5LN4A

Crystal structure of self-complemented psaa, the major subunit of ph 6 antigen from yersinia pests, in complex with choline
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
133
structure length
133
Chain Sequence
TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFNDKQSTVINSKDVSGEVTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen,pH 6 antigen
publication title Structural basis for Myf and Psa fimbriae-mediated tropism of pathogenic strains of Yersinia for host tissues.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
total genus 24
structure length 133
sequence length 133
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ln4A00
5LN8A 4F8NA 5LN4A 4F8OA 5LNDA 4F8PA 5LO7A 4F8LA
chains in the Genus database with same CATH superfamily
3GPEA 1BZ7B 3KCPA 3FCGA 5L8KB 1CQKA 1PCXA 4U49A 4DOHE 5KSVA 4JLRB 5D2NC 3CZFB 4K7PX 4IGBA 3DBXB 1F5WA 1P4IH 1YJDH 1QFPA 4FL4B 2ED6A 3U30B 3ZDXE 1WGOA 3EO1A 1GKOA 4I18C 4NKDA 3O45B 2OMYA 1AKJB 3SDDD 5EBLA 2OMVA 4ZS6D 3ARVA 1NUDA 4WGVB 5FM4A 1RU9H 4LASH 3QIBB 2C34A 3BP6A 5F6IB 1OPGL 1LVEA 3QR1A 5JHBA 3UTTE 5DJXB 1ILSA 5FDWA 4PB9H 2EIMB 2GBTA 1WZLA 1QSEA 1YEDA 4P3CL 2BO0A 4FA7B 4LCIH 4H20L 3ZR6A 2GCYB 4QLWA 3ULUL 1MCQA 1FZJB 1CU4L 1U3HB 1ZMYA 2TRHA 3UYRH 4JFHE 4N8UA 1BM7A 3TFBA 3WMSA 5HI5C 2V3FA 5HVHC 2DDQH 3RRQA 4WKZA 4HUUA 4H26B 1C16B 4LLUA 3VXNA 2W07B 2DEXX 3TIDB 3ZRCC 3ZKND 3VFNA 3ZYJA 1M05A 2UXTA 3QJSB 3STLB 2MSPA 1L0XA 2Y22A 3WGVB 3MRGB 5D7IB 2ICES 2EE0A 3JYBA 3ZQXA 3U0WH 1Z7JA 5IKCA 1GZPB 2BIIA 4BM7A 4YEEA 3C60B 1UWYA 5IR1B 3N91A 1FUNA 4NS0A 5FYLE 3FN0H 3TEXA 4MB5A 2M1KA 4RAHA 1E5UI 3QULA 4RNRB 4WZ9A 4AIEA 1RZIB 1WD9A 4G7RB 2PCFB 3QDJD 4EUPB 1MW0A 1IBDA 3GIZL 3RWHB 3ARBB 3PS6A 4PYHA 4Y4FD 1KXHA 4HJGB 1XL4A 3E6FB 1LNUA 2YAEA 2YLKA 4RMSA 3F65A 1P1ZA 5ESAB 4JHUA 1AY1H 3PWVA 4XN2A 2WJ5A 1KGWA 4AIZA 1THCA 2XKSA 1FWXA 3SOBH 1KACB 3PYCA 4CRPA 3MLSL 5CGYC 2N7BA 1AGFA 4HHAB 5ID1B 2DEYX 3AM8A 1NLDL 3DRTA 4QAWA 3PGFL 3L2LA 1XGPB 3O4LD 1A9EB 4Y7MA 2WP3O 2XWRA 1CVSC 2JFCA 3C8KA 4KXZH 3BW9A 3RX7A 1K8IB 1BXUA 3O8XA 4KO9A 2EZ0C 4Y5XA 2LFEA 1OT2A 1SRDA 2VQUA 3CSBA 4G7VH 3EDJA 4MCYA 4J2XA 2BFVH 4GBXA 1ZS2A 3FU3A 3FOMB 4AUYA 3T3PB 3TA4D 4YXHH 4OZGB 2VN4A 1ZTXE 2P42B 3DVGA 4BDVB 1LO0L 2IXQB 1KPVA 1U8IB 3O4OC 3Q2NA 1B3IA 4YE4H 2LHAA 5KBKA 1CLOL 4L8SB 1MRFL 2YGQA 3F58L 1T66C 3QNYA 3OR6A 5MEPB 1DQQB 5FUOH 3KBPA 3CXHJ 3IDJB 4PRAA 2B1AL 2AHIA 3L9YA 3W1ZA 4UQDA 4G3YL 1MFUA 4XPGH 4H7VA 5ABZA 2R2EB 5BS0A 5F0LB 3OL2A 5CJOH 3VCLB 2VDLL 4WEBL 4XOEA 3TZVD 1DQDH 2Q8AL 2P4AB 2B2XL 3BFWA 2QL1A 4L2LA 5LGHH 3L3KA 5ICZA 2XCMC 2CKBB 4N8CH 3P4NB 2WXFA 4NN5B 4N6RB 4MAYC 2DYRB 1MJUH 1KLUA 3WHXA 1UFUA 3GUTA 3D25A 1MVUB 4A63A 3GXIA 2Z92A 2VITB 1TIUA 4OAWB 4OI9A 1A21A 3FTWA 5JA8B 2E46A 4C56E 1LO5A 5E2TL 1F1DA 3LTVA 4XVSL 4QRUA 5IREA 4Y2NA 2F54A 1U8OB 2BM3A 1NPUA 4GW5B 3UADA 4DW2L 4I0PB 3TT1L 4J12A 4RVBA 7PCYA 3HBZA 3TBSA 3LEYH 3DV6A 4ZUVB 5EN2B 3D09A 3IGKA 2NT1A 4PB0L 4PLOB 5KSBF 2VW7A 2PPFA 4BA0A 2C3HA 3AT0A 4EVNA 4ONFH 4E41B 2A1WH 4EBQH 1AR1D 1PL3A 1SXBA 5DJ6A 2VN3A 1Z1WA 3CN4A 1FN4B 4XP5L 3SB3A 2K8QA 4RWYH 4OLXH 2EICA 5BOJA 1ZLDA 3RGBA 1J8HA 4XMUA 1KB9J 3HVNA 1HCVA 1WGVA 3BP5B 1DVFC 3L3HB 3OGCB 4GP8B 4P4RB 3V4UH 4AQ8C 3RGVC 4F8QA 2A0LC 4RRPM 2WB7A 2WO4A 3LD8C 5HBBA 1V5JA 1PD1A 2E4TA 4OLWH 2JV6A 4AM0Q 3VFVB 3BSHA 5AEAA 2CM5A 1YJDC 3HN8A 2P52A 4HGWA 4KJYA 4LSTH 5C0FA 2P5PA 5AB1A 4H88H 3MMEB 3QDGA 1GZHC 4TUJB 1EPFA 1A7RH 1KTDA 1KN4L 2KDYA 3TC9A 3CX2A 3VFPA 1GTFA 5HDQH 4U3HA 1QPPA 2BP8A 4DGIH 5GS2H 3RUGE 2Y07H 1G6RH 2LAAA 1SVBA 2HKFL 5GRWA 2CJSA 3MREB 4HOWA 3E3QE 2GPZA 1LXMA 4FLSA 1UASA 1UZ8A 4J4PC 3V95A 2H8PB 4OM0L 1HH9A 3GI9L 1RULH 2DQJH 1H0DB 1NJ9B 4K3GA 5L2KD 5CBEB 1PBYA 4G8FB 1J9CT 1F4YL 1ANUA 5CF3A 1MSPA 2A6DB 1NMCB 2ZONA 4U1IB 2D7PA 3QDME 4ZS7H 5FYKD 5LLIC 1GZQB 1ET7A 2X0UA 3PDDA 2GUOA 4XP4L 2F53D 2QQNH 4XTRD 2FX9H 3ETBJ 5EO1A 2A9MH 2NSQA 4L2YA 4YDKH 5IHZA 4R2GB 4KZ0A 3VGDA 2F18A 1BOGA 1FQ9C 4JFFA 1XGRA 4LEBA 3ZTJH 4G82A 4WDIA 4A7GA 1QTSA 2FEEL 3T0EE 4Y1SA 2G5RA 3I6KB 1OAJA 5HGBB 2Z0UA 2P7TA 2BNQB 4URKA 4ZD3L 3AM8C 4QEGA 2VMFA 5K1NA 1L9PA 5E99L 1GKEA 3TURA 4RGNC 1JHKH 4AW4A 1A5FH 1RVFH 1TQBC 5I76A 4ICWA 4XO4A 1UCBL 1G9MH 2R2BB 2Z4TA 4D9RE 5IVNA 2F8VA 3BRFA 5DHDA 1I9IH 1R33A 4GRLB 5CEXB 5TDNB 1NKRA 3V6OA 3O6FD 1YRKA 4GBXC 1W0WA 2D0FA 4V1DE 1AS6A 1NBVL 1XFPA 4JVWA 4MS8D 4Z5RA 1KIRB 3GSNH 3NIDF 4ELMB 3HFMH 1MFBL 3PL6B 4K9JA 4ABQA 4Y4KD 4JG0H 2Y2YA 4XCFL 4IS6A 4AUJA 4LLYB 1RZJL 3OKOA 2ZAHA 4OGQC 3CBRA 1G7LB 1QG3A 2XHNA 4S1RH 1ROWA 5IQNA 4PWFA 2D7TL 3CGTA 3UDWA 4BZYA 5DYOB 3RBSA 4JGMA 3FQRA 5D1QC 2Z34A 4QXTB 2FH6A 3BUDA 5A2FA 2Z35B 4J3OD 4X4XA 4OD2B 1TCRB 2FGWH 1AAJA 3UPCA 4HIQA 4DCQA 4KTDH 3RWCA 4K94C 2CIKA 3FTGB 1HHKA 2XBTA 5EF2A 1INDH 5L6YH 4WI9A 1JNNL 4CSSA 1BGXH 4KKCC 2WLHA 1OD7A 4XXCA 3V2AR 3GSVB 1KBGH 1L9QA 1KJVA 1X7SA 3ALPA 3D8MA 3LH2H 1IKNA 4R4ND 4XOAA 4YHZL 4EZKA 2O4EA 1JRHH 2YD4A 1BLNB 2WMPB 4JQVC 4F5CA 4LGPB 5IHUH 4XPFL 3SBWA 4XN9A 4MQSB 1SMDA 5C0BE 1Y0LB 2GI7A 2QHRL 5D2NB 4AJYV 3P9LA 5DFVC 5E1QA 3MV9E 5T1KA 1ZOXA 3DIFA 