5LNGA

Lectin domain of e. coli f9 pilus adhesin fmlh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
152
Chain Sequence
FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Putative Fml fimbrial adhesin FmlD
total genus 35
structure length 152
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lngA00
5IQMA 5LNEA 4AV5A 4XOCA 5FX3A 3SQBB 2UY7B 1ZE3H 5AALA 3ZL1A 1TR7A 4AUJA 4BUQA 4AUYA 4J3OF 4AV0A 5JQIB 3BWUF 3ME0B 5AAPA 3MCYA 1UWFA 3JWNG 4XODA 2J2ZB 3JWNH 3BFWA 4AVKA 5CGBA 1PDKB 4CSTA 4CA4A 4AV4A 4CSSA 3ZL2A 4AUUA 4ATTA 4AVIA 4LOVA 4AVJA 4X5RA 1QUNB 3BFQG 4XO8A 5FWRA 3ZPDA 5ABZA 4X50A 2WMPB 5LNGA 4XOBA 4J3OG 2VCOA 4XOAA 3RFZA 5IQNA 5F2FA 5AB1A 2XG5B 2JTYA 5FS5A 3JWNE 2JMRA 2XG4B 4XO9A 1KIUB 4AVHA 4X5QA 4X5PA 2UY6B 4XOEA 1KLFB 4J3OH 5IQOA 1N0LB 5FLUA 1N12A 2W07B 5F3FA
chains in the Genus database with same CATH superfamily
3TNMB 1G5AA 1RUKL 1ZE3C 5IOPA 2VDKB 4UCFA 4KITB 1UVQB 4R90L 4FG0A 4NQUA 5E4IA 4MD4B 3QJSB 4F7PA 2WQVA 3V5DA 3VXMD 4UTAL 3KLHC 1KYOJ 2A73A 1K72A 4X0KA 1PCXA 1R3LB 5KW9H 5DS2A 3L5IA 2A6JA 1LQBC 5HHOD 5T1LB 3OXRB 5IHLB 5GGRY 3BKJH 3QIBA 2M2DA 1XIWB 1VFAA 1O7VA 5LG1A 2VR6A 3AQZA 3F7YA 2WKLA 4K5LA 3THML 5I6NA 4ZT1A 2YRBA 2QGDA 1KTLB 1QASA 1MFDH 4DO4A 2IG2L 3EYOB 2ZCHL 4AMKL 3FQRA 4PJIE 1NOAA 4LZKA 4N2OA 2NY2D 2VLKE 3MCYA 3VSUA 1FG2B 4YPGB 3SGDH 1KXQA 3FAWA 3BAYA 3V0IA 3WIFB 4ZX4A 4ZPTB 3VFSA 3ZKMC 4BFOA 3HHSA 2O5XL 4YFLI 4XNMA 3VH8A 3QCTH 2GABA 1ZLEA 2X4SB 1I1AB 1JE6A 5C9JB 5A6IA 5A1AA 1ZDQA 3SCMD 1XH1A 4YSRA 1OTSC 1J8SA 1JZFA 1AGDB 2XA3A 1PS3A 5CF3A 3US0A 5B1JA 5DRWB 3ARGA 4MS8C 5FDYA 2EE3A 1XO8A 3BSZA 3ZE0E 5C9JA 2CDGB 3Q5TA 1ZHNB 1V7MH 3KPLA 2VDRL 2X2HA 5CGTA 3REWA 4ERSH 5L2JA 4AXWB 4PP2A 4WW2C 3AREB 3MBXL 2I5YH 2R69A 2GW5A 4AIOA 2JXMA 2EECA 3R0NA 4X6DB 1KIPB 1AD0B 3LS5H 3OKKA 3VB8A 4UZGA 2I9TB 1SOQA 5E8OB 5B7EA 1T5WB 1P7KB 3BP6B 2UVFA 1D5IL 5J1AB 1J8HE 4ONOA 4HALA 3WV0A 4JZNA 4J2XA 2V37A 4R83A 1I8LC 3VWKB 3OKNB 3A4FA 4QO1B 4LKXA 5AW7B 1RULH 4ZFOB 3Q8FA 2RALA 3I75B 4QWWD 3MA9H 3HBPA 2XZZA 2WQ8A 4LSPH 2ZWSA 3EH3B 2PR9A 2ZYSA 4G80A 4OLWH 5DFAA 4F3FA 3NA4A 4CVWA 3O2DA 1ITBB 1HEHC 3LKNA 4FFYL 3VTAA 3L3JB 1YYLH 3GTVA 4M7JH 1RIUH 4LPWA 3G3LA 2R39A 4F37F 4NQXA 1TLKA 3QFGA 5HGDA 5IHUL 4ZXBA 3HC4H 1QFWM 2AEOA 3K74B 1BZDA 1BEYH 1YMHB 3BVDB 4QRPB 5JO5A 2F54B 2GPZA 5JHLL 3K81A 1UURA 2VZVA 1YEGL 3A6BL 4K0OA 3BPOC 4QRQA 3S36L 1R33A 1F2QA 3BPNC 3SY0B 1KXVA 1RIHL 4X5XA 4AC4A 3K0YA 1M71B 3PQYA 5DVNA 2APWA 5EB9A 4Y9CA 2ZX5A 3D85D 4E68A 4R0LC 3GMMA 2Z91A 2X28A 4FZ8H 3WFEL 1XZWA 5T1KB 4XBEL 3WHXA 3Q44A 3VD5A 1EVUA 2AITA 3ZRCC 3TBYB 4OCMC 1RK0B 1YNTF 3F00A 2ZUQB 1JGDB 1FZMB 3FT3A 4A55A 4LLDA 1RY7B 2W9DH 5KBNC 4ODXA 4HVBA 3RURA 5JXEC 2R8SH 3HG1D 2ICWA 1U6AH 1GZPA 3U4KA 4ZMAT 1OW0A 1UWGH 2IBZY 2OKMA 3B2PA 3MOQA 3OMNB 2XOTA 3OKLA 1CK0L 4HEMA 5FM5O 4AL8L 3DI2B 4JO2L 5CMAB 3NN8A 1FNSL 4R6UA 5DJ0B 3RWHB 4E36A 3OZKA 1CGXA 3HLAB 4L4VA 1J5HA 3QJOA 2DMGA 1FNEB 5I19H 1NKGA 1EZVY 1DUYA 2R7EB 2OTWA 4RVBA 1MDTA 1RLWA 5JYLA 1W72L 2X3CA 2YKKA 3GNML 3MBEA 2AXGA 1T1WA 3BGFB 4Y88A 3FCBA 4HS3A 4J3TA 3QEHA 3IFLH 2GIMA 3EYFA 1DUYB 2R7EA 3C5SB 1NEZG 1AHWC 2VLRE 1JIBA 1NCOA 1NGXA 2XETA 3BGMA 4UAOB 1E28B 4O5LL 1VHPA 4YHLL 5CBEB 2QFPA 1IM3B 3BSGA 2AV7B 3EGXA 3D69A 4FJZA 4KI5E 4JVWA 5I66A 1S7UB 5EEUA 2VDQB 1MLBB 1A6WH 4XI5C 4ETQA 4NN5C 4UWQB 1N6QL 5ALCL 2QGCA 1FAKT 4K3EL 5D5MA 4ZS6C 1OW0C 4DQOL 3WUWA 1IBBA 2OTUB 3QDMD 1F4XH 1U8HA 4J3OH 2UX6A 2R56L 5DQJA 1O5PA 4M61B 5JIKA 1BBDH 