5LN8A

Crystal structure of self-complemented myfa, the major subunit of myf fimbriae from yersinia enterocolitica, in complex with galactose
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
129
structure length
123
Chain Sequence
FSVEFKATENEIVSGKLDADTPAFHLVMSDSGEHKGWNVRPTGASEGGQMVSADGTRVDLHTNELSWDNDHWWIDDGSERVEATFFLAAGDEVKAGEYQFTGRVEEYVPTVINSKDISATKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fimbrial protein MyfA,Fimbrial protein MyfA
publication title Structural basis for Myf and Psa fimbriae-mediated tropism of pathogenic strains of Yersinia for host tissues.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell adhesion
total genus 23
structure length 123
sequence length 129
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ln8A00
4F8OA 5LNDA 4F8LA 5LN4A 5LN8A 5LO7A 4F8PA 4F8NA
chains in the Genus database with same CATH superfamily
4YDJA 2NY2B 3B9KC 4OBRA 1BG1A 1BZ9B 1Q9KA 4GW4A 3FTGA 4JO1L 5ID1A 1GXEA 1B2YA 3CN1A 1RIUL 3GBEA 2OX5B 4HJUA 5EBMA 4GBXA 4MXVE 1RPUA 4YMPA 2IF7A 2DBLH 3WN5C 4BWTA 1ACXA 5F6HJ 5L88L 2XN9B 3ZRSA 1LVEA 2NY4B 4HEMA 3PXLA 1U8IB 4B7LA 1EZVY 4XBPA 4Q4EA 4MAYD 2XICA 4X5XA 5I1KL 5I6KA 3LKQB 2R0ZL 5AOLA 2BK8A 5DQDL 4AOFA 3US1A 3MCLL 4BD4A 4JGMA 5FDWA 1ETB1 1BOYA 4L4VB 3U25A 3QJFA 4WEUD 5EF2A 3SPGA 1BEYH 2ODHA 3NSYA 3G6JE 5CWSA 1OGTA 2FEEL 3RP1A 4WDIA 5C9JB 1T1ZB 1SLVA 2CD0A 1PQZA 1YQ2A 5F9JB 5GSRA 1XAUA 2YBRB 4HJGA 5KG9B 2ED6A 5D1ZA 1G5GA 1HNYA 1TTRA 3LEXB 8CGTA 5L9DH 4L2YA 3T2OA 3HB3C 5DT1H 4PRHD 1RQ5A 2HSIA 4GKZA 1ZXKA 2JQAA 4WFHD 1OCCB 1GGBL 1R24A 2FK9A 2Q0ZX 5IHUH 3O9WB 4I9WD 3MRFB 3CTTA 5FYJL 1PY0A 2ARJB 1SQMA 1MVUA 5HTSA 3W0WE 3CZGA 2MFNA 4G43A 2DEWX 3A21A 3PE9A 4RLDA 2EVGA 3HZ3A 3W9DA 1J1OH 1J8KA 3WXWL 3GIZL 4MYWB 3G6AA 1T5XA 3HBGA 5EPMB 2F5BL 4PR5A 2AVFA 4XOCA 1WUZA 5JUEH 3FO2B 3NP4A 4LP8A 5F0MB 2ITDA 5D72H 1P7HL 1TEGA 1P5UB 4U6YA 1VKXA 3QUZA 3OJVC 2G4EA 3NZ8A 5FYLE 3TVMD 1UOLA 4A7GF 4QRUB 4UTAL 2QADC 3EO1A 3QR0A 1MCQA 4PJIE 4HMEA 4S0TD 3V9FA 1B88A 1EXGA 3CZNA 1FO0L 3NIDE 3ME0A 3P4OA 4PS7A 4F9LC 3MRRB 4OGAD 2R59A 3HVDA 3DPBA 4M8QB 3I75A 1NUGA 4TSAH 5TDPB 1JGVH 4BE6A 2DQGL 2Z8WC 4X7TA 5ANME 4NSKB 1KIQB 4G5AA 3GBNH 1NL0H 3APCA 1IM9A 3BPCA 1KB5A 4JM4H 4RMVA 4TNWK 2TAAA 5BOJA 3RWDB 2VDKL 4UM9D 1DJXA 2QZQA 4YNYB 1ANUA 4ZNEE 3K8MA 1VZHA 5DEJA 1DBKL 4FFYA 3MV7A 1YNKL 3T6XA 3N43F 2YD2A 4UAOC 1MHHA 2X87A 3EYFA 4WUUE 5DFAA 2K4AA 5E1AB 2JKJA 4U1IB 3JTTA 1MRCH 2WANA 4WW2C 3WGUB 4KQ4L 4Q89A 1SPDA 1RZIB 4YHZL 1UUSA 2AJXL 1UT1A 1A0QL 1E3FA 1X7QB 5DHVH 4P5TB 2G2NA 1BDYA 1UVQB 3ASNB 4CMHC 3CWGA 4CA4A 4JFYA 4J3TA 4G59C 5H37H 5IG7B 4AMKL 1GSMA 5IMLA 4PWHA 4FQCH 3VGGA 2RH0A 5E6SB 1FC2D 1ET8A 1UACH 1AR1C 1PJ9A 4H8VA 2YRLA 5DS1A 3K8KA 4NZDA 5J1SC 4GXFA 4MTMA 5D7EA 1C16A 2O1AA 3ARQA 2OA9A 1HE8A 4PAZA 3F3HA 5LCVH 1YEIL 3BZ4A 4OLWH 3ZKQD 4O02A 4Y1TA 1HSBA 3KLAB 3E8UL 4JFFA 5FYKU 3KPOB 3VQ1C 3UTTE 3WXVH 3BKYH 5DMKB 5A16B 4KK6D 4W9FC 4Z5RA 3HZVB 4PSPA 4XCFH 1FVEB 1K4CA 2PTTA 4IRZA 1QBLH 1EEYB 3BGFC 3P9LA 3AADB 4M1GH 4ODXB 1JZ8A 3ZDXF 4HWEH 4X6DF 2VDOB 4UV7L 3DKHA 1NGZA 3T3MB 2H3NB 3NCJH 5KSUA 2WQWA 1J7VR 3QJHB 3ZK0A 3TU6A 1QD0A 3MRPA 4XOEA 2EDMA 3SE9H 1PZ2A 3OKYA 3F7KA 5B8CB 2XZCH 2HVKB 4RMTA 5DRZA 5IMKA 1A4CA 1JPFA 1MF2L 3EFFA 4DW2L 2X4RA 1KXTB 2AEIT 1R3IL 1BF2A 2O72A 3FO1B 1PPIA 4GPVA 5BW7A 4YLBA 4HS8L 4WTQA 5E95B 3BESR 3QHFH 2XY1A 4P5TC 3GZKA 4K3DL 5AW4B 3J7HA 5BMFH 4YDNA 4X5QA 1K3ZA 4ZO7A 1M9WA 1EUUA 2QSCH 1G7LB 1G6RA 4UT7H 1E6OH 1RJZA 2DLGA 1IGIH 3FN0L 1SEBA 3FU7A 3LZFL 4FTVB 4GO8A 4NKIL 2UYLB 3IGUA 2Z91A 2CDFA 4NI3A 3L9EA 4YHNA 2VN5A 3MJ9H 2P80A 4IIQC 3UGXA 5GZOC 4PI0A 4P9HC 4U1KB 2H4EA 4FNLL 3Q43A 2DM3A 1NM9A 1ZY9A 2RA1A 2VZVA 3BAWA 4GAAA 4N8VG 2VMEA 5E4EB 2EDHA 2F2HA 3QUKB 4AYMC 1MFMA 3WNLA 4A2DA 3QARA 4OB5H 2XZAL 3QEUB 3REWB 1KBWA 1GYWA 4N6RB 1B9KA 3BUTA 3RGVB 3B2PA 2G2RA 3D69B 4KROD 1H3XA 4HGWB 1QYGL 2HKFL 4WENB 3PXHA 5C0CE 4U7SA 3P9MB 1E43A 4WZ9A 3SHSA 3BCDA 4G7VL 3GTNA 1YQVH 4K8RC 1QUPA 1VADB 4FYSA 4N5EC 4Z7VA 5B8CC 5HYFA 3K6SA 3BVTA 4GSDL 3U6XS 4I2XE 1IKFH 1IJ9A 1I3RB 1MHEA 4BV1A 5DWPA 4ISVA 4J3OD 1LILA 2C26A 1V10A 3NJJA 4MMXB 3FB5B 3GSNA 3K4DA 1LHZA 4Q6IB 1CDGA 1P4BH 3OQ3B 2DMKA 3LCYA 4BM7A 5IEKA 2PETA 1OGSA 4H5SA 3GMMB 3SKNA 2Y1VA 4HIPA 1TLMA 3ZN6A 4FYQA 2WO3B 3UH8A 3E6HB 1TJIH 4GAGH 1CU4H 2GK2A 3O3BA 2OXGB 2JJWA 2AK1H 4EN3C 3T5WA 1AQMA 1FFQA 4PBVC 2J1XA 4O9HL 1AYOA 1I53A 3DMMB 4IK6A 4IJ3B 3TZVD 3TEWA 1OSZB 1MQ8A 4OZGE 3VXQA 5KN5B 1BW8A 1P7QD 3T4YA 2VDNL 1GAFL 1TJGL 9PCYA 2F0CA 1OP5H 3QO0B 4GIAA 2AJ3A 3RDTC 1WFJA 2ZWLT 4X6EA 35C8L 4L8BA 3U4BH 1CLCA 3D3VB 5I15L 1EO7A 1MCLA 2H9GA 3KYAA 4GAJH 2P5WB 5F1KC 4GRWB 4OZHE 4A7SA 5FA4B 3CSYA 4AM0B 4QRPD 5JOFA 4YFDB 3TO2B 3V6OC 1TTGA 4LLDB 1UXWA 1DBBH 1XH2A 2CU9A 2E6PA 3PJLA 1F4HA 1ZA3A 4KV5F 1P9MA 4HCFA 4YSAA 1EJ8A 5LBSL 2LU4A 3FQNA 2X2HA 4G8GE 4Q6IC 4Q52A 4TVSa 4WFEE 2V9RA 4YFLI 2R29L 4DKAA 2PCFB 3ARFB 1I85C 3U4AA 4QR7A 3FN9A 1FO0H 4LOVA 2CJTA 1HKLL 1U4FA 2DQCH 3K72B 4KJWD 3VCLB 4ZS7L 4JFTA 2VNCA 4B9CA 3RTQD 1AHKA 1IFRA 3BP5B 4G6FD 3VI3E 4DOHB 4HPYH 3WMQA 3QEQD 4POYA 3MHZA 3QUGA 1KJ2L 