5LN8A

Crystal structure of self-complemented myfa, the major subunit of myf fimbriae from yersinia enterocolitica, in complex with galactose
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
123
Chain Sequence
FSVEFKATENEIVSGKLDADTPAFHLVMSDSGEHKGWNVRPTGASEGGQMVSADGTRVDLHTNELSWDNDHWWIDDGSERVEATFFLAAGDEVKAGEYQFTGRVEEYVPTVINSKDISATKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fimbrial protein MyfA,Fimbrial protein MyfA
publication title Structural basis for Myf and Psa fimbriae-mediated tropism of pathogenic strains of Yersinia for host tissues.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell adhesion
total genus 23
structure length 123
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ln8A00
5LNDA 4F8LA 5LN4A 5LN8A 4F8OA 4F8NA 5LO7A 4F8PA
chains in the Genus database with same CATH superfamily
1XB8A 4LCCC 4XPGH 1DQLH 1ETJA 3T0XA 3OHMB 3W11D 2IAND 2DMHA 1Y6MR 4G6KL 3CZEA 4HJJH 1YEEH 1LMKA 1A1OB 4FL4C 4GAGH 1JZ7A 5MEQB 4TPRL 4OZFA 5HP5A 5ICYB 3HB3B 3CFDA 4RZKA 5D7HA 3U1PA 3UG3A 3OLIA 1OAKL 4BZYA 1KTLB 2HYMA 3N40P 3QWRA 1H3VA 5CHNA 5I5JA 4NRYB 3IDIB 1M42A 4D0CA 4Q6IA 3D9AH 5L7XH 4U6YB 3C9NA 3E3QC 4HBCL 2GSGB 4LOFA 1DQMH 4WNSA 2WP3T 5J9PB 1P1ZA 1WO2A 1GMIA 3QUMA 1FH5L 1XTLA 3ETSA 4U6TA 4PJHF 4HMCA 4UQAA 3RY4A 1Q1JL 3WG7B 3IFOA 1HZKA 4XP1L 5FK9B 2JV6A 3QUKB 2DI9A 4JFYA 1IGIL 1BWMA 1H8SA 1AKJD 1YYMH 2NR6C 1T1YA 5A2KH 4N5ED 4I2XE 3TO4A 2BNQA 3DURA 2IAMA 3LKQB 4GXFA 5BRZA 3RWCB 5D7EA 4GAAA 3UBXB 1R3KB 1PKQE 1QRNB 3MUJA 3F58H 4JFFB 4OZFG 4WO4C 3LRLA 1BFOA 3QXUA 3UTPE 3BUTA 2YBRB 2FD6H 5F0MB 5IIEA 2HN7B 4TVPD 4LSSL 5CJ8A 2XQBH 3QGVA 1Z7JA 4PV9A 3SODB 1UA7A 1OAZL 4IBLT 4KRMB 8CGTA 1Z6JT 1NINA 5IMLA 1I9RH 5CU9A 3IE4A 2B0SH 5TDPA 1WS8A 4ETQB 3DUHA 3QZPA 1RJLA 2X6VA 3RWJB 3MRLA 5IB1A 5B1KA 1L6ZA 1LTXA 3BSZL 3KGRA 3UTTA 3L95B 2KS0A 1QFWH 1MRCL 4B9GA 1PNDA 2GBVA 4JPSA 4EXPX 4HLEA 1RSFA 3L3OB 4I8DA 1HHHA 2ZG2A 3JQOB 3D4YA 3FAWA 1M1XB 1KT2A 4PM1A 3K91A 1P4LB 2MJWA 3NN8B 3DJSA 3V4VA 4NC1C 1N8ZB 2XRAH 5CGBA 3B56A 5EZLB 1JPSH 5BZDB 1EAPA 2OMZB 4TF4A 1QLEB 1U8NA 4Y19E 1BVNT 4NOFA 3ZZSA 1FCGA 2L4OA 5HGHA 5E08L 4NO2A 1H6UA 3IJ8A 4M5YL 5F1NB 4XP9H 1CGVA 4V11A 1TTAA 4DGUA 2YC1A 1D6EB 5DJ8A 1BVOA 3D33A 1RIHH 4J2QA 4NO3B 5AAWC 4LNRB 1TETL 5E1AB 1V3MA 3S3PA 4LF3A 3NSYA 4GQQA 3ULUC 5E5UB 4FYQA 5AYQA 4J28A 4NNXB 3HIZA 3J7HA 4XPGL 1DQLL 1LK2B 3RUGB 2VRKA 4HPHA 1FYHB 2ZKXA 4OGZA 5IJVA 5I1LA 2F7PA 4HJJL 1FFOB 1YEEL 4GAGL 1AGCA 4HFWA 3H85A 2WHVA 1XGTA 4KRLB 3UAFA 1MHHB 2VM9A 1AZZC 2XV3A 3ARZA 2J5WA 4WFFE 5JXEC 1F3JB 1QUPA 2V4LA 2ICEB 3GKZA 1CFQB 3JZYA 4LSUH 5CEXA 4KZCA 5BUAA 3D9AL 1MZZA 4H0LC 5L7XL 4N3UA 5CBAB 1DQML 2V3DA 3NZ8A 3CDYA 3U2IA 1Z3RA 3WTVA 1YEKH 2NYYD 5C09D 4EZKA 3D39A 3FTVA 3HHSA 2Z4QB 1R5IA 2NZIA 2HT4D 3WHXA 3AB0C 5AB2A 1BEYH 3QCVL 1YYML 4LLMA 1KIQB 1BCIA 1I7UB 2DDQH 2IBZX 1GYCA 3ARYA 3MGOB 1PEWA 1WIOA 3EOAB 3RLSA 3WNKA 4IMKA 5JA8B 4KXCA 4NBYB 1YYLH 3F12A 2K7PA 4IGBB 4JFXB 4Y4FB 3F58L 3EJYC 4WEMB 2P7TB 3D87B 3RWHA 2OMUB 5BOZG 4B3VA 3MROB 3K1DA 4FXLA 2C3HA 4PHXA 5I2IB 3D30A 1JIBA 5CIPB 1DQKA 2VXVH 2XQBL 1I8IB 4FNQA 3DX4A 4D9RE 3EFDH 4Z7QB 1I9RL 2GHWB 2B0SL 1X7TA 3BJ91 2D3LA 5EZOH 1RAMA 4L0ZA 3T4AC 3HS0C 4QAWA 4E0RB 1QFWL 1ZV2A 4N90D 5BS0A 1NWOA 3STLA 5DVLA 1EJ6A 3L3DA 1E27B 1HXKA 2L7QA 2QV2A 1NKRA 3ZX1A 4DP8X 1BAWA 1V55B 1C8QA 5C0GB 5GPRA 1KBBA 1K8IA 4GP5B 1PZ5B 2WWMD 2YD9A 3WN5B 1VGKB 3GSVA 3C6SA 2Z35B 4APXA 3HJ0A 2OS7A 2OZ4A 3D69A 1FN4B 3S3SA 3F04A 3ARGB 2XRAL 3F62A 3BP5B 4JRYE 2DLFH 4PV8A 3MNVB 2VL5A 4KTGA 3HPJB 1ZHNA 3ZT7A 2FHFA 4I1NB 2RIKA 4RFEA 4DERA 2VR6A 3L1EA 1B0GB 4XP9L 5B1JA 1Q9KA 3EJCA 1JWSB 1OP9A 5CILH 1UJ3A 3C09B 2E8YA 4QGYA 5DQJB 3S37H 1RIHL 2FUQA 4FTVE 5T5FA 1GSKA 3GJFH 5A2LH 4L3EB 4HK3J 3IDXH 3KE0A 4N2BA 5DHEA 1NPUA 3ZE1F 2VDRH 3KS0J 2IIJA 4AYDC 1QR1A 2WLKA 1NBYB 4MD0B 5DMGC 5C0EB 3GZQA 4ZFOL 4LCWD 5ENWA 4YC2C 2BSCA 4MNGB 2F19H 3BUBA 5KYXB 2PWEA 2MOVA 3D25B 3QCUH 4CJ1A 4XNMB 4WHYG 1ESOA 3WJLA 3SYOA 3QRFM 1T20A 3GPEA 1PG7H 4I89A 3C5SA 3PL6C 4O2EB 4LSUL 1IC1A 2DM3A 3B9EA 5ID1B 2R0ZH 5B3JF 4HIIB 1ZHLA 3AFLA 4L1DA 2XWDA 1YEKL 3DOIA 2WGNB 4WI0A 4MCZA 4P2RB 4IRSB 3LSOA 3FBQA 3LZFH 3P0YH 4OI9A 3GWJA 4X6DE 3WNNA 1U8LA 1D5ZB 3CK0H 3MNZA 1T0MB 2RD0A 3NFPA 3CZSA 4D0BA 1BEYL 2W07B 4EZMA 5AUMB 1NGZB 2DDQL 2OYLA 1ZGLM 2CJUH 5ES4B 4P46B 4HCIA 2PPDA 1BJ1J 1U91A 2PXYD 1YYLL 4KITB 4JFZH 1A0QH 4DH2A 4LP8A 2F54B 2DM4A 4FRWA 1IBGH 4G8AC 4WWID 1ZPUA 1GJIA 4WW2A 3SDCC 5FR3A 1K2DA 2YUVA 3BYYA 1MFBH 1UD2A 3G6JF 5C71A 1SLXA 2L8AA 5CCHE 1X4ZA 4TUOB 3PAZA 4ZYKA 2UZYA 3PV6B 5FOBB 3L3HB 4IRJA 3EFDL 3PHQB 1E4XH 4PJ7A 2P1YA 3BI9X 4ZOCA 3TX4A 3IFPB 2XKNA 3MBXH 4LLQB 3KPQA 5EZOL 2KZ1B 3B5GA 1T0OA 4ZTEA 1L5GA 5D9SB 2W81C 1CGSH 3T6QC 3P4MA 1SHMA 2MKLC 5LKNA 2H3NA 4U6HA 3ZLQC 1M6UA 3NSXA 3OKEA 5F97E 1D7DA 3DX2A 2C7FA 4U0RB 4FQ1H 3QIUB 4KTEH 3S5LG 3N3EA 2JK5B 1XQ4A 3CVCA 1U21A 2DLFL 2BHUA 4KGJA 2ADFH 4NT6A 3DETC 2HT2C 4Q6IC 3VRJB 5F9JB 1BJ8A 2O72A 2E6PA 4EUPA 2AI0L 3LVTA 1FO0H 3KM1A 3UGEA 3UZVA 4HW6A 2NUPA 2CDGB 4ZTPH 4C54A 2CZNA 1LE5B 1PDKA 5CILL 2KQNA 3S37L 1KXTB 1WIUA 