1RZJL 4OFYD 4X8GA 1SY6H 2NNRA 4PS7A 4PUBL 1LEKA 1G5GA 5I16A 1W0WB 4HJJH 4PY7A 4EIZC 1WICA 4K2UH 1FJ1A 1SXAA 3UPRB 1DZBA 2CLRB 5EO0B 4AI7A 3VYNA 3EGSA 2AS5M 5T8IA 5EBLA 2VDNL 4NM4L 1HIMH 1MJ8H 1XFPA 1SFHA 2YA0A 4I13B 4JAMB 5DURD 3SGJC 1GPOL 3L3OC 1NAKH 2VQUA 2EIBA 1IEAA 2J5WA 5CFAA 1N5AA 1K5NA 1OOWA 3C08H 3HAEA 3X2QB 3TA3D 1JGEA 1TR7A 2C9RA 2HT2C 3ESMA 4IMLB 2G60L 2WIIA 5DYOB 1R46A 2PPFA 4ODHH 4TSAL 2BLFA 4GBXB 1AGFB 5FKAB 1YEHL 3I02A 3ZRSA 3ZTJH 3QFJD 1CVSC 5F96L 1HZKA 3IFNL 2NLJA 4IRSB 3EOTH 3O6LH 4LQFH 3AQYA 1B0WA 3SQRA 1VSCA 2Y69B 5KYXB 4XOBA 3PWLB 4H88L 1TSRA 3K5SA 5C0CE 2EYRB 2H6PA 3AY4A 5D2NB 1EGJA 3S6CA 1UD5A 1RJZA 3S9DB 5IF0B 3T2PA 4XNUL 3UTSE 5L2KB 4GI8A 2D9QB 2XDHA 5E95B 2WKGA 1UASA 1HWHB 2OYLA 5CILL 2ZKWA 4LL9A 4TSAH 3LH9A 5TGBA 3G08A 3V9CA 1TITA 4KAQH 4K3EH 3J27A 5IW3A 5T5FL 3LMJH 1NCUA 3NSCA 3FQYA 3MRIA 2PYFB 5DT1L 3O4OB 2CUMA 4IBVA 4I48A 4CSZA 4NQDB 4FNLH 2HYMA 4QHMA 4NZRL 2V7HA 5ACZB 1XF2B 3INOA 1R3HB 3G08B 1FFPA 4QRRD 1EXGA 5IKCA 1HH9B 3UGEA 3CN2A 4LMQE 5DZPA 1ASPA 2YLHA 1OK8A 5LBVA 5HHOB 3LPWA 4C4KO 4UU9B 2DYSB 5F7EL 4QHMB 3QK0A 3JUZA 4PGCA 2L7EA 1DQLL 1S7TB 5C3LD 4XMLH 2CHNA 3AADB 5C6WH 1BZQK 1QBML 2LLNA 1PG7H 3NIGB 2HT4C 2CLZA 5E03A 3HR6A 3L3HB 5FV2A 4P2QB 1S7TA 4M7KL 4IKKA 3ARQA 4X9YA 3UTQA 3CFUA 1HZHH 3S5LA 5KS9F 3V4UH 3AVEA 5B3JF 2WQSA 2ZONA 5L4MA 2BY2A 4KGJA 1OSEA 5DMGD 2FX7H 3EJTA 2MCAA 3QIWD 2KDYA 3VMPA 4BQ6A 1OE3A 3VFGL 1L7IL 5EEVA 1YPZE 1FGNH 4O5LH 3FOLB 2A77L 1FNFA 1PNDA 1DQJB 4XMLL 5C0GA 5FDWA 1LMKA 5AG9A 4JHAH 4H5SB 4YL4A 3JTTA 4Z7UE 3DMMC 4HPOL 1T5XA 4GKSB 4LARH 4EZJA 5ABDE 5IHWA 4HMCA 3RA7H 4B5ZA 1I31A 2FJSA 4MRCA 3LN9A 2XVLA 3B9KD 4LHUB 3ECBA 4J3SA 4BK8A 1JGVH 3LKSA 3QDGE 3MREB 3C09B 4JAMA 2COQA 4EQ3A 2N59A 3GBML 1SDAB 1T3FB 2ATAA 1DVZA 3B9KC 1M2VA 4Q4EA 3TNNA 4Y2OA 1SZNA 5KJ7E 3BKMH 2G75B 1HWWA 1XH0A 2EINB 5JMOC 3QPQD 3K0WA 3QXAA 4X6CA 4FNSA 3DMMD 1L4IA 3LN4B 4KNUA 1Q1PA 2AEQH 2LE9A 1NGZA 2AK1L 4I89A 4BFIA 2R0LL 2IWKA 4IDJH 1R75A 1P6AB 1OCOB 1C5CH 3O9WD 4Y16D 4JVPA 5E1AA 2G3XA 3H0TB 2MMXA 2FIRT 2JIXA 3G5XB 1JPFA 3SKMA 5KYWB 1GC1H 2HFGL 4TUKL 4WUUE 1Q0YL 4MAUL 4FLRA 1D5BB 2AK4A 3RNQB 4XN2A 1QBBA 3EIFA 5BCAA 3DV4B 3L45A 1TQBB 1BG1A 2YZ1A 1HJBC 2IALA 4YZWA 1ZLDA 2JKJA 1A4CA 3S3DB 4HX1A 1AFVH 2JV6A 3UJIH 3N41B 3NPSB 3VXQA 4HF5H 4WHYH 3N43B 2DEYX 1EZSA 5DO2D 1KZYA 3BZFB 3X1FA 4CSPA 3VFTA 1C1EL 4LIQH 1BFOB 1XGZA 5IW6B 1R1CA 2GYSA 1IEBB 2KHAA 3RTQD 4BELD 5INDB 3MX0B 2SEBA 3SE9L 1V10A 1H8OA 3TBVB 5EEXA 3ATFA 4OZGF 3QFJE 3L2MA 4OGZA 3NZ8B 1MW2A 3BUQA 3MJ9H 1N7ML 4HLZG 4JR9H 3SQBA 3MRNB 5GIRB 4RFNC 2GUOB 2SEBB 5EPMB 2EKJA 4IBWA 3D85B 1IC4L 4XPHH 5AYUL 5I28A 3L3HA 1KC5L 1CL7I 1V8HA 4YIQB 4PJHF 3W82A 4MNGE 5C0RL 1U3HB 4HPHA 2WTPA 1QG3A 2Q86A 4GINA 4QY8B 5AVXB 5FYLD 5IB4A 5L8JB 2MTAA 5D7LD 4NQEB 3QA3B 4L5FE 3MLVH 2CQVA 2WVSA 4E42B 4QXGH 3WNJA 2PW1B 3AREA 2BS9A 2IWEA 4KHTL 1XIWC 4APQD 2Z65C 4KC3B 1A3ZA 2BNRD 2NY2B 1D9KA 2A83A 1N6UA 2WO3B 3SKUD 1OP9A 2OW6A 4QHUB 2MHAB 3B2UD 1BGXH 3L5JA 2Y3AA 4QXWA 3NEXA 2VO8A 3FHQA 4PJCA 3QR1A 4P3CL 1IZKA 1U8KB 5KYUB 2X6BA 1IKFH 4OZIB 5IBTL 4ADJA 2ZX9A 1NC4A 3FW6A 4WWNA 1IE4A 2A3TA 3BC9A 3LKSB 3KLLA 2B5IC 1D5RA 3WNNA 4AV4A 4RSYA 4E5XA 3QXDA 2AJZB 2XWBB 1BD2B 1XV8A 3AWGA 4K7PH 4G9FA 4M62H 2NX5D 5E8EA 2NZ1A 4ONGL 3RJDA 2FLBT 1PL3A 4KK9D 5H4ZA 1JZ2A 3RIKA 5J1AA 3AB0C 5GZNA 5JO5B 1S5IL 1AQMA 2ZSVA 5ICXB 1K8IA 4FJYA 4PBWD 5A43C 2B77A 3QEQA 2DTMH 3QQDA 1I9IL 2BS8A 3HZMA 3F83A 2MKLC 4XNZB 5B3NA 1EJFA 