5LNGA

Lectin domain of e. coli f9 pilus adhesin fmlh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
152
Chain Sequence
FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Putative Fml fimbrial adhesin FmlD
total genus 35
structure length 152
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lngA00
4J3OH 4X5PA 1N0LB 4XO9A 2JMRA 1KIUB 4LOVA 5F3FA 5LNEA 3ME0B 5IQNA 4ATTA 4XOEA 2W07B 5FWRA 4CSSA 1KLFB 5ABZA 1QUNB 3MCYA 2VCOA 4AV4A 3RFZA 5JQIB 3BWUF 4J3OF 4BUQA 1PDKB 2XG4B 1UWFA 3JWNH 4AV5A 1ZE3H 5F2FA 5FS5A 4CSTA 4X5QA 4AUJA 2XG5B 2WMPB 1TR7A 3ZPDA 4AVHA 5AAPA 3JWNE 5FX3A 4J3OG 5AALA 5LNGA 3BFWA 4AVJA 1N12A 3JWNG 3ZL2A 4AV0A 2UY6B 3SQBB 4AVIA 5AB1A 4AUYA 5IQMA 2JTYA 5FLUA 4XODA 2UY7B 4X5RA 3BFQG 4XOBA 4AVKA 4AUUA 4X50A 4CA4A 4XO8A 5IQOA 3ZL1A 4XOAA 5CGBA 2J2ZB 4XOCA
chains in the Genus database with same CATH superfamily
1PMYA 5DZNA 1KIRA 4Z95H 4NHUB 2X9WA 3B5HA 4I3SL 5CBAA 2Y7SA 1J9QA 3L2NA 5AKTA 2JSFA 3E6FA 3GSOA 4ZMYA 3TURA 4HD5A 1VDGA 4S1SH 3OL2A 5B38G 3L54A 3J8F7 4M8VA 4Z77B 4X5WA 1FZOB 3D06A 1WD8A 3GZOA 1WTGT 4LP8A 5CJXA 2AZAA 2BIMA 4U49A 1KXVA 1PX3A 2Y7QA 1HDMB 4NNPL 2VDKH 2A73A 3RGVA 3DURA 3OAUH 5DZVA 4UOZA 1COBA 2A83B 3GIZL 2BNQA 4Y8DC 3ILPB 3EG9A 1Z9LA 1TO4A 2QGEA 5IVXA 3RFZB 2ALAA 4LP5A 3VWJB 2ZWSA 4PJIE 1SXCA 5C6PB 1YEWA 4ELME 5DJZB 5F7KC 2Z91A 4S1DC 3G7TA 3OXRA 1A1NB 3KW7A 5E4EC 1A6ZB 1SOXA 4C56D 1DVZA 2FQFA 3ATBA 2X4QA 5JLZB 2YQBA 1GIGH 2WP3O 3KS0J 4ZAKD 3ULUD 5I6PA 4KRPC 1E8YA 4HHWA 4RX4A 1A6WH 1X9RA 4ETQB 3W9EB 3LZFH 4ZFFB 4ZOEA 2K9UA 4Y1TA 3FRPA 4PTTB 1E2VA 2VXUH 2AC0A 1KB5H 3RA7H 3P0VH 3R8QA 1H3UA 4HH9A 4HISA 4JRYA 1OSPL 1TZAA 4YC2C 3FQRB 4ETYA 3JWNC 3LRKA 1G9MH 4DQOL 1FO0A 1EIBA 3PWNB 2ZUTA 3W0WD 4WFEE 1I3RA 1RLWA 4K23H 1U92A 1V8HA 1OGTA 2CIKB 3SGJA 5JYLA 5IMOA 5E8DL 3HMXA 4G1MA 2BOCA 3ETBF 3IJSB 1LEIA 3V5KB 5JHMA 2DQMA 1JZ2A 4MZ2A 4AYDC 5DF0A 2ORBH 1TO5A 2EIZA 5EDXA 4YNYB 3UJJL 3QEUB 4NKOB 2NX5D 1H3PL 2FEDC 4OGZA 4Y2DA 1AE6H 1D9KB 4AG4H 3O6FD 1WCBA 2BPBA 4JG0H 1ESOA 5HJGA 3WJMB 1OAKH 1J1PH 1YNLL 3FO2A 4P9ML 3QDGD 3VYNA 4N9GA 1O6VA 4MXWH 1USQA 3N1PC 1EQWA 4H0LC 5F7NC 3SYOA 4UTAL 5KVFL 2JK5B 3KDMA 1W0WB 5MHSD 2O5YL 2VM9A 3N43F 4ZD3L 4TLTA 3ESVF 2VMDA 3BPNC 4YSCA 4ALAL 5A2KH 3VI4B 5DJDA 4JFEE 1AD0A 5AVUB 2YGVA 3T09A 1N7ML 1BGXH 1JP5A 2MH4A 1A6PA 5ISZA 1E9PB 5BRZD 1HOEA 3BEWB 3O3UN 1SYVA 3WY2A 4PJGF 4MJ4A 5CD3A 2IFFH 3QZNA 3WFHA 5T5FH 5A2IH 1MNNA 5C07E 5AW2B 1R9FA 4OD1H 3CD4A 4ZUVB 3DXAB 2F7OA 1PEZA 3JSSA 2VW7A 1UEYA 5C7XL 2BIHA 1JK9B 1NGQL 5G5DA 1CK0L 5IOKA 1PLGL 5AAPA 4GEIA 2HJLB 4KDVA 5F8RC 3B7UX 1IGCL 5C1MB 2VR6A 1KGUA 1VGKA 4UMSA 1UM5L 1DQDL 4MA1B 1BZQK 4Y19D 4DP8X 3SBPA 5F0MB 3QJHA 3OGCB 3T2LA 1IEBB 4LBEB 1JGVH 4XMPH 1GAFH 1UXSA 3EW3B 5EFIB 4AGLA 3HKZA 3AS2A 3BPOC 1XHHA 1DQIA 2KLTA 1BW8A 2J57A 3OLDA 3O4OC 5T1JA 1LP9B 2XN9E 4F3FA 1SFHA 1ETB1 4WGVB 3TXAA 3HE7A 3WV0A 1ADQA 3EO1B 2OYLA 4R7VA 3FUEA 2X38A 2HJFA 4QT5A 2D7NA 2I9LB 3T77A 3T9WA 2DLFL 4MLSA 1ZXKA 4HSAC 4IRSD 4ISVB 1QFWL 2BCKB 3FONB 2RFXA 4L8SA 3VG0L 5LUMA 5GGRY 3BIBX 4MA8H 1L7IH 4BK5C 3N40P 1AFVH 3WG7B 4BQBA 4YHIA 1J9RA 1FVCB 1CZ8H 1O7SA 1UB6A 2DLIA 4LCIH 4R2GB 5DYOB 4QHMA 2BVPB 1OQOA 4F2MB 3SY0A 4POYA 5HHMD 5G4OA 4AC2A 3G6AB 4XWOD 5F7HA 3CZEA 3FCBA 4N8CH 2YUXA 3L16A 4OZGA 3VYPA 4BH7A 2Y1AA 3KCPB 2QBWA 3B2VH 5D96C 4HJSA 4E5XA 1UC6A 4XHQA 3MTXA 3KPNA 4BDVA 1FO0H 4URKA 3LVEA 4FNLH 4GUPB 4WU7B 3X11A 4RGMB 3TH4T 3H7BA 4NQDE 4KFMA 2XN9B 4KK5D 5E7FA 1NH6A 4FKKA 2EXWD 3FCTB 1GPOL 3HLKA 3NJLA 3NDZE 4K71B 4KOBA 4N2GA 2VXQH 3THML 1MY5A 3LKPB 3UL4A 1H6FA 3ELQA 1MZYA 5GRXG 1YAIA 3HA0A 4E5XB 5DMJB 4QRRD 4HWZB 2OPCA 1W6LA 3AAZA 4F1SA 1WC7A 1KN4H 3ZE1F 5LXGH 1SDAB 5IROC 1B3JA 1YPZE 3AMLA 2I60H 3VFTB 3IDJB 1IKOP 3G5YB 5LN4A 4F7CB 4MAYB 2BNQE 2Q76A 4JRWA 4X4XB 1U21A 2P5EB 5I28A 4ZS6D 1FVDB 5E03A 5DVOA 4X7FC 1N8ZA 3P9WB 3F6IA 5IHLB 1HEHC 1KCBA 2YQ2A 2OV0A 3AREC 1IRAY 1A7OH 2BP8B 3MJWA 3WXWL 1D5RA 2X6CA 3KWUA 5JQ6H 4YGVB 1RPKA 1LDPH 1ZANL 1LWJA 1J0IA 4XODA 5EUOE 1U8NB 3MGTB 9CGTA 4OLEA 5HVHC 1CU4L 3CUPA 4PJ6A 4DW2H 3QZWA 4HV8A 3G6DL 5AKSA 1P4BH 1I8MB 4JFEB 4PGEA 4BWUA 3MNZB 2KS0A 4N2EA 1WBZA 1DQMH 4FEMA 4X5XA 1X4ZA 3CVDA 3SDDA 1E2WA 1T1ZA 1Q9WB 4W9KC 2HT3D 1ZHKB 3QQDA 5IFAH 5JW4M 1CBVH 2FX7L 3DVNB 1A47A 3MJ8A 4M6AA 4X8JB 4HCRH 5LNGA 3BUQA 5I17B 5GISH 4L3EE 4RFEB 1VEPA 5KANG 1MNUL 4JGJA 3PABA 3ZKMC 3MACH 1XXDC 2GTZA 2ID5A 4WW1B 3KPSB 4JZJC 2XA3A 2P8LB 4LEOA 5ICZB 4G7VH 2ILLA 4E41D 2E7HA 5EN3A 5JHLH 1P5UB 1UM4L 3HI1A 3L3DB 3MCYA 3NJXA 4OF6A 2CDFA 3MX0A 4Z23A 3T3PB 1RV6X 4KI5D 4NO5A 1PFOA 5KZCB 4XCCL 4LGSB 3OD3A 1OTSD 1PKQE 2ZAIA 4HIPA 3T0AA 1ZT7A 4OKVB 4QRSA 2LAAA 3C60B 2BW5A 4FFVC 3Q8FA 4MD0A 4Q9RL 1G0YR 4WWKB 2NX5E 1JPGB 3DYOA 4PCTA 3OZ9H 5TFSL 4I13B 4UNUA 2ADGB 1IJNA 1H0DA 1BM3L 3KPMA 3AB0B 2VDPL 4RGOL 2DQTH 5E6IA 5EEZA 3O6FB 2WW8A 3W5NA 1BM7A 5HYFA 2O5ZH 1R34A 2OXGA 4M5YH 4M6NL 1MCOL 4YDZA 3BDBA 1IGJB 1FAIL 2CO6B 2BC4A 1LO3H 1S9VA 1MELA 4YWGH 4B27A 1JHKL 1AC0A 2J1YA 3L5HA 3CN2A 4QRPD 3SDYH 4EI5A 4J3OG 1UCBL 2C3VA 1Y18A 4Z7UB 3WDJA 