4Z0XB 3BWSA 2IDSA 1LHZA 1DZ0A 1BLNA 2EYSA 3IDXL 4AEHH 4AQAA 3CC5A 5D7SH 3BN9D 2VDRL 3WY2A 4K5NA 4LEXH 1E4XI 2VXTH 2F19L 3TO4C 1TLMA 3JV4A 3O4LB 4UU9B 2IAMC 4OV5B 3CFTA 3SYQA 3QCUL 2CPUA 2WNWA 3HNVH 1NGPH 2AV1B 1T7YA 3CVBA 5LHDA 3IXTB 4TQHA 4KK9D 4QT5A 1FFNB 2F15A 4RIRA 4ZMPA 3GQFA 5DI8B 3MJ7A 5D7LD 1PG7L 2AQQA 4K8RD 4DJMA 1QFPA 4X8JB 3GS0A 4OM1H 5IF0B 5KVGE 5BV7C 3GDBA 4FD0A 4Q6KA 2DEWX 1KG0A 3O81A 2R0ZL 1RP9A 3QDMA 1ZVHA 5DEFB 4EUPG 3VFSA 5JW5A 3RFZB 2C7UB 4XH2A 3ARBC 2G2RB 3V4UH 2A9CA 2HFEA 3QUYD 3LZFL 3BVDB 5AALA 3P0YL 1Q72H 4XO4A 2H6PA 3CK0L 3GSWA 4KHXH 4BHUI 2PPEA 4KO6A 5GGRA 4ODUB 1KIPB 3MJ8B 5DURD 2WVVA 5EF0A 3W9DA 1K3IA 3EFOA 3PABA 4X8CA 1UH4A 2CJUL 4L1LA 1QTSA 3NJVA 4Q0XH 1KJ2A 3BZFB 3HMXH 4ALAH 4L4TD 2ITDA 4HVBA 1N19A 4A2HA 2UVEA 3GTTA 4JFZL 1A0QL 3DV6A 3QPXH 5I1GH 1IBGL 3PWNB 5H2BB 4ORGA 4Q4IA 4WWPA 3O2DH 5GGTH 1NCJA 1MFBL 1B2WH 1M7IB 3O6MH 3A5VA 5JIQA 1R9FA 4F2ME 3C8DA 1JXKA 1WRFA 1WFUA 1EDYA 15C8H 2YXMA 3FU7B 4OFVA 4YBQD 1E4XL 1WPCA 4UAHA 2XN9E 4KI5E 3MBXL 4R6UA 3VD4A 2XFXB 3QQ3B 4JS7A 2CHDA 2ZAHA 1CGSL 2AW2A 2XZZA 4V1DA 3HUJE 5EU7E 4CSZA 4DO5A 3WTTA 1QHPA 1H3WM 1GKEA 2CLVA 1E9QB 5IVNA 3WMSA 3JTTB 3AU1A 4LVEA 3OZLA 2F8XC 4KFZC 4FQ1L 1MQKH 3B8SA 4KTEL 2H8PB 3ZYJA 1P7BA 3HG1E 1YPZE 2EZ0D 2LW3A 2W59A 3BUPA 2Y72A 4P4KA 3MRIA 2V9UA 1HHGA 3PWLA 2ADFL 1ID2A 2B7DT 4H8UA 1T0NA 3MXWH 1R5VB 4X4KA 4TNGA 4PJAB 4Y4HC 3I02A 3GHBH 1XX9C 2QPUA 1FO0L 4U1IA 4MB4A 4G9FE 4KI1A 1BM7A 4PJHA 2F74B 2JVUA 5JYMA 4WHTB 1LNUB 3VXMD 4E5XG 5MI0C 1F1AA 1QUNB 2R1YA 4Z7VB 2E7DA 4M61A 4AEHL 3BW9B 1CFTB 3GRWH 4P9HH 3W0WD 4ES9A 5E5MB 5D7SL 2MCMA 2EECA 4JFED 3KJ4C 4EIGB 3TVMB 4NP9A 3BH4A 3ZKND 4W4OA 2B3IA 4LEXL 5FEBA 1JZ3A 4IMKC 2VXTL 2ZSVA 1KELH 4UOZA 4BGDA 1XSKA 1T21A 3EYVA 3HNVL 2GKIA 1YCSA 1NGPL 2P9RA 3L2MA 4FXGA 5LNEA 5TDNB 5DMKB 2FK9A 4AEEA 5HYJB 3FH8A 4HIJA 3EYFA 1MJ8H 3V6BR 4OM1L 2WLIA 5FYLD 2VDQH 1Y07A 2WAQA 4BWUA 5FA4A 5AW7B 4YGVB 1VZGA 1DYZA 3GJFK 3ARED 3NGBC 2CJSA 4NWUH 2DWYA 3GXUB 3ZT6A 3V4UL 1E4WH 2WYIA 3RDJA 4PWGA 3T77A 1EFXD 3DIFB 5DTFA 3T65B 4F7TA 4KHXL 1MRDL 4XBEH 1XMEB 5FKPB 2AQ3A 4QY8B 4X6FB 4UOJA 4HIHB 3MRDB 4NGHH 4BFBD 1N5AB 3N1MC 1KWGA 4Q0XL 4ALAL 3HMXL 5I15H 1ZV9A 1F6AB 1XGUB 1TO4A 4JY4A 2OW6A 3QPXL 5I1GL 5KSVB 3ABGA 5E1GA 5GGTL 3O2DL 3IDUA 4UT9H 4MSWB 3PRZA 2AXGA 1B2WL 3O6ML 2NY0B 4M7ZC 3O9WB 4JJ5B 2J8UF 2PKDA 1BQRA 1NFDE 2QFRA 4S1SH 4XAKD 5B1JC 3MLVH 3CGTA 4CJ0A 32C2B 3UTSD 1V54B 1OGPA 4BDVB 4QRTB 1Q0XH 5MEPB 2E6QA 5CLXA 4JO2H 2ZXWB 3FO2A 1VCAA 4LLUA 4FXKB 3VXNB 4AJVA 5HHXH 2WLYA 3BKYH 4MMZA 3ULVC 5KYWA 1Y1DA 3SPVA 3GUTB 1T7ZA 4ODWA 2V2WB 4YZWA 1WBXB 2A6DA 4UNUA 3UMTA 3UJTH 2PN5A 1MQKL 3WLBA 5AKSA 3PAUA 1IU1A 2W65A 4HKBA 1L0XA 4JZNB 3TA4D 3HC0A 3WJLC 5IV2A 1K85A 3GSNA 1A9BA 1G7QA 1T5XA 4IIQA 3RJOA 3DX7A 4CVZB 4FJ6A 4X2UA 4KJQC 4A7GF 3DTDA 1OSEA 1SEBB 1OSZA 4U05A 5K69A 2XWXA 1D5BB 3MXWL 3NJJA 3INUH 4UZGA 1PLGH 5A7EA 2JE8A 3GHBL 4AV4A 3FCSA 1OQOA 2OMVB 2ZXEB 4QJ3B 1ROCA 4FA8A 2K9FB 3WKNA 3RVTC 4C56D 4NBXB 4ZFFB 2VABB 1UOKA 2DB8A 4WSGA 4P9HL 3GRWL 3QAZC 2ZX8A 5I19H 1L9SA 3KR3H 2NY7H 2NR6D 4HUVA 3SY0A 2EYRA 1UH2A 4CMMA 3BZ4A 2JCWA 2VC2H 2WO4A 4I3RH 2XN2A 2FBOJ 2YAOA 3CSFA 3W81A 4CVXA 2PWFA 3HI1A 4J8RA 4WO4D 3U48A 4LB8A 3F7LA 1JHTB 5E6ZA 4B9KC 3IJEA 5FC9A 1GZQB 4X5WB 2DTMH 1NCTA 3WUWB 1MJ8L 5DJCB 2G5UA 2CQVA 4ZZKA 2VDQL 3RU8H 4D8PB 3H55A 2ICWB 3WUZA 1BVLB 4IRJC 5E23A 5HVWA 4NZUH 3WV0A 3PREA 1GGCH 1GZPA 1WA0X 3D08A 1AQHA 3CSPA 4NWUL 3U4EB 1LD9A 1E4WL 3FFDA 1JF5A 4K5MA 4Q9BA 1ORQB 5GS2D 4YSSA 2UWEF 3PHOA 3T2LA 1AXTH 1HHIB 4Z3JA 5C6PB 3P73A 4XBEL 1EA9C 4JFQA 1TT6A 2XICA 4PWHA 4HWEH 3OAUH 3VRIA 2IG2H 4JRXE 4XXCA 5LGJB 4RWHA 3U9PH 5LGKA 4NGHL 5KS9F 2D0GA 1TU2B 1S9YB 1JG9A 3PQYB 1GGBH 3B9VA 3TO2B 1FNEB 5I15L 1DLHA 1OY3B 3QH3B 1C7SA 1MZYA 4I2XB 2RFXB 2CG9X 3UCQA 5BXFB 4PN6A 1OSYA 2R4RH 4AIOA 3QFJD 4Y5XA 4UT9L 2JMRA 1CLYH 1PKQB 2O6FA 1UASA 1OWWA 4R7DB 4UDUB 3TN0B 3EYOA 4DP7X 1X9LA 4NFBA 3VXPA 4KOBA 4S1SL 5DEZA 4YDMA 2OL3L 3FQTB 1G7IA 3BUQA 1QLRB 1XF4A 1FVEB 2F5AH 1L6PA 3ASWA 2BMKB 3ORJA 3I6LE 1Q0XL 2H9GA 3Q48A 3HAEH 4JO2L 2WQWA 4GIOA 1A7OH 2CUHA 5B7EA 3TBVA 4AIEA 5HHXL 3BKYL 1CQYA 5HYQA 3ULUD 2DI8A 1X9UA 3ZKXC 3NESA 1RURH 5K9KA 1OL0A 5CXPA 1C16B 3VXOA 3QO0B 3UJTL 3OKNB 4BH8B 1I8LA 4PGBB 4NQXB 5JHLA 4I4WA 4HCRA 5IB5B 4JEGB 3VFOB 4A38A 5JXED 2YA0A 5AW5B 1KBWA 4CNIB 3INUL 1FZMA 2D31B 2AZUA 5KVEE 1DVZA 3S3JA 2DIAA 3RVUC 3ZTJG 3IGFA 3DX1A 3UABA 1FCCA 4YHLH 3D09A 3D85A 1YEDA 5G55A 1YEJH 2PYFA 3ZHKA 2EE2A 1VERA 5I19L 3S96B 4JGMA 3KR3L 3SE4A 3WTYA 1COBA 2NY7L 4G8FB 4IRZA 4WV1B 5AAPA 2A2QT 5HVFB 2A4ZA 3VMPA 2VC2L 4I3RL 4P3WA 3H0TB 3GMPA 4HZLB 4WUUD 3QE5A 1Z3GH 3D3VE 3ROLA 1FVCB 2WGXA 3QBTB 3EJYD 4X7SH 5T3XH 2X4SA 4NN5B 4PFEA 2DTML 4Z3EA 3G6JA 4NPJA 1IB5A 3CBKB 3TV3H 3MRGB 5EOTA 3GFUA 3RU8L 2PR9A 5DT1H 4OD2A 2Q86A 4LDOB 4NZUL 2AK4A 1GGCL 4N3TA 1VSCA 4PJEF 5C0CB 5FO9A 1PAZA 2B9BA 4N2OA 1Y18A 3SJVE 4YR6A 2KDYA 3CDGB 1PLCA 4RMSA 1VCBC 2JKTM 1A4JB 3EO1A 3IDGB 2YUWA 3QDJE 4HWEL 2Q6WB 2MOGA 1JCVA 3OAUL 2IG2L 2UV3A 1J8HA 4OLEA 5E4EC 3ZSTA 5A2CA 3U9PL 2VIRB 1L6XA 4M3HA 1E43A 3BPCA 4BH7B 