4PJEF 5DZAA 4M6NL 4WEEA 1SHMA 2GFBA 2R83A 5DZJA 4OZIB 1IGTB 1C5DA 4B9JA 3T1FB 1A6UH 1DQKA 1HI6A 1XH1A 3QUZA 5EU7C 4KU1A 3OB8A 2EH7H 1EZSA 3DHUA 5KS9E 4JHAH 5I6MA 1D5RA 3VO0A 3H0TB 5L0QC 3LS5H 4JFSA 4X6EA 5GRUH 4TSBH 1YN6B 3GLAA 1R3JA 3M1BA 2A9NH 3K2KA 2VSCA 3BWAA 1A1OA 1EZVX 1JN6B 5B1KA 1B0GA 1Z32X 3RBGA 2DWEA 2WUBL 3K4DA 2XC8A 4FXKA 3MRQB 4LCWA 3QXDA 5CILL 1VFAB 4XPAL 4BFFA 1E5CA 3AMKA 3IWVA 5K1VA 4R0LC 5IWLA 3B3IA 1YEKL 3BUYA 2LOEA 5HVHB 1LEGB 2GHWB 3V6ZB 4WHYG 4G6ML 4NOFA 4G9FE 5KVFH 5IF0B 3VD5A 2IPKB 4PRIE 2CBOA 5T3ZH 5SWSB 5JIPA 3KWXA 3V4VL 1ZEAH 2Z4QB 4JN1L 1BG9A 2ESVD 1X6LA 1K2DA 5DC0A 3SKMB 1C8QA 4N8VG 3ARED 3HC0B 4X99A 1BF5A 3TEYA 4Q0XL 3VFWB 2C1PB 1DSFH 5E4IA 1EEUA 4KQ3H 1BQKA 4TLSA 4G43B 4K7PY 4B9PA 1Z9MA 4PJDB 3IJYA 1BMGA 1MFEL 3X11B 4E5XA 2DMKA 4PJFE 1NCAH 2EUXA 2VR8A 1KG0B 2ZKHH 2PYEA 3ARXA 4Z8FL 4O5LL 3V0HA 1ZWIA 3G9VA 3HBGA 3O0RH 5C7ZA 3ZE1E 1CXHA 2AVFA 2XDHA 5CN1A 2JLPA 1VCBC 2HT2C 4PVNA 3S2CA 5BQ7A 5ACMA 5ILTH 3W9EB 5DTFA 2C9XA 2QV4A 1ZT4B 1YMHB 3LKQA 4PJ8D 4HWEH 4PH8A 4BFJA 1ZHNA 5C0AB 1A9VA 3QA3A 2CMRL 4UOW0 2XQ0A 3OAZK 2X4PB 4GXUM 4P3DA 5A2BA 1EHKB 2W60A 3IMWA 1RUPL 4PG2A 5AW8B 5D4HA 4D8PB 1TQSA 3K6IA 4YDIL 3KYKH 1CFQB 3GRWL 1B6UA 3PU7A 5B22A 3V4VA 1CG9B 3I3DA 5GGRY 5B7FA 3TYFB 4K4KA 5DJDB 3FUMA 1M56B 3FU8A 2WQSA 3IRCA 3ARYA 3CSGA 3LN4B 3ARDB 3K8LA 1XR8B 2GYSA 3I9AA 4FXLA 1J0YA 3HRZB 4OV5B 4U3XA 2Y3NA 5D7HA 1BFOA 2HTKD 2ARJQ 3HR6A 5EO0A 3AS0A 3NZ8A 5D6CA 4IDLA 4YS4A 3MRJA 5CD5D 5FO7A 3WIIL 2W91A 4GSDL 4PW9A 3WBDA 4KC3B 3KXFE 4UQ9A 1BZDA 4YSEA 3UTTD 2X88A 3B4NA 5F9JA 3W38A 3B7RL 4QRPB 1IARB 4B9FA 4WNQB 3F83A 4QRTA 4RZKA 5DK0B 1QPKA 4FQXC 1GGTA 3MZGB 4ZYKA 2CQVA 2NTSP 4PWIA 4XNDA 4OGXH 4AZUA 4H8WH 2VXVL 2Q7YA 5G5DA 2IGFL 5GSVB 1U3JA 2BNRA 1G7JA 1E4WH 1IM9B 2NY0D 1BBDH 3SYQA 4RSYA 1VIWA 2XOTA 2K45A 1UWGL 2X1QA 3P2BA 2F68X 3GRWA 4S2SB 2YWZA 4YL4A 3U1QA 3MDJA 1PCSA 3QWNA 4RDBA 1G7QA 1F58H 3D33A 3BN9D 1G9MC 3UC2A 4E68A 4HJEA 3SDDA 3EF7A 3NA9H 3RPKA 2G75A 4MAYB 4BIKA 1I1CA 3DX0A 3PWPE 5B3SB 4HFUL 4X8CA 3INOA 4EIGB 1DEDA 3NGBB 4GH7B 5MEOB 1NFDB 1PKQB 1U3YA 3II1A 4TN9A 4AMWA 4KXDA 1G7IA 5TPWH 3QZPA 4XVJH 4IM8A 4ZMAT 3BN3B 3EYUL 1N3NA 5DRZB 4MMZC 1IKNC 5FYLD 4AEIL 1J1OL 2VWEC 5BVJB 3RAJH 2J71A 4JPWH 5E9DE 5F3BA 3OC5A 2X44D 2Q20A 4XT1C 4ORZC 4ZO6A 1LDPL 3NOIA 1X6NA 3EDDA 1F0LA 5GISH 4XNMB 1TJIL 3NJNA 1AQMA 1JGUL 4JB9L 4XBGA 1TNMA 2XPGA 1UM5H 4FKHA 2ZUTA 3IDXH 4HLEA 3QS3A 3WE1A 3JWDC 1XGTB 4FQJH 3MOBL 4GI8A 4M8RA 3CIQA 1FNFA 1RUQH 3GSOA 3JV6B 1D7DA 3MNVB 5DI8B 4HWZA 4CC4A 4L9LB 5C2UB 1DVFB 4P5KA 4K23L 3MJ8A 4POYA 4YFDB 1RLBA 5D7JC 3RGVB 5GS0H 4L8DB 3ZZ1A 4NRXB 1KLGA 3GTTA 5IVXF 2F7OA 1S7TB 2NUTB 2W38A 5JHMA 4DKAA 3D39A 3NRFA 1CDHA 3T8XB 3IJ8A 5GZNA 4OCXH 2K9UA 2CU9A 5C09B 6PAZA 1HXMA 1SBBA 1B2WL 2O6CA 4P59L 5CUSH 4Z1PA 2NQDA 3UH8A 3DGGA 5IK3B 5J9PA 4HCRA 3MNDA 3AXHA 2XXGA 4AGMA 4MA1C 2X4TB 2BVQB 4X5WA 3BGMB 4JFXA 2YOAA 1T04B 2EYSA 3VRJA 1E90A 4HS6A 2J1YA 1EANA 4YO0A 5HHVH 5D7LA 2QSCL 1XGQB 2AK4E 1X4XA 1CYWA 3PGDB 1J48A 3GKWL 4ORGB 1DQJB 3OXRB 3ECBB 3KLDA 4LFHD 4ABWA 3SKNB 2VLJA 1IEHA 2CGZA 1KT2A 1H3XA 4CW1A 2J5LC 4WIQA 1C1EL 2AQRA 2JCCF 3UTPE 3O4LA 2EIZB 1L9MA 4I0CC 1MJ8L 2OXGA 1JVLA 1C12A 4PJ5B 1AG6A 2VAJA 5EWIL 4L1DA 2X4UA 5DURD 3VX0A 3VI3B 1AGBB 3AACA 4G6JL 4YZFF 1BVLB 4KXZI 2AANA 4RSVA 2CDEB 2IV9A 3VA2C 4QMEA 2BOLA 4OM1L 1QWHA 1RZFH 4YDJA 1K9TA 2KZKA 5BNXD 3N6YA 1T20B 2CUMA 4P9MH 1IGFH 3V0EA 3WL9B 3SKJL 1B9ZA 3R06A 2ZXQA 1DQLH 1GY2A 1X5GA 4NKIL 3DMMC 4C56D 4GW4B 1UJ3A 1QBML 2C3WA 5K33A 4UQIM 3FQWA 4FJYA 3OF6D 5AAMA 3CMOL 3LB6C 4J8RA 3CBJB 3DV4B 3CU7A 5IVZB 4PJHB 4PPTA 3MLZL 4XP1L 4GS7B 5I8KL 5DVPA 1S7UB 2MPAL 4D9LH 5BRQA 1J9RA 1W9XA 4P9HL 4JKMA 2QQLH 4OZ4B 1IM3B 2MCMA 1OAYL 2VDPH 2V9QA 5F7DB 1H3TA 3MLWL 4N90E 1PLBA 3QUXC 4M7KL 4GAGL 3DOIA 2QDVA 2XBDA 3PGCB 5C07B 4ZK8A 4JGUA 3KWWA 2OQJA 1RJLB 1XWVA 4DQOH 4ZFQA 4PJXA 3E6HA 3CDZB 2WCGA 3TX4A 5KSBE 1HINL 3DI2B 2F7PA 4ZMOA 2C4XA 3GEFA 3LQZB 4G7SB 1CZ8L 2ZWYA 2YEVB 4CILA 2ITCB 3SZ6A 2LTQB 1OSYA 3RX9A 3UTSB 3X17A 4ZW3A 4NHUA 5DUPH 3ZTNL 4J27A 3ARGD 3MRNB 3HVDA 4RBPH 5KVGL 3S3SA 1NC4D 1KPUA 3Q5YA 4EI6B 1DL7L 4JM2D 5FGRA 3VWKB 4BEIA 1MLCB 4NAMA 3IF1A 4XODA 3QIWD 3ZKSD 1HIML 1A4AA 1PYWA 4XOCA 4X7CC 1NAMH 3SDAD 4B96A 3Q2WA 1FHGA 3TA3D 3KPQB 3LY6A 3QXTA 5IM7A 1P7HL 1XGUA 2XQBL 4M1GH 5ICYA 2ORBL 1SNRA 4NBYB 4WI0A 1VB9A 5HJGA 2ZPKL 4XBMA 1CGYA 3KVQA 4LSSL 4O02L 3AY2A 3WY2A 1XCTA 2DYPD 4FEIA 2XKNB 5E1AB 1MFAH 4ZXBA 5E2UH 3S97C 3T71A 4H8WC 3S2AA 1OP4A 1IU1A 1EHAA 4K3EH 5CLTA 1FGVH 2OJZL 2ADFH 1MNUL 4QHUA 4OV6F 3VFMB 5I1AA 2DQTL 3BP7B 3SDXF 1SXCA 3QDMD 2I7SA 1Q94A 3HB3B 4LAQL 3KPRB 3DKHA 3GSWA 1KN2L 3H9SE 4DP8X 1U9KA 2NY5H 4PREB 3UAFA 3W11D 5J56B 1HHIA 5EV7A 2X6AA 1L5GB 1EUUA 1T6WA 4JVPA 3GJFH 4P07A 4P8QA 3MXWH 5JOFB 5I1LA 2A83A 4AYDC 5DLML 5DEFB 3T0ED 4R0LB 3NDZE 4Y9EA 3GIVB 3OHXC 2CCLA 1YEJL 1H3VA 3F12A 3L9EA 5C0JB 3NG5A 4LEXL 2BIMA 5EZOL 3MV11 3VTMA 4Z78A 3S88H 3F84A 1OWRM 3O3DB 3S34H 1EGJA 5I19H 4NYLA 4Y0GA 4D9RD 1KYAA 1I8AA 4X7DC 1ORQA 3ZRSA 1FIGL 2AXJA 4X0NA 1GVIA 2E0PA 1HDMB 3MODH 2AEPH 4LPVA 