1DUZB 2HTKC 5A3ID 3U48A 3APFA 3TYGL 4OCYL 5KYYB 1PNCA 4BHUI 5HYSA 3B9DA 3OG4B 2C8NA 3SKJL 1S3KL 1MVUB 1R24A 4N2OA 5D70H 3WDHA 4G6MH 4YXKH 4UQ3B 1YPZF 2NY5C 2R0LL 3VXMD 3OAYH 3W39A 2QKIC 4PN6A 3ZE1E 3CLWA 4ZAKB 5TK2A 4AGMA 5CHNB 5F3HB 3GMQA 3QI9A 3HAEG 2QLVB 4WJ5A 5T1LD 3WJJC 2CNZA 1BQLH 2DJ4A 4X5QA 4L8DB 3LRGA 4DN4H 2ZX8A 1HQ4A 3KGRA 2P9RA 3O3BA 1Y6KR 3JWOL 3MRMA 1AQMA 2B0SH 3GK8H 3MBWA 2Y5QA 4G72B 4MDIB 4PJ8D 4DK6A 1FRGL 1U8JB 4LIQL 5J06A 4ZO9A 2I7SA 2QZQA 4F8LA 3WJLC 1XGRA 4B3VA 3WAJA 2Z34A 4ZX4A 1MJUL 1WZ1L 3J07A 4OCNC 5K1VA 3T3MB 4D8PA 1YN7B 4ZT1A 4ZUWA 2HH0H 2XUWA 3MHZA 2KZWA 1KPVB 3O4LE 5IR1B 1G87A 5K39A 1F1DA 5BJTB 1J10A 1EMTH 4JZNB 3P3RA 3L5XL 4YHYC 2VR4A 4KZEH 4Y4FC 4XMUA 5IVOA 3TLRA 1HWGB 4UU9A 3IAGC 5HJBA 2DQDL 3GB7A 3U4EB 4FNPA 1QWNA 3OLEA 4LOUD 1IM3D 4G5ZL 3UBGA 3DX8B 3SGKC 5D8JH 1KELH 4PP1C 1UUSA 3QWQB 3FB8A 1FFNA 5HGAB 4IMKC 1HSBA 3W1ZA 2P44B 1O7DC 1E42A 4J8RB 4KK6C 4PRDA 3TZVD 5I5RA 5IEHA 3DMMB 4U6YB 4ACPA 5BMFL 3O2VH 1SVCP 1MI5B 1XXFC 3LKRB 4P9HH 4QGTA 4AIXA 5I8CA 4CKVX 1A7PL 1LO5B 2WKGA 2OSLB 4OTXL 2J8HA 1VA9A 2XT1B 4NO0D 5G4MA 1HC1A 3ARFB 4Z7WE 2WB1A 5EUOA 1EX0A 5HHVL 4JREC 1RFDL 2KPNA 5BO1H 1QFUL 3T8MA 1E67A 4KRPD 1SEBB 5E8NB 4MD0B 1SJVA 4GW4A 4KKZA 3ARDA 1K8IB 2PWDA 3CTTA 3IMVA 4JL1A 3EYQC 3LMJL 5FIEA 2WCGA 5IT2L 4YR6A 2TAAA 3J2PA 4HOWA 4X80H 4KXAA 2D0FA 4K9JA 1C5DA 3HS0C 2VDQH 5AVYB 3HNTL 4QNPE 2WLYA 5I1KL 5BOPA 4LEXH 3BOVA 4P2OD 1N0XL 3QEQE 3E6HA 2HT4C 2OJ1A 1L5GB 4QEGA 5I71B 4FLSA 3SD2A 1HT6A 1TVBA 2B3RA 2GUYA 2H3NB 2ATAA 5IESL 4S1RH 4GMSH 1NGXB 4M7KH 5FA4B 3VNZA 4R90L 5AFAA 3ZSSA 3I3EA 1DANU 3L4XA 3U82B 3ZR5A 4IBSA 4YMPA 3UPCA 4JPWL 1PDKA 2IGLA 5GRVK 5DJ6A 2HKAA 2J4WL 2Y36L 4KITB 3AMKA 3MRQA 1JWSA 3QQ9D 2WK2A 3I2CH 4X98A 2YFOA 4NXKA 5JUEL 3PGCB 4UV4H 1Q0XL 5HI3C 1J48A 5T1DH 3JZYA 1QVOB 1QWUA 3D07A 4AT6A 5K5YA 2Y7QB 4F7PA 2GBVA 3WSQH 4FKHA 3BE1H 4OGXL 3BUIA 3FTUA 3TPUA 3V2AR 4NNPH 4RMUA 3L81A 2ZKWA 3CV5A 2CBTA 4ZXBD 1KENL 1VFMA 5H37A 4Z77A 4RH4A 4A2DA 1QG3A 4E0RA 4M62H 4P59H 2CK0L 4CVZA 4DPRA 3GSVA 1RZQA 1KN2H 1P1ZB 3APDA 4WEUD 1PQZA 5KYYA 5E2WL 3IJEB 2B08A 2JI2A 4UBDD 5INCB 2H3KA 4FTVA 3HE7C 3KYNB 1AR2A 2A1WH 4YZFF 1FNGA 3UEQA 2F54E 3EJZD 4W68A 1FZKB 4NN7C 5E4EB 4F58H 4PWKA 5D6DC 1I1AC 2CJSA 1DJIA 1U6AL 1IGTB 2A5UA 3M7OA 3VACA 3LKPA 1ASOA 3HE7B 1TYJA 2UXFA 3VJ6A 1PFCA 4D8OA 3FQWB 3PGFH 4HIXL 3LV3B 1A3LH 5FYLL 3IYLW 3ZTEA 2JWYA 5BV7B 5F21B 1PKQA 1X6NA 3DBXB 4RWYH 3TZVA 3IMUA 5D4HA 2XDHA 3GXFA 4TLKA 5GRWA 2EXSA 1DFBL 5JPNB 3HZKA 3D6GA 2V4LA 4AGQA 2EXTA 5BVPL 3JV4B 4UAOB 3QIUB 1J5DA 3EGDA 2DLHA 4KY1L 1J18A 2ZUSA 4HQQL 3SQBA 3QEHA 1BVKB 2AQTA 4XB7A 4E0RB 5ETUB 4PVLA 5D2LF 5ADOL 2BNRB 1HH9A 4JQIA 5JW4Q 3UBXI 5K9KB 1GW6A 3WMPA 3PHAA 3FBKA 5HYJD 1Q9KA 1MHEA 4AV5A 1YEEH 4PVMA 1IQWL 2XV0A 1V3LA 1Q4NX 2CZNA 1C5DB 2OMWA 5AOLA 1B4TA 1FORL 2VABB 3A4EA 3MLWH 4MXWL 4ADIA 1CICD 4Y88A 1WA1X 2VXQA 3WE1A 3ZN6A 3HC3H 3P9LA 2IV9A 2CM6A 3Q8BA 2R0ZH 1R5WA 2N0KA 2R2EB 1JNNH 1XH2A 1FAKT 3NDYE 3PYCA 2YMTA 1CLYL 1J8HB 2O5YH 4GRLB 1X7SA 3U7AA 4H2AA 4ZD3H 2C5DC 4FNRA 5EUOB 3TV3L 4AQAA 3ZE0E 1LM8V 4FP8H 1W16A 4Y19E 1N64L 3QPKA 3V9FA 1JG9A 4YSTA 1F2XK 2CXGA 3F7VA 3PNRB 3LRHA 1UFUA 4WV1C 1OGPA 4G80B 4NZRL 4KK5C 2JK5A 1AH1A 5FCUL 3I85A 3SQOL 3BRFA 3RBSA 1NLDL 4I4WB 5CSGA 5DD6A 4YDJB 5LGJB 1JGUH 1A5FL 5C0EB 3GI8L 4JO2H 4OD1L 4RCAA 1J0KA 1CIUA 5ACMA 3HNSH 3L1OL 4L1DA 4J3OC 4XP6H 3Q44A 4M1GH 3WJMA 5K69A 1MW2A 4HALA 4GBXD 1JNHB 4TF4A 4U3XA 3FO1A 4CW1A 1PLGH 3EYSH 3FTZA 5JXEA 2DDQH 4MA7L 3V4VL 2PTVA 3VXOA 4YE4L 4MAUH 5IROD 1N5YH 4XMTA 1F90H 1NDMB 3KYKL 5E2VL 5IZ7A 3FQNB 3OKLB 4H8UA 2WBXA 2Y72A 2B2XH 1VPOH 4JK0D 2Z35A 3SOBL 5F71A 4YXLL 3SDXB 2DL2A 5I6XB 5H35A 5IFHH 2KLRA 1VAHA 3QDMA 4P5RA 4RDQG 3KH3A 4KO6A 4QOKE 4NQQA 3HE6D 1EFXD 1KPUB 1KGCD 1L3NA 1CGUA 5D1QC 1H5BC 4ELKB 2CSPA 1KXTA 1MWAL 3AG2B 2WWKT 3I50H 1BIIA 3BH4A 2NTFB 4AOFA 5ICZA 3MFFB 5DR5L 4AX3A 5J56B 3W57A 4F7EA 4LK4A 1FDLL 1J88A 1B2WH 4N6QA 1OF2A 4HBCH 1T5KA 1XZWA 1MCKA 1OD7A 2J1WA 1KPUA 5DD0L 2RB8A 3II2A 3WD5L 1OHZA 4NZTL 2HT3C 2QGCA 5M94B 3LN5A 2X6BA 2H1LM 2JKLA 4GLRI 1MCFA 1H3GA 3X3GL 2FDBP 2ZUWA 3GSNA 1J5IA 2ZOWA 4O58L 2JQMA 4Q0XH 3QT2A 1AGEA 1ZVHA 4P2QA 1KYOK 1QQDB 3ZKMD 4MMZA 4M5ZH 2NY1C 1N68A 1ZVYA 4YDIL 3L9EA 5GS0D 4KUZL 3FU7B 4W4NA 1OP3K 3VXRA 5A2FA 4AVJA 3LZNA 1HTYA 2A2QT 1CUOA 4GKSA 4H1LB 1JXGA 3NCXA 3HG2A 4MMZB 3DX2A 3VRIB 3R7QA 1CB4A 1DSFH 4LSUH 1EO8H 3S48A 3PXHA 2FNBA 3QVAA 3MBXH 4PREB 1QNZH 3OKMA 3NACH 3F64A 4CVXA 5I76B 1IC0A 2PKDA 3GRWH 4OAWA 2IPUK 4BFBD 1N5AA 2WMPA 3D34A 4PLJD 1FN4B 3BVNA 3CSPA 1BF2A 1CQYA 5LWYH 1MCLA 5DYFA 2X4QB 2XN2A 1RJLB 4KOCA 3ZYIA 4AW4A 4Y7OC 1IIKA 3S3CB 1HINH 3LAFA 3VXPA 2NUTA 3W37A 2NSQA 2W07A 1C16A 2WWKO 3GBML 4UOJA 4FQXD 3GUTB 2LLGA 2N1TE 2XVLA 1W8NA 5KTEH 1C1EL 2XZQH 3D4GA 4WFGD 2WWMC 2H41A 2HT2C 3EG9B 3QDJA 4RNRA 2O5XL 1A7OL 2Y6SC 2ZSWA 1LO4L 5A3IC 5C0CE 4Y2LA 2FWOA 3VD5A 2WVUA 3BRDA 3RDTB 1T03H 1AZCA 4E9WA 4YQXH 3H7BB 1JV2B 1F45A 3FQUA 1FGNL 2P80A 3A4FA 5ESAA 3GGWA 4YUEL 1CU4H 3GHEL 3WIAA 3NRPA 3DOHA 4O51B 