5C3IA 1W8EA 5IVZA 1M2VA 1GGBL 5DRWB 5DYFA 3UZQA 3V6ZA 1X5HA 1R24B 4Z76B 5I8CA 1FZOA 4WI5A 4GKZB 5FUCE 5A43C 2CDFB 3QB7C 4GBXA 3UEZA 3AMKA 2GJ6E 4P4KC 2WK2A 5D7JA 2R4RL 2UXGA 4XX1E 1D9KD 1A22B 2BP0A 3ZTEA 1CLYL 1IZJA 3TWYA 4YO0B 5MP6H 3TBTB 5CP7B 1GGYA 3WJMA 2YIHA 4BSVB 2OK0H 1NC4B 5FB8A 2X1PA 2F5AL 4L1HA 3DO7B 4MCNA 4UYQA 3QZBA 3WFZA 3NJIA 1A7OL 2NZ1A 3EO0B 3WS6C 4UTBA 3D18B 4W4OC 5LQBH 1RURL 3KPOB 1DQQB 5JIIA 2VW4A 4YWGH 4ZDHB 3GBLA 3L6FA 4R96B 3TJEH 4XRCA 4FXGC 2HUHA 1T5KA 2BX5A 1SOSA 3DUSB 3FO1A 3Q5YA 4WEUD 5KBNC 5IVXE 9PCYA 2Y23A 3VA6A 4P57B 5K9OB 3QR2A 1OK8A 1TCMA 3FRPA 3BZEB 3PL6D 3GSUB 1NFIA 1OD9A 2D4FA 2XNAA 4KMQA 4QOKE 3D6GA 3VXRA 4MJIA 2Y7NA 2VDNB 4QR7A 5ICXA 1QFUH 4N0YH 2VUKA 1G1KA 4JRYB 3BSZA 2VQ4A 1CR9H 3ECWA 4AUJA 1HYRC 4YHLL 5IT2H 3VDAA 3KPPB 4ZXBB 3L3JA 1JNJA 1YEJL 5G5DA 5T1KA 5IHZA 3L7EB 2UZIH 3PGDB 4EXKA 3TJPA 1U3ZA 4EMZA 4FTVB 4QHMA 4A68A 5DJ2A 5EZJA 1S7SA 1IGFH 2XZCH 5EO1A 5FDWA 5HI5C 4J5VA 3SKMA 2H6OA 4XBPA 2G9HB 2NY3B 2KPNA 1Z3GL 2JKIS 1CGYA 4JFOB 5AFAA 3EFFA 4X7SL 5T3XL 3SDCD 2AJXH 2PP9A 1LO4H 2NY6B 2ARJB 1S78C 2NSQA 3TV3L 4Z7UB 4N2EA 5DT1L 1NCNA 1H5BC 3BPOC 2DWSA 3P3YA 1YMHA 3PPEA 2A74B 4IW4C 3KH3A 1GYVA 1UADC 1OKEA 2E27H 1RLWA 3L3GB 3SIKA 1MUJA 4GW4A 3DLQR 1ET8A 3P0GB 4JO4H 4NAJA 4KO9A 2ED9A 5LUMA 3HBZA 2K8MA 5LGYA 3W39A 1MI5A 3MGTB 2H32H 1KOAA 4MMZC 4ZSOE 1N18A 2NY2B 4XX5A 4HOWA 4UQEA 4I9XA 3BQVA 1RUPH 4G5ZH 4X6DB 3U0PB 4A7SA 5J89A 2QGEA 4FGMA 2UZXB 3DX9A 1EXHA 4ODXA 3CZGA 2GIXA 4JZJB 5CP3H 5C0NC 2VW7A 4IIQC 2EIEA 3APDA 3FUDA 1JHKH 2Q7YB 1G0XA 5IBUB 4B3EA 2X1QA 1UZGA 3DETD 1AD9A 2HT2D 2EEDA 3C5ZA 4HEMA 5MP6L 1IBFA 2FIRT 1KENH 1LGVA 1F2QA 1MLCB 2C9PA 2YD7A 5ICZB 4BSWB 4L8BA 1NGYA 2OK0L 3VNZA 3SCMA 3ZZQA 1ZSDB 1JMXA 1N6UA 1AS8A 5DJYA 2EAEA 2GK0B 5ALBH 4EZLA 5TFSH 1FSKB 3T6WA 3VWKA 4DSYA 3V4PA 3PDOA 2D7MA 3PG2A 4JMXA 4P5TB 1U8QB 1L9QA 1DJZA 3HI6H 4L9DA 5LQBL 3ABKB 1MQ8A 3EDEA 3TO4D 2BNQD 4YWGL 2IAMD 4OGXH 5BRZD 3BP6A 2Q7AA 3TJEL 1URIA 3H54A 3K3QA 4U31A 4FP8H 5IFJA 2E7LA 3UO1H 3WIFA 5C92A 3K2MC 1L7TH 2FJFB 4UQ2B 1FL6B 4JN1H 3QJQB 3BP4B 3BGFB 5J1AA 5IP4A 3B1UA 3LKPA 5SV3A 3BHBA 3S4SB 2BSDA 3RKDC 1QFUL 3JYCA 4N0YL 2EADA 1G4RA 2OMWB 1W6LA 1CR9L 1VFUA 4XHJC 5IT2L 4NN6C 1WCQA 3CZUB 3UTTD 2A4CA 1AGDA 5A3ID 4HAFA 1KJVA 4N68A 4FLRA 2UZIL 2CKBB 5BPPA 3Q2LA 1KACB 2EYTA 1SOQA 2DD8H 3LNHA 4XXCC 1DUYA 5F9DC 3FRUB 5K33A 5CMAB 2XZCL 3FCBA 3VFWA 4NENB 2EVGA 2VN3A 2YZ8A 1BZ7A 4XOBA 2HG5B 3Q6GH 1K4CB 2BCKA 2BPBA 2YPLA 1K5WA 3NCXA 5BO1H 5AKRA 4Y5XC 3QUXB 3CH1A 2AJXL 1LO4L 2K70A 2CUAA 4ELDA 5I1LB 1NBCA 3QQXA 3IT8D 2J8UA 4NSKA 2WLHA 2IQ9H 4ZNEA 1UACH 2F9BT 3GINA 1F02I 2E27L 2YSSB 4KXDA 4PCTA 5HSFA 2J2ZA 5FM4A 3A21A 3JWDH 4JO4L 3CPLB 1X7QA 3RHWK 3UYRH 4S0SD 2BVPA 4LVHC 5I17A 3W38A 3NFSH 4ZFOA 1CL7I 3V6OE 2FNWA 3IK2A 2A99A 1RUPL 3KW7A 4G5ZL 4PVMA 5FUOH 3I9AA 5ID0A 1SN0A 2NW2B 3NAAH 3NQKA 1I8LC 1QOKA 2GC4C 1G6RB 4XN4A 5L2KB 4J3TA 4N0UA 1EZVX 4WI7A 3GBNH 3T8XB 4YJZL 4MMYA 5CCKH 5L2JA 1JHKL 2ZF9A 3E3QE 2OW7A 2DTSA 3IRCA 3BUYB 5J13B 4K9EH 1IEAB 4HGWA 3MRJB 1XMWA 2COVD 2CGYA 2WXQA 4A7QA 1I3RB 4CDGC 2JB5L 4NOBA 2XPZA 1DVUA 1EWHA 4M8RA 1KENL 5F7KC 3ZPDA 4U1SB 4OLVH 2JKLA 1MLBB 2YA1A 3D39D 4F2MB 3LH8A 3EH5B 4BJLA 2CE6A 3RTLA 5ALBL 5TFSL 2VLRA 4L1BA 3PWPB 3SE4C 2OAAA 4WGVB 3VXTB 1KLUB 3HI6L 3R19A 1WTGT 1X5YA 5K9QI 2WZPA 4OGXL 1IGTA 1BBJB 4FP8L 3UO1L 4WU7B 1L7TL 2COQA 4HUUA 2PMZA 2WZ0A 3GPSA 4MDRA 4ZUWA 3ZSSA 3LZRA 4JN1L 5D1XE 3HG1B 5G2NA 1YPZB 1ND0B 3VFRB 5KYYA 4FMKA 1HCVA 3B5TA 3E9TA 1HDMA 2F53A 2ICES 4G8GE 3I6SA 4HT1H 5T1MA 3N9GH 5DFVC 2NNRA 3MREB 2TSAA 2XG4A 1OP4A 3BKCH 3MRRA 1KCLA 3CDZB 5A6MA 2FEDC 1PFCA 4R0LB 4MAYB 2UWEA 4OKVA 4WEEA 3KYKH 1BXVA 5BS0D 2GCYB 4G9FB 1SN2A 4JB9H 4YSAA 3NCYS 3BO8A 2DD8L 4MKMA 1TYJA 1TZAA 4Y8DC 4JN2A 3T8VA 5KS9A 4FQ2H 3JV0A 2EDBA 4ZPVA 2VQ1A 3TF4A 2GB2A 5DVKA 3GIVB 2C3GA 4XPBH 3Q6GL 3OJ2C 5HYIA 1I1FB 2DQIH 4GBXC 3LRHA 4HWZA 2WVUA 5B38G 3QDGE 3I85A 5D7JC 5BO1L 1F5WA 2W94A 1K8DB 2BCMA 2X1OA 3KXFE 5HDWA 2LT9A 5IQ9B 4J3UA 3UTQB 4LSPH 4Q58C 3H53A 1BFSA 4JQXA 1BQHA 1FFPA 2IQ9L 4JPIB 3OAYK 4RGNC 4ZO7A 5B1CA 1UACL 3ESVF 5GGUA 4R7XA 3GJFA 4X4YA 5MERA 3WHE0 3JWDL 2WBJB 3GTVA 1HIMH 3UYRL 5JW4Q 1NCOA 1SXCA 1TZHA 3NFSL 4OCSH 3ULVD 5I1DB 4B9PA 4UNTA 2QQKH 5FUOL 3OC5A 5KN5A 1TXKA 4LPYA 3NAAL 1LP9F 3UTZB 2JCCF 4Y89A 1AQ8A 3VH8A 4F91B 5HY9B 3GBNL 2Y24A 4HP5A 2G3XA 4MDJA 2ZT9C 5CCKL 5EO0A 5F21B 3V95A 1DEEA 4KJQD 3S9DB 4FQCH 4K9EL 2YD6A 5FGSA 1TENA 1UXLA 3EH2A 1MWAB 1ORSA 2G60H 2GABA 4ZO9A 2D3VA 3BLKA 4PY7B 1DJHA 3IJSB 3K6OA 5I5IA 3FU5A 3M17B 1XGPA 2RR3A 4OLVL 4DKFH 3TBWB 3RVTD 3OGOE 2C9VA 2KI6A 3ARUA 4FI7A 1HHKB 1DFXA 1JZGA 1NFDB 3ULSA 5T5NG 5HI3C 5BOJA 5AD0A 1PEZA 2FYYA 4HMDA 2WXPA 5HHVH 2OJEA 3EGSB 2FLRT 5J7CC 2MOQA 1TSRA 3PLYA 1IC7H 3SO5A 3BDBA 2BXZA 4DP4X 1LQBC 3VI4F 2XLLA 2Y1YA 3T3MB 1DDHA 4XZ4A 2B59A 1DANT 2WYHA 1QQDA 1A1MB 1R34A 2O6DA 1U93A 3CVHB 1I3UA 2EDHA 4Y2OA 1BD2E 3ISYA 5F93C 3X1GA 2Y06H 4AOFA 4HT1L 4IRJD 2KH2B 3N9GL 5IY5B 5MHSD 4FEIA 2NY1C 4JM0A 3O45B 3D2TA 5IHUH 4D2NA 5IMOA 2DZEA 3BKCL 1S7VB 4TQIA 3P9LA 4HS6A 3LZNA 5DJXA 1L3NA 4HD9A 