1DE 5DRNA 3TN0D 4JQIL 3THMH 1WBXB 1UWFA 5CJXC 1KULA 2KLRA 3BH4A 3KPNB 3GKWL 3IJEA 3O11B 3BP7A 3O9WD 3QORC 3IU3A 1ADQH 3UGXA 2VLRA 3LIZA 1OP4A 3QS3A 2IDFA 1GZQB 4JZJC 5DS8A 3T3MF 5T3XD 3PFQA 3GLAA 3EJYC 3CFDA 1I1YB 1OM3H 1PEZA 3LNIA 4UUJA 5F44A 2VISA 2YEZA 2ESVE 2X1QA 5DEJA 3WKML 1LK2B 4D2NA 1VEOA 1MH5B 1NMAL 4GG8B 5C71A 3BP4A 1HINL 1VFBB 2UX7A 3E6FA 4PV9B 1P69B 1A6VL 4LF3B 4PJXB 4RISL 3CFIC 4YUEH 3FH8A 3U0TB 4BWWA 4R7XA 3MCKB 3PNWB 4HKBA 1DQDL 1KJ3H 3PQYE 3HC4H 4KJYA 5C7XH 3DTXB 1ZLVH 2BVOA 4JFYB 4AG4H 2FL5A 4FFYA 3R18A 5TE7L 1ZT1A 5MERA 4HZLA 1E2WA 2DYPD 2FX8L 3T2NL 1M6OB 1XH3A 1IFGA 2GTWA 1DSWA 3DSFL 1CLOL 2DYSB 3BQUC 4FQPA 4L9LA 5KYUB 4NCDA 3DOSB 3N0PB 1PZUB 3MO1A 3L3HA 4RGNC 3RPBA 2JJUA 4CJ1A 3FB8B 1MWAH 3U0PA 1KEGH 2OMNA 1N59A 1A6WL 4H4NA 1I3GL 2ZSVB 1RZGB 4PWIA 4IRSA 4A2FA 2FX7L 1OTSC 1WIUA 3RVWC 3VU2A 3M86A 1M2OA 4Y2LA 4KXCA 4KPHH 2CBTA 1F1AA 1CFNB 3IRZA 3VD3A 1G4MA 4WFFE 3KPMB 4UANA 3NOIA 1NJ9B 4N24A 5D1XE 2ADFH 1URIA 4MJ5B 3CDZB 4YSEA 1FNEA 1J5HA 1A7PH 4L4TE 4MVBD 1CU4L 1WAAE 1YUKB 1KJMA 2NXZB 4P23B 4EI6A 5D2LE 1BQLH 3DPBB 5L0QC 3B37A 1MXGA 3QIWD 3GLEA 3GXNA 3ZRSA 3STBA 3HCVA 4Z6AT 1J18A 4XO9A 1VJSA 4R83A 2G60L 3EJCA 5CEXB 2J5LB 3OKKA 3GSWA 2X9XA 4PQXA 4YBHA 1SMAA 5B4MC 1OAQH 1XF5A 3WSQH 2J1XA 3O3DA 1MREL 1SXZA 3QZBA 4AWJC 2AK4A 3MROB 4NP4H 4G80A 2WZPA 3SE3A 4WWPA 1LO0H 3SPVB 3TIDA 1PQZA 2BSRA 2ZKMX 4IMLA 3EYOB 3RNKB 3QQXA 3GBML 5LWYH 5JUEL 4EUPB 4UINL 2APBA 5D6DA 5JHDA 5I28A 2H4EA 1OGAE 2Z3FA 2QQNL 2KZBA 2XA3A 4X5XA 3EJZD 3MRRA 2YR3A 3KR3H 4XPHL 3EH2A 3KWXA 5JHLL 4U1HA 4F7PA 3T8XA 4H8QA 5F2FA 4RAUA 1A8JH 2D7NA 1MRDL 3KNBB 1UFGA 1G43A 2NY7H 2Z35B 1WAAA 4RAVA 1KY6A 1UACL 3IF1B 1T83C 4JRFA 3S6CA 4N4YB 5HYEA 3OHMB 4HJ0D 3CFKA 4YSPA 3PJLA 2WBJB 3F64A 1MW2A 2WSDA 2VDLH 2K8MA 2VDML 4GT0A 4YSRA 5DJXA 5E7FA 3RTQB 2KYIA 2DQTL 5ITFA 3OTTA 4E41E 2D7PA 5CMAB 4MD4B 5D7EA 1CUOA 3KPOB 