1H8NA 3OBAA 3IMBA 3TO4A 3QHTC 5CJ8A 4ODBD 5H37A 4Z7NE 2ZF9A 3A23A 1MHHB 4Q2ZA 1KIRB 1E4XL 2XTSA 3GHPA 1J05A 4IRJA 1WISA 2Q5BA 3LXCA 4MHHG 3VI3E 4ZXBB 1AC0A 3WIHL 3WFDH 3UBHA 3G5ZA 2HXAA 1RSYA 3I2CH 3FT3B 5IT2L 4Y4KB 5TE7H 3X12B 5DMIH 1YEJL 4ZPVA 3GS7A 2ZCHH 3IJSB 3TJHC 4HIXH 4Y4FB 3G5ZB 3IU4H 3V7AG 2Y1ZA 4KV5F 1LP9E 1DSWA 3D3VD 4OV5B 1J86A 1VDGA 2QZQA 4I0PD 2AJSL 4P2QD 4JM2A 4GAJL 5E6ZA 3B7TA 3N1PC 5EIQA 2X4RB 5JIHA 1DLHA 2DQDH 3MODH 1VENA 4DFHA 4F8QA 2AQPA 4W9JC 2DBJA 2DLFL 4KI5D 3AZUA 4ONHA 4KU1A 3SQBB 4JANA 2MOQA 1U8NA 3CXHJ 5I6PA 1JPEA 3SJVA 1J5DA 3ABGA 2E56A 1WZ1H 4YL9A 2YAFA 3G5WA 3QFJB 4ESKA 3WIFA 1KTJA 1G4RA 4YC2C 3TEWA 3FN0H 5E5LA 3FRPB 1QEWA 2HFFA 1JZ7A 1ZDSA 5L8KB 2YD3A 3W39A 3ET9F 4P23A 1G9HA 1SJMA 3CFKA 4JPVL 3HHMA 3PJLA 2P52A 2HWZL 2APXA 3G9AB 1FO0H 2OTUA 4Z3FA 2ZKMX 1TZOA 4QYOB 1S7QA 4QXTB 4N8VA 4FS0A 1UOWA 4N26A 4NKDA 1CD1A 3MNMA 2JKRM 3GMQA 1NLBL 3O4LB 1FG2A 4H8VA 4YPGA 1U8OB 1WBXA 3JVGA 2A0LD 1HQRB 3O6KL 1LO0H 3CFCH 4OM1H 3A24A 1DJWA 5IMLA 4D7PA 4LSSH 3WNOA 3CZEA 3F01A 2WB7A 2IG2H 3ZSTA 1HE8A 4UINL 3L9EA 4MJIB 3S4SB 1FYHB 1JNNL 5TF0A 1T0NB 3HI6H 4IJ3C 1JHTB 3QUYA 4TUJA 3MR9B 1B0RA 4NNPH 2VMJA 1YECH 4GBXC 4IBLT 2ID5A 5CZRA 2VL5B 2BZCA 4NJAH 4EBQL 2Y36L 1THCA 5FX3A 4EZKA 2V2TB 3UROR 3NESA 4GRLC 2PWDA 3S5YA 3WN5B 4JDVB 3I85A 4OGAC 2CHWA 5LUMA 2I85A 1U2CA 1QBLH 4GBXA 4J28A 2FE0A 2PP7A 2R2CA 4GRLD 2A9NH 5DJ6A 3H2WA 5EO9A 1LMIA 5FKPA 4LEEA 1LM8V 3UYOD 4DP1X 2MQ0A 4LK4A 1L3NA 1NMBL 1B4JL 4JFUA 1YJDC 3EBHA 3L3OA 1U92A 4HC1H 3NIDF 4OD2B 5F3BA 1CUOA 5AW6B 4IBTA 3TEUA 5D5ME 2NPLX 4Q6IA 4H40A 1ZY9A 2UWEA 5HYQB 3K46A 1T66C 2WTRB 1Q9LB 4U1HB 2C1OB 4ZW6A 3ZX1A 9CGTA 1MREH 2OSXA 4LLVB 4Z7WA 3ARFB 4KQ3L 2YPLE 4OU3A 3QBTB 1WV7T 2HKFL 2OJEA 3OC8A 4O2EA 5EIIG 3WFBL 4ZMLA 2W9EH 5DRZA 1CE6B 1QSEA 1F5WA 1OO2A 2Z35A 3LNFA 5DS1A 4YN3A 3TBYA 2OM5A 2CBPA 1HYRC 2V17H 3BPLC 2TRYA 5EU7E 2Y72A 1TLMA 1IT9H 4ZFGL 5EF0A 4PCKA 4XP6L 4NQCD 1R5IA 2ICWB 5IUCA 3D2UD 4M6ML 1OGAE 1U33A 2PN5A 5A3ID 2WMPA 5CXPA 5I75C 2HJFB 3NN8B 2V2XB 2Y1AA 2ZP8A 4KHXH 7PAZA 5JW5B 3HNTL 4RX4D 1M1XA 1XF4A 2J8OA 3OAWA 1YG9A 1K2DB 3QDGD 5DTFB 5KSUA 4E41B 2LFEA 2UY6A 3AT0A 3NPSC 3HMWL 3ZOAA 5LNDA 3O6FA 3LXAA 1EHXA 3IDMB 4N68A 1KCUH 1MCOH 1U8MB 1M7IA 3VXRB 1S7SB 4FG6D 4C56A 3OXSA 1TQBC 3L6FA 3EUDA 3UG5A 3KVDD 3ATAA 4RFEA 1SYVA 5I1KH 1I7RB 2L0DA 1YYMH 3INUH 5SX4H 1JNJA 5IKCB 4IK6A 1FBIL 3KXFD 4N9GB 4CUCA 4UT9H 5F6IC 3U7YL 3MRBB 3G5YB 4YEEA 2APBA 1KLGA 2VQ1A 3OSVA 3PWJB 3OXSB 4N0FB 5MI0B 4MB3A 3L2NA 4OUUB 4WNQA 3ZSSA 1QFPA 4AGOA 2ZOTA 1EAPA 4JRXA 3RX9A 5I66B 4RH4A 3EH1A 3G6AB 4LVHC 4PJHB 3U36A 3EYVA 4FXKB 1OAZL 4Z3TA 3WSQH 3ZYOA 1WFIA 2VZTA 4W6XB 1EZUA 5GXBB 2K9UA 3O8XC 1GSMA 1TTUA 1BFSA 4G43A 2MH4A 4B7LA 3MRGB 3T1WA 1E67A 3WY2A 2IAMB 3GMLB 3L3KB 5BRZD 4HJ0D 1OOAA 1NH6A 2UUDH 2PUQT 2YAHA 3TH3T 3FOLA 2PLTA 2YBGA 3BFWA 3KS0H 3ELAT 1XHHA 4HG4K 4WJKB 4WU5A 2DOCA 4HEME 5B7FA 2V2TA 1F6AB 2X2IA 4HUXA 4OKDA 2IFFL 2YR3A 1V27A 2VDOB 4UB0L 4KMTL 3BSHA 3APNA 3T9WA 1KCVL 1N5AB 4L2YA 1TMCB 4F7TA 2M26A 5GS0L 5I1CL 3FQUA 2QLYA 3KW7A 2XQYA 1JRHL 1KTDB 1IIKA 3VWKC 3RWDB 2WSDA 1XXDC 4AITA 5CSZB 4RAUA 4XWOC 3FQ1A 3QE5A 1BEXA 4A7UA 4J3UA 3F7RA 5CEZD 2NZIA 3RWFA 5FYLE 3MXVH 3UTSB 1AG6A 4XC3H 3DHMA 1KN2L 1E4WH 2BHUA 2C7FA 2GT9A 2F7IA 4DW2L 1F58L 2F58H 5IVNA 2HVKA 2FRGP 2ARWA 4KJPC 2KZ1B 3SSGA 1VACB 1PEWA 2F8OA 2FO4B 4XNBA 1AG0A 5CP3H 1D7FA 1AGFA 5IBLD 4YK4B 4ABQA 4N1EA 1K4DB 1NBZA 2IIJA 2HVKB 4ZODA 5KVGL 5I2IB 3C75A 4J8RA 