4JCWA 3RGHA 1J1PH 1SF3A 4P04A 3SSGA 4BUHA 3OKLA 4JB9L 2Z7ZA 3V0EA 1XZ0B 1TFPA 2FGZA 3SN6N 4FQ2L 4NRXB 2OMTB 4XVSH 2WINB 4H8WC 1OB1B 2LFEA 4KKAC 3H9HA 3S3DB 5CZRA 4XPBL 2FR4B 4A04A 1E4KA 1QO3B 1S7WB 2YEZA 3NIFF 1PGRB 5AVSB 3UOAB 2DQIL 4LHQB 3QJRB 3RL1B 3U7YH 5KAQF 1GJWA 4UIMB 4BHUA 1BMGA 3QJVB 5DJAB 4ZS7H 1IT9H 3WE6A 1SY6H 3LXAA 1HSBA 3C5ZC 1FO0A 4KROB 4LSPL 3CTTA 2AERT 4YE4H 4LVOB 2NX5A 2X2UA 3UYOD 4YSPA 4PJGF 5L4FA 1MHCA 2IDFA 2BWDA 1DVFB 3MCKB 1Q9LB 3SCMC 1ZWIA 3MBWA 1F3RB 1PFOA 3CX5K 1FVDA 4P49A 4OFYA 1HIML 4EN3D 3VWKC 3IJHB 4YHYC 4OCSL 4PGCA 4H20H 5DS1A 1AIFB 3NQIA 2QQKL 3HLAA 2GSIB 4L4VD 5F1IA 4JRXB 2RQ8A 1DBKH 3IF1B 3PNRB 1S9XA 5E8EA 3SZ6A 3E6FA 3OF6D 3MZTA 3DRTB 1NC2A 4QD2E 4L18A 5CWSB 1D5IH 4FQCL 3EH4B 3F3HA 3N1GC 3HZMA 3QDMD 2G60L 2R2HA 1RK0A 3DDFA 3K6IA 2BC4B 2QVIA 3US9A 4U33A 4CAGA 2WLLA 1N12A 4JDEB 1CFVH 4DKFL 3FZUD 2W0KA 1J9TA 3REVA 5KJRH 3QUZD 2J1KA 1X5IA 2ZOWA 2XWBB 2IDTA 1JERA 5HHVL 3HW7A 4GQ9H 4BK5A 4W4NA 1MFUA 2WM0A 1IIIA 2R1WA 4PTTA 3M86A 1IC7L 2YN3A 1R5WB 2BVOB 3L7FB 1HTYA 3WEXA 3SPGA 5FS5A 3O3UN 5GGTA 3O2DA 3FL7A 3PWUB 5IB2B 3WFCL 1A9EA 3P4NB 4JQIH 1TQUA 1OF2B 2BS9A 4J4PA 4A66A 2CIIB 1S2EA 1QA9A 4CL7A 1MCLA 4Y1AA 2Y06L 1VKXB 5AAMA 4M9PA 1M3JA 1N0XH 4OFKA 3WDIA 1AXIB 2EACA 5IHUL 2N01B 5L8LB 2WTPA 3EOTH 1BQUA 1A25A 2IOOA 4Y16A 3LDBB 1HXMB 4YDLC 1J1PL 1AG0A 2JLPA 2SODB 4V1DD 4HJGA 5E6RB 4NB7A 4BFJA 2BIIA 1KSRA 5T1LA 3WDHA 5E6SB 1BGXH 2BWIA 5I71C 5EO9A 2FSEA 5EOQH 2N7SA 2W88A 3AT8A 4XVSL 3GIZH 1NAMB 2VR3A 1KFGA 2OXHB 5FYKU 1Z32X 1FNHA 4OFIA 3UXFA 1OXYA 1Q9WA 3U7YL 1JMZA 4P4KD 2J73A 4PVNA 3GBDA 4ZS7L 1IT9L 1SY6L 3DTXB 1Z5HA 3ATDA 3D3VB 4PRIE 4OJDH 4KDVA 1QBLH 1TTFA 4YE4L 4LHUA 4QXTA 2V2TB 4YQXH 4KKBC 4DEPB 4NFDA 4OFPA 4ZMNA 3PJSB 3QORB 4R83A 5EZIH 3FUHA 3FPXA 3GRWA 5LB1A 3RRQA 4MB5A 4OUUB 5IJBC 4OJYA 2VN7A 2LOEA 2V9TA 2WXFA 3E2HC 1J0YA 3DKHA 5I1AA 4H20L 2FT8A 2KERA 4OF8A 1N6VA 4XXWA 3SJVB 1AC6A 3O3EB 3UPAA 2XXCB 1UXSB 2CO1A 3QDJB 1PYWB 3IU3B 4GINA 2HWZH 3KWVA 4WGKA 1AI1H 1DBKL 4TSCH 3OZ9H 2YXFA 4AM0A 2AP2A 1H8OA 4N0CC 5DQ9B 4Z78A 2WOYA 1O6TA 1D5IL 2FO8A 1KJMA 5IESH 3DOSB 3EGXB 5GGQH 4GRWH 1KXQA 2ZOTA 2GJ6B 4LHUG 1JRHI 4N22A 3CSBA 5DDHB 1OZUA 3PWJB 1TJIH 5J4MA 3OV6A 1CFVL 5EU6A 4I0PA 4NZFA 5F6HJ 1SOXA 4JVUA 3T09A 5IWLA 2P5PA 3K8LA 5KJRL 1P1VA 2Y2TA 5HJGA 4PJBE 5DJ6A 3MV11 1IBDA 4LCUB 1BOYA 1AP2A 4GQ9L 3L8QA 1JPST 2EEFA 5HI5D 3BN3B 2GTWB 2LAGB 2DYPA 1X5LA 3LRSB 3JSSA 3W37A 1BX2A 1IKFH 5E00B 2QHRH 3NABH 4UT9A 4RNRA 1K5NB 3X14A 1LILA 4JQIL 1T22B 1T4KB 1S78D 2ZG3A 2WQSA 4Z5RB 5AB9A 4FG2A 5IVXB 3D50A 2GTZA 3CXHJ 4JQXC 3IN0A 4WZ9A 4YHOH 4M5SA 1N0XL 4IBQA 2CLZB 2VISB 3VVVA 2HTLD 4QOKB 2WUCH 3U46B 3EOTL 2ZCZA 4GXUM 1TITA 1TMQA 2WOBA 3QUYB 3G5XB 1QVOB 2HCZX 3BCDA 5E03A 3RBSA 1FH2A 4YK4B 5ESAA 4Y1TA 1BGXL 2P5WA 2NT1A 2EEBA 4XPFH 5F88B 2AJ3B 4WFEE 1T1XB 5EOQL 3GIZL 4O02B 3SQBA 3GMMA 4H26A 3L3KB 1SQ2N 3KPRA 3JTSA 5C0ND 2RA1A 4C83B 5IREA 4KRNA 4BKSC 4M9OA 1DJGA 1TG8A 3PU7A 3DXAE 3RWDB 2CD0A 2PCPA 2WTRB 4WWKA 4XE0A 1CGXA 4JFDE 1P7KA 4TLSA 1CTNA 3P69A 1P6WA 1QBLL 2B2XH 2IPUG 2CHZA 3D39E 4YQXL 5BRPA 3DGCR 1WV7T 5EZIL 1T1WB 1TVBB 3QG7H 2CAKA 5E8PA 1PL3A 1SMAA 3RWFB 5JOFA 1KYDA 3RVWC 5ILTH 2PTUA 1XT5A 5KUMA 5KVFH 2OI9B 4O5LH 3X1BA 2DM2A 2N4IA 4H44C 1W6WA 1RXLA 4OZGF 5A7BA 2EVIA 4ZSOB 4JUTA 2Y7SA 2HWZL 3DBXB 2KHAA 4ZMAT 1RJZA 1AI1L 1TOXA 4GW5A 2LVCA 2ZOLA 3EJQA 4TSCL 3P30H 4W9LC 3OZ9L 2EVJA 5SX4H 1MW1A 2JH2A 4MQ7B 5IESL 3QIWA 1TZ8A 1G7LB 4E9YA 5EBWA 5GGQL 4F3FB 3KPNB 3L54A 2G2PA 2PYEA 4QRAA 3OLDA 3N91A 1GS7A 2X3AA 1MCQA 1TYEB 3RKDD 4LSQH 2RTTA 4MVBC 1I7TA 4PWJA 1TJIL 1A4KB 1HVXA 1JWUB 4XHJD 5AOLA 4HETA 4H2AA 3LKSA 1OAYH 5D7KD 2Y1AA 4PG9A 1FF5A 2FO4B 4L0PB 2EJ1A 3OHXB 5T3ZD 4L29A 4HOXA 5FYJD 3KEHA 5D6CA 1GY2A 1NDGB 4PRNB 4FQXA 4PCSA 1Q0EA 1E4KC 2PCYA 4H0GA 1P6FA 2CCWA 4M8QA 1IKFL 1QKZH 3QQDA 5HGDA 2QHRL 3NABL 3OMIB 4OAWA 3VJ6A 4FYTA 4PTUB 1YN6A 2VLLA 4NKMB 4LEOA 5DSCB 3F7QA 4M43H 4WFHE 3RILA 3QG6B 3V0VA 6FABH 4R5VA 4YHOL 3LCYA 1DJYA 2OCJA 5TPWH 3V52H 2APXA 2VR8A 2WUCL 3BPLB 2VO5A 3HAEA 5DMJB 5SX4I 2X1XR 2YAPA 3ZHNA 2E9IA 5CD5D 2QMJA 2Q5BA 3LV3A 1GC1H 1JTOA 3WDJA 1S4IA 3K4AA 2LTQC 3P3TA 4TUJA 2H2SC 3FT0A 1FC2D 4NHUA 1UG9A 1ZTXE 4XPFL 4H1LB 2FJUB 1NGWA 2JCCA 3BQUC 3PE9A 4H5SB 3SPHA 2QV4A 3DYOA 5CEYA 1KDJA 1WZAA 4HKJA 4XNQA 3ZL4H 1NM4A 2DQUH 3KYMB 4WNJA 5EPMB 4Z3FA 3GMRB 1C12A 1WG3A 3IBOA 4BCYA 5J8OA 5GSVA 1FZJA 3MNDA 2UY7A 4GPVA 2B2XL 4YHMH 3ROOB 3UERA 3VRLE 5FECA 3EADA 1OAJA 1HH6B 2HVKB 1OGAE 1UZ8A 5JDSB 3GSQA 4HK0B 3SZKC 2IO5A 5IVOA 2CIKA 1EERB 5D2NA 3VTTA 4Q97A 3QG7L 4G8IB 3P9WB 5ILTL 1VADB 4IYKA 1NFAA 1CXLA 4X4XB 4BK5C 5KVFL 4O5LL 4X6CF 4RLDA 5GSRB 2NY5H 4XP4H 4LCCB 2B77A 4I48B 3VI4A 2Q3AA 4BFFA 1U6AH 2ALWA 1GYUA 3KYOB 1SHXA 4FL4B 1JZ6A 4UMGA 4LP4A 4Y7OC 3RB7A 2YAHA 4HJEA 4QIRA 2ZTBA 4GY4A 4YL9A 2NNXA 3C6LA 3X13B 2DWTA 1IGYA 3OMNB 1KJ3H 2WTOA 3N0PB 3VAEA 5AAMC 2R2CA 3FB6B 3HOGA 4M62H 1UFGA 2AK4D 2ED6A 3F7KA 3K81A 4LSQL 1XHHA 2F6AA 2WXOA 3VD1A 2J12B 3W56A 2FBJH 2FEDD 3FS9A 2D03H 1B0RA 3ZO9A 4ERSH 3MRMB 3OKDB 1JGDA 1OCZB 1OAYL 3K71B 4IOFC 4XTRD 2X09A 1XGQA 