1HL4A 4R97B 4RBPK 5C3LD 4IDJL 1S7TB 4ZPVA 4X6EB 4XCEB 2F1AA 2JV6A 2KYIA 1NGYA 2HRPH 3BP4A 2OSWA 3IDXL 3MA7B 4HFWA 2FO4A 4IRSB 2OW7A 3OMZA 4ANWA 2CE6A 2LHAA 3CNKA 3L3HA 3OQ3B 1S4IA 4YGVA 3NQIA 3S96A 3WYRA 1ML0A 2DW5A 2YMOA 1YEGH 3MLTB 5BOJA 3FOLA 3HS0B 1DVSA 4BGDA 5FHBL 2BOLA 3KM1A 5E8PB 1JF5A 3S34H 3APNA 1GSKA 1M05A 5KSBF 1CTMA 1CVSC 1JGDB 2VSMB 1NFDF 4KH2A 3VCLA 2QADC 4N2FA 3OM3B 2FQEA 2LR4A 4X6BB 5DD1L 3F2LA 3G5VA 4YFLI 4RMBA 3ESPA 4LOUC 4MNGE 3B9VA 5I75B 3ISWA 3LPPA 1P5VB 2DQ6A 4LLYB 1MUJA 2E27H 2L7QA 5CGYD 3T6ZA 3OX8A 2XTSA 4FQLH 1F3RB 1FFRA 1FF5A 3QJHB 1XH0A 3WNOA 4NQEE 3TZVC 2J44A 2R2BA 3NCYP 3ML9A 3DJZA 1MJ7H 1ND0B 3Q2WA 5JHDD 2O5ZL 2NNAB 3QWRD 4M5YL 4J3OH 4NRZB 4UNIA 3B7YA 3GM8A 3VXUE 3TO2B 3NIFF 3DK2A 1WE5A 5D6DA 2D7MA 1KFGA 2IGTA 1BMZA 3EBIA 3QAZC 1JV5A 1W6WA 1DTUA 4QF1A 1DLFL 2WBJA 4FZEH 4Z7VF 3MGAA 1FVCA 5C6TH 1A6UH 1E9OB 3MAWA 3EYQD 2CPCA 4FOMA 4CDGC 4G6ML 3OKKB 5KN5B 4MHHI 5FW7A 1CGSL 3ZYJA 2VKWA 1EH9A 4ONFH 3HG1D 3VTTA 5ILTL 1VERA 2UVEA 2MCPL 3JTSB 2W38A 3NSCA 3HBGA 4HZLB 5GGVH 4F93B 2WXRA 1IBBA 3SDAC 5E24E 4B41A 5I9QB 3CVCA 4JPKL 1MVYA 1V7NH 4HGWA 3QUXC 1EVTC 2ZNWA 2JLPA 5JPMB 5E1IA 2PYEE 3KCPA 1YMME 2UX6A 4NQCD 1MFAL 1ROCA 1C08B 5DFVD 5HHOB 3KYAA 1MFEL 5I5MA 3B83A 1GKEA 1D9KD 2C9RA 2WHVA 1K5NA 3KYMB 2FJGB 1LQBC 4BUGA 2CM5A 5HHOE 1JN6A 1FC1A 1YMMB 2CR6A 4HK0A 1S46A 1PLAA 3ULUL 4Y16C 5T3XE 2CKBH 5E5UB 3QCTH 4HT1L 3D39D 5CUSH 4HKZA 5PCYA 3L17A 4BH8B 3BKYH 4F8TA 3FH8A 2H6PB 1YEDA 5EOCH 4MD5B 1PG7H 3LIZL 1ZS8B 1BJMA 1TEYA 2X88A 3O2WL 3H56A 3S2CA 1DQTA 1OP4A 2WAHA 3J7HA 3MRFB 4UYPA 5AAWA 5FECA 1IAKA 5I24A 1HHHB 5DLLA 4DSYA 5IUSA 4OLUL 2VITB 2VAAA 1OGTB 3PL6C 3FCUB 1N3NA 5D8JL 1IFHL 3TN0C 4NFDA 2OZ4A 2WOYA 1U41A 3SYCA 3VM7A 4RNRB 1F6LL 2A38A 1TT6A 3IXAB 2WQUA 2JI3A 3MLYL 1S7VB 3QJRB 2QSCL 4ZO8A 1FYTD 2YQGA 4KHTH 2HJKA 4FF9A 5JMOC 3O2VL 4ZQKB 4DPAX 4R7DA 4P46B 2WYIA 3BVWA 5J1TC 3QORA 3U4EA 1T3FB 5IHBA 3F7QA 3STZA 1X5AA 4DEUA 3SE8H 4PVNA 3EJJX 4N8VG 3FJTA 3MCKB 4RSVA 3RWJB 5FKAA 5K39B 1EHNA 1JZEA 1NCCH 1XFPA 2G60L 3EHBC 4XHJC 5TPWH 3T0BA 5DWPA 1G4MA 1HHKA 4PRNB 5MENE 3SE4C 3KW8A 1I8LC 3O6MH 3LNEA 4G6KL 4PREA 4OGYL 2Q87A 3I9GL 3P3YA 3M86A 2YGQA 3M7FB 4NM8H 1XB8A 3RWIB 1EK3A 1UA7A 5F7FA 3SDCB 3QC5X 3CAFA 2V17L 1UURA 3FQNA 3U4KA 5CD3B 4J7RA 4PU2A 4PJ7B 2DEXX 3ARYA 1K8IA 2R29L 1DBJH 1F2QA 4D0DB 4AJYV 4H7VA 1PKOA 2XG5B 3L3OB 1NMCC 2OMTA 1ZA3A 4I5BB 4TQPA 1OZTG 2AJZA 2ZUXA 1UA6H 2X1XR 3FT4B 4S1RL 1W2KT 3FCSA 1BBDH 4YHKL 3CZFB 3BO8B 4AYSA 5IMOB 4Z0XB 3FB5A 4P2RB 1MZZA 4W93A 1G1YA 2J4WH 2Y36H 3SO5A 3DMMA 3QUKB 1HNYA 5T3ZL 3BHBA 1T1WB 3BO8A 2XYBA 3WFZA 3F7KA 3RIFK 1C12B 1E4XH 2EYTA 4UQ9A 2DV6A 2IALA 4H25A 1WCBB 3T0EB 3WSQL 4NC1C 1H15A 4K8RH 1AKJA 1LO0H 5C7ZA 4XN8A 4PWFA 3CMOH 4RQQA 1AR1D 5JZ7D 4TSBH 1VZGA 5IJDC 2H9GB 2YC1B 4NWTH 2X05A 5I18L 3FFCD 1ZPLA 5JW5A 1BFOA 1ZTMA 2BS8A 3OKEB 3KHOA 4NNXB 4XZUB 5DK2A 1NEZB 1FGVL 1QW9A 2J8OA 1A6ZA 1E4WL 3MGOB 5I66B 3QJTB 1NSNL 2HCZX 4LKCB 4DUXA 1BQHA 2PO6C 3FZUC 3Q6FB 3T4YA 4M7LH 1VFBB 4A6YB 4KXBA 2DWTA 4U4IA 1XD0A 2AANA 5AVQB 3ZE2E 1GGBH 4ZX5A 4HSQA 4K5PA 1TQBB 4O9HH 5J5EA 1RZ8A 4GAYB 3MX0B 4OZFB 4LLAA 1QBMH 2PW2B 4OUUA 2P8LA 5HY9B 2Z31D 5C07D 3FT9A 4GLRH 3RVUD 5GGSA 5H2BA 5JOFA 5DEFA 1YEIL 4OQTH 1FZOA 2E7LA 4FMKA 2WTPA 2BSTA 1QSFB 3HCVB 3DOSA 12E8H 2C34A 2CDEB 5JDSB 2C9QA 1IKFL 5FX3A 2BIQA 4HVBA 5GS1B 3FOMA 2GW5A 5D7KD 5JW4R 1JPTH 3JTSA 1QFPA 4OF0A 3GDBA 3VD2A 1QUPA 4JJ5B 4G82A 1JZJA 2QLYA 1HS6A 4DGVL 4GW1B 1WFUA 1FYHB 3GXNA 1E7UA 2KT6A 4LMQE 2F7IA 3NK3A 3A21A 3U46B 3LRLA 3HBZA 3EJPA 1L0YA 1ASQA 4BEIA 4IJTA 3I6LE 1BFSA 2PTTB 1K5NB 3QHFH 4FG6C 4TM9A 4TTDD 4BFRA 3IJHB 3FNKA 1CE1H 1FNFA 3O9WD 1UD6A 4A38A 4H8VA 1G7JA 3WTTA 5FFGA 4TVPL 2A4ZA 2X1WL 1FNLA 3LKSB 5KSAC 1ID5I 2VXUL 4HJTA 3RL1B 4HWEH 5JDJA 3ZRFC 3HPJA 2WWOA 3EBGA 4CN1A 3AFLA 2Z9TA 1HWWA 3RDTA 3TV3H 4BQ9A 5L7XL 4L5FL 4KXDA 1DVFC 1SHWA 3GF8A 3BGFB 1HZHL 4K7FA 3X13A 4W6XB 4C4KO 4DEPC 3N06B 5TH2B 2Y2TA 5IGXH 5D2NE 4ODXA 2IDCA 1QLFB 2ORBL 4L4VB 2YPLB 3HPLA 4LAQL 4WUUB 1CL7H 2VXVH 2EDLA 2BO0A 5F89B 1A9BA 5B1BB 2W0PA 4M9OA 5GS0H 4WTWA 3S5YA 1MCPH 3N9GL 4NP9A 5EOTA 3T0ED 2G0KA 4GW5B 4N3TA 2Z6FA 1C5BL 2AMGA 2KL6A 3PGDB 2E75C 4G7SB 1ZKAA 4PAZA 5E2UL 4QXUH 3RWHA 3UZEA 4OLZH 4EI5D 2VRQA 4MA7H 3H9SA 1PS3A 2FZ3A 5E99H 3QJZA 1R3HA 4OGAC 4IS6A 5C0BE 1AHWA 3OMAB 4JVWA 4U1IA 2NZ1A 3T2NH 1JWUB 3WMSA 3VXSE 1MG3C 3CQPA 4TOYH 1OD9A 3GLZA 3IJEA 3ZGHA 5I1CH 3PWPA 5FUOH 3QUKA 3FQ1A 3GPEA 3DMMD 3D52A 4XXDB 5GSRB 1M7IB 1AYOA 4ACTA 3G5VB 3EOBB 3D1MC 2W65A 5F7LB 4LT7A 4QHKI 3H0TA 3AQZA 2FZ3B 2E9BA 1KLGB 1XTLA 4H8HA 2DL9A 1EAPB 2HJFB 1UH2A 1TVDA 1GJUA 4JFOA 4LVOB 3UG4A 4HOMA 1RH8A 4JANA 5HVHB 5KVDH 3D18A 5DR5H 2OMTB 2AXHA 4KV5F 2AP2A 3MYJB 5FUCE 1SQMA 2KHAA 4PLKD 3MZGB 4QYOA 2CBMA 3BIKB 3WL9A 4U1JA 4UM9B 3KPLA 4JDZB 3FTGB 3D3VA 1KTCA 1AAJA 1Q94A 2JQZA 3LRSB 4JG1H 4NERA 1YAZA 5C0AD 1ZA6B 3V6FB 2F5BH 4OF8A 5A43C 4HUCA 1IBHA 2DMGA 4OCSH 1EZLA 3OWRA 1QA9A 3CVHB 4ELMB 2B3IA 4HX1A 4J3SA 4PV1C 1BZ7B 2P5WB 3RHWF 1WBYB 2QR0B 3PXJA 5B7MA 4ZFOA 