2IH8A 4N5ED 4NI3A 5B1CA 3V4PL 5BQ7A 4JKPL 3T2OA 4OB5H 3GJFK 4Y5XC 3QORD 1S9YB 3FQRA 3G9AB 4G42B 4TF4A 4OFPA 4B0MB 4DKFL 5AVZB 2J55A 2NPLX 1KXVA 3OB0H 1IBZA 3RPIA 4U49A 5FUOH 3Q1SL 2F8IA 1GIGL 1U8PB 1IGMH 4DGVH 1U95A 3L7EB 2XRAH 4YVNA 5EIIG 3D69A 4S0TD 3VQ1C 2VSKB 4WTWA 2Y72A 1E9OA 1ND0A 5DSCA 1JZEA 3T3ME 4JR9H 4KVNL 3EFOB 4CMHB 1WSST 1CD0A 1BGXH 1U8JB 3JTSA 5FKPA 4DSYA 3R7QA 2VXQA 3V4UL 4LARH 4FZ8L 3MUUA 5D7JA 5JMOC 1NMCC 1LILA 2IPKB 2ENYA 4JM2B 3MLUL 4Y4KC 3B7RL 4H7VA 4JO2H 3WU1A 2QVMA 4BXVA 1NGPL 2VMDA 1UOLA 3OKLA 3KPOA 2P8LA 2VRAA 2X4PB 3O6FC 3RGVD 2ILLA 4QOKB 4KBPA 1GHFH 3OAUL 5L4IA 3V6FB 1UB5B 4P5TB 4MJ2A 3QHTC 5FO2A 1TU2B 3E3QE 1EUTA 1WC7A 3BZDA 1JI1A 2AAAA 5HJBA 3IDNA 5E1AA 4U2ZA 1XGRB 2DWDA 5DS2A 4X8XA 2V17L 5C6PB 3X1BA 1CFTA 4GEIA 4HUMB 3D69B 1MJ8L 1XSIA 1R3KB 5I1DA 1MY5A 3X13A 1MEXH 4ZX5A 1A6AA 1RY7B 1RAMA 2VDOL 1H3TA 2BVPB 3V0WH 3C5ZB 3L7FA 2JKXA 5JW5B 4CILA 3GIZH 4ODWA 3SKNA 4WTXA 1GJIA 2Q1EA 2E9BA 3S96B 3IBOA 1R0AL 4N6RA 3RP1A 1M7IA 1CL7I 1KYDA 2C3WA 1DQQA 4P9HL 2X42A 1FZMA 3G5WA 5E2VL 4QIRA 5DUPH 4ADIA 3PV6A 5BZDA 4IBVA 3U0PB 3ROOA 2ADIA 3Q2LA 1E4HA 2ZT9C 4PBDA 1Q9KA 1A6TA 5I8KL 3LS5L 3L3IB 1E3ZA 1UD3A 3UAEA 1QSZA 3B5GA 4WW2B 2HMID 3NPZB 4MQTB 4XPFL 4P59H 2PLTA 1OV8A 3SKUD 4LRIC 2BPBA 3FN3A 4HALA 5J1TC 4QT5B 4JRYA 4OLWH 1I1AC 2GK0A 5LBGA 1PLBA 4ZOCA 2OLDA 2VH5L 1MHHA 4FP8H 5F1NA 5T3ZD 5I0ZA 5IR1B 4JPIA 3FPXA 5E8DL 3RWFB 4EIGB 3T6XA 1NOAA 3ENEA 1EXGA 1VCAA 4NJ9H 3W0WA 2O6PA 2YKLH 3LKSB 3QDME 1URZA 4BWTA 3LQZA 2XI9A 5FLVA 1QBAA 2CKBL 2E9JA 4AEIH 4F9PC 2CO2A 2YD1A 4ZFZA 3HUJB 4ODTL 2OM5A 1ZKAA 2ED9A 1GS7A 4L4VE 3B2DC 4PWJA 3OZKA 1KB9J 1OIOA 1I7TA 4IOIB 2PO6D 3DX8B 5HGHA 2VN4A 3PWLB 5K9OB 1Y6NR 4PJHB 3B4NA 2CPCA 4H5SB 4WIQA 2EYTB 4F8NA 3QZWG 1FV1B 4FNLH 3QI9B 4YE4L 5C9JB 4HEPA 3HFFA 4HIHB 5IW1B 3B9KB 5E5RB 2WXHA 4PPTA 1T5KA 2N01B 4U6XA 1U9KA 3LPFA 3ARGD 4BZYA 4YLQT 