4PJ5E 2WTRA 1WDAA 1S7VB 1YNLH 2BWQA 3QEHA 2VXUH 1X7TA 3B8YA 3MOBL 4KI5C 3CH8A 4TUOB 1HNFA 1T5WA 1Z9LA 4R3SA 4PY8I 1J0IA 2E9JA 1U91B 2ZCHH 4LLUB 4LFHG 4EUPB 2F19L 3LKOB 4A2EA 2ZP8A 5LGHH 1FZMB 1EA9C 5TGBA 2AS5M 2LU3A 3S36L 2BSBA 1F2XK 2BJMH 4FQPA 5HYSG 1EEZA 2CO4A 4KKBC 3BPOB 2APWA 3QHTC 2ZXEB 1A5FL 1RD6A 2X3CA 1UWGL 3H9SE 3PWVA 3HPJB 3VFWB 3WIFB 5BS0A 3KPRE 1S9WB 2PXYB 4GG6B 3QPKA 4N2EA 4LDLB 4N0UB 1Q1JH 2HXAA 3U9WA 2R51A 1OCZB 1EDHA 3S9DB 4KAQH 2WP3T 2Z4QB 4P2AA 3TJHC 4R8WH 4PIBA 3FOLA 4ODUA 5KEZA 1LQSR 1FP5A 3SJVA 1A6AB 2A9CA 2HUHA 2P5EE 3QIBA 1MWAL 2WXMA 5TFSL 4PCTA 1MJ8H 2OMYA 1GHFH 2XN2A 4IDJH 3RVVD 1FN4A 5I8KH 2VDKB 4M6NH 4B97A 2H32B 5IQ9A 2V7HB 3E6FB 3ARFC 1E3ZA 3FUKA 3V0VA 3PFQA 2GEQA 1U8OB 3O6FC 5IQOA 1T3FB 1DQLL 5IFJB 1KGUA 3M6DA 1ZT1A 4G6KL 5BO1H 4V2CB 3PHAA 5J1AA 4RH4A 5FW6A 2YSSA 5DF0A 2A38A 5FHAL 1GOHA 4H26B 1F8TL 3U7YH 3VYOA 5IJDC 1MVYA 4HT1L 1WAAE 4OLVL 4KPHH 3FUHA 1AZBA 4MASA 4P0DA 5I8OH 4ZW8A 2D31B 1BQKA 3PAUA 3IGAA 4ACTA 1NJ9B 4IK7A 4JN2B 4MRCA 5F6HI 5K69A 2GJZB 5JNYA 2XYCA 2H7WA 5KSBB 3NSFA 1G1YA 1T04B 2IH1B 2NY1D 4DW2H 2NUTA 3HS0C 3BPOC 4RQQB 1IL1B 4DZ8B 3I02B 4PJXE 3G7TA 3GXNA 5ICZA 2VLJA 3V0HA 1BQHG 4JZJA 4IU2B 1DVFA 2NZ9C 3CFNA 2ARWA 5FYLL 3S3PA 5AYUL 4HJEA 5D7LE 5DJ2A 1K6QL 4XN8A 5BO0D 1JL8A 1O9VA 5DUBB 3V4VH 2WVUA 1ZHNB 5JHLL 2UZYA 4K7PY 4K3EH 4KDTA 3T0VA 2VRKA 2VWEC 1M56B 4QXUH 4I85A 3LVTA 1AZRA 2DLFH 4FLQA 2DN7A 1KYAA 2GVYA 4XP5H 3CU1A 4LKCB 2QGBA 3LRLA 3D6GA 1F56A 3LD8C 1GZPA 3VFGH 4CSSA 3MU3A 1M42A 4GMTH 3C12A 5KS9A 4XP1H 5IBLC 3T6QC 4GW1A 3VXTA 2YOAA 2GKIA 4DESA 1N7ML 3FONA 3FBQA 4KUCF 3DX7B 1HQRB 4OD1H 1P84J 4TSBH 1YN7A 3DYOA 1K72A 3BP6B 4G8EB 3TN0A 4K5MA 3LS4H 5GJSH 3UP6A 4DUWA 2YAFA 2HVJA 3QAQA 2WZ5A 3WHXB 5E8PB 4F8LA 5L7XH 2W9EL 2GY5A 4DEWA 1N70A 1QFWI 1ZANL 4NQEE 3D39D 4A6YL 3BP4B 2IAND 3DVNB 2HVBA 3CVIH 5F7FA 4F8NA 4HS6A 4HUCA 3TYGH 5E6IB 2BSSB 1MREL 4NT6B 3TESA 1IKOP 2BC4A 3CFCH 4G9FB 4L8DB 1Z9SA 3DX9A 1E4JA 3DV4A 4NFBA 4LEEA 5I30H 3L16A 3QDGE 3IGLA 4KUZL 2BP3A 3X3GH 2QPDB 2ADYA 4A2FA 4NUJB 2NQCA 1WFOA 1IQDA 1FVCA 3NYKA 1AGEA 2FR4B 3FRUA 4AMXA 1LWRA 1T21A 4F33B 2G4GA 3H3PH 4ZUSB 2ICEC 5K9JH 1T2JA 1ZT4B 2R2HA 3AQDA 4XGZB 4Z1PA 2NW3B 2NDGA 3QCUH 2XACC 1IC7L 5IWLA 5GISH 2A9NL 4YOKA 4YDMA 4Y19D 1RIVH 3GSVA 1OCWH 1BMWA 3O2WL 4FHKA 1T89C 4XMLH 1L6PA 4YE0A 3GS4A 4M62L 4PGCA 1EHKB 2IG2H 2MRYA 3OZ9H 1D5BB 4PJDF 4JHUA 4QI3A 1CYWA 2HLAB 4ONOA 1COBA 4PS8A 3QXAB 3C6LC 5CGYC 4NPJA 3WFEL 1CDBA 4DP4X 2EQDA 3OWEA 2DI7A 3RJQB 1U8JB 5HYJE 3W2DH 2DQTH 1DEDA 4J1UA 2ZP0T 3VGBA 2E9IA 3Q7JA 5C09D 3ZBMA 3SKOB 4PRPA 4OD3L 4HQQH 5E7FA 1U8CB 5E6IC 1OV8A 3HFML 4N9GB 3S5ZA 2H8PB 3RWEA 4MQ7B 4XVUC 3OPZH 3FQTB 4YBQC 5E2WH 4ZMZA 5D2LE 2YKLL 3MBEA 1MCFA 4TVUA 4Y4HA 1J5OH 2MKLC 4JFDB 2R29H 3QFDB 2AEWA 4N8CH 1X5JA 4NUGH 2VDNB 2XIIA 4YZWA 1T7ZA 2DM4A 4XCEA 2XNAA 2DLIA 4L3EA 3VQLA 5JO5A 5DURB 1N6QH 4NQUA 1EJFA 5IHLB 2A6DA 3MJWA 3T1FA 1LL1A 4HJSA 1I1AC 4WO4A 4X8JA 2JSFA 2Z1KA 1EBAA 4WY7L 4XH2A 1WZ1H 2NY6D 3UPRB 3QWRD 1JRHL 2ESVE 1E9PA 2ZOTA 5DSCB 1CQYA 5KVDE 4DO4A 4JRXE 1IQWL 1FL6A 5EZOH 3S34L 1F90L 4QEGA 4XC3H 1FWXA 3QULA 5TK2A 1A21A 2UXGA 2WN2A 3ZIMA 1ND0B 5CMAB 4AT6B 1EO8L 5EC1B 4PU2A 1O75A 2G9HB 3UTSD 3CFKA 3KXFE 3UIYA 3W3BA 3FXIC 3LH2L 2GSIA 4JQIA 1OB1B 1A5FH 1P4LB 3VI4A 4C4UA 5G4MA 5DMYA 2GJPA 1WCBA 4R4FL 2K6ZA 1NEZG 1LD9A 3D2TA 2ZUQC 2CO6A 4NQXB 1XGUA 2W80C 2WINB 3U48A 4QRRA 4PW4A 4TVPE 2ENSA 5AWNH 1KPVA 4HFUL 5IZ7A 2FBOJ 3C60A 3L5HA 1WBYB 1BXXA 3II1A 1B0GA 2X6CA 3VD0A 4D7BA 1XR9A 4HPHA 5FGBC 1E5BA 2QZ5A 1ZLSH 5A3ID 3FT2A 2P49B 1KJ2B 2YD9A 2J55A 3LEVL 1A6ZA 4JCMA 3FFCD 3HKFA 1VZGA 2AI0L 5DHMC 4D0DA 2UWEE 5I17B 1BBDL 1XL6A 3BH8B 5DS8A 5JIPA 1A7NL 2WSKA 3K0WA 3IDIB 4J8QA 3O8XD 4CVXB 2WLYA 3CAFA 4O2CB 1ORQB 1FORH 4I4WB 5C0IA 4OZ4A 2WXGA 1XH3A 4AENA 1XCTA 3EFOB 2Z1PA 5H94A 1LO4L 1ZGLM 5MEPB 5C0GA 1MCRA 1MW0A 5JIKA 4WFGE 1E4WH 4Z6AT 1UOKA 4GRLB 3WIHL 1Q1PA 1U8NA 3SDXA 4GUOA 1DQDL 3IS0X 1MWAB 1RZ8A 1XBDA 2Y6TE 3NCFB 4DVRH 3G6JB 1IEAB 5AZEH 3S36X 5JW4M 3G5VB 5K59E 1OPOA 3PQYB 2DDQH 4NO5B 5FYJU 2QGDA 3EOBA 4M93B 2MCAA 3U30C 5DU7A 1ZAGA 5CILH 3NBNA 4CBZA 4DGWC 1UM5L 2EINB 1AAJA 4HJ1A 4N3UA 4APQB 4M5SA 4MQTB 4BQ8A 4IIZA 1P84K 4X9BA 2ZG1A 3E1F1 5GGVH 4ZYKB 4L3AA 1ET5A 5IVXE 5DMJB 1CYGA 2IOMA 3IAQA 4OQTL 2GITB 4E41D 3HRZC 3KYNB 2FYYA 1I9IH 1NKRA 2QQNL 4QGYA 3QGVA 3SGEH 1UM4H 2P8LA 2EZ0D 2FX9L 2C9AA 4KXZH 2EEDA 2AQ3A 2X09A 4Z0XA 4KKLC 4ZW6A 2R2BA 4HKBA 3T4AB 3MRCB 4QT5B 2VLKE 1Q72H 1XO8A 2XQ0A 3MMEA 4N8VA 2JQMA 2UV3A 4XAKD 2IQAB 2X1XR 6PCYA 1MN4A 2P26A 1HX0A 4NUQA 4R0LB 3WUZA 2XWZA 2MPAH 5EOTA 1SBSL 2WXIA 4MD0B 1AD9B 5KTEH 5FHBL 3U46A 1NPNA 4W9IC 4IRJB 4MB1A 1AMYA 4ZJ9A 4JK0D 4PJIB 5SWZA 1DVUA 2XV6B 2ENPA 4LIQL 3GLEA 3RL2A 2WXJA 2VOTA 3IFOB 1RZQA 3NIDB 3QNZB 4XMTA 4HZLB 2D0FA 5FUCE 4XI5C 3OBAA 3AAZA 3B1UA 3ECUA 3QHZL 1GGUA 5E9DD 4JANB 3CNKA 1U2YA 4LCCB 3DX4A 1V27A 1KGYE 1YDPA 3RVTC 4JX0A 3MA7A 5ANMB 3DPDA 4M7LL 4R4BB 5CZXD 3WFZA 2P8PB 4A63A 4APQC 3DDGA 4B50A 5MERA 1J5CA 4HEME 5GGTL 4HOZA 4ODHH 3QFJD 1NFIB 2GAZA 1HDMB 2YPVL 1I8LC 3V5DA 5D7JA 2AXGB 5I2IA 4E9YA 1MFEL 