4NUJA 1OOWA 1U93A 2NT0A 3E6HB 4PUBL 2WMPB 2C1PA 4KK9D 2XXCB 1JFQL 1NGZA 2N7SA 3VYOA 4KC3B 5ABAA 2QADD 1N26A 1BWWA 3T6XA 1ETJA 1BQSA 1HVXA 2APFA 1VEMA 3RWEA 3F84A 4ZOCA 3QWOB 2MQ3A 5D7LE 4BK8A 5KVGE 1LK2B 1I1YB 4QLWA 2AV1A 2NY4C 2A74B 4ZTPL 2GSIB 5F88B 2VAAB 4AXWA 2ZWYA 4FI6A 2JNZA 5DJCB 3GJEA 4N1CA 3VXPB 3VFUA 3D39B 3CHSA 5IG7B 4MA8L 1U91A 4ORGB 3ZW3A 4X6FB 2I07A 3CZJA 1CF1A 5HHQB 3VB8A 2BY3A 2WSDA 2BVQB 2YZ8A 3VD9A 2CJ3A 1FN4A 4CC4A 2G5BA 4XO4A 5JDSA 2ITCB 2VDQB 2XTJB 4N9OB 4RZKA 4XN4A 3BMVA 5KYNA 1BPVA 3NFSH 2CR3A 1G9EA 2ZCHH 2OZNA 1UXSB 4E5XG 4HU8A 5AVSB 4LOVA 3EYOA 1BJ1H 3D0AA 5IF0A 2KBGA 2MRYA 4YFLF 3V0EA 3HN5A 3D2UD 1JGEB 4MJID 2ITFA 4WV1A 3MROA 1I1AB 2VUKA 5DS2A 3O4OB 5LBSH 1P6FA 1AYRA 1AP2A 5E6YA 5CWSA 1F3DJ 3WTXA 2XWBB 3SDAD 3U1SH 3UJIH 4OD3L 5BJTA 2NY0B 4IBYA 5EWIH 2WYZA 3B2XA 5K33A 1FBIH 2AJSL 3FQXB 1QRKA 1LE9B 5B8CA 2R7EB 5F88A 4Z3EA 3RU8L 4K7PH 4N22A 2J8UB 1M4KA 4PMEA 2C26A 1U95B 3RX9A 4S0SD 3WLWC 5FHBH 5EV7A 5C0IB 4E9SA 1HQ4B 4RAHA 1E6JL 4ZSOA 4O5LH 3PCYA 2BY1A 2IF7A 3FT2A 4UIMB 2LU5A 4LSSH 4N26A 5I1IH 4WHDA 3MJ9H 1BEYH 4GRWB 1GS8A 1PG7W 4U1GB 4DP6X 3DI2B 3NFPA 4DESA 3DYMA 2LU4A 2DM2A 1UB5B 4FTVD 4U1LA 4Q6IB 2OP4H 1SF5A 1P5UC 2I69A 4LVNC 2CNYA 1XL6A 3ULVH 1JUFA 4UDTB 4PTUB 4DW2L 4KQ3H 1GCYA 3R06A 1T1XA 3MRRB 5F6IB 3UC0L 4BFKA 2CHZA 5I82A 2BFVL 4NM4H 3FO0H 3NEOA 3C9NB 5KS9B 1FHNA 2HUHA 5T5FA 2NUPB 1J1OL 4PJBF 1N12A 4RGMC 1IEAB 3GSNL 4XC1H 5EEXA 3CUPB 1GMIA 2P5ED 1Z7JA 1JHTB 5C0RL 4G8FB 4QLRA 2F53A 2PPFA 3D18B 4HS6B 3T5WA 2DMKA 3RFZC 3LSOA 1E6OL 4W9EC 4DNLA 1NC2A 4DOHE 3V4LA 1TZHB 1P4LB 3EAKA 3LKOA 2WXJA 1AGFA 4YDJA 5FYKL 4BSVA 4XP9H 1ULVA 2BMKA 4LRIA 4PP2B 4QWWD 3T3MF 5ITFA 2CCWA 2WO2B 4N24A 4UCFA 4WW2F 2R51A 5T1KB 1EA9C 1I4FB 2LFEA 2XJKA 1LEGA 1R3IH 1I7ZB 4NQTA 2K45A 1U8MA 3BFQG 3ESMA 2NNCA 1HWHB 1PF3A 2ICWA 1YYLH 4R4BB 4BE6A 4XXWA 5JHLA 5DVMA 4ANVA 1PAMA 1V7NL 4R0LB 3M1OA 5GZOD 2JF1A 4HHAA 1JWSB 4HAGA 1D5BB 5KOVC 3HN8A 1U3HB 5E5MB 5MP6L 1MFEH 1PZCA 1KC5H 2DH2A 1T0OA 1F4AA 1XGTA 2ESVE 3GMOB 1MRCL 3B3BA 5J89A 1KCRH 3DDFA 5DHDA 1MW3A 1TJIH 5EZLB 3L4YA 3EO9H 2H3NA 3CE1A 3M8OL 1KZQA 5CJQH 4EIUA 1JPST 5BZWB 2E5EA 3N0AA 1ET8A 1WFJA 3BKYL 3DX7A 4I0PB 4OFVA 1ZS8A 1AQDB 4N2CA 3TJEL 3BKMH 2R4RH 1C16B 5HPMB 1YZZA 1L7IL 5FV1L 3D9AH 2B8OT 1J1XH 1VZIA 3HC2A 1AQ8A 1KG0B 2W81C 5EO9B 3RJDA 5GGSY 4LCCB 3QO1A 4MHHG 3BN9C 3WN5B 4ABQA 1EEQA 3TNMA 3VDBA 2OMYB 3LH9A 4BUHA 2IPUG 3QIBD 3L9BA 2A74C 4X5WB 3ZO9A 3HNVH 2WUBL 1CTOA 3GXTA 5I1DA 2R69A 1NLBL 3PLYA 1GOHA 1F1GA 2I9LA 1WZMA 2XRAL 5I75C 1SHMA 3L95A 1B90A 3CXDL 3PIQA 4R2GC 1F86A 4N0FB 1XH1A 1MXGA 3ETSA 3O6LL 4GKSB 4QXTB 4XWGH 2YSTA 3CDZA 4Y19B 3THMH 2VXQL 5D7IB 5C0AE 3TJPA 1KTDA 2VO5A 3MUJA 1BFVL 3LDBC 1EUTA 3HOGA 1SJHB 1QACA 2X4NB 3TA4D 3QIWC 3VMPA 4Z76B 2Z31C 1J8RA 4XT1C 2Z8WC 3RVVC 5D7IE 2CA3A 3G9VA 3L5XH 4HAKA 1ZHBA 3O6ML 2F6AA 2Z8RA 1OOAA 1AHWC 3OAWA 4X6CB 4L0ZA 4HPYL 2VM4A 1CIDA 5LDUA 1RP9A 1GL4B 3K71A 1I8KA 4L4VE 3HS8A 2EQDA 3TJHD 1MIEH 1QUNB 2Y06H 5J9PA 5DMIH 1A0QL 4CMMB 2I9TB 1DEEB 1PJ9A 3GSUB 4ZMWA 1E9QB 1AGDA 3SBRA 5DU7A 3DXAA 2GK2A 1ZANH 2ODHA 4D7BA 2GBUA 3BEVA 4G6JL 5TE7L 1U8JA 1K8DB 2GHZA 2NQ3A 5E8OB 3UG5A 5L8JB 2J7LA 3FH7A 5EEUA 3O4LB 3T3PE 2AXFB 5ACLA 1BVZA 1IE5A 2FBJH 3ROOB 4XPTL 2RQ8A 1CLZH 4NRXA 5KSVA 2OKMA 1SXSA 4PY7A 5GGRB 3F58H 4XBGA 2FUTA 1BOGA 3VVWA 2P3YA 4GRLC 4M5SA 5HYQA 3O9WC 5DFTA 4DP0X 4JY5L 1NEZA 2JCWA 1SZNA 4GO6B 4GRWH 4OCXL 3DRQB 5AZEL 4IRJA 2H9GA 1BYOA 5IVXF 1JHTA 3HC0B 3P4NB 3KDMB 2XZAH 3NTCH 3OG6B 3OR7B 2EE9A 2P8PB 1EANA 1FUNA 3EYFB 4Y9GA 2IALB 3CFMA 4JHAH 1Y18B 4Z7UA 4HJ0D 4AEIH 5EIIA 4NQEB 3HMWH 4KTDL 3CFDB 4TNFA 4R3SA 1F41A 2HFFA 1AOZA 1IU1A 3QHTC 5EOQL 4TPRL 4Z7UE 4FHJA 2OXHB 3WIHA 3QC6X 2EILB 3RIFF 1IBZA 4U3CA 4NC0B 3NABL 4I48B 1VGKB 5D7KE 4P5TB 2PWHA 5HHPA 5BRZE 1U3ZA 2CXKA 3WDIA 3N42F 4AK2A 4LU5L 3VFUB 1AI1L 4EI5C 1U33A 4IBTA 2LE9A 3FFCA 2ZCLL 3NSDA 5L2JB 5K1JA 3ULUC 4JFDA 1KIUA 2JJSC 2ARJA 3MLSL 4UQAA 3VI4F 4XPGH 5KSVB 2FLRT 4O4YL 4PJBB 3QISA 4OGAD 4RFOH 3MR9B 3WBDA 5I30L 2Q5BA 5LAXB 1MQKH 2OYKA 4ANXA 2CG9X 4H2CA 1T5WA 2YK1L 1NMBL 3V0DA 1YY9D 3PWVB 1GR7A 3DMMC 3IDUA 3ARBD 2JFCA 2KPWA 4WHYG 3TN0A 3PL6A 1ZOXA 3PNWB 5J57B 1UD4A 1MHEB 5EUOF 2CA4A 1RJLA 1NCNA 2C1OB 3DJ9A 1UOWA 2Y23A 1F6AA 2EUXA 3MUGB 1HEZA 3Q1EA 2EDQA 3QUYD 4XCNB 4CADA 4NKIL 1DUYA 1OAYL 3GBDA 3KGTA 4QHKJ 3O2DA 2O5NA 1L6PA 2HG0A 1OWRM 3ZX1A 3FH5A 3MV7E 3IE9A 3BP6B 1HESA 2B14A 4IBZA 3MV9E 3LB6D 5I8KL 5T5NG 7FABH 4PJCB 4B95C 1KCUH 2IAND 2YUVA 4CILA 4TVPH 3SE4A 1K6QL 3DURB 1OCRB 3FQWA 1AZBA 1FLRH 2J21A 4RWYL 2FO1A 2IGFL 4ZDHB 4BXSV 4KROD 4YL4A 1TYRA 1IAKB 4DP1X 4TKWA 4JG9A 1FE8L 1M56B 3K6NA 4EQ2A 3GS7A 2CLVB 1IT9H 5I8CB 3NPSC 3ZKND 4AXWB 5A6IA 4ZO7A 5LNEA 2DQUL 4NRXB 4XMLH 2QQKH 3QUZD 1ONQA 3RX5A 1EPFA 2ESVB 4S11A 5KSAB 2QV2A 2CD0A 2KERA 4IKIA 5CINH 2X9ZA 3RTQA 2WSPA 2CWRA 5EORH 1N10A 2OS7A 3E3QE 1CF8H 2C3VB 1PYWA 3ULVF 2KDYA 3K8MA 1HILB 4JFFB 3VFOA 4QOKB 5KW9L 3RY6A 3K3QA 1UT2A 2BERA 3N9GH 3AREA 4KH9A 5DS1A 1DVYA 1L0PA 5DMGC 1L9SA 3CFEB 4NN7B 4NQDD 4XCNA 1EEUA 