1AVAA 4FL4B 3CMOH 3UZQB 2NSMA 1KZYA 3TO4C 5K9QI 4KY1L 4ZSOE 5AW9B 3O9WA 4PRAA 2NX5A 5SWSD 3ARDA 2XTLA 1UJ3C 3ILPA 5LBSA 1MAML 1J86A 3WEXB 5IB3A 1DLFH 2E6QA 5EIIB 1K85A 1DHKA 1HXYA 2VERN 1QSEE 3TBBA 3L3DA 3F65A 3EZJB 4MS6A 5LHDA 2P5EB 4Y2DA 3WL9B 1PS3A 2IQ9L 1CLCA 5IROC 3MCG1 3WS6A 2A5UA 1JZJA 5T5NG 3FAXA 3SQRA 3VXMD 4W9GC 3NA9H 3UAAA 4GQ9L 3VD1A 3AJ7A 3DWTA 4NWUL 1RURL 4A66A 3BKYH 4BWUA 4FULA 1MFAH 4F92B 5BS0E 1L9OA 3D85D 3FU7B 4H8WL 5C0RH 4QRUB 2NY2B 1QNZH 1HT6A 2XTJE 4IRJD 4NM8H 3UBXA 1QLEB 1BQSA 3IFNL 4UQCA 4ALAH 1CDBA 2H2SD 3MGTA 4NIYE 4RFOL 3O41A 4JO3L 4XMWA 3ESNA 3OX8B 4N20A 2EUXA 3BFQG 4PEEA 5E03A 5DFAA 4NOBA 5F7KC 3S3SA 4NEHB 4P07A 3KE0A 5SV3A 4ZMXA 3VFOA 2N3JA 3RX5A 4JM2D 1KTRL 1KNOA 5C0BE 2HVJB 3ALWA 2XJLA 3EYVB 3IMBA 3HPLB 4WW1A 3GI9L 1OZUA 1UYWL 1MCBA 3FUNA 3RIFF 1NKOA 3WNJA 3IJSA 4X98B 1HHKA 5F9WB 5GGVL 2LU7A 4QLRA 4P5TD 3MCLL 2B3IA 1J1OH 3UJJL 4N6QA 5GGSY 4FXGC 4M1GH 1OANA 4AKQA 1CFMA 4TULH 2IADA 4D3CL 5J1AB 5FECB 4CN4A 4TPRH 4EI0A 1OGAD 3ALXA 2Q7YA 4XN1A 3TNNB 1YNTA 3NCCB 4ZUSB 3B9KC 3QIWA 4QF1A 3G6DL 2XZAH 4JKPH 3C8KB 4G8AC 4I0KA 2IH1A 3BJLA 5IJKA 1E28A 2EVJA 1QACA 2PYFB 2VC2B 5KW9L 2HH0H 1BD2E 2H6PA 2KQNA 4NO3A 1K2DA 1ZK5A 2Y6SD 4P5KB 1B4LA 2GVYA 2MWCA 3BOVA 1IC4H 2R0LH 4G6AD 2APTA 2VLRD 5EZJA 5I6XB 3VXQB 4G6ML 1I82A 5IMMA 1NCHA 4WO4C 1UURA 4JREB 5HHXL 1AGCB 2EDKA 4HZAA 2WQSA 4QKXB 4QRFA 5IFHH 5JW5A 1YY9D 2L0DA 3ROLB 4JGMA 4BXSV 1S7VA 3IGFA 2NZ9D 1NWPA 2OP4H 3DBSA 2EECA 3ARUA 4Q9CA 4ZMTA 4ZOEA 4QI3A 5JZ7C 3OMAB 1S7QA 3HE7B 1M7IB 4IIQC 3KBHE 4P4RA 4XB8A 1OGTA 1YZZA 4ZTEA 4BK8A 4OV5B 1LP9E 4UAOB 5GRJL 3RU8L 4AT6B 2YPVH 5LGKA 1KMGA 5HHMB 2YJLA 3LKRB 1CI3M 4NYLB 4ZPTA 3G5VB 2WM0A 4TTGA 3QEQB 3L2NA 2O5XH 3QFJB 2OPCA 1R3JA 5J7CC 3OAUH 3ESPA 1W16A 2F53A 2RA1A 1MCJA 3ATFA 3OL2A 4P05A 4RNRA 4EI5D 5IBLD 1QEXA 3CCHA 3ARXA 4KROB 3UABA 1FC2D 1TNMA 5H8DA 1KLFA 4O4YH 3RPKA 