4NZJA 4F7MB 2HZHA 1N19A 4KGLA 3UXFA 5I71B 5FF6B 3OJ2C 3UTPD 3SGEH 2KZKA 4M8RA 4TVPH 4HJEA 3BUIA 4NO0B 5JHDD 1RJZB 2BERA 1SVBA 3GIZH 3PYCA 1Y7VA 2BVYA 3H2PA 4Z7WF 2CK0H 1EFXB 2YK1L 2YD5A 5JOPE 1MI5B 3TIDA 1E6JL 2YD9A 4A6YL 2UZXA 4NQEA 2BJMH 2HRHA 5CKGA 3RTQC 3U2SB 1C08A 5CEXA 4AQEA 3VWKD 3MA7A 4WY7L 3RLSA 3GB7A 1R3HA 4EDWH 4OQTA 1TTAA 4PMEA 2R0KH 4ZXBD 1JK9A 3A67H 1FZJB 2XG5A 3N55A 3RGVC 3OR7B 1VEOA 3CZNA 1JK8A 5I1AA 2XY1A 3MNWA 1JJUA 1JV5B 1X6NA 2OJ1A 2EUVA 3PV6B 1MFAH 3Q9PA 5C3TA 1OGAD 3DWTA 3MCLH 2XWTA 3P0YL 1OB1A 2NX5E 2VKWA 1HU8A 4CDHA 2EKSA 5DC9B 3KYKL 4YQXH 4OF6A 1NGPL 4Y2DA 1FVEA 1JUFB 2BSRA 4H25A 3EBGA 1E8ZA 5SX4I 2GBTA 2JLPA 2R8SL 1MIEL 3H3BC 3BZEB 3GMLA 3L3KA 3SKJL 2W9DL 3KGSA 4H4NA 2R0KL 4ZFFB 5AOKA 1M05B 2KT6A 3AXLB 4QTHA 5GJSL 4CC4A 3SIKA 1OCRB 2ZWLT 2C9SA 4UQ3A 4UOW0 4DGYL 2ITCB 3HG1A 4P46C 1ZK9A 3RL1A 4BIKA 5C6TL 4FQCL 5FK9A 3T65B 3QEQD 1FZKA 4AYEC 2WN2A 4R4ND 5EOQL 1A5FH 4UQ9A 3S5LG 4HGMA 3T8VA 1NANH 2E74C 1T0MA 4YAQB 5KVDH 2XTLA 2RB8A 2YEVB 1QFUL 4LKXB 4I88A 4LKCB 1B2WH 4UQ2A 1EAJA 4A38A 2EE2A 2P24A 2AGJL 3LH2H 4DIXA 1MDAA 5TD4A 1F56A 2BFVL 3IS0X 4D9QE 4JDZB 2Y6TE 4UTCA 4KBPA 5EA0H 5A7BA 1H6TA 1A1NA 2N01B 1EVTC 15C8H 3HI1A 3H3PH 4FDWA 4FNPA 4X7SL 5FYJH 5K33A 4GQPH 2OV0A 5T3ZD 3AJ7A 4KY2A 5KYWA 2ZNXA 1CFNA 5T1DL 3FCGA 4CC1A 4GT0A 4L1SA 1XSOA 1ZJAA 4K5MA 5A2AA 4Q6IC 1J9RA 4BH8A 1E8WA 4Y9FA 5ALBH 2EDDA 2R0ZH 1QLRA 5HI4C 3FU7B 3MRMA 3UTZB 2UUDK 1IGML 5E2WL 5EA0L 2X6UA 4KVCL 3AACA 1F3JB 1IGFL 4BH8B 3CSGA 4MMZB 4UM9B 1BWMA 3NJVA 4I3RH 3U9WA 3O0RH 1QFWI 3WEBA 2WGXA 2YAEA 3U7WL 2J73A 3RGVB 2ORBH 3CSTA 3K80A 2AI0H 1FV1B 5EUOB 1T66D 4XMWA 1LJMA 1KDIA 1AHMA 2F5BH 3EOBA 3PABB 4WV1A 3QXWA 4MCNA 2O30A 1IL1B 3W39B 1UFGA 2Q7AA 1ONQB 1JV2B 4DUXA 4NNXB 3TPKA 1IFRA 4FLOA 4XN7A 1E9QB 5K9JL 1O75A 4KXAA 1DZ0A 1WRFA 1XIWA 4C54A 2LVCA 2PP8A 3LCYA 5L7XL 4PJ9A 5D6CA 5L0QB 3BKCL 5BPPA 1AOHA 2BVTA 5LAXA 3SBRA 4KXCA 3PHAA 3QR2A 2Q10A 3FO9A 3BVWA 2VW4A 1SXCA 5DRWA 5FGBC 3CXFA 2NXYC 4XCYB 1ZVYA 1NQBA 4S1DC 1S2EA 4JN2B 3EUUA 1M1SA 3KYAA 1MH5A 2Z4QB 3TTSA 2OPCA 1A6VH 5GRJH 1QNIA 3QORA 1F1AA 3QO1B 4NS0A 5F89B 5JW4Q 3QIUC 1SDYA 2IMMA 1TETH 4FP8H 1HCVA 4U0QB 5ICYB 4X6DA 4PYHA 5F7YC 3BUPA 1U4EA 4JFFD 4A63A 2BO0A 4HS8H 4BBWA 4Z7VA 4WQOA 1HAWA 1MWAB 1YMMD 5EU4A 4KOCA 1AGBB 3IGLA 4WV1C 4D9RE 2G5BA 3JWDH 1YY9D 4W6WB 3Q6GH 5SWZE 4OAWB 5IJDC 1L9MA 4X6FB 5DD5H 5BRZB 4K94L 5CR1A 3L5XL 1KBBA 2E6JA 1CWVA 3B5TA 3NJLA 4QRRA 1KXQE 2HKFH 4FGMA 1DDHA 3AQDA 5CN1A 2F54D 5F7AA 4P9MH 1KBGH 3CNKA 1EXHA 3MV7E 2CRMA 1JNHA 1F11A 1AXSB 4HXAH 1K6QL 4JFPA 3V7MA 4BWTA 3B8YA 1FRGH 2FX8L 2A9ML 4ZBJA 2UZPA 4QHKJ 4GUQA 2ZCZA 2UZIL 4Q2ZB 1JNHB 3O2DL 5E1QA 4LFHG 2CIKB 5D4QA 3RY6A 3UTSD 5SWZB 3WIIH 5LN4A 1QLFB 2VLJD 3KH4A 3MGOB 3BP7B 4XCFH 4NN7B 1P5VA 3T0WA 3VXTA 2X53A 1QNZH 2PETA 4N3TA 5J7CC 1ADQH 1ECZA 4M1DL 5SWZA 4KRMB 2GK0B 3QCVH 3L3GB 1ZSDB 3B2MA 1DJGA 2V2XA 4OZGA 1RUAL 2Z8SA 3ES6B 5DHXB 3SPGA 1RK1B 1M6OA 2OI9C 1RSFA 3ESPA 1ZV9A 4Z3IA 4R2GD 5FWRA 4KDTC 3IDMA 5CCJA 2E9BA 3NSDA 1B4JH 2VSMB 1A14L 4PJXF 4Z1PA 1XH3A 2JJVA 2WAHA 2IFGA 3RUGB 3MV8E 4I1PA 2WGNB 1I7RA 1B9ZA 1Y1UA 2VH5H 4KX9A 1J9QA 5KTEH 3QDME 5DHYB 2ZSWB 1B0GB 5A16A 4G7YH 1NFDB 5DD1H 2GAZB 2AJSH 4AOFA 4OJFH 1BVLA 4ES8A 1LO4H 3FO0L 4PJ5E 5AWNL 4O9HL 5LHDA 1HHGB 3RNKA 1A14H 1M7IB 3BYYA 4G6JH 4UIMA 2WXNA 1QFOA 3QG6B 2YPLA 2NTFA 1YC8A 3L48A 4JBSA 2EDLA 1TVDA 1MEXL 3FO9B 3IKCA 4MWFB 1J9CT 4Z78B 2RQ8A 3MI6A 4HLEA 2W07B 4UQDA 4TNWF 2IWFA 4AEHL 5I75B 