3H9SB 5F9JA 1QUNA 5DT1L 3OHXA 4HEME 4DGYH 1NEZG 1KYDA 2X70B 4I1NB 2R1XA 4X5LA 3TOPA 5KYWB 1ZVNA 2BX5A 5F96H 3U9UA 2F0CA 1IBGL 3ARDC 3HR6A 2W9EH 3MUUA 3RAJL 1YCSA 4OTXH 3BP5B 2WQRA 4EOWL 1SEQH 4GH7B 3TBYA 1NUNB 3RWDB 2H45A 1H3TA 3I02B 5MEND 1E30A 1UASA 4WFHD 1JVOA 2ATPA 5I23A 4OD2B 4QXVA 1EUUA 25C8H 4C56A 4HIJB 5AW4B 1PZ2A 2DPKA 4MJJA 4I7ZC 1P5UA 3HI1B 3H9HB 3NZHH 1UXMA 4NZFA 3HJ0A 4YX2H 3B7RL 3C2AH 4LEBA 1L6XA 3KR3L 2ZKXA 2DQHL 2GT9B 3QQ3B 1L9MA 3IDIA 4OCRH 5EC1A 1OIOA 3ZMEA 1CDJA 2E86A 1CCZA 4HEPG 3RI5K 4LKXB 3WFCH 4G80A 4KJWC 1ZD6A 3IKCA 4IRSC 4NQSB 4PG9B 5AZUA 2XQYA 1KFAH 2QHRL 4K0OA 3UTSD 4B9YA 4Z3TA 2VN5A 4LHUB 2HFFB 5HDQL 5TE4L 2ZWKA 5FGCB 1NJ9A 1CG9B 1A7NL 2HKFL 2P8PA 3EYFA 1KNOB 4LHUG 4MNGA 2OMZB 1DLHB 2VQ4A 3K2KA 2YD7A 1XGUA 3OKDA 4H0HB 1A6TA 1TTCA 2NY3C 3L2LA 2Q7AA 2ZF8A 3UBXG 2HSIA 1CL7I 3MXWH 5BS0B 2KLSA 3MRBB 4U1NA 4MCMA 3S88H 4GIAA 4A7TA 1OARH 1OCOB 1U8CA 4WSKA 1MJJB 2IWFA 2ATKB 2BNUB 2ETWA 4NSKB 1JXKA 5AW7B 1SVZA 2FB4L 5B3SB 4Z8FL 1I9EA 3FTSA 1CVRA 1B2WL 1RZIB 3MODH 2NSXA 2CRZA 3K0YA 2WIIB 2R9HC 2QQLL 4IRJD 4QRQB 3KM2A 4LOEA 3GI9H 4CC4C 2YD9A 4JO5A 1SNRA 3ECQA 1IZKA 2WO3B 4BJLA 4O58H 1CBJA 4Q0XL 3MNWB 2YRZA 4G6AC 3NP4A 5FM5O 2W91A 3WLBA 3ZE1B 1USZA 2H5UA 3O3EA 3OC5A 1U3YA 4YDIH 2EDXA 2EACA 5EO1B 3FQ2A 1TKWA 3KG5A 3LRMA 2IMMA 1UT1A 4FX5A 4QWWC 1I9IH 2NXYD 4MTMA 5E6SB 3DRTA 3ZHNA 3MBWB 1CFSA 4MA1C 4IOIA 1OCCB 3WOVA 3F7LA 3LQAC 1ILUA 2YXMA 1XF2A 1NFDB 4YHNB 1LQSR 1PZ5B 4K5NA 3K6FA 3BD4A 4ZAKA 3DROA 5BVPH 3TESA 4LHQB 3TT1H 5DMKA 4EKXA 2RCSH 2VC2L 4MNHB 5L9DH 3P73A 2D03L 3PPEA 2DICA 1HINL 4I77L 1ET7A 1RZ7L 4TUKH 5BV7H 2DD8L 1JGLH 5IBLD 5I1AB 5I76A 5JA8B 3B2UD 3QEUA 4NKOA 4Z0XA 2HMID 3VGHA 1HN1A 3ARRA 4GXVL 5DHVA 3RJOA 5C0NC 5JPNC 2OMYA 5IG7A 1P0SE 5D7EA 1CFVL 4EDWL 3O0RL 4UT6H 1H8NA 1CD9B 1O9VA 3MLWL 5KANI 5LHDA 4JR9L 3NA4A 3JWNE 1IC5H 1V27A 4PJDA 5EIVA 1HZKA 3LZFL 1ZWIB 3HHSB 2Y9RT 5CZRA 4MX7B 5E6ID 5GSVA 5CS7A 2VMJA 3DK0A 4NO3A 4KI5C 3P0VL 4Z7VB 3F01A 3VXRE 5KEZA 3TT3H 4OJFL 2NY7L 3BPLB 4MNQA 4DQOH 1G9ML 6TAAA 3FHAA 1YQVH 4HG4K 3MV9B 2YWYA 4FFVD 4GSDH 2WGNB 4S0HA 3MGOA 3SIKA 1TITA 3HZYB 2BK8A 2WQ8A 3CLFH 4IHOB 4MA3B 4QD2E 5KYWA 3BYTA 4KXZI 2QR0A 3ULVE 3MV7D 3OMNB 1QRNA 3UTPE 5FCUH 4AMWA 3SQOH 5AW9B 4QHUA 1O6SA 3NAAL 4KRNA 1SOSA 4PRID 2DEWX 1WFTA 1H3PH 5CF3A 1AQKL 1WK0A 4ABUA 1AE6L 3HUJA 4IOFD 1WGVA 1F13A 3BZFA 4QAMB 3D08A 4DO4A 5HHXH 5SWSD 2DBLH 4APQB 4PJEF 4XVOA 3OSVA 3UCQA 1J87A 4UQCA 3P30H 2X42A 2VDLH 2JTDA 2WINA 2XICA 5F3FA 3RVVD 3B3IA 1MHCB 2HFGH 1PTZA 3MNMA 4Z0BH 5ESVA 3KYKH 5E2VH 3ZE2B 4JFDB 1ETZB 3NMEA 1TZHA 3HTLX 5E2TL 4HXAH 4X5XB 5EEWA 4NZUL 3DJRA 1H6TA 2XKUA 2E27L 2ZIDA 2N56A 2BWIA 4ZFGH 4GUQA 1YPZB 2B5IC 5LG6A 5E4AA 3QXAB 3SGEI 3LHPL 1DBBH 3UZQB 4HUWA 3WI9A 1BQHG 3B3IB 3S9DB 1F18A 1A14H 1E90A 2YMXL 5E94B 5C0FB 1DDHA 1M7DB 3CHQA 1WZKA 3MJGX 4R26H 3P2TA 1KCRL 4XB3A 5JIDA 1W0YT 2NY5H 5ALBH 2NZ9D 1ODAA 2R2HA 5CJQL 3VXSA 2GTWB 5EBLA 1HEZB 4QRTA 2XPGA 1NGQH 4HH8A 4JFFE 4LCUB 2KDGA 2Q8AH 2WXMA 1N6VA 4NUJB 1P7QA 1HE7A 3HAEB 1HOCB 3MREB 5HGHB 1NBZA 1DQVA 3B2MA 2FWLB 4B0MM 3GJEB 3OXRB 4FQHB 4LSPL 4UTBH 4XNQA 1AO7B 2X4RA 4KX9A 2P24A 4LPTA 1IGFH 1I1YA 3HNVL 3JUYA 5FK9B 2VGLM 5D2NA 1LILA 5D7LD 4OZIB 5F0LB 2I25N 2BP5M 2FR4A 2F7QA 3MN8A 3SKOB 2ZYIA 2BW4A 3IEAA 3N2JA 4PJ7F 3ASOB 2LOEA 2OR9H 3AZUA 4PJCE 5IW6B 1FYTA 4CMHB 3P4OB 3S3SA 2AQRA 3MV01 5DA0B 4Q9QH 3UTSE 1XL4A 3K81A 3B6SB 3HIZA 3QRBA 3IVKB 3C75A 1RK0A 1PPIA 3K71B 4DTGL 3GO1L 4KI5E 4N2NA 4Q52A 4MS6A 3R7RA 4TVPD 5EOCL 1A6VL 1JF6A 3EYVB 1Y7VA 1EEZB 4LNRB 1CT8A 5E9AA 4HOZA 1RUAL 2CGZA 4X6DF 5K9OA 3IFPB 4X7TA 3T3ME 1YJDC 4ONHA 2F8VA 4AYFA 4L0YA 1B6UA 2RTTA 5ADPH 3QK0A 4P23A 1BG1A 2X87A 2JELH 4FQPA 3X2QB 2CR0A 4YHNA 4OBSA 2NNXA 1TMQA 4QKTA 4GFTB 3AGVA 1UM6L 2XKNB 3QA3A 4MBOA 1A0QH 1OT4A 1CGVA 3GTTA 5H94A 3ZZ1A 1WISA 4GW5A 3JYBA 5HXMA 2Z65C 1FO0L 3EZ8A 4OF5A 3PWPE 4YQXL 2D7TL 1EAPA 1CDIA 1T0MA 3B1UA 2FBOJ 3CZGA 1H9DA 4G6JH 5TE7H 2WVSA 4C55A 1JWMA 1QI3A 1JDDA 4N8UA 3EADA 3SJVE 1N59A 5D72L 4LOFA 1EBPA 3SPVA 2WVTA 1D2PA 1R19A 3LB6C 5B22A 5F8QC 4GG6B 4ODHH 3PG2A 1ZEAL 3ARPA 1B4RA 2C7FA 1RQ5A 1VADB 2PXYC 4XVJH 1KYOJ 3E2HB 4BHUA 1RXLA 5KVFE 3VI4E 3KPRE 4ZNEA 1QSED 1T5XB 1DDTA 1KT2A 1DR9A 2YAEA 2ZZUT 4N25A 5KYXA 2V8LA 1WBYA 3Q6FA 3BPOB 3TFKC 3GMNB 1OKEA 5E6UB 1R0AH 4WW2C 1ACYH 3QUZC 1Q9WA 1ODUA 3E8UH 2IWEA 3VTAA 2VLRE 2X4UB 3LEVL 1ES0A 3ARZA 3TVMD 4M6OH 3UZVA 2MJWA 3VH8G 4YGAB 4AYID 4F7TB 4PS8A 4APXA 1L7TH 1I8LA 1XF3A 43CAA 1I1FB 2VMFA 3FU8A 5CR8A 5SV3A 3DC0A 2IH3A 1CG9A 1Z9PA 3O2DH 5FA4A 2E9IA 4EN3D 5F7DA 5LDSA 5D96B 1A7QH 5MHSE 3WHE1 1R3KB 5JIHA 4RLDA 4QKXB 3BHBB 4FULA 1XGQA 4GFXA 3QQ4B 3RL2A 4EUPA 2DJSA 4R96B 3VSUA 4XN2A 3ULSA 1MQKL 3OTTA 1T7WA 2PCFB 3PP3K 8FABA 4MDRA 4GT7A 1BF8A 1KJVB 1LJMA 1Z0NA 1H6UA 3OHXC 5JMRA 5DDHB 1IQDA 1HXMB 4V2BA 3AADB 1MHHB 1JVKA 3FN3A 1HEJC 4DZ8A 4JM4L 1XH3A 5DZ9A 3LOWA 1JDCA 1EAJA 3FFDA 2FX9H 2AXGA 1OSZA 1A7RL 3NZ8B 3F7PC 4NHCL 4W9CC 1TQWA 2MCPH 2HFEB 3IMWA 3OKOB 2A9CA 3FRUB 2ZUUA 4HUKB 5I8EA 3LZPA 2Y0SA 2WZ0A 2H7WA 