4YHIB 1DQKA 1UADC 2YQGA 2OMXA 3WIHH 3OAZH 3QJUB 4TQEH 2F7RA 4AK2A 3V4UH 1DQQB 3QS2A 3SKJL 3S9DB 1R4XA 3VI3F 4I9WD 5E9DD 1ACXA 2Y7OA 2BRQA 1QSFE 4H8VA 2CM6A 1COBA 5T1KA 3RNQB 5IGXL 3TEZA 1J1PL 5E6IC 5HGGS 4CAGA 2ZXBA 3VJ6B 3TBCA 3W3BA 3DDFA 1TPXB 2OMTA 2VDQB 3HE7A 4FHKA 1DR9A 4HIQA 4L4VB 3U82B 4JMNA 5IEKB 5L2KB 5CFHA 1G7HA 2IANA 2O6CA 2HA1A 3MV11 3U9UA 1K4DA 3NACH 1RU9H 3AS3A 3AQXA 2OZ4L 3U0WL 4AM0B 4LCWD 2IPTL 4BUGA 5BW7A 1YMMA 2GTZA 4Y1AA 4ONHB 2X87A 1OF2B 2P5ED 3CFBA 2J4WH 4GP4B 1HCZA 4LOEA 5KSBE 3KWWB 1YUHA 4NQCA 1LLAA 2A3TA 4RBPH 1DSFH 2X4SB 4BYHA 3EXLA 2GIMA 2E46A 4KK9C 2EIDA 4WEBL 4I18A 2JE8A 4WUUE 3S3PA 5C8JA 1XCTA 2DLFL 3FN0H 4Z76B 2DAVA 2EE0A 3QEGH 2APFA 1F1DA 2YPLA 3BCFA 1QZ1A 3QDGB 1MVUB 2NY4C 1ETJA 5DJ0B 2BWDA 4DEPC 3S98A 5F7UA 4Y0GA 4O02B 3V4VB 1XF5B 2DQDL 2ZUTA 3VQMA 2GT9B 4MNQB 5E8OA 3FB5B 2PMZA 3L3JB 1CGWA 5MENA 3VFRB 2Z31A 1NKGA 1BLIA 5C0GA 5DK3A 3R7RA 1UM6H 5IB4A 3LKPA 3C6LA 4CBPA 5JQ6L 3A6BL 4PRPE 3HW7A 5AFAA 4YPGB 2IFFL 3PP3H 3QWOB 2J72A 1FZKB 2NCMA 5C86A 2CDEB 3LNDA 4R3SB 6PCYA 1SDYA 2OCFD 4GSXA 4I18C 4JDVB 4GS7C 2MRYA 4P2QA 4OJAA 4V11A 1UCBH 2YZ1A 4EEEA 4F8TA 2JB5L 5JORA 1AY1H 3FRPA 2XYBA 3MRDB 3BVDB 2J21A 1KGCE 3SD2A 2ICEA 3PHAA 1QSFB 4O9HH 1IC4L 2R0LL 1P4IL 2WCPA 5EA0H 2DWSA 4L5FE 3LOWA 3AG1B 4OCYL 3UZVB 4LXFA 3T2QA 2PTVA 4OGXL 5KS9B 1WFJA 1HYSC 4DP9X 5CCGE 4PJGE 1ODAA 2PP9A 3LIZL 4BSWB 4U0RC 2NY6C 3IJ7A 4HMDA 2EP6A 4QUOA 1WICA 2J25A 1MRCL 5C09A 4LVOC 4WDIB 4GG8A 5LBSH 4LRNL 4XMUA 5DS1A 2QADB 5JDSB 1JOIA 2VGLM 3KPSA 3F5WA 3HPJA 1U2CA 1IGIH 3GSWB 5KVGH 2H47C 2DN7A 4NNPL 3O2WL 3KLQA 2CR6A 4WUUB 2HG0A 1FC1A 3KWUA 5HPMB 1KGIA 3VD4A 4M1CD 1M05A 2HCZX 4TUOB 1KFGA 3MA7A 5HDOA 1KJ3L 3HKFA 3LEVL 3BQUD 5LJYH 4N8VB 4OJEH 4R2GD 1FIGH 2JKSA 3ARDD 4NM8L 1CYWA 4CVWA 4ZNCD 4D0BB 4KTDH 5IMOB 1JRHH 2GUOA 3WKMH 4DETA 4NKDA 4JFDE 3QA3B 2AEQH 3NDYE 2HRPH 3B2UD 1TU2A 4GKOA 5D7HA