4BKTC 2W81C 4P3CL 4G3YL 4AKPA 2Y22A 5SV3A 2WBJA 3LIZL 4U6VL 4WUUB 1B4JL 1N19A 2VXQH 3P4LA 4G8FA 4OUUA 4A7QA 2WB7A 1ACYH 4HHGA 1JTOA 2FO1A 3VGEA 3VXUA 2J72A 1GPOL 4YR6A 3O2WH 3T4AC 4A6YB 1NFAA 2AEPH 3MPCA 3O4LA 4FZEL 5IJCC 4NKMB 3DGGA 2DQHH 3C09C 3GMQA 4XVOA 3FHEA 5DMGD 5EZIL 4DERA 4KNQA 4U6HB 1MLCA 2GSGA 1S4IA 2H6UA 2J3SA 3FU3A 1PG7H 3DJZA 3JV4A 1INEL 3ZMNA 4N2LA 3KPNB 3ZKSD 2JKSA 3VFUA 1OM9A 5CP7A 4WJG3 3CHOA 2I9LA 3SKJH 3UTTB 3BISA 4RAUA 4BKLB 2NUPA 1PZSA 2YPKB 3TWCH 1DJIA 3UMNA 3QQDB 3MZTA 3QRBA 5FWQA 1FRGH 4CBPA 1QA9B 5DJYB 1LWJA 5HPOA 3D1MC 2H26A 5JA9A 1OK0A 5I8EA 4UDUA 2IPUG 1FHGA 1Z0NA 5DC9B 1QFUH 2PYFA 1YEFL 3UAAA 3HLKA 1XXDC 3RUGF 2KUTA 1SXSA 1WCQA 1DQMH 1JRHH 2GJ6A 5C3TA 3BAJA 3VXOA 1A8JH 2B4CH 3CD4A 4PD4J 5AAWA 1NFDA 4IYKA 1XMWA 1JG9A 1U92B 1MRDH 3AREB 4DHLA 2IMMA 3D0AA 3RI5F 5ACZB 5CN3A 3WNKA 3QZOA 3STLB 3VSVA 1NCHA 1C8QA 2ATKB 3OB8A 1CGVA 2H0JA 3DYMA 3ZT7A 4MAYC 3MNZB 3ULVE 4JPSA 2NX5D 4TV3A 1XZWA 5JW3H 5J13B 1QTSA 1G9HA 1NCTA 2QPUA 2FCBA 4I7ZC 3AFLA 3WD5L 5E94B 3WKQA 2H1PH 3MV7E 2X7LA 1IBBA 4MA7H 3MGAA 1S7WB 2BERA 3F5WA 3VRLE 5HGBA 1J5DA 1CMOA 2VSMB 5CN2A 5GXBB 4ERSH 3ZTNH 3A6OA 1S2EA 3SCMB 3WL9B 4DK3A 4UOJA 3ET9F 1D6EB 3UP1A 3RPIB 1HHHA 2EDTA 3AS2A 1E4HA 4JW3A 2OW6A 3PDDA 5I71B 5IM7B 8PAZA 1MCBA 3FCUB 3OM3B 3TO4B 1FL3B 5JXEA 4TOYL 4EIBA 1ADQL 1DCEA 5IB3A 2FX7L 4FKEA 1N64H 4I2XB 3BLBA 1NDMA 3IETB 3FT0A 1TSHA 4EOWH 3JV5A 2FGWH 4G8IA 5DFVD 4FTDA 3UPAA 2B08A 3D85B 1MJ7H 4JFFE 2VERA 2XTJB 4GT0A 1X5XA 4NNPL 2Q7YB 3TM6A 5I1AA 2VITA 4IKNA 2QHRH 3AREC 2N0MA 1BJ8A 4DJMA 4R26L 1Q9LB 2ORBH 3MLXH 5BQDA 3LN5A 3WJLA 1ERNA 1NANH 2B0SH 2HPOA 2E6QA 2NY5H 2XPGA 2VQ1B 2C4FT 3VA2C 2X4OB 3ASWA 1BQHA 3QIUA 3GJEA 4MDIB 4ODBD 1DE4A 3BXNA 3W11D 1BQRA 2Y4SA 4ONGH 5AVZB 5GGQH 4JLRA 4OZGB 3HW7A 2FEJA 4PH8A 2WTPA 2MNWA 5I73C 3KAAA 1TZAA 3PHQA 3Q3GA 3SCMC 2FUTA 1CE6A 2BHYA 4GSUA 3EJTA 1A3LL 5ANHA 2B2XL 5F8RC 1MDTA 2DQFB 4X7FC 2Y7QA 1VGEL 3E1ZA 4OZHB 3RU8H 4OJFH 43CAB 1LEKA 4RBPH 5KVDL 5JR1L 3BRDA 3LKRB 4P3DB 4BGDA 2PP9A 2BXZA 1D5ZB 1R9FA 2BSEA 4Y4FA 2X4SA 3DBSA 3VGAB 5DJXB 1N5AA 3DV6A 3GO1L 2WNXA 4IMLB 4LSVH 4PV1C 4YBLC 3NPZB 3ROLA 1GSKA 1YO4A 5DHYB 3ATFA 1T83C 5HHXH 1HHJA 4NQDB 3I6KB 4FQIH 5CIPH 3K1KC 1Z3GH 4G8GB 2XTJC 3DBXB 1NAMH 2Z8SA 4JPVH 4AUUA 1H3PH 4JM0A 2IGFH 1LO2H 1DANT 1RI8A 3C5SB 2J25A 1J8SA 2LFEA 4TVPL 1HYSD 1IE5A 5EEYA 4J3OH 1QFWM 3ECVA 1JZEA 5DUPL 2G3ZA 1E28B 5DQJA 3VI3B 4DN4L 3OKDA 5SX4I 3QJXA 4NFDA 3ZZLA 4ZOEA 1KPUA 3NCEB 4Z7VE 2BHFA 3EDKA 2QQKL 1WZMA 1NC2A 4W9HC 3QUML 2Q76A 4FEMA 4MB4A 2FJFA 3KCPA 5FV1L 4XO5A 3GRWL 1D7DA 3B2MA 4LAJH 4Z7NE 1G9ML 4MJ6B 1KYDA 3OKEA 1QLEL 3RDJA 6CGTA 1QR4A 3WELA 3IDNA 1I3GL 3LHAA 3KYMB 1DQQB 4LAQL 1RVFH 3G5ZA 3LHPH 3T08A 4NFCA 1LMKA 2CKBH 3H9SB 3QPXL 3WFDH 3WE6A 4F3FB 5IBTL 1M6OA 2Z8RA 5E2UH 2X70B 2X9YA 4HC1A 4POUB 3POHA 4QOKD 3PV7A 5B39B 1FG2B 3O0RL 1SJHA 3VGAC 43C9A 5HD8C 2NY5C 2QMJA 4PJHA 3WJMB 2ICWA 1QSEA 4NC0B 4R83A 1U41A 4LDEB 1TZOA 5ECJE 3OZKA 5FPIA 3MYJA 3V5KA 5HYQA 15C8H 1A7OH 4LF3B 1EERB 4JY6A 4QHNB 3B34A 5TE6L 4F7CA 3UJJL 3GS0A 4PD4K 1E8ZA 5DURD 4CW1B 3UCRA 3SDAA 4KK8C 3VFNA 3MACL 4EO5A 4FNTA 5D96C 1RJLB 6FABH 1A14H 4KJYA 4YFEA 4L5FL 4XCYB 3GLDA 4M5TA 2BS71 3VW3H 2X6MA 3C08L 1OM3H 4A7VA 4Y2DD 4BHUA 4MCMA 1MCDA 1CZ8L 4W70A 1SLXA 3VWKA 2PW1B 4L18A 4JM2F 2DEYX 1ITBB 2CNYA 2I5YH 1T0OA 4LRNL 1XWVA 2E7BA 3TBSB 5I0XA 3HUJA 2IH9A 3SQRA 3UABA 3KPMA 2SEBA 4PJXB 4XP4H 4Y5YA 3QZLA 4GNKB 1FNEB 3VWJD 5CBAB 2DH3A 1AY1H 2VZUA 1KJMA 3FT4B 4WGWB 5EEWA 5B7MA 1WH0A 5FM5O 1QR1A 1FV1A 1B6DA 3QEGH 2XJKA 5T3ZD 5D7LB 4WJ5A 3POCA 2F8IA 3A4DA 4LSTL 4R5XA 5JIQA 4QRSA 2GTWA 2NSMA 4J3OC 3MODH 4NWTL 3WDHA 2IJ0C 2KZKA 4GFTB 1LEIB 4MNQD 1NEZA 4H20H 4NN6B 1YEGH 5EWIL 1RULH 5AZ2H 2DWTA 3TEUA 3EW3B 1OSPH 2G75A 2X12A 2EICA 4X98A 1OT4A 1MCOH 3T3PE 1KTBA 3L3OC 3Q5OA 5HYEA 2LABA 2MOVA 3KYKH 3EH2A 4CMMA 3C5ZB 3NVQA 3U83A 1EBPA 2OI9B 5BS0E 3V8OA 3PCYA 1I1YA 4FQ2H 4GEIA 1OP5K 3SGJC 4JDZB 4N6QA 1WISA 2JKWA 4RA3A 3QH3B 5DR5H 2ZYHA 4RGMC 2VR5A 4QRTB 1Q0EA 4EZKA 3HI1B 3LNHA 4FI8A 4NPKA 5LN8A 3SJVE 1WWBX 2B59B 5IV2A 1IVTA 2VR3A 2APXA 2WKOF 5CINL 3PDOA 4NQEB 1CFMA 3QXVA 1KGIA 4NGHH 2WQRA 4XT1C 1XSOA 2CA4A 4JPKL 4F2EA 4Z3IA 1ZVSB 3MAWA 1NAKL 2L0DA 4FJYA 1JZ5A 1VLXA 2YA2A 1AHMA 2V7NA 5F7HA 3H85A 3QDGB 4RAVB 2NRDA 3OKKB 2XWJB 1TETH 3VA6A 1U8HA 3TIEA 2CXKA 1NQBA 1JZIA 4HK0A 1T22B 5E99H 5HHPB 4KZCA 1E5YA 5IQMA 3PUUA 1FLRH 3VG9B 2CBPA 2OMWB 4NN6C 2W0PA 2O61A 2DQ6A 2LE9A 1Q9OB 2AMUA 2X0VA 4OV5A 4KJWC 3HI6L 3W0WD 1MIEH 2EEXA 4J6RH 3SGDH 1U93A 3BZFA 3DNKA 3MKGA 4XHJD 4OD2B 5AAMA 3ZKMD 3LSOA 2V5SA 3QG7L 5DLML 1YEDB 3GNMH 1MAKA 4PG9A 3ZL1A 1IVLA 2VLJE 1MFBL 3F05A 2VDML 3BUDA 1A4KA 1FVDA 4E9WA 2ZXQA 3JV6A 4GO9A 4X7SH 3JTSB 4ZMYA 1P7KA 2VDLL 5HYJB 4ZX6A 1OKEA 1ES0B 4KHXH 1J87A 5GGRA 4I1NB 3EGDA 4UT9L 1WRFA 4P46A 3K6DA 1XF3A 2YOCA 1K2DA 4BINA 1J9QA 3PWNA 2FIKA 1NOAA 3BC9A 3QPQD 3PWUB 1DUYB 3GINA 4K3HA 1WIOA 2PP7A 4MRBA 5HVHB 1N6VA 1CC3A 1LO3L 3V4UH 2E7LA 2XBZA 3S8GB 2Y3AA 3ULVL 1KB5L 3B6SB 5KS9E 2K3HA 2VT0A 1BX2B 4FFYL 4MVBD 3EOTH 4P2YA 5EUKA 4EVNA 3CHRA 4EKXA 3VRJB 2D2OA 1QPXA 