3RGVC 4Z7VE 1G7PA 1XF4A 3PAYA 4PRIE 4EIGB 4V1DD 1KMGA 2DKMA 4KJYA 1WAEA 3NFNB 1SXAA 3KXFE 4PWEA 3M88A 2VLJB 4JHBA 2A6DA 1B4JL 1GRWA 2IGFH 3WE6A 3EZJB 4QRRE 5HD8D 3EJYD 4PJGB 4ZSOB 3WIHL 4F20A 2B1AL 1QSEB 3QUXA 2Z1KA 5I9QC 1I8IB 1UB6B 5I0ZA 1BYNA 5FA3A 4NKMB 1EWHA 4FTDA 2FECI 5IR1A 3LKSA 3QFGA 1RVFH 3FONA 4L8SB 4AIOA 1NCGA 5CINL 3T4YB 3PPSA 3CLEL 1PIGA 1ZLSL 2PP8A 3F05A 4YXKL 1RMFH 1NFIB 4PJFB 2R23A 4XP5H 3L1GA 2ADFL 4ILDA 2YEZB 4LRNH 1OTUC 4RAUA 2VJXA 1XR9A 4ODVL 3ARBA 5F1NA 3P4LA 4J3OD 1CE6B 3D85D 3FYIB 3VFRA 3QHFL 4UV7H 1RURL 1CE1L 1EZUA 4Y4FA 3JWOH 3JZ7A 5F96L 1M6OB 4AYFB 2YPKB 3VWJC 1FRGH 1KB9J 2WAQA 4FNQA 5C0EA 2ZX9A 4G6AD 3VA6A 5IQNA 1RAMA 2E76C 3K2UL 3ATEA 2XX0A 2Z93B 3N1GC 1UH3A 4Y1AA 3QG7L 5C9JB 3D50A 4FQ2H 2OJEA 4XP1H 2HFTA 1CXHA 1VCBC 1CXKA 2XTLA 5ANMB 5DMKB 2NXYC 2WKLA 5I5JA 4FQ1H 1XEUA 4LO9A 5HYSG 5DRNB 4KGLA 3HAEH 3Q7JA 1NMAL 4AMKH 1W0VB 2DM7A 5D1QD 5CXPA 4KZDH 4EKJA 3WTVA 3BAEH 3LZRA 5C0GB 2VR9A 4FDWA 5JXAH 2G5RA 3VRLE 4C47A 4DUVA 5K9QG 3WMQA 1ZTXE 5KVGL 4G8IA 3QI9C 2J71A 1KJ2B 3HRZB 4OCRL 1ZTXL 2ZUVA 4OZHF 1G7IB 2YEZA 3TO4C 4G7QB 4AZ8B 1M53A 1RUQL 4GAJH 2P8MA 2X2IA 2VXTH 1BVLB 3WO4B 2VKXA 4KVPA 3L7EA 4OLWH 5ISZB 3L3OC 5D1XD 5D7LB 1I85C 2PWGA 4NJAL 5HJ3A 4DT2A 1ID2A 1TEFA 3IB4A 4P23C 1T6VN 3NESA 2CK2A 4NRZA 3UDWC 5C0ND 1MFBH 5C0AA 3T4AA 1OSZB 3VRJA 4GUOA 2ZSVA 4HS3B 3VXUA 3QJFB 4LFHG 5D7IF 1MF2H 1KBVA 2CDFB 2FVNA 5HHVH 4JE0A 4U0QB 4CSZA 3C5ZC 3GFUA 4JCLA 9PCYA 4XNUH 1E4XL 3IF1B 2AQQA 2YLKA 5EU4B 1E7VA 3V4UL 1JCVA 2FE0A 2VDLB 4NQEA 3OKNA 2GTZB 4MQTB 3S88L 5EZIL 2BIIA 4QUOA 4WI6A 3ULUE 2X9XA 2B77A 4J3WA 1M2VB 3RI5F 2NOYA 2X5PA 3K8KA 4X6DE 2FWSA 3BKCL 3D0LA 4NLAA 2QDVA 2WXIA 4QYAA 3DSNA 3QP3A 4DVRL 3S4SA 3RWFA 5I1KH 5BW7C 3UH8A 4K94C 4OI8A 1R3KA 2OA9A 1K3ZA 4APQC 4F37K 3NRQA 5EPMA 3AWFA 2Y5TB 5EEYA 4QNPF 5CJ5A 3MNZA 1SMAA 1ZHLB 2ZOOA 1WICA 3GI9L 4XMKL 1A1MB 2VDMB 4BELD 4DFIA 5KSBB 2YEVB 5IROA 4WNQA 1ETZA 1ZSHA 4N0YH 3U2SB 1EHLL 4GQRA 4E41E 1GGBL 3U9PL 3KWVA 3UAJD 5ELIA 3GKWH 4RISL 4HK0B 5CCKL 1JNLH 1LGVA 3U30C 3VGBA 5GRUH 2EVGA 4LNRA 1LL1A 2WWMD 2P7TA 2A99A 1UKTA 4DGIL 4AM0Q 1HL9A 2OMWB 1XIWB 1Q0XH 3E1ZA 1M7XA 1W8OA 4HKBB 4OV5A 1NGZB 2X4SB 1MSPA 4MSWA 3UBXB 1K9TA 1O7DE 4CNIB 1YEJL 3Q48A 1TMCB 2MNUA 1T04A 4CVWA 1FV1B 4D9QE 3G5ZA 1ZS2A 5L0QC 1P7KB 2ZUQB 1WFOA 1OAJA 2WC7A 3HKFA 1KENH 5LAPA 1PL3A 1RUKL 5LCVL 1WAAE 2H4EA 3X1BA 1WTLA 2A6KA 3JV4A 1EVUA 4PGZA 4WLCA 2RCSL 4MZRA 4PGJA 2QPDB 1BDYA 1KJ3L 4AENA 4CDHA 5L9DL 3KZ8A 2X89D 4U3HA 4TUKL 5BV7L 4OQ1A 2E9GA 3S8FB 3OHMB 3LTVA 2G4GA 2NZ9C 2V3FA 4Q4IA 1T0MB 2GJ6B 4FFTA 3IT8D 1PZUB 4JCWA 1JYVA 1LHZA 1Q0EA 2OL3A 2DJMA 2XWZA 1KACB 3AJ7A 1CXFA 3PXLA 5E0QA 4NGHL 3DSFH 2ENPA 2QSVA 4JM2B 4JKLA 5ID0B 1IE4A 2AXGB 3GJFH 5I8OL 3JT0A 1NEPA 2L3BA 4EI0A 3PGFL 2G75B 4Y7MA 2J5LB 2BINA 1XIWA 5DD3H 1K85A 2R4SL 3DVFA 5JW3H 4WNSA 2FIKA 2A4CA 3UTZB 5KUMA 4JLRB 5BXFA 1DVXA 3P4MB 2VUOA 1IARB 3TA3D 1MOEA 1YQVL 3GM0A 3WIFB 4K3HA 2VW6A 4K3EL 1P4IL 1S7QB 5EWIL 2JCCE 1HZHH 2Z7WA 3V4PB 2AJSH 5I1LB 1CI5A 3OV6A 5ACZB 3PREA 5E1AB 4UWQB 3JWNH 1G0DA 2ZICA 4ERSL 4ZDHA 3WTUA 4PIBA 4R7LA 1I7UA 1V3JA 1YC7A 5E00B 5D7JD 3NP3A 1I1FA 1LVEA 5E2UH 4YHMH 2QVKA 2YN3A 3LCYA 1QR1B 3QDMD 4JO4H 2NXYB 3HFMH 3OXSA 5AAWC 35C8L 4MJ6B 1YECL 3S2AA 3TONA 3WY1A 3LXBA 3B2PA 4FI8A 3CC5A 3Q8EA 3QEQB 1E8WA 2BHUA 3SCMA 3LKNB 4GS7C 1NGYB 2WLHA 2AJ3A 1KXTB 3OGOE 4WDIA 3S35H 4HUVA 3CN0A 2NSMA 3IDYC 2OTWA 4J3VA 4BFIA 3P40A 5CBEB 3GSXB 5GGTH 3WFBL 3HZYA 3F65A 4M9PA 4P99A 3SBQA 3CX5J 3QRGH 5FXCH 5CU5A 1F8TH 3GPSA 2YMXH 5ITBH 2ZKYA 2BMKB 1D7DA 4I3SH 1MH5A 3CFBB 2HWZL 5I19L 3UYRL 4TN9A 2HTLC 4ZMZA 5CEZH 1AXSB 2IH9A 3GI8H 2BP0A 4JO2L 4OZ4B 4R97C 5ALBL 5EZPA 5C0CD 4FYSA 4S1SL 2G3MA 3HNSL 3L1OH 3IKKA 3A47A 4PB0H 1OTTC 3WELA 3QXDB 2P24B 5FS5A 2VC2B 5IQ7H 1DBML 4X6BA 1RIUL 2DDQL 3V4VH 1Y6NR 4GP5B 5IJVB 3L4TA 4HIEA 4AIZA 2EYTB 5IBUB 4FHKA 3UYPB 3S3BB 1YMHB 3CX2A 3D3VD 1OZUA 5F9OL 2CDEA 2Z8SA 3VWKC 3ZT6A 2JKIS 4W81A 4BV1A 4NUMA 4MKMA 2YA1A 5D93B 2CCLA 1GZHC 1THCA 2EXYD 5IOPB 3IK2A 1C5CL 2OX5A 3O6KL 4OIIL 1ZHNA 3G3LA 1Q72L 2EIEA 3TVMC 1DDHB 4ENEC 1TJHL 1IV8A 3SKNB 4BFEA 4Z78A 1E5AA 2YAHA 1IGJA 3F5WB 1T6WA 4PGBA 1CE6A 4YXHL 4PB9H 2SODB 4G42A 4X5RA 2WXKA 4YPJA 1GOFA 3S3DB 1GJIA 2FECL 4WTQA 2C9AA 4JDVA 4O51A 4UT9H 2R27A 1HK6A 1S78D 2FJSA 3EHBD 2R7EA 3WD5H 4XHJD 4Z7WB 2ZPKL 2CGRH 2N01B 2D2CC 1NBYB 4GSRA 4ANUA 3GBEA 1M1SA 4MJIA 1ZT7B 1ZSDA 4GG6E 1HHJA 3CBRA 2JELL 1P7BA 5IHZA 4EI6A 1M57B 1NICA 2Q86B 4BZ2A 2C9XA 2VWEE 3N91A 1SBSL 4G42B 2EE0A 4KTYA 2A9AA 2ZX7A 2CKBA 5CCGE 2NW3B 4P8QA 5D1ZB 1D6EB 4L8DA 1TPXC 3AREB 4XNQB 2DB8A 5LBGA 5D1XB 2RMNA 2YAMA 3HB3C 4WO4D 4Y4HB 2MQGA 2XRAH 3WHE0 3EFDL 4NZJA 4CBZA 5DK0A 3EFOA 4AJWA 1UJTA 4E9YA 3MBXL 4OJYA 2XIBA 1F3JB 1D2OA 1BFVH 3POHA 5J1AA 2KC0A 4OH2A 2J2ZA 1I8UA 1UZGA 1LMKA 3QNFA 4M61B 4RESB 4XVJL 1L6ZA 1XCQA 4ZTOH 4Q58C 2YGOA 3JQOB 1IBDA 3RNKB 3RQ3A 1IBFA 3MUHL 4HAFA 4PHXA 2H6PA 4YDVB 3ZBMA 1S9WA 4NQUA 4Y19A 3VFRB 1GJWA 1PZBA 4KGJA 3GBMH 4FLQA 4AZUA 2W0FB 2V2TB 5B1CA 2YGNA 4Z5RA 2AFNA 1FLTX 