4WY7H 4O2FB 4O02A 2GJ6E 4V1DD 4F7TB 2ALAA 4OCMC 3D3VA 1KXTB 3NSYA 2W9DH 2OK0L 4GXVL 5AD0A 4PGDA 3VSQA 3ZGHA 2X6UA 3ZHFA 2F53A 5JXEC 1M1XB 1O0VA 5D1XE 5D2LE 1HL4A 3SQBA 5EULV 1JPTL 5DD6B 2UY6B 2DD8H 2EP6A 5JPMB 1T2JA 3VM5A 3L2MA 5CU9A 4WFHE 1HCZA 1QVOB 3BWSA 3IM1A 3VNZA 4Z76B 1JZ6A 1NOAA 3DC0A 4JR9L 1FL3B 1UA7A 2X9YA 3EUUA 4Y16C 4HG4J 1XR9B 4YLBA 2O6PA 3RY6C 3IAGC 1X9QA 3WNOA 1AZUA 1I1FB 2F1EA 3MRDB 4GSXA 2L3BA 1DLFL 2EADA 4AJ0A 4D7BA 3EOBB 3TWCL 1N18A 1E7VA 4OTXL 1QP1A 5F93C 1EZVY 3VXUE 1FCGA 2X4SB 3V79C 2WLLA 1HHGA 1FA4A 1LM8V 5D5MF 2JB5L 5C0BD 1YY8A 2NLJA 3ZTEA 4YHLL 1NIFA 5T8IA 5H4YA 1G6RB 4FADA 3O11B 2MTPA 1D5ZB 3ALXA 3L1GA 4OFDA 1U3HD 4XB7A 4L5FH 2QT6A 5E6YA 4QIRA 4KJQC 4HBQA 3IT8D 2Z31B 5FX3A 1FH5L 5EU4B 5SWZB 3SCMD 5I30L 5CO1A 3IJ9A 3PF2A 4NM8H 1ZIAA 4Z7WA 4YDLC 5ANHA 5AAMC 4ZMWA 1KB9K 2DYSB 3FSZA 2R2HA 4JN2B 3B3BA 3KL3A 1UB5A 1YUKB 3N50A 2IH1A 1T21B 2RCSL 3RWJA 4TSCH 2CHXA 4HEME 2ENYA 1CE6A 2APWA 3IFOA 5DGRA 2EEBA 1QLEL 4ZFOB 1N6QL 4KY1H 1E27A 3BFOA 5DD0H 2Q76B 3GBNH 3EADA 2ZP9A 4HYTB 5JW4R 1BFSA 3NCFB 5BO1L 2VZTA 4U6HB 3TO4D 3U7WH 3BLKA 5L9DH 2VSKB 4PI2A 3UO1L 2VDKL 2NXYB 1CICA 3WTVA 4MB1A 1WG3A 2H26A 4XPBL 1A7NL 1GTNA 2H3XC 3TESA 5E6RB 1PZSA 3PP4L 3RNQB 3QAZC 3ARBD 4G9FD 2PLTA 2NZIA 1A4KB 3LHPH 3MLPA 4PRID 3UGXA 2VLRA 2I9LA 2YRPA 1V3MA 2HN7A 3P73B 4OKVA 4I87A 4LCYB 5DJ0A 4Z7UF 3A23A 1OOWA 1OSPL 3UBXI 5JPNA 4MNHB 3ECQA 5H35A 5I5IA 3FTZA 4R7DA 5FECA 4MMZB 2HG5A 1BWMA 3GSNB 1CL7I 4IHOA 1AOZA 4JDVB 2W0FA 2XA3A 5F1SA 4Z95H 3VXMA 2R23B 1GMEA 5B1AB 5EC2B 2YGOA 4XBEL 1BQHA 1L7IL 3UJIH 5I6LA 1T1WB 5JQ6H 1HCYA 4D0BB 3IBEA 4PRPE 3U46B 3T6QC 4BSVA 5B38G 4X0KB 1QRNA 2F7QA 2W88A 3LEVH 1XMWA 1IAIM 4WW2F 3BP4B 2WAHA 5IMOA 1JTPA 4DO5A 4CUCA 4U31A 3BYYA 2ZOLB 1FE8L 4NUGL 5E4EC 1I7UB 2F7IA 3ILPB 5BVPH 1XSOA 1UD3A 1YNLH 2QADB 3NCJL 3HPLB 4HH9A 1TO4A 2HVKB 1RERA 2ZSWA 3OMZA 2ESVA 5B1CA 4PVBA 1S7RA 4DZ8A 3N1FC 5E8EB 5ANMB 3NAAH 2CWRA 2IH3A 2E9IA 3MACL 4H0LC 4JANA 4OF5A 2WQAA 4M8QA 4OQTH 4R96B 3H53A 3WFCH 2MTAA 2WXGA 4HDIA 5CFHA 5DMYA 3ZJAA 2EAEA 1MREH 3UBXB 4LSRH 2NTFB 1MHEA 1KDJA 1CDIA 2VM4A 3OPZL 4FCAA 5E8DL 2EDDA 4X6DB 3KPSB 1RIVL 4NWTL 1OB1B 3K2UH 2FO4A 2OZ4L 4MHHI 2OULB 3R18A 1A7PL 4QOKE 2D4DA 1D9KA 2X4QB 1CTOA 1UADC 4JRFA 1ZCRA 2FWLB 2WLIB 4N0CC 1I4FA 1A1MA 4PJ8A 5E6IC 5F9OL 4HKZA 3T0WA 3WFBH 5CCKH 2XV3A 3P54A 4HQQL 4J6RH 2NY5C 1MNNA 2XWBA 3EJYC 3AQYA 3H85A 5E5UB 3A4AA 3OKEA 3EOTL 2J5LB 1VADA 5HHNA 3G6AB 2Y6TE 3CFBB 3ABZA 4TPRH 3C6EA 1M42A 3X13B 4MQXC 1G7PA 4BQCA 5JLZA 1C5BL 3V0DA 5E70A 4PS4L 4J3UA 1QYGH 2YZ1A 3X3GH 4V33A 4AKPA 2CHDA 4KKAD 4K8RH 3A5VA 3TN0C 5C0CE 1DYZA 2B0SL 4B97A 3IDGA 2BHYA 1EWHA 2PPDA 4EIZC 4F2EA 3PWPD 3FQTB 2E47A 3GZKA 5FYLL 5D1ZC 3S35L 5B39B 5TF1L 1Q90A 4AM0B 1K6QH 5ITFB 1KEML 3WLWC 5I6XC 1IE4A 1MCPL 1QBLL 3C09B 3HAEB 5EUOE 1RIUH 1BXXA 1Y18B 2Y7SA 2KHAA 1G4RA 5F1IB 5A2AA 1YUHA 2J6WA 2WXIA 3P3TA 5E9DD 2OZ4A 2EEAA 2KLSA 4RMQA 2NY6D 3WUWG 1ZPLA 3K4ZA 2EVJA 2Y3AA 1RIHL 5AVXB 3E1F1 3RY5A 5F96L 2Q7AA 3RVVC 3D30A 4PS3A 3VXPA 3VD4A 3EO9H 1QI5A 4KI5C 3DNKA 4I5BA 1BOYA 1JK8B 4C58B 1A3LL 3FDWA 4Q9RH 4HJIA 4PJGF 4XC3L 5CJXA 1JWMB 1F90L 1E8WA 1O7VA 2Y0SA 3SHSA 2FJUB 1W0VB 4OT1H 1P5UA 3BO8B 4X50A 2MHAA 4M48H 1BM3L 3S5YA 1M7DB 4J3VA 1GYWA 4KZEL 4M93B 3OKDA 2VL5B 4RIRA 8FABB 1GGIL 1OAZH 1PW3A 2IAMB 2O5YL 3D0VB 3QHZL 1R5VA 5H37G 5GSRA 5JIQA 2AABL 2QTVA 1JFHA 2YARA 3MNZB 3RJQB 4Q6IA 4E9QA 2FR4B 3MGTB 2FJGA 4EI5B 1FVDB 1HAUA 1KC5H 3RPIA 5BZWB 4ODVH 4LSDA 1IO4C 3H9ZA 3DX8B 3H7LA 1KV7A 2X2JA 1NMAL 1U42A 2Y1VA 4BSWB 1PD6A 2DL2A 3G6JE 5IVXE 1KCKA 4ODWB 5ACZB 3US0A 4HV8B 4OJFH 3PIQA 4S1QL 1XD1A 1CD1A 1R24A 2PUQT 2L7EA 1ACCA 2J57A 1W15A 2PO6D 1T6VN 3V5DB 3ULAB 3AADB 1VFBA 1SMAA 4CL7A 5T1JA 2AK4D 1ORSB 1DQTA 1ND0A 2R1WA 4UWQB 3QHFH 4UQ3A 1R3IL 1UA6L 1VFUA 2WWNA 3ZT6A 2VQTA 1L9OA 3SDCA 3EYQD 4HULB 4AOFA 2BNQD 3AWGA 3UTPD 3RWIA 1GOGA 4A6YH 3ZKXC 5KYXA 4GQ9L 4LLWB 2P5WA 3HI5H 4B9IA 1HEHC 4XN5A 4MXQC 3NFPA 4N1CA 4GG6B 4JEGB 3Q9PA 1QBBA 3MRLA 4RGMC 5CKGA 2KBGA 5D7IF 5GGQL 4YFLF 1LK2B 4MYPA 4AC4A 1KTBA 4CA4A 4ZUWA 1B3JA 1A4JA 3LNIA 2WWMC 4GP5B 4U1MB 1DZBA 4MKMA 3FRPB 4NDMB 5GS1C 4M5YL 2W0LA 3QWRD 1OAQH 3UTQA 4AQ1A 4CADA 3OHXB 4Q74A 4DP7X 2Y2WA 2VDRH 4PGEA 2FQDA 1FG2A 2QKIB 3QUMH 4I3SL 4LL1A 4W9LC 1BVOA 1DBML 1ZLUH 4ADIA 1NCWL 4NM4L 1M6OB 1S9YA 3VW3L 4WWKA 4AGPA 3OWEA 1OGPA 3ULVE 4KY2A 3RFZB 4EZLA 2YUZA 4ANVA 1UOLA 1ET5A 4TVUA 1GCYA 1I3RB 2CHWA 1T0MA 2VIRB 4N90D 5T5NG 3STZA 2A6JB 1BA9A 5JNYB 1IKFH 4FNUA 1P7QD 2E3VA 1SXZA 2YFNA 3GEWB 2VXUH 4W6XB 3HCVB 1R5WB 4KFZC 2HT4D 4ZAKC 5LAXB 3DJ9A 1ZHKB 3DVIA 4DUXA 4YBQC 3L3DA 3E38A 5F7EL 4CC1A 3ZHLA 1UTDA 4GMTL 4YSCA 1BQSA 2WJ7A 4U1SA 3FUEA 1H3PL 3SO3B 1EXUB 1Q1PA 1UWXH 3LQMA 4C56A 2IANE 2CXGA 1U92A 1Q9LA 4LHUB 5TE7H 3SYCA 3B2DC 3T3PF 4P5TC 4OZGF 2FSEA 3QJZA 1JF5A 1IFHL 1IC4L 4FJ6A 3OF6A 1LTXA 2A73B 5L2JB 4N0YH 3TYGL 3BDYH 1GYAA 3ZN6A 4NJ9L 3L9RB 4K71C 3RTLA 3QFJB 3HJ0A 4HUKB 3W37A 4WHYH 3PWUB 4YR6B 2H4EA 5IOKA 4NQVA 3B9KB 3QR2A 4S0SD 3AQXA 4IJTA 1YNTA 4LNRB 5J1TC 1J0KA 2C7UB 2I5YH 4OLVH 2V3DA 5I66A 1INEL 2J56A 4AL8L 3FUJA 