3TXAA 5J3HD 3ECBB 5DYOA 3UBXB 4MDJA 3S35L 4ORGB 4MCZB 1HSAA 2HFFA 4ZO9A 1IAOA 5AOIA 3RLSA 2CJUH 4TNEA 1OALA 5C8JA 1UB6A 2ZSWB 2XWTB 2OV0A 5AQ0A 2EC9U 3RKDC 4OLXL 3QO1A 1J1PH 4L9LB 3HE6A 1UASA 5DRWA 5D1XA 3WNIA 3IJEA 3EFDL 4YPGB 4CL7A 3EJYD 3KXFB 5F97E 4X9FA 3SD5A 2V5TA 2AQPA 4QHLA 2E9WA 1CLOH 3GSRA 4ENZA 4ZUTB 1TFPA 4P5KA 3ZTCC 1KCRL 3FUEA 4O02L 3DLQR 1KGJA 2NY1C 1FH5L 4RFEA 3VXPA 1J11A 1L7TL 4KO9A 1S46A 3NJIA 1T7YA 2Y5EA 1WHOA 1QUNA 1ULVA 5KZCD 3ZSSA 3UZQA 4LBEA 3WEXA 4GFXA 4XNMB 2GBVA 2Q6WA 1U3YA 2DM7A 2AJSL 1IAIL 4X50A 4X4KA 3QUMB 2F54D 1F4WH 2M26A 3C9NA 1KPRA 4R7NB 3KVDD 1CFQA 4PHZA 4AIOA 1IIKA 4JGNA 3ARDD 1QLEB 3M1BA 3V52L 4E0RA 3HPLA 4LU5L 3SE4C 3N6YA 4L5FH 1PLBA 4F92B 1BMGA 5LXVA 1ID5I 3CFUA 4DPBX 3ISRA 1M2VB 2RAMA 4PRPE 4R90H 4QNPF 4D9QD 1JNLH 3Q06A 4L9LC 4O58L 3MUHL 3I6SA 5MI0B 3UYOD 2YXVA 2L04A 3PPEA 1PBYA 1AXTH 1R3LA 2H45A 2YMXH 3L81A 3EOYG 1XZ0B 4L3EE 4BUQA 1E9QA 4XC1L 4KGJA 3AY4A 3Q8AA 5DFWH 5HYIA 3CMOL 4UM8A 4YDZA 1HI6B 1M1XB 4GP4B 5HHVH 2Z6FA 3BQUB 1FHNA 4FQJH 2H0PA 4QTHA 1CLYH 4JKKA 1E27A 1F6AB 4N25A 4U6TA 3MN8A 4H1LH 3SOBL 4NYLB 4UQBA 1R5WA 3ARVA 3GSUB 2V4LA 4FMKA 2J57A 3A67H 4NBZB 1KC5H 5TD4A 5IHWA 3RAJH 4BDVB 2ILLA 3TEYA 2LT9A 4ZFOA 3VTTA 4Q9BA 1J0HA 1UURA 2MKWA 2WLLA 4FQQB 5CJ8A 4YHOH 2BZ7A 4KJPD 4L8CB 1CCZA 3FFOA 5DJAB 3WO3B 2Q7NA 2R69L 3LVEA 4U1JA 4PJGA 3RWIA 3IB4A 4QYOA 5F3BA 1MFCH 1QSFA 4YLCA 4PRID 2JH2A 4YZFF 5C0CD 1HOCB 3VI4E 3Q2NA 1G9MC 5EU5B 3TO4D 2YEZB 3FS9A 4NRYB 3RHWF 2P3YA 3ARGD 3SPVA 2OL3A 3MUZ1 4OCMC 1AD0A 4PSRA 5JZ7C 2DYPB 1DQVA 5DK0B 5C07D 4AEEA 4ZFGH 1WWWX 2G5BB 4QRRE 5F7EL 1NBVH 2GABA 1D9KD 4APXB 3NJVA 3E7JA 3D85D 1CFVL 4G6AC 3ULUD 1EO5A 3RNKB 1OT1A 5MI0C 3VH8B 3X11A 5A6LA 1JV2A 5I6PA 4GSXA 4F2FA 5AKSA 1PCXA 3I3EA 1JFQH 4RDQG 4X8CA 3QXUA 7FABH 3UTZA 2D7QA 3BEVA 2A0LD 1TQVA 1NKOA 5EBMB 5D7KD 2VB5A 4GBXB 2BIIA 5C3IA 1X9LA 2EJ1A 1ML0A 5I26A 2P7TA 3TL5A 4DNLA 4KVPA 4HUWA 2WXHA 2OMZA 3AGWA 3US9A 3UGUA 4DGYH 2ZOOA 2DTMH 1F02I 2X5PA 4X5XB 3PS6A 3EYUL 3UFIA 1HYRC 1A6WH 4ODTH 5DD5L 5FV2A 4ELDA 5EF1A 4ZPVA 5AB9A 2XA8H 2GYSA 1NINA 5A2AA 4PB0L 3SDXE 3WKNA 2X2UA 4IBLT 2EXWC 2CQVA 3QJFB 4YHYB 1NA8A 3HZMA 3INUL 2QBWA 1QWUA 5CWSB 1KXVA 3GQFA 1OGTB 4DCQA 4NENA 3ZZ1A 1ICTA 4WDIB 3S37L 1PQZB 3L9YA 2X3AA 1UHVA 1U42A 5PCYA 1NMCB 3H3BC 4M61A 1KCLA 4HJGB 2XY2A 3F7PC 5D1ZB 4C56D 3T1WA 2Y06L 3D12B 3MR9A 3R06A 1DSFH 1W8NA 3V4LA 2WNKA 2XWEA 3BFOA 1QP1A 1NC4A 4GKZB 5I5RA 1I8MB 4WFED 4MNGA 3AMKA 1R24B 4BRVA 2NPLX 3X13A 4KNTA 4F58H 4JRYA 1OPGL 2GTZA 2YFOA 1AZNA 2GY7B 2IWKA 4B9FA 4YDKH 3HNTH 5FUCC 3ZE0E 2E4TA 4JY5L 1JVOA 5FGRA 5C08D 1BZOA 4GBXC 3QQNA 4G43B 4WW1A 5A6IA 3CSBA 2NCMA 4HSQA 5H37G 2V2XA 3W9DB 1W0VA 2C3VA 1A7RH 3D7PA 1U58A 2FBRA 4PJ5D 3CK0L 1T5XB 3G6AB 5AL8A 3TLRA 5T3XD 1XCWA 4PR5B 4M48H 4NRXA 2AJYL 4AYEC 2VDMB 1J88A 3L4TA 3MOAH 3ZL4H 2ITDB 4AZ8A 5A3IC 4OLYL 2JNZA 2WXRA 4U6YB 3QUZB 1VKXB 1VB9A 1KOAA 3G5XA 1NDTA 4NDMB 2VDLB 2C9UA 3EO1B 5SWZE 1RUPH 3EH3B 1T1WB 1II4E 4QTIH 5DZOA 3WY4A 3H9SD 2IO5A 3ME0B 3O8XC 1L4IA 1AQDA 3KPRD 4J3XA 1EHNA 3P4OB 4FS0A 3QXTA 2WYTA 2ODIA 2R83A 3DPBB 3I75B 1RLWA 3OGOE 3LRHA 1NBYA 5DJDA 2EO7A 4X7TB 1AGCA 1ONQA 4ZPTA 2I9TA 5FW8A 5IFAL 1ZMYA 4PLJD 1IM9B 3BPCB 1KB5B 5C7XL 3SQBA 2P5ED 4UBDD 5H8DA 2G3XA 2BVYA 4NHCH 3BAKA 1PJWA 3MV7B 3IWVA 4XXCA 1U3HD 4GP5B 1X5HA 4X83A 3EYFB 2FRGP 4ADGA 3QAZB 4KKNA 3JTTB 12E8H 5L2KD 2WTOA 3JVFC 4L1LA 3RY4A 3VXUE 3T71A 3L13A 4HDIA 2P52A 1BZ7A 3LNDA 3O4LE 3CZFA 5IB4A 1IGCH 1GTFA 4L37A 4RISL 5BVPH 4Z95L 5IB1B 1E5CA 5IMLB 1T4KA 2YD5A 4JG1L 3ZGIA 4LHUG 5ALBL 1ZPUA 4MZ2A 2F53D 4KH2A 4HJTA 4KKAD 1H6TA 4HUXB 5JHDA 2H5UA 3N9GH 3EJUA 4QPEA 2EZ0C 2CH8A 2HT3D 1GVIA 3TV8A 2R1WA 1R34A 3T3MF 4ZW5A 3BZ4B 4O02B 1HSBB 1SNRA 3R8BB 4JFFB 4L8SB 1KCVL 3IDMA 1M7DA 4UDTB 5DHXB 1CDIA 4U0RB 4PG2C 1C9SA 1TT6A 1BEXA 1BECA 4Z5RB 3OC8A 2PTTB 1BV8A 5EH1A 1N9PA 3CFEA 3P3RA 2XN0A 3ESUF 3NZUA 2BIQA 3CBRA 3P9LB 5I0WA 5J06A 3ULVC 3L3DA 1MJJA 4UQ3A 1NGZB 1BIIA 2DWDA 2WVSA 3RGBA 2VSCA 5KSUB 3FC8A 3QDAA 4M9PA 1N26A 1QPPA 4KGLA 3WMSA 2ZJSH 3FRPG 5T1LA 5T8IA 3VGHA 1WS7A 3DX0A 4YH6A 5IVNA 2KZBA 5J6HA 5DRZB 5IMKB 2GJ6E 4HUNB 1AOHA 3EFFB 3QAZC 1JZ4A 3UTPE 1KDIA 2X4RB 3KPPA 2EH8L 3ERXA 1NFDE 2X40A 4PRBA 5D2NA 3C5ZD 4TTDD 1I8IA 3LKPA 1AZVA 1INQB 2Z3FA 1UUNA 1HC1A 3RA7H 5DK2A 4Z7WF 1H0DA 1UCTA 2H32H 2FECI 4OM0H 2B39A 3IDJB 5FAAA 5M94B 4P2QB 1P1VA 4WEBL 4ZXBD 1JK8A 4XXDA 4ZBJA 2QV2A 3ARBA 1G6RB 2X28A 2HKAA 1RJZB 1ETZA 2YPLB 5HDWA 3RWFA 1C7TA 1KLGB 4PREA 2GBTA 4MJID 4AQ8A 4Z0BL 2J6EL 2VJXA 1XGYH 3G9VA 2Z91B 2CDFB 5AG8A 5FUZH 4EI5B 2ZUUA 1QFOA 5IQNA 3WO4C 4YHNB 2CRMA 5AALA 4DSYA 3QIWC 4L8SC 2JI2A 1UOWA 1R47A 3CC5A 5GHWL 2CUAA 3BJ91 3FO0H 3UO1L 3L7FA 3QDGD 2XRAL 5T1KD 1UZ8A 4GMSL 5DHDA 2FQGA 4KTGA 1AFVL 4WU7A 1BAFL 3G5WA 1P1ZA 2AV1A 4TSCL 1J0ZA 5FIEA 1KACB 4LVNB 4DGVH 2EKSA 3H6AA 2YAQA 3MRKA 5DVNA 2KQMA 4Z7VB 2I07A 2VDQH 1FL5B 3FQYA 1M3JA 4KZDL 4J4PD 2BOCA 3H2PA 4AC4A 4EXPX 1BD2A 2OTWA 1GZQB 2AAVA 5AW7B 1MHEB 5E5UB 3VXSA 4ISVB 2QQLL 3RG1C 1OTSC 4FABH 3ZE2F 2EYSA 3L1EA 3BKML 3GSNB 1YYMH 4Z7NB 1K3IA 4NCC2 5B3JF 3WTVA 3D9AL 1AGFA 4PJ7A 5IEKB 