1J8HD 3H9SE 1B3JA 1B4JH 5DFTA 1CYWA 5FM5M 3CSYB 4JR9H 3ZQ9A 3KLHD 1ZK5A 5IHLB 2XETA 5LGHH 1BIIA 2YMTA 3LNFA 3MUY1 4ETYA 1QKZL 3D12B 4GBXD 5DZOA 3OWRA 3L48A 4JL2A 5D7JD 2O5XH 4Y9GA 4UQBA 2FDBP 1DBAH 4M43L 1SFDA 4ZW6A 6FABL 2V7NA 3IWUA 2ORBH 4RGND 4KDWA 5I9QC 1Y0LA 2OKMA 1CMOA 5D1XB 5TPWL 1OP3H 4S2SA 3V52L 2L7JA 4URKA 3T0EE 4WAFA 2B39A 4XNZC 3BSHA 4G8GB 2Y7QB 4P9HC 4TRPH 4K71B 1QLEH 1GC1L 4KZ0A 4WTQA 2A83B 2UUDH 5DRXA 2A6KB 3WSQH 4PGEB 1QTYT 4HXBH 4I77H 5EV7A 4X99A 3HN3A 4XXWC 2A9MH 2FVNA 3UBXI 3WI9A 4GI6A 4A2EA 5EU5B 3HG3A 2JKWA 4RSYA 3HZYB 3SDDD 3O11A 2VOTA 2RH0A 4FNLH 4MA3B 4NUGH 5D93C 3QEGH 5DHYB 5KAQG 3ZL4L 2DQUL 2WKGA 3MLTB 4AV5A 4ATWA 4HEPA 2N7BA 4LEEA 3LIUA 4LL4A 2PW2A 4PJFF 5GQBA 3VW3H 4GW1B 3VXRD 4QF1B 3QQNA 4MJID 2DKMA 4JCMA 2X6UA 3QDGB 3R06A 1KXVA 4YHML 3E9UA 3MV7E 4NQDE 3ECBB 3GMOB 4I0PC 4OTXH 4V2CB 4DCQB 3Q3GA 4ODHH 1U8CB 4FCHA 4QTIH 5T1KD 4YN3A 5HI3D 2W9DH 5KBDA 5LDSA 3QIBA 2DYSB 5ABDE 3ATEA 1J05B 4IU3A 2NY5L 4XP4L 3BD3A 1BZQK 4AQ1A 5I74C 1S9VA 3EJZC 2E59A 1U6AL 4LIQH 4BFEA 4NN7C 1RJYB 2WIMA 2DH2A 1A5FH 2IH1A 4HEPG 3MLZH 4TKWA 4DGIH 2WLNA 5BVPH 1KCWA 3CN0A 1KJ3L 4R5TA 4DPCX 5FFLA 1HWWA 4M62L 1N8OE 2BRRH 4OZ4A 5IQLA 3N42F 3WLWC 2NY1D 4URTB 4V1DE 1QW8A 4OCXH 3RI5K 4XBGB 3JWOC 2FBJL 4NKOA 3U4KA 2D03L 1SVZA 2I9LB 1XXDC 2W38A 4ERSL 5JW3H 2GITB 2H32A 3PP4H 4WKZB 3RG1C 5CIPH 2FZ3B 1J5DA 1BYOA 1MI5D 1W0YT 4IKNA 4MMXA 5FO7A 4BZ1H 4D3CH 4EOWH 4FQIH 4FA6A 3AB0B 4LKCB 2JWYA 1U2HA 3CSTA 4HSAC 1LQSR 1OTUC 3NSDA 4Z7AA 5CP3A 2DWDA 2YRBA 4KKAD 4JR9L 4KWUA 3PP3H 4AYEC 2GUOB 4WSJA 1NEZB 4XNXH 5LGHL 4MDIA 1P84K 2Y7OA 1KYUA 4E41A 4J3OF 2OMXB 2EVHA 4HAGA 2EEXA 2O5XL 4WWKC 3LX9A 4FI6A 1AZRA 2E8ZA 4K4KA 1DBAL 4BCXA 1IE5A 2IDQA 3L4ZA 3C5JA 5F7YC 5BUPA 1WC7B 2ORBL 5FAAA 2XY1A 1BD2B 3SCMD 4Z3HA 2WQRA 3V79C 12E8H 1RZ7H 3QJHB 3IDYB 4TRPL 3T4AB 5EUOF 4LP5A 4I0CC 1QLEL 1DO5A 3EJPA 3VWKD 4XCEB 3WSQL 4J7RA 2VDMB 3ZQXA 4HXBL 1AZUA 4I77L 5CZKA 4Z7WE 2A9ML 3GLZA 1W15A 1I8AA 1JK8A 1M6OA 2IPKA 2VZ1A 3ZDXE 3MSPA 3CZJA 4FNLL 4NUGL 1E4HA 3QEGL 4YDJB 2D3JA 3RB5A 1EH9A 4U1MB 2VLKE 2K7QA 2XXFA 3ISWA 4HQQH 4ABQA 2YUZA 3NCBB 3QIWC 4GRWF 5GRZA 3E6HA 3QI9A 3VW3L 4QKTA 2CBQA 4AK1A 1N68A 2XCMC 3NEOA 5JMOC 1BAFH 3WFDH 5KVMC 4R4BB 2IALA 4TTDC 2W95A 3QS2A 4O4YH 5A16B 2Q2EB 4ODHL 4F7KA 1AFVH 3NCMA 1QFHA 4QTIL 3ETBF 4MA8H 2VDLH 2W9DL 2NCMA 4JO1H 5DC9B 3VD7A 3QEQA 1HJCA 1X5MA 3Q0HA 1NM9A 4PRHE 3KL0A 2KDGA 3KYNA 1WWAX 4Y9CA 1ECZA 3RPKA 3M45A 1JXFA 1VF5C 5EFIA 2YK1H 4YFLI 4YC2B 3I6KB 2VE6A 4FQXC 3EGDB 1YZZA 4PRPE 4LIQL 4OFDA 2V2XB 2YPLD 5IKCA 5I6XC 1F58H 1OLLA 2NT0A 2XTJE 1QHQA 5E8NA 3MLZL 1QMUA 3IKKA 4DGIL 4KX7A 2ZNXA 3FBKA 3FQWA 3VFUA 5BVPL 4D9QE 2R2EA 5HHMD 2IWGA 4GG8A 3ZL1A 1EANA 1HILA 3OKMB 2BRRL 3RBGA 3LKNA 1OGTA 2E4FA 2OCCB 3FB7B 1JZHA 1AIZA 3ISRA 3N04A 4OCXL 1MN4A 3REWB 3SHSA 3NJKA 5AYTA 2YEQA 3TNNA 5JW3L 3PP4L 3HVNA 1GSMA 4BZ1L 4D3CL 4EOWL 2ERJB 3F05A 3MHZA 4FQIL 4YIQB 4X7TA 4ELME 4IQHA 1UM4H 3FYIB 2O93L 4EQ3A 4BK4A 5BJTA 3P11H 4DFHA 3F7VA 5DQDH 4XNXL 2R7EB 3L5HA 3B6SB 3DRQB 4ZMTA 4DNLA 5D7IA 2QDVA 4IJ3C 4X6BB 5CKAA 1FBIH 2G3MA 4RMUA 2X4RA 3IETB 3FJTA 2OQJB 4G42A 2JF1A 2E56A 3VE0B 2JLLA 4P2OA 2Q8AH 1I3VA 1T04B 3CV5A 4KKBD 1ZVSB 2EUXA 5D2NC 3E1F1 12E8L 3MV9A 1RZ7L 2WO2B 4P4RB 5JYLA 3VB9A 3R7QA 2VLRD 2UY6B 5IJKA 4DHLA 5HHOA 2PNDA 3MRNB 4B9CA 3CZLA 3MUHL 5AW8B 4GXUN 4OZGA 2R59A 1SNRA 2WZPD 2WLZA 3KDMA 4HIQA 4ZMLA 1OPGH 3EJRA 4XMTA 2UXTA 4N0RA 4FG0A 5KOMC 2AKRA 4OZFB 2C9SA 4HQQL 1VHPA 2NDGA 2K9UA 3NPZB 5KSBF 3B2XA 3RX8A 1SDYA 1L9PA 4N0CD 5CHNB 1OP3K 3C6LC 5IBTH 5AW9B 4Q6IB 4D0CB 5AENA 4PJDA 4N24A 3C9NB 2IF7A 4Z77A 1BAFL 4JPQA 3WFDL 5FWRA 1ZLEA 2JTYA 1KBPA 2W9LA 4PRIB 4OGAC 5D7KE 4O4YL 3OG4B 2CBPA 1AFVL 1KMGA 2Z7UA 3E8VA 3IFOB 1G9HA 4MA8L 5DGRA 2VDLL 1IM3A 3ULAB 3ELAT 4JO1L 3NMEA 3KPSA 4JFYB 3T08A 3FFCA 1XSIA 2FECI 5SWSE 2NY4C 5CINH 4ZW5A 5J1SC 1T1YB 2YK1L 1E4JA 1YUHB 4I1RA 4XB7A 3F8UB 3TO4B 4JGNA 2BNQB 3HKFA 2IAMB 1I4FA 4P2YA 4H8VA 4JHWH 2WYZA 2PWHA 3NDZE 2CO6A 4OH2A 3D0VA 1F58L 2XX0A 5IIEB 1XCQB 2VRAA 3Q13A 1JWMA 1RSYA 5BV7B 3MYJA 3QWNA 4C58B 5IMLB 2AJYH 3K4ZA 4Z7OE 1R3LB 3HN5A 4KAQH 1JZFA 3ARBB 1RJLB 1QLFB 1KIRA 4MBOA 3W82A 3MRLB 1A3LH 1JUFA 4WU5A 3LXUX 5IB1B 4F80A 1G7HA 2VQUA 3UTTB 4CC0A 4JZOA 4UQ3A 4BWTA 1SXZA 1A7QH 1EHLH 3IMUA 3AS2A 1D5MA 1TR7A 3DDGA 1YMMA 3DSFH 1UM4L 1DSWA 4PJBB 4IK7A 2H2PC 1TQSA 2A6JA 3U2JA 5D1ZB 3P2TA 5FXCH 3P11L 2AV7A 5DQDL 4FS0A 4J1UB 3V4VB 3ASOB 1JXDA 1FBIL 2FH8A 2VLJA 5AW6B 1EAPB 3MR9A 1IO4C 1U8NB 3TFKD 2P80A 3NJGA 1FHNA 3LB6C 4DZBA 1KXVC 2Q8AL 5JW4M 3K7UA 2DWEB 4L37A 4NO2B 3UACA 3QQ9C 1OM3H 1I7RA 1WTLA 2X0WA 2ZF8A 4L3CA 5DJ8B 3THMH 3RVWD 4JJHA 2MFNA 4MLSA 1DE4A 2GY5A 3PP3K 3HNTH 3QIBC 4X6CA 4NRZA 5MENA 3UDWA 1JN6A 3U4AA 2EDRA 1T66C 3WKPA 4FYRA 5C2UB 4AQ1C 1RIVH 4CKQA 1ZPLA 3I6GA 1OPGL 4LCYA 4RAVA 4PJ6A 3VG9C 1AGCB 2WC7A 4M5ZH 1XGTB 1ZJBA 5AVXB 4MA1C 5INCB 4N2AA 4G7YH 4QHNA 1OE3A 3JT0A 2R1XB 1OTTD 4OIBA 5SWQA 5IBTL 1SLWA 2DQGH 4Y4HB 4HU8A 2M26A 3NZ8B 4DVRL 3DYMA 4MVBD 3BH8B 4NIYE 3TTSA 5CM1A 3MBEA 1OPOA 2YPKA 4IOIB 1Q94B 3D39B 3MQIA 1R5IB 4WEBH 5FW7A 4KQ0A 2EE3A 4MMXC 