1TZGL 4C83B 4HZAA 2PF6A 3QUYC 3CFCH 1A22B 1GIGL 3PP3K 1ZLSL 4ERSL 2W9LA 2FB4L 4U1NB 1V3JA 2P8LA 5JXAL 4Y9BA 1V55B 3H6AA 3E8UL 3RTQB 3K6SA 3SPVA 2NX5B 4IDJH 2X2IA 4XCEB 4EF3A 4NRYB 5CSGA 3QEHB 3MLXL 2BSBA 3APNA 3GM8A 3GSQA 4B7IA 4F33B 2PPAA 4L1TA 4DN3L 1U58B 2IPUG 3TV3H 3SDYL 4K8RC 4TS6A 2XWEA 3FSVA 4TM9A 5EEWA 3H9SD 1DQMH 1N0XL 4ALAL 5EBMB 1WIPA 2B39A 1WO2A 2X7LB 5KWYC 1SY6L 2XVBA 3FQ1A 4JM2A 4WHCA 5H94A 3KLKA 1E50A 4NJAL 1TZHB 3DURB 3PHOB 4EO5A 3C5JB 2YXWA 3QFDA 4OZHE 3WS6C 2Q3ZA 4NWUH 1BIIA 3VFTA 3WXVH 2QEJA 1OAXL 4LXFA 1PEWA 3UAJC 2R56H 5CINH 2R27A 1GOHA 3DX4A 3QAZB 3FU6A 5HGAB 4RFNC 2D7NA 4FP8L 4JFZL 3C5ZB 4J3OG 1KCUH 5LO7A 2MPVA 3TFKD 4AJVA 1DN0B 4HLZG 2E76C 4XP9L 4NT6B 2GJ6D 5LBSH 4K7PL 4P3CH 2VDPB 3BPOC 2JI3A 3GXDA 1KBBA 1CGTA 1UM4L 3FO0H 3NACH 4CVZA 2ARJB 4W9GC 5F7YC 1LE9B 2B20A 1MCCA 1CU4H 4YVNA 5D1XD 1O5PA 3MXVH 2FL5A 5L88L 5DQ9B 3ZE0B 4L3CA 4M7JL 2JXMB 3RQ3A 1R5IB 2C3VA 2HUEA 1EAOA 3O41A 4WFHD 3KLHC 2E7DA 3B2VL 5ESVB 1SY6A 4WJ5B 3SDCC 4N0RA 1U2CA 1NL0L 1N2RA 4PJAA 5DJAB 3HLAA 5AW7B 1LLAA 1Q9KB 2MNJB 1RZ8A 3D0AA 1GAFH 4UDTB 2HWZL 1QHPA 3FU9A 1GSKA 4HUMB 1Q9WA 4EIUA 3BAEL 1JV5B 3FB7B 4KROB 4G6AC 1TVHB 5D96C 1F00I 1KJ2H 2BH0A 4R26L 5JIHA 3MLUL 2Y9RT 3ZOAA 2FLMA 1XTLA 3EHBC 4PCYA 4X6BB 3UYPB 4YHNB 1D5XA 4V1DA 5D7SL 4F3FA 4NSKB 3AUVA 2JELH 3T4AC 3P40A 3D9AH 2ZYIA 2DH2A 4IOIB 2C9SA 1BQHG 5LVEA 5C0GB 4HVBA 3QISA 3DBSA 2H2PC 2FBOJ 3OB0K 4FXGC 2WK2A 3MRHB 1FZOA 3M1OA 3RWGA 3ZDZB 4XOBA 2EC9T 3WAKA 3FULA 3N1GC 3Q6GL 2CLZB 2WXPA 4OCYL 3BPCA 3TEZA 1DSWA 1MRCL 5E6IB 1MUJB 1IBBA 3PGFH 3QNXB 5ID0B 4MCZA 1NBYB 3PG2A 1ED3B 4MNQB 1EO7A 2V5YA 4JL1A 1BBJA 3GJFB 3EJSA 5AG9A 3RWFB 2OYMA 4KTGA 4HF5L 3MRKA 3DHMA 5C0BA 2YSSA 1WBXB 4AGQA 4XC1L 2DKSA 3ATFA 3MV9A 4PRNB 3RL1A 4A7TA 1UXWA 3S3DB 5GGRA 3H4HA 4S1SL 5BXFB 3TN0B 3S37X 3CFEA 2AQPA 4I13B 3TBYB 1PF3A 2BVPA 2Q9OA 2Z93A 4WO0A 1AXTL 2VE6B 5IJKA 3SCMA 4L05A 4BFIB 4U6XB 4Q52A 4R5TA 1CDJA 5D1ZB 4ELMF 5FFGA 1FO0L 3LMJH 4ODSL 3HR5A 3CFIC 3ARWA 1T5XA 2OPCA 3LIZL 1LWRA 3QZMA 1I1YA 4F7MA 4BH7B 2R29L 2PP7A 3QPXH 1KCSL 4LCVA 4YAQA 1DSYA 2B1AH 3C6LC 3S5LA 4KKRA 1YEHL 3MYJA 3CK0H 2Y1AA 4YSQA 1FL5B 3H56A 4RFOL 3U1SL 3AG3B 1OLZA 1BQRA 2WTRA 3IGAA 3TO4A 4OCWL 4QF1B 3VMNA 2OMTA 2Y7OA 4PRPD 5T1LD 4F24A 1BX2A 3GRBA 3O6LL 4JPIA 3CZNA 1Z9NA 1VJSA 2VR9A 4IRJA 2CJUL 4QHMB 4G9FA 4QRAA 4X7TB 4PRIA 2JI2A 3M8OH 1SFDA 3V8CA 4LVOC 5BRZE 4M03A 5J13C 4L3FA 2AJSH 4FQQA 2A74A 3CVHH 3FFCB 1A6WL 4LL4A 4LPWA 4QXGL 4XVSH 3UBHA 4GW1B 3I6LE 4KK8C 1A7BA 4OZIF 1IBHA 4PFEA 3MUGA 5DEGA 5T3XE 5CP7B 1FO0A 4J8QA 5MEQB 5TGBB 3U4BH 2FE0A 1Z66A 4TOYL 4WGKA 2LLLA 2P80A 1TQCC 3LIZA 5ECJE 4PJFA 5EORL 5FDYA 2DB8A 2R29A 3VXOB 2Q10A 1KCRL 5J8OA 1TJXA 2OR7A 3G04A 3BPNC 4WLCA 3BGFC 4XP5H 4H25B 4FEMA 1X5MA 3N43F 2GTWA 4MA3B 1AO7E 4FNTA 2CPCA 5I16B 1XZ0B 2I07B 3BE1H 3HHSB 1QMUA 4JPQA 4M7LL 3WI9A 1E8XA 1H15B 4PJBE 2XWTA 4YGAB 4QRSB 3IVKA 2PW2A 2RJMA 2G3NA 1EVUA 3F6JA 3LCYA 1IC5H 1ZHBB 3HIZA 2IPTL 4JFUA 4WO4C 2CDGB 3K0YA 1WIOA 4GRMA 5SX5H 1PY0A 3MFFA 3VAEA 4RGMB 3L7EB 3QCUH 1E6JH 5D8JH 4Z77B 2ZNXA 1LEIB 4W9EC 4DVRL 2Y7QA 1WP6A 3KWVA 4Z23A 1LO3H 5C0CD 2JMRA 1EJOH 1M57B 3DX7A 4L3EA 1RQ5A 3AFLA 4E9XA 5KUMA 1FAKT 2AGJL 2WSPA 5AZUA 2XYBA 3EO0A 4X4KA 4N2FA 2FEJA 3SJVB 5KSAD 5IQ7H 4K9EL 5EU3A 5DDHB 3FTYA 2YMOA 3KXFA 4G6KH 4PJDF 1JPFA 3FPXA 2XBZA 3BH9B 2I60L 5EG6C 4RDQF 5IIEA 2R1YB 4NENA 4UNTA 4MGXA 4L4VE 3FZUC 2HT3C 2FBJL 4A66A 4HKJB 1G5GA 2MOVA 5DD1H 1BSIA 4NCDA 1MI5B 3ARFD 4TNGA 1QFWM 4HISA 4W9CC 3RNKB 2BSSB 3NQKA 4XNXL 1U93A 1PS3A 5J6SA 1FFQA 3VACA 3MLVH 5IFJA 4JFQA 1NLBH 4G9DA 5E5RB 3CFMA 2IFFH 2A9BA 4PR5A 1PKOA 2LR4A 3LZNA 1FVCA 4ZAKB 1NGPL 5E94B 3PWPA 1HQ4A 4FHJA 3D7PA 1F3DH 1NGZA 2DJMA 4M4RB 4ZD3H 1T89A 4JMXA 2RBLA 5I1GH 3EZ8A 4AEHL 1RKRA 4JFVA 1DLHA 2LFGA 2Z64C 4JM4H 3T6WA 2Q3XA 4JW3A 2NY4D 4LFHG 3GMNA 1P5VB 3BX7C 1MKFA 5FGCB 1BECA 3QRFM 1L9RA 5HHQA 2JK5A 4FOMA 5JQHC 3L1FA 1BXVA 1V27A 2APBA 3GTNA 4WU5B 4XNYL 2G5BA 4Z9KB 1OM3H 4B9YA 3DXAE 3WEOA 5BO0D 1NFKA 5JIKA 1S78D 4NCC2 2WQXA 4G6FB 4WNJA 3MOQA 4AMKL 1WEJH 2Q8BL 2FHCA 3IU4H 4YSUA 2BCKB 3MV7E 4J1UA 3KJ4C 4X6CB 1KLFB 2IDCA 3X1BA 2X05A 2E27H 3BKML 1J0HA 2J1KA 2MRYA 3LSOA 2E7LA 1AVAA 2XFXA 1CFNB 2OFQA 4LIQE 3ASWA 4JO4H 1IAOB 4O00A 5FA3B 4OD1L 3EH5B 4H4NA 2Q1EA 4U2YA 3SE4C 4APQA 4L4TB 4YGVB 4ILDA 1QFUH 2B8OT 2EDWA 3HOGA 4JRWA 5AB0A 2NQCA 4N2OA 4ODXB 1WA0X 1UA3A 5DVKA 1I82A 3H9HA 3UTOA 3N2JA 1UXSA 1XH3A 1E9OA 5DMGD 1F3JA 3UJJL 5K9KB 4G8EB 2B5IC 4AYBA 4XI5D 4WWOA 3U82B 3BVNB 4Y8DC 2N1TE 4OFPA 1XF3B 3N55A 3DJRA 2JLLA 2H6PA 4LP4A 5IQ9B 4EN3C 2ZX8A 4FMKA 3P9MB 3BH4A 4MJIB 4UAOB 2FZ3A 2NNXA 5FF6B 3X12B 3K46A 1UWEL 3QW9A 1JG9A 4LPTA 3ULVD 4R5XA 2UX7A 1T22A 3IGFA 5AWNL 4Z7OB 3FYIB 1E9QB 4Z7AA 1J1XL 3FFDB 2R7EB 3DX2A 3GO1H 3D87B 1NGQL 3VTAA 4NQDB 3PFUA 5AZEL 2BRQA 2JKRM 3LJ3A 3G9AB 3OGOE 4LSUH 2AK1H 3CFJB 1TVBA 5KOMC 3SE8L 3PJSA 4Q6KA 4YSPA 5ELIA 2OP4H 5CCHE 1FNEA 2C9PA 4JHZA 1AGEB 2AERT 5HGGS 3QQDA 1D6VH 1MIEL 3P4LA 5KYYA 3VFSA 1DUYB 5F7BA 3S3CB 1QHOA 2JJTA 4FI8A 1BD2B 1M71A 4FQCH 2ZCZA 1XF2B 2DIJA 2R1XA 1NCIA 2Q6WA 3CZUB 4B41A 