4LHJB 5ENWA 4RAUB 4FERA 3P0YH 1NPJA 5TQ0L 4I18A 2GJZB 3SQRA 3LEXA 2EIDA 2Z4QB 1BLIA 1BX2B 1S2EA 4XPBH 5DJ8A 2AVGA 2CUAA 2FJHA 1FP5A 1T03L 1JVLA 2PO6D 3FZUD 4MJ5A 3K5SA 3TWCL 4LSTH 4UTCA 2NLJB 4YUEH 1L7TL 3LPWA 4Y9FA 5KBNC 3IE4A 2XFGB 2BNRA 3B7SA 1YEKL 3C6LB 2E8YA 1F4XH 1YUHB 2AJ3B 4HXBH 4JRFA 3KGSA 4Y9BA 5G4NA 3SB3A 1ANUA 4Y4KC 3RURA 2XYCA 4JRXD 3AXHA 1I9JH 1MW0A 3BRGC 1H8LA 7CGTA 4H26A 4XXCC 3PWJA 4U6HB 2A9ML 2X4UA 4LXFA 5LJYH 5IVZB 4EVNA 1PBYA 1CDBA 2W60B 4NI3A 4K2UL 4JRLA 4U7KA 1GGIH 3QFDB 1U8CB 3TBSA 3RNQA 2XPYA 3S0PA 3O3EB 4XVTL 2HFEA 1XGYL 1VKXB 1A3ZA 1TZOA 3BVDB 4KVNH 5KJRH 1KT2B 2E0PA 2JMRA 3C6SA 3VXSD 1F5WA 4X9IA 1FPTL 4OJEH 4XX1E 5IKCA 5L2KA 4M1CD 4KX7A 3FU5A 1WF5A 3VX1A 2VOTA 4GSXA 5J6GB 1ZLWK 3K6SB 5I0DA 1BBJB 1HKLH 3L4VA 4NHCH 1NFAA 4HWBH 5D4IA 1UXLA 5IIEB 4NQVA 1IM9D 4JPSA 4TNEA 4A7UA 3GLEA 2CHNA 1FNEA 2Y24A 3HR5B 4HUXB 4G8GB 15C8L 1UH4A 3TO4D 4YSEA 5CEZD 3Q6GL 4XPAL 4AI7A 3KYMA 1KDJA 5CP3A 1RP8A 2IPTL 3LNIA 3EOTH 3RFRA 2X1OA 1MJJA 3UMNA 4N0UE 2GT9A 1AFVL 2VXSL 3MKKA 6FABH 2EADA 1KC5L 4P23D 4KHXL 3B34A 1B4JH 3DRQA 3DVIA 4YLCA 4MCYB 1TJGH 3ILQC 5DLML 5H94B 3AG1B 3WEBA 4IJ3C 2BVOA 3ZT5A 1OL0A 3L08A 3M46A 1XF2B 2ED6A 5DJ2B 5B7FA 2XQYK 2DM3A 5IQMA 1Z3RA 3ASNB 1RVFL 3ARSA 3SE3A 3U1PA 2HA1A 4HUUA 2R4RL 1CFSB 3EBAA 5MEQA 1GCFA 3K72A 1BZDA 3T65A 3ZE2F 4G83A 2B9BA 4RA0C 1MRDH 1RIHL 1W15A 1V3MA 3PHSA 1XCTB 1CGSH 1FI8C 3FTXA 3LX9A 1KB3A 3QO0A 2Z7UA 1MLCA 3HZVB 1KXHA 4JFZL 4A1RA 5GHWL 1AGBB 3MRGB 2VN3A 3DTUB 3TVMB 3VI3A 2BNQD 2JKSA 3K7UA 4Z7NB 1I8KB 3WNLA 4HWNA 2ICEC 4XVSH 1NCBH 1JXDA 4PRHA 2PF6A 2ZCKL 3VFOB 1NBVL 3WY4A 4F2MA 2AEPL 2E7LC 4HPHA 2XXGA 1RUPH 1ZLVK 1Y0LA 4FQCL 2IWGA 1QI5A 4QXWA 4GUCA 1KBGH 2ZD0A 4ZFZB 3QCTL 4PW4A 2ZXBA 3ASWA 2CLVA 1KIQB 3L9YA 5BVJB 3PHQA 4ODWB 4HMDA 3BAEL 1HSAA 4N2HA 2X70A 5EF2A 2NXZD 1I31A 1YEHH 4CAGA 1NC4D 1GA2A 4N85A 3JTTA 2BDNH 3V4PH 4U6VH 4W6WB 3E1F1 4PLKC 3GBNL 3V5HA 3MLTA 4U0RC 2OAAA 5EIIB 4KO7A 4PRBB 5BO0D 2YBGA 4J39A 3V10A 2CHXA 1KF9B 1CT8B 2JI1A 5E94A 3ZRSA 4AE1A 1BIHA 1S9YA 2LVCA 4PJ8C 2QQNH 4F9LA 1XAUA 5F6HI 3Q2LA 3RWGA 2QTVA 2BIOA 1UD5A 2BJMH 1SEBA 1F02I 4WJKB 1OB1A 5GZNA 1OPGH 3T0XA 5T5NF 4YDKL 3RZCA 4ZPVB 2UZPA 4XPTH 2W9DH 3QFJA 3SE8L 2QPEB 4YJZL 1SJXA 2JIXB 4POZC 4Y16B 4Z7OF 1J5OH 2MSPA 3PHOA 4WWKA 2AEQL 3L7EB 5IB3B 3RIAK 2XNAB 4U6YA 1WZLA 2FJFA 3UGUA 5IY5B 1XDTT 3PGCA 3O4LA 4K5LA 3ZXAC 5AVVB 3I6GB 4LVEA 2NW2B 1EHKB 4C54A 3C2AL 4I2XB 1Z2KA 4QCIA 2J8UF 5J6SA 4X6DA 1A9VA 2B9AA 2R29H 2JKXA 3ZJAA 5C0GA 3WE6B 4LLWA 3NT0A 1KY7A 2C1PB 1MAKA 2XOTA 3NIGF 1BAGA 5ERWA 1XQ4A 3IRZA 1QP1A 3C6LA 4RAVB 1Z3GL 3ELAT 3F8UB 4FFZL 3FSVA 5T1KA 4I48A 1AKJD 4YHKH 2J1XA 3UTOA 4AQEB 1EHLH 5LN8A 3QSKB 3PNWA 1XX9C 4ZQTA 4PR5B 1XCTA 2XVKA 1T7ZA 4K94L 2DQIH 4WNJA 2FT7A 5DZJA 5DJ8B 5FYJE 1G5GA 3QJSB 3TTYA 5CMAB 5JR1H 4O02L 5IEKB 1A02N 5TE6H 3LRSA 1ZRUA 1NC2B 4L3FA 4L23A 4X9FA 3TYGH 2X2UA 1DJGA 2AK4B 4JO1L 2E59A 4LPWA 5BPPA 3EUDA 2NCMA 3G6JE 3U9WA 5TDNA 1BLNB 4OM1L 4ONGH 1LO0L 2OXGB 2YK1H 5HGBB 4WJ5B 2DMHA 1N9PA 4P2QB 2OX5B 2ZXCA 2BHFA 5TJWK 2BHYA 2RBLA 5MENA 4P2OC 1WPCA 1RUKH 5LCVH 3OMIB 1ZGLM 4P5TA 1JPGA 1KEGL 1H8OA 1MEXL 1PW3A 4BK4A 2HN7B 1N6QL 4H8WC 4NBYB 2ZXDA 4XXWC 4LCWE 4W4OA 3KPPB 5A2BA 1LO2H 4DCQA 2OQJA 2WXHA 1F4WL 3OAYK 2F74B 4LCCA 4NUGL 2HX7A 3ATFA 3A0OA 2WLIB 4NKIH 3BP6A 3GIVB 1ZT1A 4MMYB 2B20A 4C4BA 1OTTD 4AQ8C 4URTB 2W8CA 4H8WH 1DEDA 1JPSL 5L2KB 4IGBB 5I8KH 2CUMA 5HI3D 4CGTA 3WTSA 1F6AB 1KCUL 1CDUA 5HDBB 3PGDA 4MBRA 3S37L 1EDHA 3FRPG 3RTQD 5ID1A 3CK0H 4WKXA 3ZZQA 1AACA 2GAZA 3L4UA 2E9WA 2X4OB 1G7PB 1XF4B 5C08E 5SWSB 3DJTA 4XTRC 3BJLA 2PYED 1G1KA 2XWJA 4K3EH 1XMWA 3OLGA 3TWYA 1IKFH 3AXLB 3CPUA 4KVCH 3NIFB 3VB9A 5E8OA 3CN1A 2EXYC 2QQKL 4JFQA 4KUCF 3HG1A 1AP2B 1OAZH 3T1FB 4AQ1A 2P46B 1RUMH 1V3KA 4ENED 4WV1B 5I0VA 4A2FA 1P53A 2HRGA 5IP4A 4GNKB 5J11B 1LEKA 5D7SL 3ZIYA 4RX4D 3BLKA 4QHMB 3QYMA 4C59B 4G9FD 2XVBA 2H26A 4ODBD 4P57B 3OWEA 3PIQB 3VI3B 4J3XA 1T21B 4NKDA 3V55A 1I1AD 1L0XA 1UVQB 3BQUD 3QUGA 2BNRE 4YPGB 1WAAF 4HJIA 2J6EL 5IB1B 4NT6A 1S78C 4JR9H 4FQXA 2COQA 2IO5A 1OGAD 1PD6A 3DETC 3VFWA 4B53A 4X4KA 2R1YA 4XCYA 5CCJA 4DZBA 4UUJA 1HIML 1H8SA 2AQNA 4ENZA 2YA0A 4B9IA 1EJOL 4M00A 2UZYA 1SEQL 4XVUD 5TDPB 3RKDC 3FO9B 1E27B 2WUCH 4P9HC 3CFTA 3RIKA 3TP4A 4YHLL 3T6QC 1Z5HA 1T2XA 2PYFB 3OR7A 4N5ED 1J8SA 1I82A 4X0NA 1N0XH 2VISB 4MYWB 1DVTA 4YVNA 5FM4A 1N6UA 1XCQB 3MUY1 3HB3D 2XV3A 1WSST 4WO4C 4YIQB 4UQ2B 2IDSA 3P9LB 1FJ1A 3HZMA 4Y1AE 5J7CC 3FT1A 5CIPA 4A6YH 4P46C 4BQ6A 2R59A 5TF1L 3FFCE 3GSRB 3PAUA 3NAAH 2B59A 3A4DA 2R1WA 4ZMNA 1HH6A 2J43A 3IMSA 4PRAB 2ZAGA 3KL0A 3EYUL 3RUGE 3AU1A 1OLZA 3PWPD 2OSXA 1IUZA 1T21A 3IBEA 3WFCL 4XRCA 1KY6A 5DS8B 5I74B 1FNAA 1YNKL 3ECUA 5CR1A 4GRWE 3E8VA 1DJHA 4R7XA 4UIMA 4B97A 5AG9A 1A9EB 1J5HA 5KBLA 3DWTA 5JIPA 3FU9A 1OHQA 1X5ZA 4XP4L 5DS8A 2DWSA 4NN6B 4OF7A 3C6SB 4PJ5D 3L5IA 4WFFE 4MJ6A 1SFDA 2CAKA 2BH0A 4TQEH 4G6FB 4A7GA 2BOBA 2J8UE 4U1KA 3FHQA 2VNCA 3G6JB 1BZ9B 1C5CH 1NZRA 2P1YA 4OIIH 3UAEA 4LPUA 3X11B 4ZMPA 1B9KA 4PJBE 3ULAB 2HRLA 4HS6A 1JAEA 4KK8D 