5K9OA 4DKTA 2EDBA 1X5MA 4N0CD 1A9EA 3CHPA 3I50H 1JTTA 4L4TA 4LIQE 5D6DA 3KBHE 1AKJD 4NO0D 4RMTA 5JHDB 2VABB 3CFDB 4RFNB 4JGJA 1H3TA 4GP4B 3LRSA 3JXAA 4OIAA 4XXWC 4ZNEE 4J3OG 5DUMH 3QUHA 5E99L 2MPAL 3MOAL 3FXIC 3ML9A 2MJWA 3SPVA 5FM5M 1E40A 3NH7H 4UYPA 2JCCE 3U7YH 4XOEA 4HA1A 5JHMA 2H9GB 3ZZSA 1FBIH 2QPUA 4FRWA 2R59A 2OL3B 1ETZA 3FQWB 4RZCA 4FQXA 4D8PB 2KERA 4PVLA 3A47A 5EBLB 1E8YA 3CZLA 4QIRA 4XCCL 2V5YA 1TJIL 4OIBA 4RGOH 4UQIM 3B9DA 1WE5A 5GS2H 1G7IA 4GKNB 3W3BA 4KXDA 3HZVA 4POYA 3OKNA 4M93C 4D94A 1JTOA 3P4NB 1T83C 2AEIT 1TJMA 1U0QA 4MMXB 1ERNA 3FULA 4U1MB 3MFGB 2AQSA 3EG9B 3S96A 4K7PX 4ZX3A 4P5TB 4JB9L 3JTSA 2HLFD 4NZDA 3GFUA 4IHOA 3QUZD 1BF8A 3HPLA 4HK3J 4LP4A 2PXYC 1T1YA 2WANA 2ZKXA 4JFDA 3ZHNA 3EFFB 4G8IA 4NQXB 2YJQA 4IHBA 3TJPA 1JWUA 1XF3A 3LS4L 1YO4A 2W0PA 3ZU8A 1UCTA 1EHAA 1MJJA 5D7LA 4JUSA 4TVPE 3LKRA 2MCPL 5EDSA 1K4DA 5D1ZA 4UQCA 4LVOC 3TZVD 4MKMA 4Q0XH 3HBQA 3US9A 1AHKA 4H20L 2XA8H 3H0TA 4LL4A 2WZPD 4X5XB 5KZCB 3T2NL 4FMKA 3LTVA 4L48A 5C0BA 5JXAH 2Q2LA 4LOFA 1MFUA 5GGTA 2BRRL 1HHHA 1TF4A 3QDJA 3SKNB 3D25A 1ETA1 2BVOB 2WUBL 3T3PF 4H8WH 2Q8BL 4AQAB 1IKFL 2O5YH 1HX0A 1O9WA 3Q9QA 2L7QA 4ENEC 3EXJA 5E6IC 3BWUF 4M7ZC 1CR9L 3IXTA 5I1EH 4U6YB 4A04A 2GJ6D 1NGQL 2J5LC 3PQYD 2EDXA 4Z0BL 2MNUA 3VCLA 4NI3A 4OFPA 2FQFA 2HUEA 4IRJC 2APFA 4HS8L 4TVUA 5T3XD 1IBZA 4M1CD 2FJFB 4UM8B 4NZTL 1GYCA 2OMZA 2ZWKA 2K3TA 4CJ1A 5KUKA 1Z0MA 4IBYA 1UJ3C 2EDWA 4WO0A 1WZLA 4D0BB 2GI0A 3RWEA 4ZUVA 4ZFZA 2W38A 1IAIL 4HIIB 1NOLA 3M7OA 1RUQH 2ATKA 3HUJF 4RGMB 3T77B 4PJ7A 1BZOA 4R26H 5KSBE 1D5MB 4M43L 5CEYA 3HZKA 2HG0A 2ZG1A 2DPKA 4X6CF 4Q7DA 1KJ2H 5FM8A 4L1LA 3QC6X 5EO1B 1UM6L 2IQ9H 4MA1C 4CNIB 4FQPA 3E6HA 4AIZB 2XY2A 4YHML 5MENB 3GB7B 3QWOB 1HHIA 4DP0X 3K2IA 4F57H 1U3NA 2A9MH 3GPEA 3U4EB 5LVEA 1CGYA 4TQIA 5C92A 1LEIA 9PCYA 1DQJA 5I1AB 2W1NA 5ETUA 1FL5B 1P0SE 4R2GB 1ZS2A 1OAKH 1WAAF 5KSVA 1XGQA 3QARA 1GVIA 3QJXA 5TE4L 1OANA 3LKPA 2B39A 2AABL 1HE7A 4RIRB 2HSIA 2AI0L 1DHKA 2X3BA 4H2CA 1TG8A 5ETUB 4XO8A 5KS9E 4M61A 2W60A 1Q94B 3EJUA 2X4TB 5CJ5A 4KX8A 2F53D 5DMGC 4N90D 4RIRA 5EZIL 5LGKA 5D96C 3TO4C 1ZGLB 4PIBA 3P4NA 4MNHA 5JOEA 3BKYL 4HC1A 2W60B 4TUKH 5F44A 3KNBB 3BDXA 1CD9B 4XXDA 4I85A 2NYZA 2HT4D 1WZMA 2ZOKB 4EXKA 2OMTB 2XI9A 5KSAD 3SY6A 1F3RB 1O7SA 4RLDA 5F1NA 1MHCB 1FH5H 3UTTB 2F6AA 1NIBA 4M6NH 5IQNA 4PJEF 3QEQB 3NRFA 1AFVL 1DLFH 2VWEE 1O5DT 2VISA 1G4MA 1KIUA 1T03H 2FAUA 1E90A 3IDXH 4ZUWA 1LGVA 3RUGF 5E9AA 2BC4A 3WKMH 3OAYH 2DQEL 1HN1A 2RAMA 5TF1H 3TT1L 5I30L 1E3XA 4K9EH 1O6TA 3VMNA 3A3YB 3GRBA 3JWDL 4KKRA 1MF2L 5IQ7H 3WNLA 2D7PA 2FH6A 2R1WB 1YLBB 2FD6L 3ESVF 2ZKHL 2ZUSA 1U9KA 1TKWA 1DQLH 4GG6B 4UOZA 4WY7H 3BESR 1PTZA 4JQIL 2ZWYA 3PS6A 4DFIA 4M3JA 5FR3A 2D0FA 2FX9H 1PG7X 4WTQA 2IALB 5T1LD 1QKZL 1FL3B 4JG1H 2NR6C 1PGRB 3D2TA 2NR6D 3FB7A 3NPZB 1UD6A 2ICWJ 2DWEA 4N2CA 3P9MB 2RTTA 1YUHB 4N8CH 1NUDA 4L8CB 3D85A 4FQLH 3DPBB 5DK0A 4OVUA 1S9YA 3Q5YA 2PWEA 2CA3A 4MXVF 3CTTA 1UKQA 2DWEB 4AT6A 3GSWA 2MTPA 1UD8A 1KWKA 1KCBA 4TLUA 3FFCE 1AQDA 3QUKA 4PI0A 5EORL 2P8LA 4MCYB 3NRQA 4MYWB 1BGXL 5DZAA 4ZAKD 2AQ1A 1I1FB 1EHLH 1JYVA 2X9WA 1DBBL 4HISA 5T3XH 1AP2B 3OPZL 2E9WA 1NUGA 1VESA 1G6RB 4XVJH 2BFGA 3B34A 3C60D 3B1TA 3DOIA 2XZQH 5E2VL 5ILTH 1G9MC 2Y25A 5KVDL 1JG9A 3MXVL 2HN7A 4FTVB 3UJJL 1FZJA 2KZBA 2XG5B 4AKPA 4N87A 2IOOA 3TP4A 4TL4A 1X44A 1KB9K 1X9RA 2GBVA 4HJ0C 1WP6A 2VUYA 2E46A 3K7UA 5CEZL 2V3EA 2VRKA 6PCYA 8CGTA 3EJJX 3KYMA 3GMRB 2CU9A 2X7LA 4JGMA 3UAEA 3VD3A 4MJIA 1HIML 1MJ8L 5BRQA 5IK3B 