1ETZA 1URZA 2DWDB 1V7NL 1MHHB 2H3KA 5I8CA 1RPUA 4KKQA 4XVUD 4Y4HD 2BJMH 4WI6A 3OHMB 2PYFB 4HS3A 4G7YH 1WITA 1HNGA 5GZOA 1JNJA 5FM8A 3I9PA 5E6ZA 1BW8A 1ACYH 2F58L 3L4WA 1KGJA 3EHBB 3QI9D 2PXYA 5GGSY 3EGSA 1IBFA 1ZGLB 1QA9A 3VJ6B 1CDGA 2XY1A 1YAIA 3CDCA 3IFPA 3VM7A 3L54A 3QXWA 4Z8FH 1PG7H 1U95A 2JKJA 5KSBA 3OMNB 5C6PB 2YD8A 3VI3F 1U33A 4Y1AE 4BWWA 1BEXA 3EXJA 3KM2A 3NEXA 4JY6A 1JVOA 5AVTB 4A6YB 4AZ8A 2BMKB 2JKNA 4MVBD 1YEGH 5C9KA 1KCVL 2D03L 2NZ9D 4UYPA 4HJTA 4WWPA 2O1AA 2ED8A 2VABB 4ZTPL 4XNZC 4I9XA 3HE6C 3IJHA 3LXBA 1AKPA 5FUCC 3SZKC 2YPKB 3RIAK 1J86A 2XXCB 2QDWA 4NO2A 1VGEL 3Q43A 5EOQH 4RA3A 1HILB 4JZJB 2ATKA 4UV4L 4PJIE 4J3WA 1WF5A 1HXKA 3RVXD 4BZ1A 4RMTA 2BP5M 2R0KL 3GMPB 4G7QB 4N2KA 4NAJA 3V5KA 3BRGC 4PJHF 4NRZB 3IJEA 5AOZA 2VDRB 3WN5B 3QUMB 5K69A 1ZE3H 2V3EA 1UH2A 3D69A 4LQ1A 3VFGL 3WY1A 3P30L 1NBZB 4MMXB 5EF0A 4F8NA 1KGCE 4MJHA 3DUHA 4PGCA 4UIMB 5I0VA 5C6WH 2NY1C 1MCKA 4PYGA 2UY7A 1NCBL 2EYTB 3FQ2A 1LEKA 3P4OA 5FW8A 1MWAH 4NPYB 2QPFA 1E4XL 2WIMA 1PQZB 2DOCA 2CUIA 3DETD 1N67A 5DCCA 4AT6B 1HNFA 3G5ZB 3T77A 2DIAA 3FHQA 2ZXBA 3HG0A 2DLEA 4HHWA 4QWWC 4ADGA 4NKQB 3C6LB 5IMKA 4POZC 3VTTA 2ZWKA 2AITA 3UZQB 5FPIA 5ENWA 2A6KA 2BSTA 1UZ6E 4JRYB 1HL5A 1JDCA 4GEIA 4P2RE 1S7VA 5JOEA 5DHVA 4ZW8A 4PRHE 3RZCB 2VISA 3BQUD 1T83A 3Q8CA 2TAAA 3KG5A 1KIQB 1FZKA 4GSUA 4L37A 2CBTA 4I77H 2W92A 3J2PA 4BE5A 4YK4B 4S0HA 1I3GH 4NIYE 4LVOB 2XXMB 5E03A 5EU6B 1DBKL 4ZOBA 1H3UA 4B9CA 1OL0A 4UNIA 2EECA 3SE6A 2YGPA 3EYUH 3J8F7 3ZYZA 1DCEA 4OUUA 4AEIH 1CWVA 4NKDB 4FTVE 1F6AA 3BKCH 2O5NA 2MWCA 3QVAA 5EMYA 5LWYL 2OMVB 3UZVB 1GHFH 2WQRA 3BZEA 2MEJB 1I1AD 1TYEB 2IWGA 4C8XA 4DGYL 4F7EA 1T2QL 4ZMYA 2YBGA 1CT8B 1P9MA 3CHRA 2QPDB 2E6PA 4G83A 5D2LA 3B2UC 1TQCB 1DE4B 3GBEA 1AJ7H 3GHEL 1MCDA 4BKTC 2NPLX 1S7QA 3EG9A 4QHLA 5FDWB 4X4ZA 5L8JB 2SEBA 2VQ1A 2CD0A 1U3NA 2ZX9A 4NC1C 3UGEA 4LRIC 4O2CA 1KF9B 1BAGA 3T3MB 2FUQA 2ZXDA 1ZVSB 3BGFB 1ZLVK 1CK0L 3MBXL 2J44A 1QO3B 5CSZB 4B3VA 2OZNA 1CTNA 4WKZB 4G42A 5FW7A 4LLUB 4Y5VC 5SWQB 1ADQH 5CR8A 2B3RA 3VFNB 3CFKA 3ZZLA 3VXUA 3FFOA 4CMMA 2CRIA 1M05B 3QH3A 12E8H 3RDTA 2F6AA 4FQPA 4WO4B 4L1SA 5CZVL 2XWXA 4U6VL 2ATPA 3UJTL 1KNOA 2XKUA 4P59H 3TNNA 4LLDA 5IKCB 3LDBC 5ISZE 3W0WA 5H37H 4P23A 3BI9X 1VPOH 3U7YH 4HIHA 3HS0B 4LOUC 1PFCA 5KOVC 2DLIA 1EXHA 1IGML 2HLFC 2NXZC 4IRSC 3DTXA 2F19L 2VLKB 3HUJE 5IMMA 2DAVA 1YECL 4KK6D 1OP9A 1TJGH 4PJEA 2QJDA 4QY8A 1J05A 4YN3A 3UP1A 4HEMA 1ZPUA 4KI1A 1KIPA 2ZUQC 4LMQE 3IFNH 1P1ZB 1C1EH 3PRZA 3PWVB 5JO5A 4JHBA 4AIZB 3BIBX 4XXWC 3DIDA 5KAQG 5EWIH 1B4JL 2R9HD 1I85C 2ZCKH 5EOTA 5F44A 3S7GA 3LZFL 4EI5D 5KVEE 2XTSA 1CMOA 3S3BB 3A24A 5GGVH 3BZ4A 4G1EA 1OP3H 2B59B 2EO1A 3WJJA 5L7XL 3C8KB 3IN0A 3N9GH 4LKCB 5A7EA 3BW9B 5BRZD 1YYMH 3U4EB 2WVTA 5ETUA 3MOAH 3O8XB 1Q1JL 1NCDL 3WNMA 2EVHA 4KVNL 2WVUA 1Y6MR 1HXYA 3K72B 4LARL 1OTTC 5AOMA 5KBNC 3UG3A 4L8CA 2KZBA 3I6LD 3AUWB 3NK4A 3HNVH 4PGBB 3TF7C 5C1MB 2AJZB 4EEEA 2WIIA 5TQ0H 5T3XD 2Y5TA 1J8KA 1MH5A 1W8OA 1B88A 1IZJA 1FFPA 3KAAA 3PAUA 1HSAB 2W9EL 4OFKA 4UINL 5I82A 3MLZH 4IRZH 3DJTA 4KITB 3HNTH 5T5FL 4NNPL 3GC3A 3FN3A 4IMLA 3VXQB 5CJQL 3QWOB 4PWGA 4BH8A 1BFVL 2VN6A 3MV8A 4G80A 5HGDA 3LNHA 4PRPA 3S3PA 5I2IB 5DQDL 2XA8H 5EB9A 3V0WH 4GAGH 2FX7L 4OFYD 3I50L 4PRAB 3FXIC 4A04A 4HUVA 2DLFL 5CEZE 2B08A 3TBBA 1ADWA 3MROB 3SBQA 4AV4A 1AO7D 1WSST 2YPVL 1X5ZA 5KZCD 1HINH 4AK1A 5F8QC 5BS0B 1MCJA 4I1RA 3G5VA 2VLLA 3GMQA 4JO3L 5AB9A 4BKSC 4KPHL 4GQRA 5E8NA 4ZTEA 3PDOA 4TTGA 1V54B 2FT7A 3L3KB 1AMXA 3GB7A 1KLUB 4N9OB 3AB0B 4FQ2H 4WI2A 3E2HC 2YPLE 4ZS6C 3D25B 5KVGH 4RH4A 5FA4A 2Z92B 2HKHH 3KPNA 2IOMA 4EMZA 1LO5B 1ZE3C 2ZXWB 1SEBA 3P11L 4FZEH 3UC0H 1N70A 4G59C 4QRUB 1TU2B 2BW5A 3DGCR 1R3KB 4A37A 3HMXL 1BVNP 1OGAE 2F54B 5T5FA 2B5IB 2CO6A 2E9BA 3WHE1 4FE9A 2TRYA 3FHAA 1SJMA 4QOKA 1Q0EA 4JFPB 2CKNA 4EVNB 1S7XA 4AYID 4L4VD 4N0UE 5FYKH 2ITDB 1F2QA 5DRNB 3SGJC 4Z3JA 3OB0H 3OKYA 4A2HA 1KXVA 4YDVA 1JGLH 4JG1H 2YPVA 3LV3B 2YQ2A 2DQTH 3QEGH 1BXAA 2BVEA 2B15A 1AZNA 1J8HB 4LLMB 4NKMA 2VDLB 4W70A 5IB1A 3FCUB 3U9UA 2DBLH 2DQFA 3QQ9C 4M29A 5E4AA 3G5XA 2EH8L 2Q2EB 1JZ8A 2WKLA 3B9KD 3RVWD 3GINA 4TMPA 4JO5A 1R3LA 1SJHB 4YX2H 3FK3A 5IP4A 4MA7H 2FT8A 3Q06A 4ZPTA 5HXMA 2DWYA 5F6HJ 2C9QA 4KJYB 3B43A 2AEWA 5KSAA 5C0FB 3BZFA 1KYFA 2EEFA 5DO2C 2VKWA 2BZDA 3QQ4B 2YMXH 4HIJA 1I3UA 4LEXH 4LLVA 4AITA 3QDGB 4PJ9D 2PR9A 3CZKA 1S7SA 3D48R 4R7VA 5FYJE 3HMXA 4Y4FC 1SOKA 3L3IB 1TTBA 3RTQD 2MOQA 3A47A 3LRSB 3ISWA 5T33H 4KK9D 2BP8B 1P6WA 4DQAA 4OF8A 4X6DF 4JY5L 2B9BA 2KZWA 1VZHA 2VOTA 3LIUA 3HI1A 4HT1L 5B8CC 4Q4EA 1ZJAA 4KMLB 2P44B 4FG6C 1UZ8B 1XIWB 1Z5LB 1BREA 4WUKL 4GXVH 2OK0H 3VG9B 3DXAD 3KYNA 2QLYA 3GDBA 4KV5E 4JFTA 1QWUA 3D18A 4J3OH 5IW6A 5TDOA 1KENL 5A16A 5L4MA 1VCAA 1TPXB 4HLZH 3MV7D 3O3BA 1CLCA 2HPTA 4PRBA 2ZOWA 2GUOB 1BEYL 1E2VA 1NCTA 3DX6A 1V7MH 5KUKA 3HZ3A 4XP6H 1W6LA 1X5AA 5IHZB 2HJFA 2FEEI 4DP0X 1BOGB 4JFFB 1DLFH 1XGRB 5CR1A 4P4KA 4XMPL 3QT2A 3C5ZD 4P2QB 5DMIL 5E4OA 4WDIB 3ISRA 3NCXA 4R8WH 4K2UL 4XNZB 5JR1L 1AE6H 4JHWH 4YHKH 3G6JA 4YHLH 5IVXA 4UQAA 5DJYB 4Y5YC 3FUNA 4OLZL 2PTVA 1JF6A 2WXQA 1QSVA 2CDFB 4HKXA 4YDMA 1UYWL 2O61B 3HE7D 