1LDPH 3QUHA 3NDYE 4J23A 1O5DT 5DZLA 4H44C 4OU3A 2ZAGA 3SKNB 5HYJD 4B9GA 3NIGE 1L0XA 5HDBF 1JFHA 3O3BB 4NP4H 2VZ1A 1PFOA 5EIIG 5TE7H 1YYLH 4Y5VA 3CIQA 3N85L 3FSZA 1XDTT 1ZXQA 4KK5D 4XZUA 3HG3A 4EI5C 1PMYA 3CXDH 3D48R 4GRWF 2PO6D 3NCWA 3FB8A 4IGBB 5HDRA 1H19A 2DEXX 2WIMA 1NIEA 4PWFA 3AQXA 4WCYH 3T4YB 1BM7A 2HFGH 3LYRA 5ITBH 3B9KA 5E2TH 1E7VA 5EO1A 1P5VA 2AJ3B 4ZUWA 4JKPH 5F96H 3H4FA 5C70A 4N2FA 3RL1A 3UZVA 4NPYA 2E3VA 4MJ2A 4L8BB 4DETA 1EFXD 4DP8X 4D0BA 5BRZB 2H9GB 1TYRA 1CIUA 3WN5A 1F4XH 2EIMB 2XXGA 3CSYB 2Y2WA 4MQXD 4QXGH 5MEQA 1N0XH 1DN0A 5CD5C 4X5PA 1KJ3L 3GXUB 5EU4A 3CK0H 2ESVD 3HMWH 4B9ZA 5JOFB 3DX6B 1QSZA 3A3YB 1UXWB 3BO8A 1KGXA 4EBQL 2AJYH 4JRXD 4XN5A 2WZPA 1L7IH 1ZA3B 5ISZA 2K1MA 4A2GA 4PGBB 2J8UF 4ETYA 1IBYA 4JQIL 2HT2D 1NMBL 3BGAA 3FQNB 4MB3A 3SO5A 5F7WC 4UB0L 1A6UL 3KXFD 5CHNB 3NA9H 4GUPA 1JGDA 2F7PA 1WF5A 3QI9D 4G42B 3LB6D 4NQTA 3LQAL 3EH1A 1NZRA 3GKWL 3MJ8A 4LSRL 4UQ9A 2ZWNA 5DUML 1BVKA 1BGXH 4HV8B 1TZIB 1OP3K 3R4DA 4UQEA 2DWEA 1CGTA 3SGEI 1IZKA 2Y07H 3S37X 4YSCA 4KKCC 2ZPKH 2NNAB 4LB8A 2WQSA 3EDJA 2GBUA 1F86A 2WTRB 4XN9A 3QEHB 4IGBC 4KXZI 4GG6F 2OMNA 5JW4Q 1YEEL 1M05A 2BMKA 2DQUH 3G04B 3K7UA 3IAPA 3LPGA 4R3SB 5F9OH 3N1PC 3IVKA 4LVHB 2VM4A 1OAUH 3KR3H 3PXJA 1BZ9A 4AVIA 5TGBB 1TF4A 3T3PB 3LDBC 4XTRD 3GSOA 3BSGA 3M7OA 3TA3D 1MCJA 4QF1B 3U9UA 1YA5A 4IRSA 4F2MA 4BFBD 4G1MA 1W0WA 1M71A 2O6PA 4NUPA 2LTQC 1XT5A 3OR7A 3UIZA 1Q0XL 5KYUA 5BS0B 3HZYA 2QSTA 4X6BA 2XN9A 4C58B 3NIFE 1ETJA 3ATEA 3O11A 4RGOL 4KTEL 1XR8A 5FUOH 3MRQA 4JJOA 3FOLB 5LWYL 4PJHE 2N1KA 2YMOA 3SJVB 1QSEE 1LK3L 4GP8B 4ANVA 4HZAA 1U8KA 2AZAA 2FYVA 1NIDA 3QJQB 4JEGB 3U36B 1FGVH 2OMYB 3BQVA 1KYUA 4TS6A 5HI3D 3QRGL 1CL7I 5DO2D 3F84A 1G4RA 3UG5A 1VA9A 1ZD6A 5GGSB 1Z2KA 1ZT1B 3PGFH 4JFQA 4EDWL 3LPPA 5J1AB 3VSUA 2YSSB 3WKML 3WHE0 3BVVA 5GRJL 3LEXA 3N91A 1RCYA 4WI7A 4NO0D 3Q2WA 2E47A 2E27H 4JREC 2WKLA 1PS3A 4ODWA 4NERA 1X5ZA 3IDXL 3IGAB 4GINA 1MFDH 2IV8A 4LP5A 5DC4B 5FKAA 4M29A 5JMOC 4A66A 3N1MC 1OAXL 1O6SA 1MFAH 3MVSA 4LVHC 1IO4C 1C5BL 5JNYB 3LPFA 4X6FB 5T3ZH 1Q0YH 1KTDA 3WY1A 3DOSA 2J73A 3J2PA 4WW2A 2HJLA 4YHML 1CG9A 5AW8B 3UJTL 1P6WA 4M02A 2NUTB 3HUJE 4N2CA 1XHHA 4ANKA 4QWWC 5EN3A 1W15A 2VLKD 1PNDA 1FJ1A 3QUYD 4XPAH 5ICZB 1IE4A 1BREA 1V3MA 3U7AA 4E42A 3LMJH 4JZJB 4D9RE 1DVFB 4U3CA 1JNNL 2HKHL 4UT6H 3B3IB 2QGCA 5T33H 5EORH 1KXHA 5DJ2B 4E9VA 3NZHL 4A2LA 1KCUH 1ZJAA 1CBVL 2UZYB 1FAIL 3VYNA 2P5PA 4B96A 3DOHA 4ZAKC 2DMHA 4N3TA 1PW3A 3AABA 4OCRL 3M45A 2CJSA 3LNIA 2HMIC 2ZNWA 2EEFA 1EEQA 1R6VA 1AI1H 1J10A 1VRSA 1CFSA 4F15B 1HQ4A 3S2AA 2CE6A 4GW1B 4Y88A 3QQ4B 3VXTB 4Z3JA 4M4PA 5D4HA 1FNAA 3FONB 4MZIA 3KNBA 4YNYA 3QT2A 2PR4L 1G1OA 3WLWD 2PR9A 3MLUH 3CLEH 3TN0B 1A02N 4XVTH 3UG3A 4Y16B 1USZA 2FWLB 2NY3D 2V0AA 4XBMA 2P8MA 2GHWB 2QJDA 4B9PA 2CBQA 3K6FA 4LSSL 1GGIH 4HS6B 3TA4D 2X4NA 3CVDA 2BC4B 2YKKA 3D5OF 1Z9SB 2ZQKA 3OMAB 3BKMH 4CVUA 3DV4B 1X7QA 3VGDA 2OZNA 2A9ML 4P5TA 1GIGH 1U8MA 1R17A 2ZOLA 4L1HA 4F91B 3LKSA 4XR8C 2HX8A 1T03H 3GFUA 1IQDB 3JWDH 1FVCB 1R75A 1AGEB 2X6VA 4GXVH 3PAZA 3ARPA 5C71A 4BFNA 2RQEA 2PLTA 4RMWA 1KV7A 4PYGA 1HH9B 2IQ9H 3GJFH 4JPIA 3GUTA 5L8LB 2R2HB 4IIQA 4G5ZH 3EDFA 1A3QA 1QQDB 1PD1A 4KVCH 1LMIA 3FUIA 2X42A 3GSVB 2R1XB 1FVEA 2VZOA 3C8DA 1OAYL 1EEYA 1U9KA 4PGCB 4WK2B 1RK1A 5IUSA 1VERA 3FB7A 4RMBA 3RY6C 5CGMA 3UTQB 3H55A 5ACLA 1ET7A 5DHVA 4OSUL 3RBGA 4Y16C 4J1UB 2QSQA 5H37A 2RMNA 4PTUA 5ILTH 2O5ZH 2UX6A 7CGTA 4PRPB 1SDDA 4ZSOA 3T6VA 3THML 2OW7A 2OP4L 4KVNH 3FO1A 3CN0A 1KCSL 3C6SA 1L0QA 4YE4H 5F3HB 3RWEB 1NANI 5I76A 3F58L 3AG3B 4OF8A 1TVHB 5LCVA 5TF1L 1DFXA 3MBEB 4M7KL 4Y4HB 1HL9A 3HBQA 5IF0A 5C2BH 3DRQA 2XPZA 2ITEA 1V7NL 2CG9X 4L3EB 4XCEB 2G3NA 5F1NA 5JO5B 3SYOA 1QTYT 5F7AA 4H2CA 4FTVA 4XX5A 4HBCL 4HZ1A 2H6OA 2UYLA 5E1QA 4EN3A 5BV7H 3W1ZA 1E5AA 3VXRB 4BWUA 1PLGL 5IP4A 1SGKA 1M7UA 4WO4B 4X8JB 2DKMA 3H1ZA 3T77A 4PJ8D 2RIKA 4HGKC 1NIFA 5EBWB 1NCBH 1E9PB 1MG3C 2J56A 4U1KA 4KNSA 5IWLC 1X5IA 2VLME 1FL6B 1S8DA 4NJAL 4DKDC 4ZMVA 3QULB 3KJ4B 1MAML 3RDTA 4WVRA 2Z9TA 3KWXA 5D1XE 2CCLA 3QEUA 1E30A 4XP9L 2BY0A 4WWOA 3CFTA 3CFKB 4GKOA 1MCNA 2VLLA 2Y7MA 4KRPB 3CGTA 3B8SA 3IMWA 3MV9D 3VI4B 3P9MA 2XBDA 4HUKB 3UXFA 1WCBB 1RZGB 3DJRA 1LD9B 3P0VL 2BP0A 2CO6B 1GH7A 1VADA 3V6OA 3T09A 2YRZA 1XGUB 2CO7A 2XOTA 1S7SA 4QRRB 4FX5A 3RHWK 4WV1C 4MXVF 3GUFA 4ABVA 3ZKMC 4AGPA 1FZKA 2YZ8A 1B0GB 3O6ML 4LHUA 5K1JA 4E68A 1I8KA 4Q6IA 1TJMA 1XR9B 4FCAA 1TJHL 4NZTH 1NMAH 4OGXL 5C9KA 1G87A 2FATL 2VDPH 3B7YA 4ODVH 1C1EH 1BFSA 1A6ZB 3SB3A 2IPTH 1HTYA 3A5VA 3B1TA 1FCGA 3GMMA 3FTWA 3LH8A 3M8OH 5DS8B 4AW4A 1IKNC 1JHLL 2OXGA 4I77H 3ZHFA 1S9YA 5EOQL 5E8OA 5DEFA 3UC2A 1N59A 2EUWA 4WO4C 1LJMA 1S9XA 3HLAA 3BZEA 4KZ0A 3G6JF 4OZ4B 2HWZH 1P2CA 3N3EA 4H25A 3SDYH 1XH3B 3HRPA 3QDMA 4X80H 1PY4A 5CM1A 1BP3B 5H94B 4BK4A 2FJHA 1G7IA 1AHWC 4QLWA 2CM5A 2FWOA 1GKOA 3FRPA 4JO2L 4RFNC 2X89D 3SDXB 2RD0A 5J8OA 1CF1A 4HISA 1JWUB 1RZ8B 2GTQA 2CM6A 1U21A 5J3HC 1JZGA 3CJJA 4OFYA 2L7JA 2MQ3A 3EOBB 1IARB 5D70L 3WFCH 2Z4TA 4LCYA 3IFLL 2FSDA 4Q8BA 4ACPA 3D18B 4BYHA 1XEDA 1XIWD 4LPUA 3MLRL 4I0PC 3CBKB 3OAZK 4W9LC 5SWSD 5HDQL 2P80D 1IBHA 1VPOH 2ZICA 3DC0A 3TBBA 