3LPPA 3WY1A 3FTYA 3UYPA 5KVGH 3O6ML 4H26A 3IFOA 4WWID 3GYRA 1UC6A 4AYMC 2GSIB 2R4SL 5KVEL 4MSWB 3BWAB 3GKWL 1IBDA 2P5WD 4WW2F 3CMOL 2VNCA 3E7JA 4XN5A 4BFNA 2G4GA 2XTJD 3EZ8A 1PZUB 5IR1B 2OMVA 1U21A 3O81A 2E27H 3MLUL 4JKWA 4OJCA 1LE5B 1EBAA 2HLAA 4KZDL 1S7RA 5J1SC 5JORA 5DJ6B 1TCMA 3LN4A 4F5CA 3OB8A 2I60L 1X5YA 1MKFA 2OZ4A 1RZQA 3CN0A 4N28A 4Q74A 4WI4A 3VXMA 1A4BA 3NRPA 3PQYB 4KY1H 3V52H 3TBTA 3DTUB 2FBJL 3LKQB 5J6SA 4AGMA 1WO2A 4PWIA 1TCRB 3DTXA 1R5WA 2APVA 1BD2D 3ECWA 3QC5X 5I71C 1IKNA 2VDLB 4DVRL 2CIKA 4G8GB 3D06A 2IANA 5KVEH 3T6QC 5DJYA 2GIXA 1I7UB 5GHWL 3U25A 4N90E 1RJLB 1WA1X 1H0DB 3OX8A 4WFHE 1I8MB 2DMCA 5CGMA 4RDQG 2XT1B 1FVCB 5FO9A 4A39A 2ZSWA 1MNUH 4PB9H 1RZJH 3SQOL 4FNUA 1HEZA 2R2EB 3LXUX 4IIQA 3LQZB 1T21A 2ZCKH 5EIIB 3QQ3A 3V6OA 1R3LA 2WWOA 1OK0A 2EVJA 3PRZA 4JNXA 1I3RA 2BP5M 2XKSA 2WBJC 1SLVA 2NY4B 4NHCL 1MG2C 4PS4H 2IJ0C 1KJ2A 2CRZA 4Y4HC 1IAIH 3T0EA 5EIIA 4OFVA 4TQPA 1G84A 1KGIA 1ID2A 3VXME 2H3XC 2EADA 3WLWC 4FFVC 2EH7H 3T6XA 1T2QH 5IP4A 4DK6A 3C5ZC 5E6ID 5DRNA 3RDTC 4QR7A 2BY3A 1Y0LA 3LV3A 1XGUA 4ZFOL 1CFQA 2C9VA 4IOSD 2R29A 2A4EA 3QRBA 3FCSB 4U1KB 2CCLA 2FWOA 3NQKA 4XBEH 1JTPA 1RPQA 4ACTA 1PPIA 4TQ8A 4XVUC 4GXVH 4X98B 3TFKC 3VH8B 3W0WA 5JZ7C 2E4TA 2WYZA 4JANB 3L7FB 3BVUA 5B38B 3IRCA 2OXHB 3GMQB 1YEFH 2P9RA 4PW3A 4PGBA 3MC0A 4HJSA 1F42A 4HPYL 4IKIA 4JRXE 4NNXA 3V4VH 2W9EL 4BSVA 4Z7NB 2FX7L 3PNWA 2BRRH 4A2EA 1A6WL 1FF5A 3KR3H 2VGLM 3UFIA 1GJUA 1ND0A 3BP4B 5FOJA 1LWHA 5FHBL 5FLVA 2AMGA 4Z7VB 2VKXA 1MLCB 3V2AR 2PXYD 4DTGH 4NAMA 5ITBH 2BZ7A 3QDGB 2FECL 2YN3A 2CKBH 2Y5QA 3F6JA 4JL1A 3PP4L 5DHDA 3TF4A 4JM0A 1CMOA 3VRLF 1PQZB 2QV2A 4KHXL 2DYRB 1EXUB 4FXKC 4DUWA 4JO4L 1XCTA 4AWJC 1LP9B 5IK3A 2G3MA 1ZLUH 1MF2H 1FIGH 2BSSB 4M7LT 4L23A 1GW6A 3LHPH 4Q52A 1IVTA 3UYRL 3HFFA 4FL4B 4A6YH 4MTMA 3N42B 5CEZE 4HKJA 2DH2A 1DVQA 2CCWA 5F9WB 4HUMB 4MXWL 1AGBA 4WK0B 3GSXA 3WFBH 4ZW5A 2J2ZB 2VAAA 1RVFH 2XJKA 3PAUA 4RBPK 5AAWC 5KAQF 2W80C 1KXHA 1HDMB 5ANHA 1SXNA 3TH4T 3BGAA 4NWTL 4R97C 4PLNC 5CILH 3EOAA 4NENA 3NCCB 3SYCA 4P23C 1RZIB 3VQLA 1TCRA 5FFLA 3CDFA 2NY7L 1BVKB 2W0KA 1FCCA 3SKOA 2F5AL 2R2BB 2ZOUA 3MUGA 5TDNB 4GQQA 2CH8A 5HHPB 2X4QA 5I0ZA 4BEIA 2EABA 3KEHA 3L2LA 4ZW8A 3LB6C 4XCNA 3KLHD 2J21A 3CU1A 1DJHA 2O1AA 5AW8B 3SKOB 2IH8A 4XPAH 2NXYB 1JOIA 4AQ8C 3CHXA 1AHWA 3S2CA 1ZHLB 3HE7B 1D7CA 1JGDA 1FZMA 1M6UA 2BOBA 4GLRI 3O8XA 1OALA 1CGTA 3CDGB 3QDJB 4U7SA 4L3EA 2P26A 4JRLA 4G82A 2F0CA 2FEEI 3QIWB 3VI3F 2VIRA 3QI9C 3WXWL 4ANXA 4C56B 1HXYB 4OLXH 3EYSL 1H15B 3QUXD 3MJ8A 2QLVB 4KO6A 3UC0L 3PPEA 4ONFH 2XLLA 1ZRUA 5GS0H 4QOKE 1M9SA 3W38A 4A37A 5KW9L 4P4KC 2AJYH 4FZEH 3CHQA 4B50A 1CFTA 5C08B 3NIDB 4LAJH 2FJGA 4PRNB 1FYTA 4Z77A 3QG6A 1MRCH 2BIQA 2FNBA 3QDMA 3HI5L 4MNQE 3GBLA 3EYFB 4BM7A 3JV6B 5EBWA 1Q1JH 3QNXA 1WFJA 3IPFA 5GSRA 3L9YA 1GHFH 5JDSA 4TUOB 3OGOE 1YQVL 4QKTA 4QLRA 1MFDL 4GAAA 4IRZL 2H0FA 1BQKA 3HMWH 3OR7A 3R4DA 2PABA 2WQXA 3ZXAC 1HHGA 3GHEH 1HL4A 3HZYB 1HH6A 1GZQB 4HWBA 3L1EA 4LCWE 4NZTH 1J8RA 3WY3A 4KQ4H 4HJUA 1GYAA 4P23D 1MFEL 2NYKA 2WAQA 4XH2B 5JUEL 3TWCH 3FT2A 1TTCA 2Y5TB 4LHUA 4U1LB 5EUKB 5BZWA 1A7PL 1TU2B 2NY0C 3BPOB 2NY5C 4GP8B 4U6XB 4J3OF 1AMYA 1G9NH 4WLCA 1JWMB 4P2RD 1G7MA 3PWUB 3EGXB 1AR1B 3C12A 2PF6A 3KCWA 3F8UB 4KXZI 3TYGH 4R4FH 3U4AA 3BJLA 1QPKA 5D2LA 1LE9A 3KDPB 3BVNA 4JDVA 3CK0L 3MLWL 3IJEB 2VXVH 2J2ZA 2VAAB 2F74A 4I9XA 1EO7A 1OSZA 1SEBB 3TXAA 4EDXA 2C4FU 2WCPA 4WK2B 4UAOC 3DUUA 1EJ8A 4K94H 1HILB 1NCGA 2WQAA 3KM1A 4WWOA 3RWFB 4CKVX 4ZMOA 2G9HA 