4YIQA 4LLUA 3WEMA 1RERA 3DO4A 2OI9C 3A3YB 5F1SA 3NPSB 1E8ZA 2QEJA 4Q6YA 4YSDA 2ADJB 1M2VA 3ESNA 3UJTH 5I1EH 3VFVB 3ZDYF 4MCZB 1HCVA 1S9XB 1BVNT 5GRYA 3KE0A 5EU4A 3NCMA 5JIKA 4JG1L 4F5CE 4BSWA 1FNHA 2F5BL 4PP2A 5I1DB 3BWZA 3BGFC 5DWUH 5C3TA 3OAUL 3UAFA 1FVDA 4HLJA 5DA4A 4NWUH 4U1SA 3EO1A 4M1DH 2GVYA 4TLSA 3S37X 2DYPD 2OSLA 4XPFH 2AZUA 2X12A 4HQQH 2G2RB 5ESQA 2OL3B 1E4HA 5ECGA 4GI8A 4LHUD 1JFQH 4M1CC 1I3GL 3I6KB 3QCVH 1FIGL 4YLQT 5D2LE 1M7UA 3AAZB 3M17A 3QG6A 5EU6E 4OVUA 3ABLB 2ADIA 2EH7L 4FZ8H 4TNVK 3FB8B 1WH0A 2ZTBA 3DPDA 3FBQA 3H55A 4PTTA 5IEKA 1SM3H 1OGAB 3PFQA 1JZ7A 4JFVA 1G9NC 2XWJB 4O2CB 5CGMA 1F11B 4JRYE 3W38A 3GUTA 5LNDA 1DUYB 2VN7A 4NJ9H 1FFOA 3PF2A 3BP5A 3SHSA 3BQUB 3GMPB 2X40A 1AS6A 1P6WA 3CDGA 2GK0A 4L2LA 5CEXA 1L9NA 1T89A 1PU0A 2F9BT 2FX8L 5ANMA 4BQCA 4PHZA 4JZNA 3ILQD 5AOZA 4CNIA 1CLYH 3MROB 4PWJA 1WT5A 3RX7A 2PW1B 3DNKA 1Z5YD 2IH1A 1TU2A 4A2GA 5CN3A 4ZUUA 2UZIL 5FFLA 3MNVB 3P0YL 1MPAH 5A2JH 2CKBB 1JRHI 3O0RH 2IG2H 3GHBH 4FP8L 5GS1C 2H8PA 5DYOA 5IVXB 3RFZA 3ZKSD 4NUQA 3B9AA 5IHZB 4IYKA 5HDBF 3DECA 4F5CA 2OMXA 3COOA 4GW4B 4I0KA 2G5BB 1JXFA 2YPVA 3BIAX 5L2KD 5DJAB 3VGFA 2EZ0C 3TT3L 1MN4A 2B15A 4UZSA 2VJ8A 3VI4A 4FCAA 1F4XL 2K3TA 4ZW3A 3V0GA 4EE2A 2CUHA 1CR9L 4R5VA 2BOCB 3LZQA 2J2ZB 4TQHA 1Q0YL 4GY4A 4MAZA 2F53B 3IPBA 3EOBA 4PJ5A 5HVGB 2AK1L 4GQ9H 4K55A 1RJYB 4Y1AB 1I1CA 1NAML 3KVQA 3PS6A 4HOXA 1S7QA 3O3DB 5FO9B 3GSQA 4G8GE 3MRCB 5F6IC 3UPAA 3ZHDA 1HSBB 2WQVA 1UGKA 2Y1ZA 1G4RA 2VDML 4K3JL 3VI3F 4JLRA 3KNBA 2WLZA 3VFPA 2VLLA 4AYGA 2F5AL 1AXTH 4L3CB 1NCIA 2UVFA 3PJSB 2PW1A 4N90D 2X2JA 5A7EA 1R0AL 4BKLA 4XAWH 2AERT 3L3IA 4LSSL 5I1IL 1T66C 2ZOUA 1WG3A 1N7MH 2B1OA 4MMZC 1TTGA 2IANB 2IDTA 2Z31B 3NCCB 4LCYB 5EU3B 2I5YL 3DVGA 3T0EE 1A22B 2AQSA 3T4AB 1JI1A 4G71B 2OR7A 4KY2A 1MCWM 1PSKL 3WUZA 2OK0H 2XTJC 1V55B 4F80A 3ZDWA 1NC2D 1W72B 3TBCA 3WUWG 4NO3B 4R4FL 3SN6N 3WEAA 1CK0H 4Z7OE 1AS8A 2CO2A 1A3RH 4J3TA 3FO0L 3L4CA 4KRMB 3MV8B 4YAQB 5FLUA 1Z6JT 1KTJA 3TEUA 4JO8A 4M3JA 1AKJB 5GRJL 4XOCA 4F7MA 4QRUA 4DP4X 2D4DA 3FFCB 3PV6B 3DJSA 1U58A 1OGAE 2APSA 2OMBA 3N55A 4KROC 2X9YA 1JD7A 3VMOA 2W0KA 1DO5A 1E6OH 2BSRB 4M5ZL 1ND0A 1JL8A 5KWYC 4KUZH 1D5ZB 1JZ4A 1A1NA 5F6HJ 2OXHA 1MVUA 1R24B 2WB7A 3QWNA 4J27A 4HG4J 1VB9A 2GC7C 4JDEA 4KNSA 5D93C 1XSOA 1TENA 2FX9L 1MQ8A 1ZLVH 4L9LC 1M2OA 4WO4A 2CO4A 1J0YA 1X5MA 3MBEB 4K5OA 4AH2A 4MWFA 3GRWL 4XE5B 2VDNB 1NFDA 1CD1A 1WFNA 2CO6A 2VDNH 1ZLDA 4JQXC 5GHWH 3UO1H 2BVQA 3K74B 1LK3H 4BUQA 2EUZA 1M6UA 2PPDA 4HIIB 4LCCC 5DRWB 4ES8A 4EUPG 1XB3A 5F7UA 1EGJL 1BECA 1BAWA 1G7MA 2H3XC 2AEPH 2PN5A 3EDDA 4QMEA 3TCTA 4J1UA 4ZS7L 4FQCH 1KIPA 2E46A 1YN6B 1TVHB 1NC4B 1DANT 2IPKA 5GGSB 4DKFH 5ICUA 3BISA 5I1HH 3WIFA 1BQ5A 3AQXA 3U36A 4NZ8A 2VM3A 3ZHLA 4JGUA 3BT0A 1KTBA 1RUAH 3WHXB 4RGNC 3CLEH 3TH3T 4X4YA 3QEQA 2P26A 4N1HB 1OSPH 5J9PB 5KVEE 1AXIB 4ZQKA 2IMNA 2YGPA 1X5FA 2YAPA 3QIWB 2J88H 1A7BA 3US1A 4NI6A 3KVDD 4WIQA 3T0DA 5FGBC 1BMGA 2GEEA 2QSTA 2VLJD 1P69B 2VE6A 1OAUH 2B39A 1RURH 2LVEA 5DURB 4RZCB 4W9IC 1KCVL 1ITBB 3L3JA 4WUKH 1WDAA 2IANA 3MRFA 5CU9A 4Y5VB 4XN1A 1MFUA 2VERN 4PG2C 1I8MA 4M4PA 4X0KB 4YBLC 3A6BL 4XMZA 1D5IL 3ECWA 5I1LA 4BWWA 1A21A 1VADA 3AW5A 5C09E 1CFMA 1QPPA 4ONOA 5D9SA 3P9MA 5AB9A 3CDCA 2Y25A 2J25A 2WZ6A 4Z7WF 3DTDA 4HF5L 1S7UB 4B6ZA 1JWMB 2IVFC 5CLXA 3KMDA 4WHYH 3OB0K 4XMWA 1FVEA 2GSMB 3PL6D 5A2CA 1KWGA 5ID0A 2RR3A 4IMKA 1MRFL 1G7LA 3DO3A 1UENA 1YY8B 3H54A 5DJAA 2AEWA 4RRPA 4G8FA 4UILL 5DRZB 2OLDA 2OMVB 3H9HA 4CBPA 3E8UL 2QPFA 2VXTL 4P4KB 4PW3A 1R3HB 3OAZH 3VTMA 2VUYA 4M6OL 1I7RA 4QJ3B 2G9HB 4M02A 4L37A 4AYBA 5T5FL 3ZQXA 5PAZA 1MCIA 4GQZA 4B0MB 3Q9PA 5CMAA 2YZ1A 3QARA 4PTUA 1GS6X 5EO0A 3AABA 2VO8A 2GPZA 4HLZH 4O02H 4TYUA 1N0LA 3KHQA 4ZOAA 2KI6A 1FA4A 4XNUL 5IK3A 4NNXA 5DK2B 5IHUH 4LB8A 3MLPA 3JWDC 1HOCA 1U3HA 5E5MA 1KZYA 4KPHL 3MBED 2Z92A 5EZIH 3C6LC 4TNWK 2APBA 2V8MA 5AOMA 2R2HB 3VXSB 1Z5LB 2CBOA 4H25B 4CN4A 3CZUB 3L9RA 3LKQA 2WLIA 2R39A 4PBVC 4J4PC 4OLXH 2OCFD 4JHAL 5IB4A 4PI0A 2C4FT 1QO3B 3O3DA 2QKIA 3LPGA 5FPIA 4O2FA 4Y2DD 5ITFB 2MCG1 1TFHA 3INUH 1KSRA 1F4WH 3VXTB 2VT0A 3RPIA 3TEWA 3GXUB 3BLPX 1AD0B 3F3HA 3R1GL 3B2UC 5I66A 1RCYA 4QT5B 4WSGA 1S7RB 4KZCA 5T1MB 3U9PH 3GD1C 2HMIC 4AVIA 2VIRA 4M3HA 3NCJL 2VL5B 4L29B 4XE0A 4F15B 1X5IA 5MERA 1XAKA 4H8WL 5DEJA 1JPSH 4MD5A 1SOKA 4IJ3B 5IQOA 4YDLC 1VGEL 1XGPB 5FYLD 4ABVA 2GBAA 1IQDB 5E56A 2RA1A 2Y5EA 2VZOA 2Q3ZA 4GAGL 4IIQA 3UROR 3BD5A 5D70L 1JN6B 3MJ6A 3ZTJG 3SGEH 5E6IC 2GEQA 4PIRF 5IJBC 2RJMA 5JZ7C 2KQMA 5A6MA 3AS1A 3FQ4A 4CSTA 3WIHH 4FXKB 1SN2A 4AUJA 3LN4B 4F57H 1ZMYA 2AJXL 2DY2A 4LBAA 4UIKL 5BQDA 1CDYA 2TSAA 3P54A 4JFHE 4R0LC 4W1TA 4PVBA 1I1RA 1RK0B 2ZKMX 1QTYT 3KWXA 3E38A 5DEGB 5DUBB 5FR3A 2UZXA 3CDGB 1T2QH 1B0RA 3MRDA 1KIQA 4PJEA 4QHLA 1MCWW 3X1GA 1H3VA 5F7EL 2BVYA 3VA2C 2DH3A 5D1ZA 1FL5A 4WW2B 4XNYH 3LD8B 1AZZC 4D94A 4E42B 5IMLA 4Y1AD 5KVEH 2Z8VC 4JFXB 4OZIA 4ZMQA 1G7IA 2Q86A 4Z3GA 2NW2A 4IDLA 1YYMH 3O3BB 3ZZLA 1OF0A 3RDTD 4E42A 5IMLB 1NFIA 4PJFA 2VLRA 3BFWA 4WY7L 1Q8MA 5BOZG 4K3DL 5TDOA 4ETQA 3U0TA 4PJEB 4QHLB 2R4SH 2X89A </