2M2DA 2FB4H 2ZSWB 4YHKH 5KSAB 2ZKWA 3IKCA 2VXQH 4LLMB 4QCIA 2A1WH 3HRZB 4XB3A 4Y5VA 5CINL 4F7MB 3QNZB 5D1QC 1Z9OA 3FN0H 4O2FA 4XO3A 1HXYB 3F12B 5CKGA 1U58A 4JHWL 1QNZH 4UT7L 2V3FA 4POUB 5TDOA 1PY4A 2YD5A 4LDLB 3RWHB 2X10A 4PJ5E 3EOYG 4NQCE 2VO8A 4KMLB 1J8RA 2NX5D 4NUJA 2HG0A 4M4RA 4AWJC 3NT0A 2AJYL 3MO1A 2MHAB 3NGBB 1WAEA 4KAQL 3RNQA 4ZQKA 4AMKH 3RURA 1A3LL 2BVTA 2NRDA 4NQVA 1IFGA 2DQTH 4KO5A 1I1CA 4BFRA 4OFYD 5IG7A 4A7VA 1CG9B 2R2BB 3VFVB 1A7QL 5BS0B 2X9ZA 1OV8A 3FTSA 3TIDB 1EHLL 4D7BA 3DSFL 3MUZ1 3EHBC 2BSSA 3LKOB 2KLTA 1A21A 6PCYA 1K8IB 5B22A 2VMDA 2AEPH 3H8NA 1QI4A 5I16A 3H42H 3ETTA 3QQ4A 2CBTA 2MCAA 4PP2A 3D69B 1MXGA 2G5BA 2H6UA 2V5YA 1A1NB 2BY2A 5AZ2H 4JDVA 1NC2D 2QEJA 2AJUH 4PJFA 4ZX4A 2EDNA 3CZFB 3QI9C 4PV8B 1LO2H 1XGYH 3NG5A 4IS6A 1PTZA 3MRKB 5EOCH 4RRPA 4XMKH 1SMOA 1ZLVH 2ATPB 1RPKA 1ZHNB 2JKRM 3BYTA 4EI0A 4UQCA 5C9JB 4RFEB 3E8UH 1OM3L 2ROYA 3MRCA 1FV1B 4YBLB 1F11A 3THML 2Z8SA 3P02A 4XMWA 4PREA 2WVSA 3HNTL 5ISZA 1XDTT 1QR1B 3SDAA 3CFQA 1E9PA 3CX5J 5KOVC 3ASNB 3MNWA 1RIVL 3QNFA 3VD0A 3AUWB 2EDEA 5FM8A 2HUEA 4JQIA 4M5ZL 2K3TA 5F3HA 2VYRE 4G7YL 1RHHA 4J4PD 5FLVA 1R3HB 3L17A 1T20B 3A4FA 4H0IA 4L8SA 4OD3H 2YLHA 3WELA 4Y1AD 1EGJA 4RRPG 3N6YA 1QACA 2DQGL 2EICA 3GMNB 4F57H 3WTXA 2M83A 5EBLA 1LEGA 3JWDC 1IE4A 3O3DA 4WI0B 4X9GA 4MCZB 4Y16D 4P23A 4H13C 5KG9A 2ID5A 1RZ8A 4WEBL 2YGPA 3EUDA 1OGAB 1U8LB 4CILA 2Y2YA 4IOFD 2FB4L 4YHKL 4Z7QF 3QAZB 5T1LD 3QK0A 3NFPB 5BRQA 4D0BB 4DESA 4CMHC 1TEFA 1BEXA 2BSTA 1MFCH 2VXQL 1PW3A 2A1WL 3OXRA 4MRCA 3WL9B 3JWNG 3KWTA 3EJTA 3WOVA 5DC0A 1P7QA 1CFMA 3FN0L 2BIOA 4WJ5A 4OQTH 1HSAA 2JNZA 4ZODA 3S5LB 1EV2E 1QNZL 2H45A 4AUYA 4K9EC 1E6JH 3FF7A 1VENA 1MCWM 4OLZH 4IHOA 1K2DB 1WFMA 3EF7A 1PZ3A 5BQ7B 1MRFH 4P2OC 4LHUD 4ZYKB 4PGZA 3VQLA 4IRJB 4YFLF 4R5XA 3WGUB 1UD6A 4EI6A 4PJ7B 1KGWA 4ZO6A 4AMKL 2XKNB 1CS6A 3KPQB 4G72B 2W0FA 2PTTA 2DQTL 2VDPB 1L5GB 1NZRA 2OJ1A 3ARFB 5IJKC 3EYQC 3P4MB 3QS3A 5J6GB 2CDEA 2H3NB 3F5WB 5KWYC 5IROD 2B14A 1G9NH 1JYXA 3OKEB 3QSKB 2LFGA 3ML8A 2AEPL 4NQQA 5GS1A 1Z9SA 3H9SB 5C0JA 4ZPTA 3H42L 1SVCP 5AW4B 4NYLB 4ILDA 5AZ2L 4TL5A 4HWUA 2ICWI 5EIVA 4DK5A 1HHJB 1U8PB 2G3ZA 2AJUL 2HFFA 2ZE0A 5D96C 1ERNA 1LO2L 1XGYL 4NT6B 3B37A 2A0LC 5EOCL 2X4UB 1SYVB 5PAZA 1LEIA 4XMKL 3EYUH 2YSTA 5HDBE 2J8HA 4EUPB 3BP7A 4MA7H 4IK6A 3UZVB 3E8UL 3O41A 5HDOA 4LLWA 5EU6D 4I0PD 4XVTH 1PDKB 5CS7A 5IUSA 1AZBA 1UT2A 2XQYG 3L9BA 3MRHA 3P54A 1GOHA 3O6LH 4Z0BH 1BLNB 3A67H 3CC5B 1N26A 1YDPB 4JAMA 3T71A 3T0EB 2GPZA 1L0PA 3FB5A 1VRSA 3APFA 2OYPA 3VYPA 1MY7A 3ZKXB 2HKAA 1AO7D 1PCXA 4BQ6A 3JV4B 2DYPD 3EJZD 2ZG1A 2IV9A 4E42A 1UZ6F 1OEZW 3FU9A 3T0DA 4RIRB 5HHME 5JPMA 1U42A 1ZLDA 5C7XH 4ZNEE 3LEVH 4OD3L 5BZWA 5B8CB 4H25A 1AKJA 1FNFA 1NGXA 2H26B 1R6VA 4XO8A 1AXSA 3ARQA 3NJLA 3UPCA 4AKQA 3VFSB 4F57L 5LN4A 3WLWD 4PLKC 3OQ3B 5JW5B 2JI3A 5EUOE 4BFOA 3IGKA 3FO0H 2V8MA 2LU4A 2DM7A 3WEOA 2ZCLH 3MV7B 1BOGB 4NNYA 3BIAX 1I9JH 2H6PB 3UADA 4NQDB 3GSWB 4XODA 2XV0A 1UB6A 2BINA 2YD2A 2WVVB 1G7JA 1AVAA 3IMTA 3LQZA 2P5WD 3K72A 4X9BA 1MFCL 3EFOB 3IXAA 3GXTA 1OZTG 3B8YA 5TF0A 2NTSP 5EF2A 3KPRD 2ITDB 4GSDH 4NEHB 5TK2A 4OQTL 4NO0A 2XYCA 5E9DE 3DV6B 4LAJH 3ZE0E 1E6JL 4APQC 4V2BA 1S3KH 3APCA 4ORGB 4OLZL 5JHDE 1ZE3H 4WWKD 3VXSA 3WIAA 4EE2A 5D71H 4YAQA 2W0LA 1MRFL 3V0HA 1X4YA 4ZG1A 5A2JH 3R4DA 2VLRE 1PY0A 4MCMA 4HULB 2F58H 1ADWA 1MCBA 1JNHB 1EDQA 2OA9A 3CFCH 2YQBA 4J12A 4E5XB 3UH8A 5C3LD 4V1DB 4QHUB 2FX8H 2JJTA 1CLVA 2CO7A 3WFHA 2R29H 5E4EB 2OTWA 2CLVB 2F1AA 4UV7H 3UDWC 1G9NL 1HK6A 3F7YB 3AU1B 1QPXA 4YSRA 2DV6A 3FTXA 4FAAB 2VMCA 3QC6X 3FCTA 1S9WA 2K3HA 3FMGH 4TLUA 1KCSH 4FEMA 3T6VA 1EK3A 3FKUS 3OJMB 3FULA 4F8LA 4Z18A 4HIEA 2D3NA 1DVTA 3AW5A 2F53E 4FHJA 4P4KB 3MRIB 3QIWD 1A2YA 3PWLB 4H8QA 1PZUB 4NQSB 2PYED 1T0NB 3VDBA 3GSOA 2CALA 3EYUL 5I30H 4TYUA 4MA7L 1BZ9A 4OZHA 4TTDD 3RTQA 5C0BD 3MBEC 4QYOA 4ECNA 4N1CA 4NUPA 4XVTL 4Y2DA 4HV8A 1FHGA 1MWOA 2C3VA 4BBWA 3O6LL 4Z0BL 2E4TA 4CADA 2R27A 1X5GA 3UPRA 3FTWA 1MF2H 3A67L 5CBEA 5JIPA 4Y5VC 2ADJB 4EI5B 1Z0MA 1QEXA 1MG3C 3ILEA 2O4EA 5ICUA 4MJ6A 4FQXD 1SUHA 2VSMB 3NDYE 4MYPA 5C09A 1T21B 4Z7WB 1AHWA 2EH8H 1RMFH 1ZLVK 2L04A 3F6IA 3ZDXB 2VB5A 1WA2X 5SV4A 2R15A 5C7XL 4LHJB 4HSQA 3EYFB 3OTTA 3LEVL 3WNJA 2BRQA 4RFOH 2VLKB 1GL4B 1ZIBA 1HWHB 3N41B 5TE4H 4B41A 3FO0L 1JOIA 5E6YA 3T77B 1OAUH 3IDNB 2ZCLL 2DY2A 4X6EA 4GOSA 1I9JL 3BVVA 3L4TA 3EUUA 3DX3A 4UZUA 1DBBH 4U3HA 2WMPA 1S7TB 3RPIB 3GBMH 5ANME 5IOKA 1SUJA 1VGEH 3KD4A 1WFTA 4W81A 4JY6A 1E30A 1VAHA 5DEGA 3LRMA 4GSDL 3LN5A 4PRHB 3SGEH 5I0DA 4KJWC 5KSBE 5C07E 1HOCA 4JY4B 4MZRA 4I7ZC 3CX2A 3IMSA 3NCJH 5DZ9A 3KCPA 3LD8C 5BMFH 3PXHA 4U7SA 1S3KL 4PRPB 5LCVH 3BIKB 5D71L 2GUYA 1A6TB 3G5WA 4DPRA 4LLYA 3N43B 4D7PA 4RDQF 5ICYA 4HAKA 1EAJA 1H5BB 1QZNA 3BPOB 5DZLA 1OCCB 2YQ3A 2F58L 2MCPH 3IDIA 3CH8A 2OYKA 3RZCC 3CFCL 1D7BA 3RX9A 1HYSC 1ZDQA 1KCUH 2QHLA 4PJAF 1BG9A 2GSGA 3FO2B 2PPCA 4LLUB 5J9PA 2VCOA 2FX8L 4GMTH 2JB6B 5JA9A 1U4EA 3A22A 3IN2A 4MMZB 2R29L 3SDAC 3BUDA 4UV7L 5KYWB 2YGVA 5H37H 3SPVB 3QXWA 2YAMA 1JE6A 3JWNC 4EDXA 3WEAA 1NMCC 3FMGL 1KCSL 4WI9A 4Z7VF 5FK9A 3WLBB 4FZEH 2XN1A 3QUKA 2CXKA 4HKBB 3CN4A 1KB5B 