4S2SA 5E5LA 1CFNA 4GT7A 5CJOL 2FYYB 3ZKXB 2XYBA 3ARFA 5E23A 2CRIA 1FYTD 3L5XH 3O6FA 1KIRA 3BCFA 2CXGA 3EKCA 3K72A 4PJGE 2CGYA 3AS1A 1D5MA 1QSFE 4Z0XB 5LJYH 1EZLA 1TTBA 3LXBA 4HKBB 2EABA 4PJIF 3ULUH 5CR8A 3DTXA 3RVXC 4KTDL 3MMEB 5LNGA 4N8VB 2R4RL 3CFDA 3ZUCA 4AE1A 4DP7X 4I1RA 4WI2A 3V6FB 1UQSA 4Y9CA 4B53A 3NJFA 3MUGA 4P04A 3NK4A 4TUOA 2DPKA 4MBOA 5EOTB 3HJEA 1R4XA 3U46B 4OIBA 3NG5A 3MLTA 4YDIH 5B1BB 1B0RA 3MCG1 4EUPA 3K4AA 1X6NA 2W65B 1FZMA 1GJIA 5SWZB 2XU9A 2EH7L 2J2ZA 3HS0A 4G6MH 3TFBA 2A7BA 4FXKB 2CZNA 1U0QA 3WEOA 4RSVA 1ZGLP 4OLUL 2O5YL 2CJ3A 4NNYA 1L9SA 4ELMA 2UX7A 1PX4A 1BCIA 1C08B 1OAKH 4N0UA 1DFBL 2QLYA 3FSAA 1FO0A 2QVMA 1P4IH 5AVUB 1YDPB 5CJQL 5C0AD 4KMLB 3MA7B 4A38A 4E9LA 3IRZA 1TQWA 1FNHA 2EDLA 3AB0C 4TXVB 5I8CA 3L1OL 2GAZB 3APDA 5I75B 2J1WA 1IFGA 1T7XA 2PNDA 2J8OA 5I2IB 1I3UA 1CF8H 5EIIA 3ZKXC 3IEAA 1T3FA 1C5CH 4G8FB 5TH2A 3UAJA 1CK0H 2AABH 5EOCH 1DBML 3PWPA 4YR6B 2YD7A 5C7ZA 3TWYA 2Y36H 1BJ1J 1TMQA 1UG9A 3O4LB 4XVJH 2HRPL 3JVGC 1BFTA 3DGGB 4HJJL 2VO5A 4MD4A 3U6RA 2D31A 3MXVH 2Q87A 1IM3A 4JN2A 4KJPC 4M1DL 2PTVA 1JK9B 2JKRM 3H9ZA 5KSBA 1ZS8B 1HILB 4XP6L 3JV4B 3QG6A 4PGJA 3OAUH 5KW9H 4F7PA 3G9AB 1QW9A 4MNGE 3G6DH 5TQ0L 1HZKA 3VFUB 2F9BT 4FXKC 3QBTB 3IPBA 3FW6A 4JRYE 5T3XH 1KCSH 2I9LB 4ICWA 5GJTH 5ABAA 2LLLA 5CEZE 5IB2A 3FHAA 3MLVL 4RAUB 3T6WA 3NACL 1JXDA 4XNUL 2CRZA 4IU2A 3CFJA 5B7FA 2D03H 2EDWA 3E2HC 4NQQA 1UXMA 3BPLB 1NGPH 2H26B 1ZHNA 3BKJL 3TP4A 4YDVA 5I8EB 4UDUB 1DCLA 3ULUC 4KJQC 3SGDI 1ZIAA 3R1GL 1JPGA 2PYFB 2ICEA 1OF2B 4I9XA 1PLGH 1U30A 4ZODA 3QYNA 1BLIA 1T66D 4BFJA 1J9RA 2NXZB 1S7UA 1RU9L 1I8AA 3IM1A 2GJ6B 3SDCD 1QI3A 4FF9A 4I3GA 2VH5H 3VXOB 3HEIB 1RHFA 1NFDB 4L2LA 4NJAH 2MTAA 4XO9A 1T89A 2EO1A 2OQJA 4M00A 4EI0A 1SJMA 2WOYA 3HHSB 2XBTA 4LASH 2ZCZA 4XBEH 2QTVA 4ES9A 3HE7B 2WD0A 2DIBA 1TEYA 3C6LA 4KKPA 5HYSB 3B7UX 1YECH 3IKCB 1KEGH 4FLOA 3AWEA 2ISDA 3OSVA 2MOQA 3QIBD 5E8PA 4FA6A 4JB9L 1LGVA 3V4VA 3BP4A 1L9PA 1NIBA 2P48B 3LQZB 4XMKH 5C0FA 2X7LB 5I1JL 5JHBA 5CS7A 1GW6A 5B22A 5E6IA 4B3VA 2BSSA 1A7PH 1CR9L 3F5WB 4G9FA 4L8DA 5HGBB 4L0PB 4AITA 4YHLL 1XTMA 1KTLA 1S9VB 3HOGA 2J88H 5JXAL 4NUJA 1HHHB 1AVAA 1SEQL 4FQXD 2YFNA 3L4UA 1A66A 5F88A 3BPLC 1FGNL 2IDQA 4M4RA 3FPXA 4GQQA 4S1DC 5AW9B 1GS7A 3KWWB 3WNMA 1L5GA 3OXRB 1I1AA 3TIDB 1B4LA 4ZUSA 3HS8A 3FQ4A 3UMTA 1CT8A 5I1GL 4XAWH 3VG0H 5JHDE 5IB3B 1A1OA 5JYLA 4AJ0A 2C3HA 1NDMB 1KZQA 3ZDZE 4XMWA 4U6XB 1RUKL 3GMNA 3PWJA 3O41A 4R7DB 2VLJD 3IMTA 1Y6KR 2A83A 1ASOA 3ALWA 3NABH 2IBBA 3BVXA 1DVFD 2WCGA 2VITB 2HLAA 4OZGF 1RMFL 3HE7C 4J3OG 2AERT 4UINH 3NDZE 3TV3L 2V2TA 3LN5B 4PYHA 1TU2A 1U8JA 3N1QC 2XPGB 3NIGB 3S88L 2OMVB 1ZA6B 3NSJA 1NGYA 1QZ1A 2AJZA 1BQHB 2Y5TA 3QIUB 1A6VL 3GJEB 3QQ3B 1UD6A 1DE4B 5H4ZA 3MLRH 4RWYL 2NY7H 2VN7A 4I48A 4OZHF 4LEOA 1X9RA 4JLRB 2H8PA 2OKMA 3GSWA 1TZGH 1YSOA 2LAGB 5GGSY 1MI5D 5FGBA 1OAQL 1F58H 4LL9A 4JFDA 5LDUA 3PHQB 3Q3GB 3BPNB 4GKNA 5D2NE 5F7UA 1CE6B 1I9JL 4U3HA 4FYTA 2ZKHL 3NN8A 4PLJC 1UCBH 2DJMA 1DQIA 2VJ0A 1TNMA 1A9EA 1IEHA 2F18A 2Y7QB 1JPSL 4TULH 4BA0A 4HHAA 1VFOA 1LEKB 3A47A 4XPGH 2EYRA 3TCXA 4F5CA 4P2OA 1SXAA 3T0ED 4PWIA 1A1NA 1N5AB 1QX1A 3DV6B 3FF8A 4UWQB 3ROLB 3II3A 3H42H 2Z93A 2QVIA 1HIMH 3STZA 1HHJB 3BDYL 2ZXDA 4AT6A 5T1DL 4TF4A 5EC1A 1G0XA 4HALA 2V6HA 2ZG3A 1A7QH 2XLLA 2VCOA 5C0BB 2CHNA 3TH4T 4I88A 1IC5L 1EH9A 5DZ9A 1AH1A 1KY6A 1K8DA 2R29A 3K2UL 2IH8A 3UAFA 2A1WL 2E8YA 3NGBB 3K0YA 4NQXA 2D7TL 4ODSH 3E80A 4DWHA 4QGTA 2HT3C 4WEEA 1J5HA 1HHIB 5DQJB 1MNUL 1H15A 3OKDB 3UO8B 3VM5A 1WA1X 2EEBA 3KLSA 4W4NA 1KPUB 1WBYA 1YMHA 4GEJA 3BUYA 3IT8D 2YXWA 4YWGH 1GMIA 3HRZA 1BD2E 1NC2B 2BNUB 4D9LH 4YSOA 1R5IB 4I3SH 3VXSE 2GHZA 1Z32X 1UADC 2ERJB 1KJ2A 2FJFB 2K9UA 3C2AH 3KCPB 4RMRA 4AXWA 4OZFH 1OIOA 4BFFA 3LRSA 1I3VA 1IV8A 4Y7OC 3OKEB 3N41B 3I50L 3M46A 3MO1A 4YSTA 4E9QA 3V0WL 3BH8A 3IDNB 5CSGA 1ECZA 4PJ7E 3G5ZB 4L05A 3NJGA 2DMBA 2BPBA 4CVXA 2ED8A 1TUPA 3WE6B 2R7EA 3BVNA 4HIXL 5GZNC 3BT2H 2JIXD 3JWOL 1M6OB 3NIFB 1NCOA 3OHXB 4NM8L 3APMA 3EFOA 3HC4H 2GFBB 4AC2A 2V17L 2L7QA 4JFSA 4PRPD 1SJHB 43C9B 4PJHB 2WKGA 4XPHL 2ICWB 1N68A 3UDWA 4TTDC 1QSEB 4XMPL 4BSWA 1IU1A 3MBED 3BSZH 2CBTA 2HN7A 3MYJB 2EXYC 5HYQB 4CJ0A 5CZVL 4ZXBC 4YVUA 4JY6B 1NEUA 4F7CB 1IEAA 4M5ZH 1UD5A 3G5VA 1E8YA 3PQYA 1RZFH 1EANA 1NCIA 3F12A 5FF6A 3SDAB 1WC7A 4B0MB 2HJKA 3VFNB 3EDDA 2CIIA 1RZKH 2VN3A 4APQA 1QKZH 2AGJH 4KMTL 4PJXF 5CGTA 2JXMA 3D4ZA 1E90A 1J0JA 2F1BA 3X17A 4AV4A 3D30A 3WOVA 4NOFA 4WTWA 2V3EA 1TZ8A 1U8LA 1A9BA 3TJPA 2GT9B 2C3XA 4PMFA 5HVWA 2H2SD 2BP8A 1XH0A 3VWKB 3EZJB 3NJMA 1ODAA 4JHAL 1U8PA 4OF7A 3HUJB 1NCDH 2BSTA 2OL3L 4Y5YB 3T4AA 1J9TA 4P9MH 3H53A 2OR9L 3RVUD 3VFRA 2VSKB 4X4ZA 5B38G 1QR1B 3GDBA 5JORA 3OHXC 2WGNB 4ZI8A 4G80A 4ADIA 1JV5B 4WJ5B 3FKUS 1UGNA 3C60D 4QRSB 5ALCH 1FBIH 2MCPH 4GS7C 5EZJA 5HJDA 2UUDK 3PL6B 3OLGA 1NEZB 1BVZA 3OAWA 2GUOA 2BZDA 2K8MA 4CC4C 5JHLA 1SFDA 4AIXA 4OTXL 2X9ZA 1PSKH 2G75B 4X98B 2EE3A 3QNZA 1CXKA 1BFVL 3RYMA 4YUEL 1CPUA 3UBXG 3QZBA 4YHLH 3SDAC 4F2ME 1NLDL 2ZWSA 3DTUB 3GHBL 3HAEH 4MA8L 4S0SD 4W68A 4CMMB 2H6PA 4AJYV 3OKLA 4IKJA 1WQVT 1I1YB 2XN9E 4NX0A 4AZUA 4J8RA 2HX9A 2PO6C 4UMGA 1SN0A 1A3RL 