3RHWK 3QG7H 1OSYA 4BA0A 4KKCD 4OZGE 1D9KC 2XRAL 1BFVH 2AK4B 4PRBA 2R69H 2PCFB 5HHVL 1EPFA 3O2VH 1SN2A 4CDGC 5IV2A 1DBKH 3UPAA 4D9QD 2XN9D 2GEEA 3M1BA 3PDOB 2QADD 1EA9C 1Z5HA 1DQQA 3B2XA 2OSWA 1DUZB 1QVOA 3KWWB 4U3HA 1XD0A 5E0FA 4P5KA 2YQGA 4W9LC 5A6MA 4AYID 2X1PA 3KR3L 1IARB 3IPEA 2X40A 1ZLUK 1A4JB 4NZUL 4C47A 4BWWA 1RHFA 3FB6B 5C0DB 1E5CA 3SDYH 3MV9A 4OM1L 1P4BL 2AAAA 3WJJC 4F80A 4EN3C 2DH3A 1SN0A 3C5ZD 3RDTD 5D7HA 1BBJB 4YDIH 1TZAA 3AS2A 4U6VH 3RZCD 5AFAA 2IH1A 3A4DA 1P7QD 1J7VR 3DETC 1CFSA 4PI2A 2F15A 3CZKA 3GBNL 5CINL 2DV6A 2P5WE 3QQ4B 4M6OL 2R1XA 3VJ6A 4J23A 3ZE2E 3CSPA 2J1YA 2OP4L 3AB0B 5IHZB 4FHBD 4NJAL 2A6IB 4XB7A 1UATA 3SDCC 5KBPA 1IC1A 1MJ7L 2B4CH 2CKBA 1QLEH 3LEXA 4N0FA 1P84K 3UJIL 1T6BX 4QT5A 5BS0E 1S5HB 3BUTA 5K39A 3MNZA 4PCSA 2AXFA 2FL5A 2X0WA 4QRPE 1HH9A 3UBXB 5HVGB 2C3HA 5EIVA 1WD8A 4GXFA 3HI5H 4PJDB 1BQRA 1UGNA 4HKXB 5KG9A 4GI6A 2Z8VC 2G0KA 4ZPTA 2AF2A 2FSDA 3VFSB 5MI0C 5BZDB 3BCFA 4PJCB 3GC3A 2E9JA 4J7RA 1CGVA 1OPOA 5ALBL 2IBGA 4R7XA 4XMXA 1OTTC 4K7FA 5SWZD 4DPBX 1AMXA 2WNKA 2CLZB 4OZIF 5DYFA 2F1EA 3WTWA 3FMGH 2LVEA 4KVPA 4AVJA 1DEEB 1XGRA 3G5VA 2YWZA 2UZYA 4BXVA 2COVD 1LEIB 4ELMB 1KPVA 2FYYB 2J1WA 2V5RA 3ARZA 4XN9A 2E3VA 2NNXA 2X4UA 3ZUNC 1ZMYA 2RH0A 4ZI8A 3IU3B 2J4WH 4Z7OB 3GSUA 4F8OA 2BS71 4XGZB 5KOMC 2BIIA 3O3BA 4M5ZL 3I9GH 1T4KA 3K2UL 2VUKA 5JW4M 3WAJA 2JCCB 3AU1A 4MAUH 3GUTB 5T3ZL 1DCLA 1A1NB 3GRWH 2R0ZL 4KHTH 2I27N 1QBAA 3WIIL 4FXGB 5DR5L 2D7NA 1QSFB 5D7IE 2NY7H 3P1VA 3ABLB 2FATH 1UZ6F 1H0DA 3OX8B 1NEPA 4QCIB 4Y5XA 4EIBA 3X13B 1IGFH 4KJWD 4JKPL 1RZ8B 1PEZA 3APFA 4YBQD 1FAIL 5ESAB 3GI8L 5F9JA 5IQ9A 4AUYA 4Z3GA 4Z7OE 1OWWA 4K7PY 5AKVA 4GKLA 3KPSD 3OAZK 1JFHA 3MNVB 3DVNB 4L3CB 4Z8FL 5DQDL 1SYSA 4QI3A 4OKVB 3FN3A 5DUML 4PV9A 4W9DC 5KYNA 3H9HB 2VN6A 3W5NA 3SCMA 4C83A 1S7WB 3LQAC 5FUCE 3D4CA 1J48A 3IDYC 1BSIA 3S35X 4LDLB 1SLWA 4OLUL 3SE8H 2GTZB 1UKSA 4YSDA 3BJ91 4PV9B 3WXWH 4UTBA 2JIXB 3FSAA 1EX0A 1SLXA 2ZYIA 1BLIA 2LT9A 3DUSA 1ACYH 4NQQA 5H35B 4KY1L 2PXYB 3RNQA 1SM3H 3VGAB 2GJZA 2YUWA 3BH8A 1HC1A 4XVSL 5JHLA 1X7TA 3HC0B 2BSEA 2GC4C 4RA0C 2JELL 5HHNB 2P28B 4LDEB 4MMXC 1WLHA 3GTTA 5F8QC 3DURB 3OGCB 1H19A 1LL1A 4APQA 1JL8A 1YEEL 2BIPA 3EADA 1A1MB 1Q0YH 3VFWB 1CGSL 5E00A 3GIZL 1NCIA 3ARYA 1AD9A 3SGEI 3GS0A 1XMWA 3WL9B 4QF1A 2RFXA 5I17A 1S5HA 5K39B 4ZMZA 1ACXA 3IF1B 3KLDA 4D0DA 5HVHC 1FPTL 3PAZA 1ES0A 2XKNA 4L9LB 4RX4A 4TQEH 5ADPH 1GKEA 4ORGA 5DVMA 3IPBA 3WEOA 5D1QE 3EYOA 2W07A 3D1MC 1F90H 4JG5A 1KG0A 2LHAA 4AT6B 3ALXA 3LZLA 5IWLC 4F15C 1HT6A 2XC8A 2BOCA 3CSYB 3HLKA 4C58B 5D1XA 5J13C 2Z31C 1Z9LA 4XO4A 2CIIB 1J1XL 3ULSA 5JQ6H 2ZTBA 5I6MA 2K9FB 3LRSB 4MJ2A 4R2GC 1OGAA 4HWUA 3WTXA 2AC0A 1KPVB 1KTCA 1AO7D 4WWKB 2XN2A 1CLYL 3KCPA 1G1KA 4F7KA 1F90L 3DX8B 2C5DC 5FA4B 2CM5A 2H6UA 1ODAA 1EHLL 5CD5C 1ANUA 1F11B 1P4LA 2MOGA 3BN9D 3PFUA 1KYOK 5E51A 5GZOC 3LB6D 3MJGX 3FTVA 2ZG2A 1XZ0A 3N42F 3MR9A 4X5PA 5GJSH 3DVGB 3ARBD 5HYSA 1ODUA 5I82A 2YQ3A 4WO4B 1USQA 2D03H 2DN7A 1ZVHA 3OB0H 4S1QL 1CFVL 4UM9D 5EN2B 1MSPA 4PLOB 5K59F 2ODIA 4G9DB 3CFMA 4XVTH 2LLGA 2X4PA 2WTOA 4MNQD 4ODTH 4OJYA 4AENB 1K8DA 1ZPUA 5B1CA 1UJ3B 5ANMB 4L18A 5F96H 1Z5YD 2R56H 3IGFA 2IADB 3SBPA 2J6WA 2A2QT 2Q6WB 1GS6X 2NRDA 1C5DB 4P46A 2XACC 4IRJB 2H32H 4JFPB 5FUOH 4PRPB 4WSKA 4PJIA 4N2BA 5DJYB 4QJ4B 1K8DB 2K1MA 5J3HD 3X14A 4EDWL 3OHXC 1FP5A 3DBXB 4QRSA 1NAMH 5DZVA 4CN1A 1ED3B 4LCWD 4XN1A 4KDTA 4QXVA 1YJDL 2BZDA 2WW8A 3VXMB 5L4JA 3VG0L 4LARL 3V0GA 3GMNA 3RDJA 1RZKH 5D2NA 4ZX5A 3SDXB 3V4VA 