2ZQKA 4AKOA 2IG2L 4ZOAA 3U83A 2VDNH 5KW9L 3ULVL 3LH9A 4ZMTA 2ZCLH 2ZCHH 5IROA 1YNKH 2OMUA 1BZ9A 4KFMA 3L5WA 3L5IA 4ZFZB 1MY5A 3TZVC 4Z5RB 1GS6X 3OLDA 4UT6L 2JKLA 2UWEF 3OG4B 2P8MA 3KVDD 3NJGA 2KYIA 1WBZA 2IO5A 2BIOA 5TK2A 2NY1B 4GP4B 3JZ7A 1XT5A 1GJWA 2H2SC 3BAKA 1HK6A 3OAWA 1O7DC 3UFIA 3FQRB 4AQOA 3ECVA 3L2NA 4R7NB 1RV6X 4P46D 3SKOA 1LHZA 4KO5A 4DCQB 3RWCB 2CIKB 4NZTH 2DQUH 2QSTA 1N64L 2CPUA 5CSBA 3PP4H 3FH8A 1REIA 2XPZA 1KJVB 2C8NA 4RZCA 4AVHA 4AX3A 1WAAF 2HLEB 1WTLA 2EKSA 2G0LA 1QSEE 1UUSA 2AEQL 1AR1C 1SDDA 2WNKA 1FYTA 3KE0A 5CGTA 5BZDA 2G3MA 3P9LB 4Y2DA 1OSPH 3I9GH 5T1KB 4BINA 3GYRA 2E7CA 2GFBB 2FH8A 2UZIL 3ESVF 1FP5A 2X0VA 2WTOA 3SPCA 1Q72L 1YPZE 2G2NA 2FLRT 4UT6A 4KMQA 5DZOA 3DSFH 3GJEA 3RWEB 3GZOA 5EBWA 5KBPA 4XBEH 2BY3A 2CAKA 5AVRB 1CF1A 4AXWA 1SVCP 2GT9B 4ANUA 3BSZH 2IBGA 1CPUA 4X6EB 4GG6F 1R3JB 2CNZA 5E0FA 3BWAB 5K9JH 4UZSA 2IANA 5I1KL 2DWEB 3PPSA 3VGEA 4KUCF 4LCWB 2WM0A 4WVRA 3QXDB 2BZCA 4OVVA 2VR4A 5B3JE 4JS7A 4FQIL 4OLUL 3B3IB 3TONA 1E67A 5LQBL 1KEGL 4G71B 4YOKA 4YE0A 5F1NA 2GSIA 3ULSA 1IT9L 2FVNA 1A9BA 4MA8L 4Y5VB 1P4LB 5BV7L 5DD3L 1KWGA 4QRRB 2X70A 1DEEA 3MRMB 4Q9QL 15C8L 3F5WB 4ACPA 3VXRE 3QI9A 4RFEA 4Y19B 5C08A 2OTPA 5GRJH 4TNEA 2YJLA 3MCKB 1A6AB 4TLUA 4F2ME 1XEDA 1RK1B 4ABVA 5BW7A 3B8YA 1K2DB 1WCBA 2DJSA 4JO2H 3UCQA 5FB8A 3BAJA 3ZYIA 1T03L 4HZLA 1AHMA 1XH0A 4L4JA 3I75A 3MCLL 5E8DH 4N2IA 1RIVH 3OMAB 3WXWH 5E9NA 5AW1B 1KGCD 5E2VL 4RGNE 2OZ4H 3POCA 4XTRC 3GNML 4Z18A 2D0HA 2WKOF 5E56A 5E2JA 4E5XB 1IX2A 5TH2A 2XQYK 1D5IL 4YL9A 2NR6C 3T0VA 4H8PA 1ZWIB 3RJOA 1JXGA 2ZJSL 2MKLC 3W5MA 4OQ1A 4I7ZC 4PWHA 2HG0A 3C8DA 3EOTH 4GRWE 1GW6A 5IBLD 5BQ7B 5IB4B 5ITBH 3VMOA 1NBQA 1W72L 3QQNA 1AOHA 3HMWL 2UXFA 2HRPH 3A6BL 4GMSH 4OZHA 3ARUA 5AB2A 4P2RD 3IBOA 4PS4H 2X87A 3APDA 1AH1A 3NSXA 2LU5A 3QA3B 3SDXA 3WEXB 1BF8A 3FBQA 4IU3A 1ES0A 4P3DB 4TTDD 2B0SH 5I8EA 5FIEA 2EXWD 4YH6A 5F1KC 1DQIA 5F88A 2MNUA 3O6FC 2P1YA 1Z3RA 5D1QE 4MS8C 3U79A 5FYLH 2OMBA 3S35H 3N0PB 3NPSC 1MVFA 2BOCB 1KEMH 4OBSA 3NSCA 2Y69B 3F7LA 2EJ1A 4KX8A 4Y4KC 4PUBL 3CXDH 3AAZA 4D0DA 2Q0ZX 4YWGH 1EHNA 1N8ZA 4JQXC 1RP8A 3AITA 2XSKA 4TVSa 4FTVD 5DRWA 4CVXA 3NZ8B 4R4FH 1OW0C 5D6CB 2CIIA 1DFBH 4F20A 3KMDA 2VXSH 3MRJB 5FO7B 4J3OC 1A3ZA 1J9TA 1U8CA 2N3JA 1S3RA 1DJGA 1FPTH 3ENEA 4ZG1A 3RIFF 3V7AE 5F96H 5HYJE 1TTFA 2JVUA 3QC5X 4RRPG 1XQ4A 5M94B 1MF2L 4QRFA 1T1ZA 2ZOTA 1W72A 4XAWH 1IBGL 2OTWA 3M6DA 3BQUA 4WV1C 1KDIA 3CBKB 1DDHA 5EU7E 2GAZA 2WBJD 1GJIA 5G5DB 1KCBA 2Q7YB 3H3KA 2BNRB 4CVWA 5FCUH 4Z3FA 1G7JB 2NCMA 4X7SH 4KZEH 4KRPC 4NO0A 1G5AA 1EZUA 3AS2A 2VC2L 4XMTA 3IE4A 4XX1E 1CVRA 4TUKH 43CAA 1UEYA 4DERA 4Z3HA 1QSFE 2L7JA 4ECNA 2A5UA 3SDDB 1E5BA 1ZTXH 2I85A 2YR3A 3KBHE 3FQNB 4ONGH 4YDNA 1I1AA 5K59F 1MHPH 1AFVL 1AS8A 5IEHB 5INDA 5J6HB 1UOVA 1G7IB 3U48A 5ISZD 3FQUA 1MI5D 4PJCE 2WQVA 5A43C 1X5LA 3VDBA 3FQYA 5GQBA 4IOFD 3LXUX 4A2EA 4I9WD 4HK3N 3UERA 4NHCH 5F3BB 1WRFA 4MRCA 5A7BA 5C0IA 2TSAA 1CI5A 4Y2DC 3EYVA 5HDLA 5AKTA 1MWAB 1PLAA 3EJQA 5SX4H 1R3IH 1UA6H 2D31A 3EZJB 5G55A 4AQAB 1F8TH 1QATA 3ZE0F 4BZ2H 1IE5A 3QORD 4HXBL 4XBGB 4KX9A 3ALWA 2FJHA 4EQ2A 3MBEA 4FQLL 4A2MA 2Y7LA 4JE4B 1D6EA 3ZVVA 3GLZA 4M3JA 1KELL 3EJTA 3GSOB 4N3TA 3BAYA 4FG2A 4GG8A 2XWJB 3EDKA 4HWZB 3T65A 5AVVB 3NZSA 5F7NC 1JPSH 1TXKA 4P5KB 2YK1L 3AREC 2E5EA 2SODB 1WS8A 3D51A 3Q5OA 3RL2A 1EDQA 4UAHA 1TFPA 1KLGB 1RZQA 1T5WA 3MV01 3MJ9L 3IU3B 4AWJC 2HX8A 1MELA 2FTAA 2X6CA 1VA9A 3BXNA 3DPBA 4HS8L 4M5YH 5T3XL 2DI8A 3QDJB 1GC1L 2FD6H 4G6FD 1HXMB 4RAVB 4QXVA 4FD0A 4D9QE 4CJ0A 1HHHA 2KMWA 5CLXA 3FCTA 4DN4L 1IQDA 5J9PB 4Y7OC 1WE5A 1E4KC 2J1XA 4Y4FB 1NCWH 1L9NA 4NM4H 4K5NA 3LKPA 3VW3H 4TNVF 1G4MA 3C2AH 4X5WB 2V37A 2ADIA 2WKGA 1VLXA 4JFXB 1LE5B 4OCRL 4XXDA 3VRJB 4YO0B 5TE6L 2CZNA 1VEMA 1KGYE 2W81C 5KJRH 4OBRA 2C1OA 2CO1A 3SQOH 3P0VL 1QEXA 1WFMA 3L5XL 4PGJA 1JHLH 2WNGA 3U1PA 2VLJB 5I15L 1E3FA 1KT2B 3GI8L 1YYLL 4TRPH 5CEZD 4QAMB 3O4LB 3WUWB 3MRFA 3JBG7 2P8PB 4RESB 1MLBB 2OXGB 4KK5C 3G7TA 3K0WA 2BY0A 4LVHB 5BRZA 2OI9B 1CLYH 2X4UB 4KJPD 3TH3T 1RZKC 4K3JH 3ESNA 4AYFA 2XZQL 3JV0A 2OTUB 5ECGA 4ZSOA 3MJ9A 1T0OA 5MP6L 3VRIA 3VG0L 3WSQH 5JTWA 4ZUUA 4YDJB 2YPLD 1S3KL 4KDTC 2WW8A 5KVDL 5CD5C 3QIUD 2WLYA 2XPYA 3R06B 3SGDH 4N0FA 4XPHL 2BNUA 1RURL 1T7VA 5KTEH 1DO6A 4M5SA 4QDGA 5HPMA 5DUBA 3KEDA 1AC6A 5IB5A 1FDLL 3O6KL 2F8OA 1I9JL 1JNHA 1OGAD 3FQWB 4NQDD 4JAMB 4XMZA 5EDXA 4AL8H 3CH1B 3B7UX 2AJUL 2VZUA 5E9AA 5CD3B 4MJ6A 4NI3A 1TKWB 3ELAT 5I1HL 2WQ8A 2RGSA 4P2OC 4OKDA 5JXAH 2AV1A 4O4YL 1KWKA 4UT9L 3AU1B 5HHOA 4NNYA 3C08L 4KI5F 3GFUA 4HP5A 3TZVB 4ENEC 3JZYA 1BD2D 1QD0A 4UTAL 3KWWB 5HDBB 2VWEE 3D2UA 1O6TA 3MRRA 3LPGA 5IGXH 3K6NA 1IAKB 1C08B 4KVCL 3GZPA 3E6HB 4B7LA 1VGKA 4LKXA 4QPEA 5IZ7A 5CGMA 1J5IA 3D05A 5D4QA 5TE4L 3TS8A 3VWJD 3IXTA 1QAWA 2FWUA 1FFNA 2YQGA 1DVUA 2ZAIA 5AW5B 1JPST 3N40F 5AENA 7FABH 1ZRUA 1VKXA 1OAXH 1NOFA 2EDEA 3DK0A 1KPUB 4UTCA 3TBTA 1MVYA 4GKZA 1UGKA 4UQCA 4AG4L 3BSGA 2OJ1A 3O2WH 4L4VA 1SUHA 3O9WA 4M62L 3VFUA 1ZDQA 3A67L 1JS4A 5D72L 5IM7B 4GAJL 3RHWF 4BFKA 4UT9A 3PQYA 4K7PH 3T04D 4UTAA 4H1LA 3ZE2B 2I9TA 1EO8L 2APXA 1KBKA 5LKNA 3PWNB 4KHTL 4ZXBB 4ANKA 1FBIL 