1SMAA 1J8HA 4JFZH 3U7WL 4KX7A 5KVEE 2CR6A 3ZDYE 5IV2B 7TAAA 4K5LA 1K9TA 3PDOB 3VWKC 4KI1A 3NFPA 2YAPA 3SO3B 2UVEA 4ZX4A 3I2CL 1CLZH 2NY0D 5F70A 5CAYB 5I5MA 5J4MA 1O9WA 1MHPH 1NH6A 1ZRUA 3MBXH 3OX8A 2W07B 4MQXC 4OCLC 1VDGA 4ENED 4NKMA 1AACA 4C54A 1XB6A 2HH0H 4HX1B 2P47B 1RL1A 3FQ2A 1E6JH 4MAYA 3JUYA 5I0DA 4YSSA 4XN4A 2HRLA 1RIHH 1U8HB 3TIEB 1R3HA 1BIHA 3D52A 2I32A 4HK0B 2Z31D 3PPSA 2VERN 2Y7SA 3PL6C 4Z77B 4KO5A 1A6VH 5CEZL 2A9BA 1OOWA 5HGHA 4X0NA 2XKSA 1NWPA 3GZPA 3LB6C 4OV5B 1E40A 1RUMH 1QRNB 4BKLA 3AXHA 1RUQH 3BZFB 2IOOA 2VXQA 3KWTA 2ZCKH 3QQDA 1JGUL 3P3TA 4MGXA 1NUNB 4Q9CA 1QA9A 1BVNP 2PWFA 3AU1A 1A4KB 1FVDB 4HLEA 4BXVA 4P57A 1EHLH 3OGCA 3Q01A 1P7KB 5D2LF 4HH8A 2D7NA 4PV8B 4KWUA 3FTUA 3RE0A 2MCG1 4OUOA 4QY8B 3S96A 5GGRB 3EGDB 2AQNA 3ILQD 5F8QC 4P46B 4OZIB 3SPJA 1XF3B 5SWZD 2IWGA 4XTRC 3VXMD 1EK3A 4NN5C 4RNRB 4YC2B 3PWNB 2FIKB 4U1GB 4JPWL 3SO3C 3GC3A 5F7LB 2DOCA 4TRPL 1GRWA 5KBMA 2NLJA 3FHQA 2EIJB 3T0AA 2PYED 4Z8FH 4HU2A 1GCFA 1MDAA 3KJ6L 1QFWH 4N2IA 3QUXD 4G72B 4DK6A 2ZX7A 2OMXB 2ATKA 4KK9C 3IN2A 2A74B 3GI8H 5EUKB 3LIUA 2ADFL 5D7JD 3BT0A 2J1ZA 4JPQA 4HD9A 5E94A 4MDJB 4KDWA 4NWUH 1HSAB 1GGTA 2QPSA 2WBJD 3OPUA 2HFFB 4PN6A 1IAOB 1Z5LA 5DO2C 2QVTA 5C8JB 4KZDH 2B1HL 1UB6B 2OJZH 4IEFB 3QO1B 3VXUD 3HG1A 3HE6B 1TNNA 2WO2B 5AAMC 2F1AA 5D1XB 5AD0B 1D6VL 4HFWA 3V0IA 2PUQT 3I50H 2EVJA 4UM9A 4LSQL 5IM7A 1H8OA 2MTPA 4QHLB 3PP4H 3GSRB 2KPWA 3TT1H 1KBVA 4H1LG 4KO6A 1QWHA 3Q1SH 1OZTG 1FL3A 2Z7YA 1F1GA 3B2VL 4P5KB 3K46A 1TKWA 5IK3A 4XB7A 2UWEF 2BWDA 3VXPB 3IETA 4YC2C 4U1GC 4YQXH 1RJCA 4WQOA 4XPHH 1QUNB 3EBAA 2WM0A 2IFFL 2W0FA 4ABQA 4BFOA 3UZQB 4LBEB 3KLKA 3G5YA 5SX5H 3V7AG 3QRFM 2WNWA 5L0QC 2DL9A 3IBOA 2ICCA 1Q9LA 4N4YB 2XQYK 4KRNA 1SJEA 2A74C 1NGQL 2FD6L 2O6DA 4I87A 4MWFA 1KPRB 3WFBL 4CADA 3PGDA 1OARL 2AQTA 2X4OA 1W72L 3AG4B 4K9EH 1RFDH 3M1BB 3BW9A 1IBDA 3GZOA 4ZTOL 4HF5L 5HP5A 1MW1A 4LPCA 3HPLB 1WIPA 2YC1B 2NXZD 5H35B 4ZMPA 1LXMA 2GJ6D 5K59F 2R8SH 3FUMA 4OLZL 4KY1H 4ZSOE 2L7UA 3MREA 1DQJB 5DI8A 1P0SE 3HE6C 3GEFA 5I1EH 3QDJD 1KN2H 1KF9B 1KENH 4DP1X 3U0PA 3KLHC 4X42A 4WAFA 1CICD 1P6AB 5IVXF 1R3LB 1XMEB 5CN1A 1MJUH 5LGJA 4MAUL 2OR9H 3QC6X 5I19L 1E9QB 4FTVE 2BY1A 3QZWG 4UM8B 4RCAA 2TSAA 3QQ9C 3Q2LA 3D07A 4QTHB 4FG6C 1E27B 1HNGA 3SBRA 1ZLEA 2VAJA 3GMOA 1LM8V 1TQBC 5E2VL 1R5WB 3FTXA 3TS8A 3U9PL 2IADA 4NQDA 4PP2B 1LTXA 2L3BA 1O6TA 3DHUA 4E5XG 1L9OA 2WLLB 3LN9A 4QXTA 4MS8D 3S8FB 5CCGE 3HC0A 3GYRA 4NQSA 2K9FB 4V1DA 3UYRL 2J1YA 4OQTA 3HR5B 5GS1C 3WIIH 4PJGB 1BQLL 4M6OH 3RWIB 5F3BB 4QYOB 1CGSL 3NTCH 1QSFB 1JZHA 1T7VA 1E28A 4HEPG 2IBZX 2H0FA 2P43B 2OL3B 2YK1H 3EJQA 1KGCE 1AD0B 3QS3A 1N8ZA 3V6OE 2AITA 4IRZH 3WNJA 4IHOA 4LL4A 2ZXBA 3CZKA 3NMEA 1IC4L 1FAKT 1A1MA 3JWOC 4XOBA 4QRAA 3OG4B 4M6MH 4JN1L 1EXUA 4MJ6A 3LS5L 4Z7UB 1JV2B 5HGAA 1VGKA 1X44A 2X0WA 2MQCA 5T5NG 5CIPA 1G7PA 2CMRL 1NAMA 4UTBL 3UTZB 4B27A 3BEVB 1WAEA 3S2CA 2R0LH 1YEKL 4F3FA 1CUOA 3P0YL 5HJ3A 2GUYA 5ESQA 1FIGH 1X5KA 1IGMH 3QIUD 4RFOL 4Z23A 4X4MA 4NJ9H 3CPUA 2DIEA 1NCNA 4HUWB 4FXTA 5IW1B 3B2XA 3WJMA 5LQBL 1SJVA 2GC4C 3IJSA 3A6BH 4KI5E 2VRAA 3QDME 1SUJA 4R4NC 1G6RH 4RDBA 1MIMH 1TQCB 1LE9A 5GRWA 2B1AH 1VESA 3LQMA 4Y2OA 2VDRL 4ZPVB 5DGQA 2AXJA 3L3OA 4ANWA 4HPOL 3MX0B 4LLQA 4Y0GA 5GIRB 3LIZA 2LQRA 3PREA 3L95A 3HZMB 3ZHNA 2HT4D 1RJLA 4YPJA 4NENB 2OCJA 4DCQB 3SGJA 4PJ8C 2FH6A 3TJEH 5IESL 1L3NA 1ZHBA 3AG2B 3Q2CA 2K3TA 3CH1A 2BSED 4M61B 4Y4FD 1SDYA 4XE0A 4X7CC 2R0WH 4JR9H 4L1SA 3MR9B 1JBJA 4LSUL 5B1JC 1SYVA 3OLIA 1IBGH 5FO7A 4HKZA 2PW1A 3EO9L 5JQ6H 4NI6A 5CJ5A 3B9VA 4K94L 3X13B 4BK8A 4ZMNA 4JRYB 4TLUA 1Z0MA 1IILE 4OIAA 3W38A 2HTKD 2AK4D 1FFRA 4YSUA 5I5IA 4X5RA 3CV5A 4YEFA 3ZJAA 4WW1B 3VQMA 3GSNH 3NUKA 4Y2LA 2V2XB 2Y3NA 4DP5X 1W0VB 5CO1A 1JZFA 2NZIA 1U58B 2ROXA 1MW3A 4GKLA 5C92A 1SF5A 4NRXB 2E8ZA 1J1XH 1D2PA 4DN3H 3RVWD 1EMTL 3N44B 4LVOC 3S4SB 4AZ8B 3V4PH 4PWEA 1G9NH 1TQCC 3G5XB 2JI3A 4MA1B 5AW3B 1OCRB 4G82A 4IBWA 1RURL 1H3GA 2WO4A 2CCVA 4JGJA 2JFCA 3WNPA 5IGXH 3GT6A 3N0PB 1VSCA 1HEHC 1RPQA 1KXVC 5D4IA 1H9VA 4ELME 3O6LL 4PJBA 1HN1A 2NTFB 4N0UE 3VRLF 2WXFA 2IDSA 1S7RA 5IY5B 5KVEL 3TFKD 4TTGA 1NBYB 5DJDB 3B7RL 2WWKO 1AGCB 1JZDC 2KLSA 4ZPTB 2I9TB 1L6ZA 2UZIL 4PIRF 5PAZA 2B59A 2XXFA 3IJHA 4H8WH 3GS7A 4RGNB 1I9EA 2VWEE 5A2IH 3S7GA 1PNCA 1QEXA 3QB7C 5B4MD 4OGYH 1TTAA 1M3IA 1MRFH 4WGKA 3QNYA 2DQEH 2OYKA 4WK4B 5EU6A 3EGSB 3P2DA 2HTLD 3HN3A 2XJLA 2F08A 3GMLA 3PWPE 3HR6A 2X1WL 3AY2A 1DVTA 2DBLL 3GHPA 1XIWC 1CO1A 1P4UA 3CHXA 4KZEH 5IB4B 3RILA 3BAEL 4HS3A 4IM8A 3VE0A 3EZ8A 1T4KB 1KB3A 1W72H 1T7WA 1V3KA 1BMZA 3HMXH 3MA9H 4P23D 2KBGA 1ESOA 4V33A 5JHDB 1V5JA 1JDCA 5KSBE 4MA1C 4WKXA 4QJ5B 2IH3B 5L4FA 3CLFH 1ADQA 2CO3A 3ZDZB 3WAJA 3M1OA 1B0WA 1BEYL 2CPUA 2ZOWA 3IDMB 1UD3A 1M7DB 2WUBH 4NKDB 3CHQA 1O0VA 4D9RD 1KLFB 5LVEA 4Z9KB 4XO4A 2FHFA 4PS3A 4HG4J 5DJ6B 3FQRA 3I6GB 2IIJA 3CFEB 3Q8FA 5I19H 5L9DL 1ES0A 3L3DB 4M3HA 5DT1L 4UQ3B 2ED9A 2DWDB 5DD6A 2Y6SC 1AC6A 4ZX3A 4RGNC 5C1MB 3Q48A 3L2NA 1AO7D 5B38A 2DM2A 5TDNA 1WLHA 5CCKH 2X9XA 4JAMA 4X8XA 5HDOA 5LBVA 5T1LB 5IHUL 1XSJA 1MEXH 1H8NA 5F6IB 4KH9A 2E0PA 3EHBD 4W81A 2YA1A 3VFPA 2ZUTA 1G9NC 3VFTA 2D3LA 4PRBB 5D2NB 