4UAOC 5T3XD 4ELMB 4KNSA 2CLRA 1F56A 5AVZB 1ZGLA 1FGNH 4FQHA 1G7QB 5B3SB 3KAAA 3TPUA 1WLHA 4XI5C 4L8SC 1INEH 3ZE2E 3LKQA 3RWCA 3C6LD 1B88A 4JE4B 5E94A 3RGBA 4C8XA 3MXVH 2J1YA 3N40F 4LCWA 43C9B 1AGEA 1QRNA 4G7VH 1D2OA 5I30L 3FCSB 4PBDA 5CLTA 1NQBA 4GG6E 4OGAD 2Z93A 1OANA 3ESMA 3FUEA 4P23C 3CFBA 2HN7A 3QPQC 3MRFB 1M05B 3KGSA 5JW4N 3R0MA 1MF2L 4L3FA 4M8UA 4YOKA 4MHHG 4ETQA 1YYCA 2NY4D 5F7BA 4F33A 4XOCA 3DROB 3L95A 4JM2A 2ZWLT 1EEZA 1EQWA 4WY7H 3DTUB 3TYFA 2R0KH 3HI1B 4J8RB 4PS4H 2JKXA 4AW4A 2EH8L 1RMFL 1E3FA 3IJEB 4B9FA 2I27N 3L5JA 1EBPA 4FHBD 2EXYC 1B0IA 2NXYD 3BSGA 4ODTH 4RFOL 3I75B 2CH8A 4J27A 1WIPA 4LNVA 1GOFA 2D2CC 1FL3B 2PXYA 1N8ZA 2YAEA 3N5AA 5HDLA 5BZDA 5CLWA 3QRGH 5TE4L 2OMZA 3FSAA 5DS8A 5DU7A 4NN6B 1OAUL 1EX0A 1ZA3A 3NEXA 3PHOB 3B2UC 4DGWC 3FB8B 3U0TB 4JFQB 5F1NA 5HGAA 3PWVA 3VRIB 3MFFA 2FWOB 2R0LH 4OSUL 1BZOA 1DBBL 1QBAA 2H2PD 2X9WA 3CHSA 1VGEL 3GBML 5GS1C 4LNRA 4OVUA 5KVGH 3GMQA 5E1AA 4BD4A 1JI2A 3LYRA 4MQTB 4PQXA 5BMFL 3NCJL 2Z31A 1J7VR 4ZNCD 1IC0A 4Z3GA 5LCVL 4Y5XB 4U4IA 2ITFA 4GKOA 5JHMA 2X7LA 4JFFE 1IBYA 4PD4J 3BFQG 3HPLA 3EYOB 4QXUH 1G6RH 2ZKMX 4Z95H 4ZUUA 3VXPB 3C5XA 4IKIA 2X4TA 1NSNL 1PG7W 3QQ9D 4LXFA 2VN6A 1G7IB 1F3JA 1SHSA 1XF4B 1SZNA 2MCPL 1SDDB 3N2JA 3IMWA 3BEWA 4G43A 4K3GA 5CBAA 3MODH 3HFFA 3TBVB 1J88A 1LVEA 1NANH 3QIBD 4GMTL 2J1ZA 4PI2A 1PIGA 1KTBA 2O6CA 3X3FH 3NBNA 1T66D 4NBZB 2BFVH 2Z4QA 5K9KB 5LWYH 2NTFB 3QZOA 4FZEL 4RETB 5E1HB 3GS4A 4HJIA 5DHVH 1DBJH 4S0TD 1FGNL 5JPMC 3GBEA 2EC9T 1MW3A 3EOAA 3RJDA 5ALCH 1INEL 1GCFA 3FQRB 3FU0A 3QDAA 3MXVL 4IGBA 4H8HA 1FZMB 4G7VL 5TJWK 2XPGB 2YWYA 5JPNB 2FJSA 3MROA 1W72B 4W6YB 5I2IA 1EIBA 3D85B 1YEDB 2AAAA 4L9LA 5J11C 5HJBA 3TT3H 5D7LA 4BZ1A 1I8IA 2PYFB 5DJDB 4Z7NE 5A40E 3LPGA 5DVPA 4GUOA 4YE0A 1T2XA 2ZUYA 4PCKA 5CFHA 1GYWA 1TQBB 1OT4A 2AJZA 3QW9A 4HUNB 2Y3AA 2VNCA 3GMPB 2MQGA 2LABA 3S36X 4WY7L 1E27A 2R0KL 3F65A 4KRPC 4OGYH 4PS4L 4X5PA 3RUGE 2Y25A 4L0YA 4G3YH 5ECJE 4GKNA 5DGQA 2WBWB 1PZ5A 4OBRA 1VGKA 4ODTL 2Z35A 1N59A 2PTVA 3JTBA 1CUOA 4OD2B 5C08A 3AQZA 2V3EA 3ZU8A 3ARGA 2H1LM 2ZD0A 4RVBA 3QRGL 4CUCA 4TSAH 3L2NA 5DC2A 4HUKB 3MNVA 3DARA 1CFSA 4G59C 2ZXAA 3Q6FA 5EBGA 1UJTA 1G1OA 3BLPX 3ESOA 1H3PH 1MFNA 1P4BH 2JJTC 1VJSA 3EO1B 3S98A 2FLBT 1B0GA 2PCXA 3DX6A 1JWSA 2C3XA 2R0LL 3CC1A 3EHBD 5DQJA 4R3SA 3VFMA 4BA0A 1AGBB 3OR7B 4P0DA 5KVGL 4X98A 1M2VB 5IVZB 4PG2A 3HCVA 4WFGD 4DN4H 3V6ZB 4L3EA 3UZQB 1E7VA 1SJVA 1CYGA 5I8CB 3SBWC 1ANUA 4QHLA 2Q2LA 2VXUH 1AR1C 1KLGA 1NBYA 4GBXB 5C0EA 1DDTA 1U8IB 4C57C 5D7JB 3F2LA 3QI9D 5KYXA 1EFQA 3D25A 4OI8A 4LASH 1P84J 1H3GA 2QTEA 3FF8A 4XNMA 2IMNA 4AV0A 5T8IA 3CHRA 3NTCH 4QXUL 3WJMB 1G6RL 4Z95L 3S3CB 1ZD6A 4PJ5B 3RTQC 1DEDA 2EDJA 1XAUA 3L4CA 5AKTA 1EVTC 4NQCB 2AQSA 5AZEH 4O2EA 4Y2DC 3EXLA 2ZKYA 3EBIA 5ID1A 1ZMYA 2FLMA 5BVJB 1TKWA 4HIIA 1IAIM 1MWAH 3AXLA 3QEQD 3O8XA 5CEZE 2NYZA 3OBAA 2EXTA 3B7SA 3IJ7A 4GKLA 4JHAH 3X3FL 2YKLH 2BFVL 1RK1A 4DIXA 2TRYA 3GS7A 3FT9A 1D5ZA 3L6FB 1T0MA 5LWYL 1IQWH 4W6WB 3FO1B 1AHWC 1L9OA 4Q2ZA 2LLGA 1DBJL 5AUMA 1NGZA 3TYGH 5ALCL 1BG1A 1NFIB 1QSFA 1MCWW 2VSKB 3FH7A 1Y7VA 1E2VA 4OCNC 2PO6A 4UINH 5AW0B 3NUKA 1Y1UA 4YEEA 3VGHA 1GC1C 4MAUH 2AVGA 1AKPA 3CZKA 3CVHH 3L3JB 3TT3L 3AQYA 5G5DB 2NYKA 4P5MB 2DKSA 5IR1A 4YSDA 1UKQA 4QHMB 5EO1B 5D9SA 1VZIA 3SKMB 4K7PX 4XBPB 2HFTA 4OGYL 1HNFA 1QPKA 1H0DB 1CI3M 2E0PA 4MNGE 1T6BX 4G3YL 3CLEH 4CBZA 3Q1SH 4LARH 4MWFA 1IM9A 4P2OD 1AE6H 1UEMA 4YH6A 4UM8B 1RPUA 1B4LA 1CBVH 1XR9A 5I0VA 1XEUA 1IAMA 1NCCH 1YMHB 3H6JA 3ZL2A 1RZFH 4AIZA 1YNTB 4TSAL 3MV9D 1MUJB 4GW4B 5K1JA 3DX0A 4P3DA 5FHBH 2ZX9A 3D4GA 1H3PL 1P4BL 3C8KB 1PLAA 2NY5C 1MI5B 3EYQD 1ACCA 4P2RE 1T2QH 2CDGA 2CO2A 3L4VA 2B1OA 1KXTA 2QZQA 4AITA 1MH5B 4Z0XA 2XWJA 5IFAH 1TDQA 4DN4L 4ODXB 4KY2A 5CN3A 1RUAH 4R7NA 3OZKA 1AQDB 2VXUL 1GHFH 3DVFA 1KTRL 4CBPA 5DMYA 2AGJH 1KGJA 4ZQTA 1OP5H 2WXHA 1IGCH 4PY8I 3BVXA 4UU9A 3O4LA 4OV5A 1R19A 5EC1B 1AD9B 1F8TH 2A0LD 1KGCD 4LASL 3X11A 3C5ZB 4F7CA 4BINA 3NTCL 2BZDA 2WCPA 5DI8A 1NGYB 5GRVL 5AZEL 4KZDH 1ZHKA 2P5EA 3SCMB 3MVSA 5DJYB 4DWHA 4BFGA 1XEDA 1O7DE 1IM3D 2DLHA 2QPFA 3CQFA 3IPFA 4GI9A 1MWAL 2MNUA 3KPSD 4N6QA 5BQDA 3FFCD 2C7UA 3BDXA 3V4PB 4YHYB 3DYPA 3K2KA 4JHAL 3V5HB 4OR1A 5KJ4A 2YKLL 5I73B 1ASPA 4JM2C 1E8ZA 4N2HA 3RKPA 3DC0A 2FCBA 3TNMB 1IQWL 1LLAA 1KIPA 4ODUA 5EWIH 3ZK0A 2ZOKA 1OAXH 4HGMA 5IFJB 3WIFB 5E95B 3WKYA 3TYGL 3E38A 4NCC1 1SGKA 1MCKA 3I50H 3BZFA 4YHPB 5J1AB 1E5BA 3BHBB 3TEUA 2PXYC 3GB7B 4GYBA 4PLKD 3W5NA 2X12A 1J1XH 4UINL 3TONA 4RMBA 1SLUA 3QXDA 4EF3A 1F4XH 2XJKA 4MKTA 4MAUL 5HDBB 4Z7UF 1CD9B 2G2NA 3CVHL 4GAYA 1BQLH 3ZO0A 4KX8A 3FU7A 5D2LA 2EYTB 3UFIA 2FIKB 5F7WC 3V7AG 4UUJB 5IW6B 3BKMH 1YSOA 2XFXA 4XVJH 4BWWA 1OT1A 3VFWB 2QSQA 3QQ3A 5KVEH 3ERXA 2HH0H 5AVTB 1E9QA 2YPLB 2Z31C 5CN2A 3CLEL 1ODAA 4X6DF 1D5RA 2E7HA 2VLJD 3CH1B 3Q1SL 3L1GA 3I84A 4HKXA 3QUGA 3LZQA 1UUNA 2E7MA 2P80D 4LARL 3AXHA 2C26A 3OKKA 3TGXA 1AE6L 1NAMH 3QJTB 2H8PA 5D2NE 5C8JA 3HLKA 5HHMB 3NJNA 3X12A 2K1MA 3QFGA 1CBVL 5F44A 1NCCL 1P2CB 1RZFL 5IM7B 2BP8B 2J2ZB 4IBTA 2ODIA 1R5VA 2V5RA 1IJNA 4PJAA 4LL9A 5E70A 2J4WH 3QFJA 4X8XA 5FHBL 1X7QB 3I9IA 4YDLB 2BVPB 2H4EA 