1IGJA 2NYZA 5CIPA 4JRLA 4QHUB 4OSUH 5I1AB 3HZVA 3ILDA 3IMTA 4LIQL 3ME0A 1IAIL 2EVIA 3GSWB 4EKJA 4WRLA 1PJWA 4PJGA 4XWOD 4OJAA 2CBMA 4FJZA 1CYGA 5JYMA 2EE2A 1QZNA 3PWLB 4I88A 1OWWA 4XO9A 2Z7YA 2FAUA 2HWZH 3W9EA 1KUMA 2WYHA 2VW4A 2A83B 4H8UA 3BAEH 3TVMC 3NMEA 1NIEA 1LWJA 5IUCA 4R26H 4CMHC 1YVLA 4PTUB 3CZFA 3F12B 4L29A 2VERA 3U0TB 5I23A 1HZKA 2PYEE 3DBXA 4F9LA 4K07A 4HIPA 4NIKB 5TJWK 3QPQC 4NYLB 1E2WA 3TJEH 3CHSA 1A3RH 1ORQB 1IIKA 4WJKB 3LVTA 2PETA 4ZQTA 3LKOB 5C0RH 4R3SA 1OKEA 5L2KB 1ID5I 4F15C 2K6WA 2EDJA 4ES9A 4JDTH 1MOEA 2R4SL 4C4KO 1JXKA 3D3VB 3QFGA 4IIQC 3MV7A 5DHEA 5DJXA 3SYPA 3NIGB 2DMGA 2L04A 3RZCD 4M1CD 5AD0B 1SEQL 2WNWA 5C8JB 4U6YB 1SJEB 2F53B 5DO8A 4XWGL 1QASA 4OCYH 1KB5H 3REWA 4N20A 3SQBB 1MCHA 5JUEL 4K15A 4IGBD 1MCWW 1FZJA 1CBJA 4F57H 1QKZH 4GUPA 2DMHA 2VDML 3M17A 5I0DA 4E9SA 2UWEE 4KBPA 3CDGA 4GIAA 5EO9A 2Y36H 3C2SA 6PCYA 3PHSA 2C9UA 2AQTA 4XC1H 3KJ6L 3CQQA 3ESMA 3MRGA 1EDHA 4JY4A 5D7IA 3VU2A 4LSQL 1U4EA 1XMEB 1YQVL 4PWEA 2J73A 4WW2C 1HHGB 3BAXA 5J11C 1QSED 3EGXB 5HHXL 1AXTH 3FU5A 3GMOB 1QNZH 5IR1A 4ODBD 4DFIA 3NPSB 4Y4KB 4ZW6A 5IFAL 4N26A 4RNRA 3T2OA 1O6VA 2ZP0T 3TU6A 4EXPX 2EKJA 2DQCL 3L81A 1P7KB 1YHPA 3GS7A 4NUJB 4PBVC 1NKGA 3RWHA 3QZBA 1AG0A 3U1SH 4X6CF 2ICEC 4P46A 4K5MA 5D70H 3S37L 3KLLA 4IKJA 1WQVT 4GIPD 3WJMA 2IH1B 4BFOA 3S4SG 3ARGC 1CE6B 2XG5A 3DYMA 2ILLA 4DKEL 1A47A 5DJ8B 1J1PL 4HHAA 5ID1A 1DO5A 2YA0A 1SM3H 3Q8FA 3NQIA 2A77H 3BWZA 5IW3A 1JE6A 4WV1B 3L95A 2VKXA 1XDTT 3QIWC 1KMGA 1XGPA 1CICB 1WZ1H 1X7QA 2X4RB 3RG1C 3U7AA 1LP9B 2H26B 3TA3C 4NP4H 5DUMH 3VDCA 5CJBA 2H1LM 1TQUA 3AT8A 5GJTH 2GHZA 2YBRB 2FSDA 3UZEA 4GSRA 2IFGA 3RB7A 1Q9OB 2FWOB 1XVSA 4DTGH 3QJHB 4HIXH 2HN7B 3ULUD 4OKVB 1RUKH 1NCGA 2PR4H 5DJ0B 3ZL2A 5EEVA 2CKBH 2WP3T 1YEWA 2VDNB 3MC0A 3EDFA 4OGYL 5H35B 2IXQA 4D94A 1U8IA 2VZ1A 2FATL 1KCRH 3NN8A 2RR3A 4XCYB 4KZDL 4WCYH 4Z7OF 3RX5A 5FECB 1QQDB 4L8SA 5ABAA 4B95C 5AVYB 3IKCB 4P04A 2ZWLT 2P24A 4RGND 2BZ7A 1DQQA 2DM7A 4Y1AA 3VXMB 3W11C 4BK5A 3IDJA 2D3VA 4KMTH 5HVWA 1BQHB 4J28A 1HE8A 5INCB 4LP5A 1LL1A 3D39E 1A6PA 3LPOA 4MJJA 4MWFA 2F74A 1U36A 3T0EC 2EVFA 2QQQA 3IMVA 4PMFA 5HDOA 3OKKB 4BSVB 2XXFA 4PHZA 4KQ4H 4GBXD 1MG2C 3H3BC 4N2AA 1U6AH 4NNXB 2CK0L 3P4NA 3S3JA 2M83A 4PJIA 1JFQH 3KL0A 1JDDA 2K7PA 3LOWA 2Z8SA 5D7LE 3LEXA 3F7KA 1EXGA 4N9GA 2ESVB 4NQCE 2LE9A 5TK4A 3QCVL 3MKKA 2VITA 2YAOA 1S7RB 3AREB 4FTDA 4BE6A 4Q2ZA 3LZRA 5DK2B 3T5WA 5K9QG 3CXFA 5E00B 2IH3B 3ZLQC 2VRAA 4HXAL 1EJ8A 1SBSL 2O5ZH 4KVPA 1BJ1J 1U8OA 2VMDA 4LQFL 1FAIL 4GW5A 3LPWA 4I0PA 3ZZQA 4HDIB 4WFGE 2XIBA 1ETA1 5BS0D 4KKCD 2DQEL 1CXKA 3NIFB 1IGCH 2KC0A 3QZNA 1MHEB 4Z7VB 5H2BB 5B39G 4F9LC 4FL4C 3U30C 1RJCA 5ADOL 5JW3H 1PDKB 5JMRA 2XWZA 3Q3GA 2LAGB 3SBPA 1H6EA 3HAEG 4EDWL 3UIZA 1M2VA 2FO4B 5HYJD 1OGTA 1X4ZA 2V2TA 3SBRA 1HKLL 2Y72A 1R6VA 4XNXH 1OTSD 1FN4A 3OAYH 4PJ8B 1W16A 3QIBC 1A1MB 1CS6A 5HVGB 2K4WA 4HKZB 6CGTA 3F01A 1MQKH 4RX4D 4PRHA 2AQ1A 1JTTA 1NCHA 3BP5A 3L3HA 4DVBA 3MI6A 1W0YT 4PCSA 1VADB 4KAQL 5HHNB 3VH8A 4XPTL 4MLIA 1I8KB 4DOHB 3ZSSA 3E80A 5JLZB 3IFLL 2B1HL 2OMXA 2JTYA 3OQRA 3NABL 2VDQH 1U3HC 2QBWA 4XZUA 2OXHB 3KGRA 3NRQA 3ZDXB 1MWOA 5FYKU 1QSFD 3V4LA 3BAIA 4M5TA 2GTZB 3R7RA 1KCLA 4FTVA 3ZT5A 3UPRA 3Q8EA 3MMEA 4BSJA 4BGDA 1XSJA 4TUJA 3THML 1JI1A 1F18A 2ODIA 4HBCL 3SE3A 4LE8A 4PJXE 4ZBJA 4ZPVA 3UTTB 1ONQA 1RUML 2VYRE 2VO5A 1A7OL 3F7VB 4DSYA 1EMTL 3O2VL 1RUAL 5C3LD 1YUHB 3N1QC 2J2ZB 3POHA 2QSQA 2XU9A 3C60C 4JKLA 3VSVA 1L7TL 4J3XA 2R0ZH 4HCGA 5FFLA 1WK0A 1I9RH 4UV7H 2P46B 4HWNA 2WBJA 3VXPB 1NJ9A 5EOCH 5CBEA 1FHNA 1S5HA 4G8FA 2NY0B 4I5BB 4G5AA 1DJZA 4X80H 4TYUA 1RP9A 3BKMH 4EPSA 2A6DA 3TJHD 4U1IA 1ULVA 3ARBC 1XBRA 4I4WB 4XVOA 3R8BB 1GZQA 1H9DA 4KRNA 3SKUD 2MHAB 1X5YA 2CRMA 2HPOA 3A22A 3CX5J 1N4XL 1WA2X 3FCBA 3IJSB 5E51A 3NH7H 5IY5B 4UB0H 1UQSA 3ZT7A 2FYVA 4OZFG 3WKML 5GIRA 4A2DA 4A68A 1SUJA 1N12A 2JJSA 4IOSA 3SPHA 3OLGA 5ISZA 1R5VB 1P84J 1CBVL 5F7WC 4QUOA 1G0YR 2DZEA 3I6KA 5HGBA 4JKWA 5F7AA 5AZ2L 2MCPH 3FB5B 4KUZL 2HT2D 4Q6IB 3R0NA 2UVEA 1P7BA 2YD6A 2OR9H 2WWKT 2FJGB 3DARA 2DLHA 3WD5H 4N2DA 4YC2B 1COBA 4X9YA 3OG6B 1IBYA 3NJLA 3RPIB 3HUJA 4D9QD 3L5HA 4GRLA 3FRPG 3QQ3A 5EN3A 1IGIL 3ZL4L 4MDIB 5TDNA 3OLIA 3QORA 2AFNA 3L17A 5JHLH 4KNTA 1R24B 2OX5B 4MJ5B 4WHDA 2Q87A 3T3MF 4ELMA 3NJIA 4NQEE 4R83A 2MCG1 3PL6A 1VFBB 3LN5A 4KTEH 5K9OA 4P0DA 5J57B 1ND0B 2R1WB 4LLYA 5FO9A 4UQ3B 2K4AA 2WLMA 3QRGH 1NGQH 1RMFL 1CF8H 3JUZA 4JL2A 1SFHA 4QLRA 4WSKA 5I0WA 5DYOA 1TYRA 3RWIB 4Q9BA 1OCZB 4HD5A 4FI6A 4QXTA 3FTXA 1TYJA 2Z35A 5B21A 1TCRA 2MJWA 3VQLA 1TCMA 3N1MC 1MIMH 4YUEL 4EZJA 4TQPA 1T3FA 3FTGA 2F2HA 2KKQA 4M56A 4XMKL 2X38A 3P9WB 1GGBL 1LK3H 2IV8A 3T2LA 1GJUA 3WTSA 3O3AB 4FQXD 1A4JB 3VI4E 1PSKH 2BK8A 3D3VE 3GSVA 1WT5A 3NIGE 5DC9B 1TLMA 2J3SA 1XH2A 2DN7A 1BLNA 4MBOA 3W57A 1U2HA 3IETB 3UTQB 1Y0LA 4AQ1B 4CADB 4LU5H 5D2NA 3PABB 3DHPA 4YQXL 1FG2B 1F4XL 5LNDA 3L48A 3HS9A 4H1LG 3MRIB 1OD9A 1E5AA 4HALA 5ABDE 2YZ8A 3FRUB 2FJFB 3T1FA 1S9YB 1YN7B 2EXYD 1WFUA 4U33A 4D8OA 5E2WL 1T1YA 4NCC1 4PY8J 1QACA 5IUSA 2VMCA 1LO2L 2EDKA 4KRMB 4NEHB 5AOIA 4IJ3C 4OB5H 3DVNA 2BSRB 1U21A 3D4CA 3HNSH 2DTMH 3NYKA 