3OZLA 3LNFA 1I8IB 4ZS6D 3UADA 4D3CH 1BX2A 1J1OL 5E0QA 3RFRA 5DK2B 1H0DB 4J27A 2WYZA 1QO3B 1RSFA 3RWGA 3MFGB 4PP1C 1JK8B 5JUEL 4DF9A 5D72L 3UBXA 3ARBB 4ORGA 5FEBA 4MCZA 2AW2A 2D0GA 3SE4A 3HNSH 1NM4A 3VD5A 4PREB 4UUJA 4XX1G 3HNVH 4AVJA 3F62A 3KBEA 1U36A 4J5VA 2EIEA 3MRDA 2J5WA 2XWDA 4PFEA 4XPBH 4L9LA 3BWUC 4G9FE 3T8VA 2BOBA 5KWYC 2MHAA 3CC5B 4Z7VF 2VN6A 4TSAL 3L7FB 3OF6D 1JGVL 3O2VH 1XD1A 5C3LD 4JM4L 1WZKA 1NL0L 3GBNL 4ONFH 1G4MA 1XFPA 3L4WA 3NCXA 4WU7B 3P0YH 1SXCA 1CLVA 1P1ZB 3WMPA 2AV1B 3L3KA 4Z7NF 4H13C 2EKSB 4TQEH 3MRKB 4X9HA 2N7SA 5AVQB 4AK1A 1B9ZA 1KTJA 2I07B 2BOCB 1MRCL 1MSPA 5F6IC 1BD2B 2OTWB 3ZUNC 3VXSB 1VACA 3AWGA 2EYSB 4AYDC 5ESVA 2IAMC 3QUMA 1TVBA 2A9AA 1TTFA 1MY7A 3QNXA 1JGEB 3PY9A 3GRWA 1AGFB 2EC9T 3P3YA 2YUWA 4X5LA 4O2EA 4PJ7B 2AJUL 2BDNH 2FB4H 4WEMB 3U1QA 2YD8A 4XNXL 5F0JB 1B2WL 4FQCL 5DD1H 1PYWA 3ARBC 1TJXA 4ABWA 1UACL 3F2LA 2BP5M 5FO8A 3HKZA 4AQ8C 3SDCC 4Y5VB 3FT3B 3P30H 5LCVL 4OLWL 3ZOAA 2VKWA 2Q9OA 3D4CA 1EQWA 1AKJD 3WLBA 3WXVL 3BKYL 3M07A 4HAKA 1JAEA 2X2YA 3B9KB 4JFDE 1ZLWK 5EO1B 5HGDA 1P5VB 4NCC1 5JOEA 4ZUWB 1QBLL 4M1GL 3D2UD 3UZVB 4NPYB 4LLYA 4UNIA 4GQ9H 4UANA 3RKPA 4D0BB 1HI6A 1M1XA 3NCJL 3TPKA 1E4XH 4L23A 4YGAB 5DC2A 4MX7A 3B2UD 3PIQB 2RGSA 3SE9L 2HA1A 3CBJB 3GSUA 5MEQB 5I16A 4F5CE 1XGTA 2XZCL 4LQFH 4OFDA 5EU4B 4BDVA 3VFOA 2YGNA 3BO8B 1HXKA 3JBG7 4FQQA 2GCYB 1G7JA 5F0PB 5GSVA 5LB1A 1WEJH 5ISZB 5HJGA 2FT7A 5AW6B 1I7ZA 5D1XD 3P9WB 4JDVA 3GMPA 3IMBA 4FN0A 3DIFA 3QHFL 4YEEA 2XWXA 4HETA 4FQXC 4QHMA 1MAJA 4GUPB 1ACZA 1XB3A 3GIVA 3OAYK 3KGUA 5BMFL 3A22A 3TOPA 4A67A 1UH2A 1M57B 2NCEA 2WOBA 2QSCL 4UT7L 2BNRD 2ZWZA 3LNGA 2H1XA 3MJ8B 1E6OL 4MSWA 4U2ZA 1IGIL 2ENYA 5J9PA 1N6UA 1BVKB 3QWRA 5DK0A 3GWJA 4WWKD 1DVZA 3DWTA 4HIEA 3N5AA 4Y5VC 2KQNA 2UZIH 5I74B 4APXA 1SXNA 4XPFH 1DL7H 3HB3B 3MJ9L 4DKEH 4K71C 5BXFA 4XNYL 5CU5A 3P54A 4FKKA 1M05B 1IRAY 3DUSA 5IROD 3IVKB 4P07A 4CNIA 4P49A 2E4FA 4LMQI 4PJEF 4D0CA 1WZLA 1OE2A 2BFGA 2Z0UA 4OB5L 4UV4H 4IHBA 4W9EC 3GSOB 3U9UB 4IRSB 1ZE3H 1UWXK 4F2MB 1IUZA 4G1MB 1UA3A 3V0AC 1W0WB 1M71B 4ANXA 3OR7B 5KYUB 3BVDB 4ZTEA 2WN3A 3HZYB 2G0LA 5AVVB 4AI7A 4FFZH 4X6BB 3VB8A 2W5PA 4HG4K 1YQVL 1SY6H 3BDXA 1JCKA 3BAEH 4LOEA 4WI4A 4MMZC 3O11B 4K9JA 1IKFL 1EAQA 1XR8B 2XFGB 3MRQB 5J1TC 5KUMA 4AQZA 3T8XB 3ZDYB 3FFCA 4JDTH 2QADB 1U8KB 2KDYA 2V9TA 4IBZA 4M6AA 2OSWA 1P4BL 5ADPH 2PCYA 3EJSA 5D1QD 2X44D 3M17A 3UJIH 1ITCA 3ZIYA 4CKQA 3MV8A 3RZWA 3BUIA 4L3CA 4FERA 4W4OA 1KN4L 1HU8A 3ALXA 2VC2B 3O8XA 4M7LT 3ZMEA 1MH5B 3MZGB 3PQYE 4JFQB 1UATA 1TJIL 4GAGL 1CU4L 4K94C 5KVFH 5INDA 2AK1L 3T0EC 3B9AA 3NJXA 3TNNA 2YA0A 1IGJA 2YZ1A 3DI2B 3D08A 4KTYA 1D3CA 2ZT9C 3IMUA 4X6DB 5I74C 5IW6B 5J12B 4I8DA 4QAWA 2Q20A 2WWOA 2WPGA 4ODWB 1O6VA 1I8MA 3O3DA 5FKAB 4R9HA 3QZWA 3L8QA 4UAOB 3SDDC 4YL4A 1O6SB 5K39B 1KTDB 1TQUA 3DOSB 4WW2B 2KPNA 3U4BL 2HJLB 1CG9B 1F3DJ 1UOVA 4FG2A 3SYAA 1CDJA 4GAJL 4IRSC 3OQRA 2G5UA 3WSQH 4E5XA 1FJ1B 4X9GA 1V8HA 2WJ5A 4XN2A 3ZO0A 4Z7WA 4E42B 4CMHB 1O9ZA 2OSYA 3DRTA 2ZYIA 1Y7VA 4IOFC 4AVKA 4JHWH 1DBBL 3IFPA 4E41A 3Q6GH 3WS6C 5J89A 1T0NA 4HH9A 3BAYA 5DFTA 1BWMA 5E4AA 5KS9F 1OY3B 5ID0A 1AR1B 1U4EA 4HEPA 1BOGA 3IS1X 4NDMA 3AU0A 5B3SB 4GIOA 5I1DA 3IF1A 1MVFA 2BIMA 3MSPA 1T1WA 2XTLA 4N22A 4UT9A 4PY7B 3HTLX 2AHIA 1I82A 3LPWA 2DQCL 4PRDB 4FADA 4PG2A 4LPYA 1CFSB 5GRZA 5LAXB 2JVUA 1HQ4B 3BGFB 2IBZY 4AW7A 5J11C 4HPYL 2NNXA 4E9XA 2F58H 1ZE3C 1R3KA 3WY3A 5J12C 3KNBB 1YNLL 1TYEB 2VXUL 2JB6A 4P2RD 2OS7A 1J8HE 3GPSA 1AP2A 2VR9A 4XNZC 2ZCHL 5LN4A 2D2CC 4CU8A 1J05A 1ZDSA 2R9HD 3E3QC 5LGHL 2P8MB 3DK0A 3MRLB 4RMSA 2BJML 3H56A 1Q9WB 1YAZA 1I8UA 3ORJA 3DX1A 4R5TA 5KANG 2OMUA 2RBLA 2X4NB 5AYTA 1D7FA 4JKNA 1HKFA 4GXUM 4AWJC 3QORB 4YSQA 2M8XA 5TTRA 1Q1JL 3QFJA 4PGEA 3VMNA 1U8MB 2CUMA 2YXMA 4PWGA 2AJUH 2ZOLB 4G1EB 5IB1A 3LKSB 2Z7ZA 32C2A 4KAQL 4XNXH 4R8WL 1B2WH 3R0NA 2H2SC 4LKXA 3IPFA 4HUXA 1I75A 5I1HH 2V5RA 5D4JA 1NC4D 5B3NA 2JMRA 1MJ8L 2BZCA 1GHFL 4IDJL 3ZE1E 1HWWA 5I8KL 2H47C 4JPIB 2WSDA 4LOFA 4M6NL 2F7QA 5KBNC 3GUTB 1W8EA 3K1DA 4IIQB 2ZCLH 4JO3H 4I18C 3QIWA 4L8SA 4UDTA 4U2YA 5A1AA 1XAKA 4PJ9B 4ZTPH 5BO1L 4CN6A 3FQXA 1A4JA 4AQAA 2XWBA 4JO5A 3PRZA 2X6BA 3HN5A 4OI7A 2CR0A 3U7YL 1YJDL 3GXTA 4JM2D 3ZHLA 1RK1B 3ABKB 4KPHL 3FB7B 4FQ1H 3VD9A 5I8OL 1BAGA 4PGZA 5DHVB 1TLKA 4WNJA 25C8H 3NRQA 4QRBA 1B90A 4PTUB 1H8LA 1PEZA 3DJSA 2DWSA 1M1SA 5EBGA 2N01B 3VB9A 1SDDB 4ZSOB 5TDOA 4Z7QE 2CHZA 1HCZA 2B20A 5BCAA 1UJ3C 3C6SB 1MW2A 4ALAH 1INQA 5I76B 2VXVH 1KEMH 4JO4H 5C0ND 3QORC 5IF0B 2HJFA 1RY7B 2WXKA 3IDJA 3BEWA 3MGOB 3DRQB 4P2QA 2NXYD 2WLZA 4GJTB 4WHCA 4OI8A 1RK7A 2CGZA 1NCAH 2X4PA 3KYOA 5F1NB 2FX8H 1QAWA 4POZD 3V4VL 2YPLA 1KLGA 2TSBA 4K3EL 1LNUB 1E3XA 1RUAH 4OT1H 4EN3B 4JNXA 3ZHKA 4QXUL 4EI5A 4F7TA 3U9PH 3T77B 2DLFL 4HMDA 4AQ1C 4I5BB 2NY0C 4XP5L 3VI4F 3GRBA 4X0KA 4XNYH 1SUHA 3VFGL 4ENEC 4PJ9C 4R97C 1E2ZA 1S8DB 1K4DB 3HG1E 4GMTL 3NK3A 4JQXC 3OG6B 3RDTB 3TT3H 3GHEH 3KH3A 4XP1L 3RBSA 2WLKA 4Z7IA 3PJSA 4OKVA 2NX5A 2WNGA 2VLLB 3ZTEA 1MCSA 4OD1L 2Z31C 4TSBL 1NPUA 4UI2A 4P3WA 4AY0A 2R69A 3JSSA 3LS4L 5GJSL 1I1FA 1URLA 3FDWA 5FB8A 2BP0B 5C0RH 2NW2A 5L7XL 2X0UA 3Q5YA 1DLFH 1FL5A 2CO7B