1T2QL 3DNKA 4YSTA 5MEND 1M7DB 1P5VB 2B5IC 3VGFA 1SXNA 4DP5X 4WHTA 5I71B 1T03H 2XV2A 3IS0X 3ZTCC 5ID0B 1LNUA 2HVJA 1KULA 5IFAL 2XYBA 3MMEA 3BW9A 1RUAL 2J57A 3NJFA 5EU3B 5E5MA 3CU7A 2G0LA 3TVMA 3TURA 1OW0A 1GHFL 4BXVA 2AGJL 3O3AB 5L2JB 1IGCL 2K45A 3BN9C 5E0FA 5ELIA 3RWIA 4KC3B 5AOMA 3AABA 4IGBC 1CXKA 5E9DB 1NIDA 2FNBA 2I7OA 1P4IH 3M07A 4RDQG 2CJ3A 3ZE0B 1GMEA 5DMKA 4C4KO 2OM5A 5JHDB 3MBED 5HYJA 4Y1SA 2WO3B 4LSRH 5GRYA 4L9LC 1OSPH 3AACA 1SHWA 2DMKA 2VLRB 4FG4A 1G7MA 1KGIA 2VXQA 1I8KA 2XHNA 4PRDB 4HPOH 4YZFE 4U1JA 3E2HB 4NZRH 3T65A 3VQMA 5JOPD 1CGTA 2PW1B 1ET7A 5HVHC 3BXNA 5FKPA 5EWIL 4NP4H 1OAXL 4U1NA 5B38B 2EE9A 4HIHA 3SKNA 3H9YA 1A6ZB 4HUUB 1N5AA 4ZUWB 3I50L 4K2UH 5GRVK 4N1HB 2VAAB 4AZ8B 3TS8A 1DUZB 1I8MB 1JS4A 1XGUA 1C08A 1TQCB 1HDMB 2F53B 1B90A 5T1MB 2DI7A 3ARGC 5KSVA 1JZEA 1J1XL 3MUUA 1SOKA 4WK2B 3UC0H 4B9YA 4HIPA 2XG4B 2Y3NA 1F4XL 5I5MA 2XXMB 4MCYA 4L8CB 3O9WA 4AXWB 4XVUD 1QSEE 1BQLL 2WWOA 4KKNA 4U3SA 1NLBH 4HS8H 4JN2B 3C09C 32C2A 1KBKA 3BKML 4ZUVA 1KTDB 4XVJL 2Z9TA 2VW6A 4PG2C 3BAIA 2VQ1B 4QRTA 4ZPVB 4BDVA 5MEPA 2DN7A 1XZWA 4S10A 3L4WA 5IBLC 4AIXA 5KVEL 2NQ3A 3KNBA 2HH0L 4FQQA 4FXKA 3VXNA 3OL2A 2QTVA 4KJWD 3H4HA 4FOMA 5DFWH 2OXGA 4HWZB 5JIHA 3GUTA 1H8NA 2SEBB 4G6JH 1LM8V 2V2WA 1DJSA 1WBXA 4QRPE 1J0IA 3VWJB 1B4RA 4O02H 1NAML 3GRGA 3NEEA 4R90H 5CR8A 1WICA 1RY7B 3ARVA 1FFPB 5T33H 4JO3H 3VI3A 2P4AB 4G7SB 1I7ZB 3QRBA 2J1WA 4JNXA 4G83A 3S88H 4LPXA 3MYZA 4X4YB 4HUXB 2DQEH 4TL4A 1HYSD 1PLBA 2J4WL 2Z0BA 4U1GC 2WV3A 5ISZD 3O8XC 4FNTA 3SDAD 4FADA 5E1QA 5FO8A 1OQXA 1AYRA 3KVQA 3UJIH 1T03L 4ZFFA 1MCHA 5KN5B 2FH6A 3X1NA 3WE1A 1N70A 4IIZA 1JGEA 4W9KC 4KI5F 1M9SA 3AT0A 4GNKB 5ANMB 4MDJB 3QDHA 1GW6A 4XI5D 5D5MA 3GRBA 3HUJF 3KCWA 2F18A 1P4IL 2GFBB 2BOCB 1JHTA 1BFVH 2PO6C 2X70A 4U2YA 1XGPB 3WUWA 4LSRL 4P23D 3LPPA 4HFUH 2Z7YA 1OSPL 4C4BA 5I6OA 3ULSB 3QPQD 1Y6KR 4PU2A 1YPZF 2ICWA 4F7PA 4GO9A 2XWCA 3PXLA 5EIQA 1HL8A 5K1VA 5D1QE 1JYVA 4AYGA 4HPOL 3U4EA 1U41A 3SGJA 2ZXGA 1M57B 4NZRL 3N55A 1U9KA 3AREC 5FYJU 4AGMA 4E41E 4Z3IA 1P7QD 1ORQA 4OQTA 1OP5K 2HJKB 4MXVE 1HHIA 2VN4A 1XVSA 1DDHB 1SPDA 2J20A 4GQZA 2Y07H 5F8RC 2B59B 4NP4L 5LGJA 3HE6B 1TJGH 3FH5A 2X0VA 3K74B 4U0RC 1QQDB 4K2UL 3TO2A 1FNEA 1ZY9A 1HCYA 4Y2OB 4ZW8A 1FFTB 3BAEH 1BF8A 3EO9H 5GZOA 5KYNA 3BUIA 3ZE2B 2J43A 2DJ4A 1NL0H 3UC0L 5IMOB 4R9HA 5FOJA 1PKQA 1XGRA 4HS6B 5DJXB 2NXZD 3CHXA 4UDUA 1WFJA 3J07A 3TN0A 1XV8A 1JV5A 2F7OA 2YRZA 3B2UD 1AZVA 4F8PA 1ZHBA 4GG6B 3LPWA 4XN8A 4PJIE 1JZDC 1NLBL 1N0LA 4HS8L 1B4TA 1VFBA 3DA0A 5SWZE 2CRYA 1BBDH 4TMPA 4J39A 4FFTA 3AY4A 3RNKB 3LN9A 3VX1A 3H9HB 2ITCB 4YHIA 4AK2A 2VRQA 4NM8H 2YEZB 1FG2A 5J3HC 2C9QA 2VL4A 1SXAA 4LEBA 4PWEA 4ABUA 4G6JL 2FRGP 2BZCA 3F00A 4OCYH 4GSUA 3QO0A 4BH8A 3OKNA 3WE6B 4H1LH 4PGBA 1HSBB 2QELA 4NQXA 4G82A 2KLSA 2YS4A 3FHQA 4FXTA 4O02L 4R90L 2NX5B 3UJJH 5T33L 3VD2A 4JO3L 3O3BB 1MHCB 4AE1A 2EEAA 4WI3A 3S88L 3QEQE 4DTGH 2YWZA 3TXAA 4CNIA 5EZPA 1BVKA 2DQEL 2FQDA 1FVDB 2D31A 1J8KA 5DRNA 4W70A 1GS8A 1KPVA 1RZJH 3IPBA 4PGCB 4Y19A 3MLXH 1QTPA 2OMYB 2C1OB 1ZAGA 3UJIL 1JNLH 2VR4A 3HLAB 1NFDF 2KZKA 2XFGB 3BQUB 2DS4A 3ZQWA 5DJZA 5FA3B 1NJ9A 3BPNC 3S96A 1FP5A 3KH4A 3PQYE 3RWEA 1S9XB 4WV1A 3BWUF 2ADGB 3QO1A 1IFHH 3LKRA 2AS5M 1JGLH 3QCVH 3H0TA 3HZMB 1JYWA 4LFHG 1I1AA 1OHQA 4K3HA 1DANU 2R2HB 2CJTA 4HPYH 2ZP9A 1RK0B 1FVCA 1BFVL 3DHMA 4F7EB 2C4FU 5HJ3B 1AY1H 4NJAH 4N2NA 4HFUL 5A2FA 1GYAA 1ZT4A 3MRGA 1LWHA 4Q4EA 1CDIA 5DK2B 2V9RA 4P2QE 2ESVE 3LH9A 4PTTB 1W8OA 2X6AA 3LVEA 5D7IE 4G6AC 4X9IA 2FWSA 2XWRA 5DZAA 1A6AB 1A4JA 3IDGA 2Q6WA 4NO0D 4FFZL 2WAHA 4KRPD 2Y07L 4B6ZA 4B97A 2AEIT 3WJJA 2XACC 1TJGL 1XH2A 2VIRA 1A9EB 2WXJA 1GZHA 3VXSD 3BC9A 4JDZB 4X9FA 5F70A 1UD4A 1KB9K 1ONQA 1WZLA 1QA9B 5A1AA 2HB0A 1CVSC 1WITA 4GKZA 2CDFA 2ARWA 3BAEL 1YAIA 3FQ1A 4KJPD 5C9KA 3EO9L 2I07B 2ADYA 2EDDA 4TNWK 5E4IA 3HG2A 4V33A 5HHOE 1NL0L 4G1MB 4OVVA 4YO0A 5I0WA 1ZLWH 1TO5A 5CP7A 3U79A 2R29A 4GQPH 5DD5H 2XZAH 1TCRA 1NC4A 1S7UA 1BBDL 5EO9B 4CW1A 4Z7NB 5I8KH 1OAQL 2XC8A 2ZUXA 4DVBB 3EO0A 4PB9H 4NM8L 4YX2H 3TVMC 1AR1D 3G6AB 3LH2H 3PDDA 4PJDE 3I3DA 2FGWH 3MGAA 4MX7B 1D5XB 3PNWB 4JKKA 4OCYL 3UC2A 5J6SA 4ZFZA 4R96A 4MD5B 3DUSA 1WT5A 4LHUB 2MKWA 3LRGA 3QWOA 2HLAA 4R2GB 5ESVA 3RTQD 3UJJL 5I9QB 4P57A 4WO0A 2ZXBA 1HAWA 3QFDA 4Y2DD 3GSUA 3QARA 1FZKA 4AL8H 4DTGL 4JL1A 4GRLB 1WJ3A 4F58H 1UEYA 5C0CE 2IH3A 1CI5A 1NCBH 3D0AA 4JRYA 2QGBA 2XUWA 1RZJL 2ZPKH 3MLXL 2FJGA 3R4RA 4DP9X 5I1AB 3D1MC 5J0BA 3BWAA 1JNLL 3NIDE 4TQ8A 2G75B 2ZUQC 5AOJA 4ZXBA 2Q20A 1YNLH 3L7EA 3WXWH 1THCA 3WGVB 4FTVA 4AM0B 2XG5B 1IFHL 2VLMD 2VDQB 3L45A 4Z78B 1JGLL 5JHAA 1KJMB 1YNKH 5F6IC 5IHWA 1SJHA 2BSBA 4HPYL 2Z6FA 1AY1L 3AWFA 3UAJA 4A37A 4NJAL 5EU6B 2NY0C 2ARJA 3O9WC 4XNDA 4LLVA 1YMME 1REIA 3NZHH 3O4OC 2A74A 2XWTA 1Q9OB 3L3GA 5AVYB 3N85H 4XNYH 2BHFA 4A1RA 3TBSA 3FT4A 1K4DB 4XCYB 2B1AH 4FXKC 2VLJE 4BE6A 1BX2B 2ARJQ 4NN7B 4NO5A 3MOQA 4FJZA 4FN0A 2G9KA 5LCVA 2JI1A 1FNGA 4X6DA 1T6VN 5C0AA 2WB7A 3WO4C 3R18A 3X14B 1P9MA 5FYKE 4JZJA 4X5LA 5EOCJ 1DR9A 2JXMA 2GTZB 3HB3D 4PJ9A 3S36H 5D4JA 3X1EA 4DOHE 1J18A 4BZ2H 5E4AA 3ZYIA 1HN1A 3DI2B 1D9KC 4OLXH 5JLZA 1MLCA 1KGXA 5DD5L