4M02A 1T0MB 3BH8B 3H0TA 4X9HA 5DURB 4KKAC 1T0NA 3CCHA 5TQ2L 1ZY9A 3BKYL 1JZHA 1U8HB 1YN6A 5EH1A 1GRWA 2NNAA 5I24A 4Q58C 1N6VA 3L3DB 5KYWA 2D8KA 3CFQA 1IQWH 3MRQA 1AZVA 2W0KA 5DHVH 3GT6A 2FQGA 1IVLA 4C56B 1CGXA 1U92B 1VAHA 3KS0J 8PAZA 4D0CB 1R47A 3V6ZA 4Z7NE 1F41A 3QUZD 4G72B 2VXTH 2VUKA 1F97A 4HJJH 5FYJL 3QEQE 1FIEA 3SGDI 1OGAA 5DJ2A 2QZQA 4Z7WE 4AK2A 2IPKA 2R0KH 3CUPA 2WXRA 1YEIH 3IN2A 1T1XA 2HTLC 2QGEA 2ALWA 2XZCL 3LVEA 3X3FL 3FUIA 3EW3B 2X4OB 2FX8H 1G94A 4YSAA 4AQEA 3TF4A 3SPJA 1TTCA 3QCTH 5IJDC 1XSKA 2X10A 5EHFA 3SKMA 1CJYA 3HC0A 5J11B 1YNTB 1QPXA 2YD9A 3MZTA 4N0UA 5L4FA 5I66B 4FGMA 4LSVL 5G4MA 1OAUH 2VSDA 3JV5A 4LCWD 2F5AH 3PJLA 3QO0A 3T2NL 1BYPA 4MXWL 3P2DA 4PJDA 3V0FA 1E4XH 1G0XA 2EUWA 3S36H 3QP3A 3KLAA 1E30A 1AHWC 3GBLA 2VR5A 4V2CB 4PVLA 2F61A 3BUQA 1TJHH 1F6FB 1NEZA 3K6SB 4MD4A 1W91A 1I8LC 3NPZB 1UXMA 4MJ4A 4QTIH 5HJ3A 5F0PB 1OALA 1HESA 2VLRE 2DQDL 6FABL 2DICA 3RU8L 3GSQB 3TGXA 1EHLH 3UOAB 1DBBH 3QQXA 3R7QA 1YMHA 3K2IA 3BVXA 1NC4B 2LABA 3LHAA 4N2EA 1NMCC 4TSAL 4JM2B 5H94B 2DI7A 3UTZB 5FHBL 4V2BA 1CFQA 2DS4A 3VFTB 2NY3B 1A02N 5DQJA 4NC2B 4ZQKA 3SDAB 3RUGB 1GS8A 2PO6C 4QTFA 4R2GC 3TA3B 3DSNB 3TYFA 3UBGA 2EIEA 3ATBA 4N2GA 5DJDA 4Q97A 3GLEA 2PYED 3EJPA 5GRXG 2VW6A 3MJGX 3ARDA 1YMME 3EYQC 3KDMB 2FEDD 2YKLH 4DGYH 1QRNE 4KWUA 1L9SA 4E9YA 4X5XB 2DYPB 1H3GA 2D9QB 4FYTA 5DXWA 4CN1A 4F37K 3JVGC 2MQCA 5B1JC 3UX9B 4LO9A 1NFIB 3VFRA 1OARH 1HZHH 4GLRH 4H2CA 1KGIA 2GIYA 4D3CL 2VUOA 1M3IA 2X09A 5BMFL 3QJUB 2XX1A 3QDMB 2OSXA 3GZQA 3K5SA 4CVZB 4JZNA 3FOLA 4QRPA 4XGZB 2NY7L 4PP1D 1RJZA 3N85L 2G9HB 3WCYA 5FFOA 4MDJB 3LB6D 4OI7A 2FL5B 2XV2A 2C3VB 2J8UF 3IAQA 3O41B 5GSVA 4I1NB 4W9KC 3T0EB 4DKFH 2KERA 2VQ4A 1KOAA 2NT0A 3ZDYF 3TT3H 1KZQA 1NMBL 3HLAB 3IMSA 1R19A 4HPOL 4S2SA 4CU7A 1RZ8B 3ABMB 1SJXA 3TEWA 5EIQA 1OTUC 3MUZ1 1Q9WB 5F3HA 4MAYA 2B4CH 1IV8A 4XMLH 1E6OH 4DUWA 4GO9A 1FYHB 1JP5A 5MEOA 1YJDL 2AAVA 3ROOA 2LVCA 3ETTA 4U7KA 4V1DB 5DRZA 4NPKA 2F19H 5BVJA 1YECH 1Q0XL 2VR6A 1A6TB 1K8DA 1XGZA 2A9DA 3ISYA 3IRPX 5DZLA 1NPJA 2BNRD 2A4ZA 4OLYH 3EGDA 3HHMA 4UT7H 1RU9L 4JG5A 4LASL 1T7ZA 5DUJA 5EIIG 1CE1L 5EBGA 1B6DA 3I74A 2NMSA 3H3PL 5JOPE 5LNGA 4PB9L 3TV8A 1KJMA 1QFWL 1B4JH 3MRPA 3VD1A 3LZFH 1XGTA 2Z91B 5D6DC 4ZO7A 1VACA 2G9KA 1PAMA 1IMHC 2XRAL 1OPOA 2XN9E 3UYRL 3TCLB 3JV6A 4X8JB 3ZO9A 4A7GF 2P3YA 4J7RA 4MCZB 1RJYA 5DI8A 3KYOB 2DDQL 3ARRA 4KDWA 1DVFA 4AQ8A 1M3JA 4U4BA 3RGVA 1Q1JH 1NCDH 3GXTA 4KVNH 4NRXA 2X1OA 1AP2A 4NZUH 5C0BB 3WV0A 4BGLA 1S7TA 2Y7NA 4LARH 3VU1A 3MV9B 2WXNA 4A7VA 1TTGA 1UXWB 25C8H 3T8XA 5GGRB 3SOTA 3EJCA 3U9PL 5TDPA 5FM5M 1NDGB 3U0WL 1YPZA 4U6TA 5C0DA 2W9EH 5IK3A 3SCMB 1GZHA 3VD7A 2F0CA 2PWFA 1B4RA 2X4TA 2BVQA 3FN0L 4XCCH 5KS9B 2C9VA 5E95B 3BGMA 1N68A 3HR5B 1T5XB 1T04A 5A1AA 4F7MB 4Z0XB 1G7MA 3H8NA 1F6LL 1FLRH 2FX7H 1XGQA 4YAQB 5FEBA 4EAEA 2DLFH 1KFGA 4FULA 1DQJA 2HFEA 3ABGA 3OXRA 4MASA 4ORGA 3VH8G 3ECBA 1KB5B 4J4PA 4MYWB 2WTRB 1KB3A 5ESQA 1IJ9A 3D39D 3IGAB 3VRLE 3TO4B 4YMPA 2OMTB 4JO3H 5GZND 1AY1L 1BX2B 3SEPA 4JPIB 4PJ5A 1MJ7H 4KPHH 5GGTH 1BZQK 2OSYA 1MHCB 2P28B 4MTMA 1UB6B 4QTHA 1NCUA 4G9FB 4NZ8A 5CLZA 4YNYA 1WUZA 5C0ND 1BVLA 4PRIB 4X8XA 3VXRA 3NRPA 2MCAA 1LQSR 3FB8B 4XO8A 1UACH 1NOLA 4BK4A 4Q9CA 5D7LD 4F2MA 1T20A 4ZJ9A 3TFKC 4NQCD 3B2PA 4K94L 4DGVL 2CALA 3EYOB 4GW4A 5DEGB 4P2AA 1H9VA 2BFVL 2VLJD 1FO0B 3GXUB 2WVSA 4YXHL 4EOWL 5D1XC 5B4MD 2FT6A 4PJFB 2P5WE 4WFGD 5HJDA 4PJHA 3SGKC 3UACA 1PIFA 2BVUA 2N7SA 3MJ7A 3CSFA 3PXLA 3OX8A 4JE0A 4ABUA 1M2OA 4YE4L 4ATWA 3QJRB 3ARDC 4ODUB 3ZE1B 2V5MA 3HRZC 2Y1ZA 1MFCH 2X89A 4QRBA 2R8SH 2IWEA 1IM3A 3B34A 3ETBF 5F7DA 5FUOL 1FVEA 2WNXA 3P77A 4ONHA 3OLEA 3MX0A 4KJWC 5C07A 4WW1A 1NDMA 4G8AC 1X5IA 3UMNA 3N44B 1I7TB 3CFUA 4ZDHB 4E9RA 2CGYA 3IWUA 3QZLA 4XPGL 2G30A 3TBWB 2XWTB 3F2LA 3IVKB 5CJOL 4JQIL 5LDSA 4WFED 5D1QA 1FRGH 1DQDL 1TFHA 2F1BA 2EUZA 3FBKA 3ATEA 3LX9A 4IIZA 5LGHL 3H9YA 3UTSA 1IRAY 3DX9B 5GGUA 4EDXA 2O26U 1MJUL 4OW6A 1JZ4A 3VQ1C 3WTWA 3P02A 1UH3A 1NDTA 4S10A 3ROLB 1NUFA 2EACA 3QJFB 4EI6A 1YEEL 2X3AA 3N0AA 5I74B 2YXVA 2JKSA 3GLDA 3EO0B 5D9SA 4WI8A 3FC8A 1T6BX 3HG1E 2CNYA 5EU3B 4ETQA 2IGTA 4JQVA 3KXFB 4HT1H 1JGVH 1ZHLA 5HYJA 1JPFB 3KPQA 3LRMA 5IIEB 2Y4SA 3NGBC 3V5HB 4NENB 2APTA 1YQ2A 4NPJA 2O30A 1F4WH 3LEYL 1YEFH 4LVNB 1QEWB 4RX4A 3H2QA 1RZGA 4Q6YA 1ML0A 3SODB 1FC1A 4LPXA 4ONFL 4EBQL 3MO1A 4IBSA 1KENH 5E1AA 1LYQA 4U3SB 4P57A 4FF9A 4IJ3B 5BUPA 3VFMA 4RWYL 1BEYH 4JFQB 4PS8A 3L3OC 4G9DB 4JQIA 2BFGA 4F1SA 2AJYL 4APXB 3KPRA 4JGJA 3DO4A 4NI6A 4UM9D 3FU7A 1QSFA 5HDRA 1L5GA 3PWPB 2B4CC 4JDEB 1XF5A 4MBRA 3N06B 1OOAA 5JOFA 1NGZB 1HNYA 4BCXA 2FQEA 2DLGA 2GJZA 4LSTL 4R0LA 5J1AA 3GIVA 4PJCA 4XBPA 3PNWB 4L9LC 4H88L 2TSBA 4G2AA 3GMNB 2Y06H 4ZXBD 3LPFA 3BWUC 5E9DB 3H7BA 1A7RL 5GHWH 2NY6B 5HHQB 2K78A 2YUXA 1CUOA 2FO1A 5DJCA 2EDFA 4DGIL 4GKLA 2Y07L 1G6RL 3NCYS 1WV7T 4HJUA 1HDMA 2G5BB 4O2FA 2YLHA 5JIDA 4F7TA 1X3DA 3ILEA 3WTTA 4YHPA 1BVNT 5CN2A 2WZ5A 2JIXD 3V52L 4XNUH 4NQED 1EAJA 3LKNB 1EDYA 4Z7IA 2VTFA 1RULL 3F7PC 3QJTB 1M1XA 5LG1A 3BESR 3INUL 1AHWB 4J1UB 2XVKA 5DD6A 5JDSA 4HUXB 3JWOH 4S1DD 2BX5A 2XFXB 3PHAA 4ZS7L 1RZ7H 4CGUB 1F02I