4ZZFA 3B43A 5TH2A 3T8XA 5KSBA 4LNVA 5EUOE 1SY6L 5BOZG 5L2KA 3PV7A 1I3VA 3BN3B 3TEXA 1FFTB 1WZAA 1U8PB 4UZUA 1KGWA 1FE8L 1YEIL 5IQMA 2DM7A 3FU5A 3MRCB 4UT7L 4W68A 2BHFA 3EOBB 1OT2A 2A38A 1DL7L 4FLSA 1YN6A 2R0WH 4U1GC 4YFEA 1I3RB 3PAYA 3KPSE 4R3SA 2WCSA 4F5CE 4J6RH 5I17B 4MX7B 2EH7L 5KZCD 3RE0A 2VN5A 5D6CB 2XQYG 4BSVB 1DN0A 3MBWB 3IDIB 2E7HA 3WKML 4M4PA 4EO5A 3TZVB 2XPZA 4HUVB 2WVUA 4PGZA 5C0BE 4UT7H 2DJUA 3EBIA 3MRBA 3QI9B 3TFBA 3VFGH 2CJUL 3L4VA 5H4YA 1MCQA 1KENL 2ARJB 3G04A 3DC0A 5DZLA 2Q3AA 3GI8H 1SJEA 2Q2EB 3FFDA 3NOIA 1ZTMA 1EEUA 3QCUH 2FGZA 5DJ2A 5ICYA 4PN6A 3UBXI 2RGSA 4G72B 1MCOL 4WI3A 3GGWB 1A6AB 4Y5XC 3OWEA 4TOYH 3Q01A 3ZRFC 1N67A 2QQKH 5KBLA 3NIFF 3V5HA 1JNLH 3EDKA 4OGAD 1NMBH 1A7NH 3ZVVA 4OCLC 1UM6H 1B90A 4U1LA 4ETQB 4AUJA 3LJ3A 4KROB 3APCA 5JPNC 5EEYA 5D55A 3W57A 1I8UA 4GBXD 1OTSD 4QOKB 2BJML 4ELKB 3IMUA 2YGQA 1G0XA 3IGUA 1QFUH 3D07A 1ETZB 1QLEL 2ERJB 2PWHA 3FQWA 4Y2DD 5DEJA 2F53E 2OFQA 3VRJB 4GSUA 5D1QD 2NYYD 5F1SA 1BOYA 3DGDA 3UZQA 3QPXL 5I6OA 2ZOLA 3GLAA 3GLEA 4IIZA 1T1ZA 4MAZA 4M7LL 5D4IA 4ZMWA 5C0JB 4ANWA 2OYMA 2P3YA 4ELKA 2OL3H 2AMUA 1H6UA 3BP5B 2D7MA 3BAIA 3MAWA 4EXPX 1GY1A 2FLMA 1J88A 5E6RB 3ETBJ 4JPSA 4M6MH 4Q9BA 1T7ZA 2W88A 1A3LL 5DWUH 1J8HD 3WNMA 4PG2A 3ARFA 1KBKA 1TJGL 4FTDA 2XTJC 5B1AB 3ROLB 4N1CA 4P0DA 4XCNB 3B2VH 2F1BA 4JFYB 4MJ6B 4KMTH 2QSQA 2HX9A 4X7CC 4I0PA 2IFFH 4N5EC 1MXGA 4QRTA 2XV6B 2GCYA 1ACZA 1BA9A 4V2BA 1R5IB 4DJMA 1AGCB 1HSBA 1MCPL 2BX5A 4OZFA 2LLLA 3DV4A 2XJLA 1KGXA 3QIWA 4Q6YA 2AAVA 2UWEB 5DUJA 4ZMTA 1XH3B 4HQQH 4HS6A 3TESA 4ZO7A 4XVSH 2EACA 5E23A 4B97A 2H41A 3MHZA 4QRPD 5K59E 1DE4B 2OX5A 4ERSL 3NJJA 4HBCL 1HQ4B 3GBNH 3TN0B 1IM9B 2VM3A 1P7BA 4MHHI 5CMAA 4KK5D 2WLYA 1BPLB 2EEFA 2BMKA 4HGWB 3QZPA 2R1YA 5LG6A 5TF1L 3TT1H 1EEYB 3P69A 1QTYT 4R3SB 1DVYA 1GYVA 5DZ9A 5D1XC 4A7TA 1TMQA 3RWIA 3VA2C 5JDJA 2LAGB 4NCC2 4R7LA 3ZL1A 2K70A 3C5ZB 3RDTB 3QWOA 5J5EA 1OAQH 4RISL 3U0WH 2CJTA 2MKWA 1NCNA 2VDRB 1NCAL 2CHZA 4XMKL 4PJAE 2O6EA 5I19L 3U2SA 3BHBB 4X4XA 1YYML 5E9DD 1X9LA 4HJGA 3UBFA 5K9QI 1XGRB 3GXNA 1WCBA 1IAOA 4OLWL 4XO5A 1MCIA 4PD4K 3N1FC 1PYWB 3IEAA 5LGJB 3GSVB 4F1SA 3RWCA 5LNEA 2FCBA 3ZDZF 3BKYH 1ZE3H 4YGVA 1Q94A 2ADGA 2K7QA 2HTLD 4L37B 3LOWA 3QJTB 4MBOA 2CO3A 4F2MA 3TVMA 3LNEA 1QNZL 4JB9H 2A4ZA 2Q3XA 5T5FA 4R96A 2WOBA 4LU5L 5CKAA 3T71A 1WIPA 1TNMA 3F7PC 2ALWA 3DDGA 5A6LA 1JI2A 3GXUB 3MREA 4LASH 3NUKA 3E9TA 5HXMA 5D8JH 2X42A 2XG4B 2Z34A 2WXPA 1NCTA 3BFOA 5E94A 4NQSA 2X1XR 4XRCA 2ADJA 3RRQA 4N0UE 3NYKA 3K4ZA 3ZTCC 3BUBA 3QW9A 2VE6B 4LCCC 1T5XB 2J6EL 4O2CA 1W6WA 4G1MB 5F8RC 4X6CB 1XDTT 2P5EB 2JLLA 2XCMC 3QIUA 5HJGA 4DKEH 5A40E 4NN7C 1RZGA 1NFDF 1CF1A 4A6YB 2DWTA 5D2NC 5FXCH 4KRLB 3F7LA 2WUCH 5C8JB 1D7BA 5FHAL 3QCTL 5C09B 5BS0A 4YZFF 3CAFA 3ULUD 1O6SB 2E75C 4BK5A 1OSZB 1I7ZB 2APTA 3FCTB 4ATWA 1SQ2N 3PDOA 2CR6A 3HN8A 1OT1A 2ITDA 3ZMNA 4LPTA 3UTZA 3FQUB 2J4WL 4XBGB 1HILA 3D2UA 2F61A 2GG1A 1RIHH 2OJZH 1XB8A 2YPKB 2EYRA 1VEPA 2H6PB 4PRPD 4H13C 4G8GA 1PMYA 1JZ5A 5FOBB 2DI9A 3ULUL 1NBZB 3HB3C 4OY9A 2JQAA 1EFQA 2Z64C 2WP3T 2X12A 4LSDA 1OAKL 4GT7A 2BSCA 1OAZH 5HHNA 1BVOA 1PZDA 2XA8L 2ERJC 1Q90A 1XCWA 2EDJA 3S7GA 4WV1B 4WFHD 2ZUYA 2FVNA 4IIQB 4PRIE 5DDHB 1PZ3A 5IG7B 3CIAA 4KUCD 1DUZA 1A1MA 1JDCA 2QJDA 3VFWA 1QWHA 4G7YL 3TN0A 4BRVA 2JKXA 5J12C 4G9FE 5EF2A 2BXZA 2UWEE 4ZUSB 1GTFA 1S9YB 5ESVA 1HZLA 4MAYA 1ETB1 2Q8BH 3MA9L 2ZX6A 3MRNA 5FO7B 2G4EA 2H47C 5DO2C 5BJTB 3DJTA 1RZKC 3TEYA 2D7OA 5LAXB 1MCBA 1QAWA 5IFAH 2WXGA 2B9AA 2IO5A 3LN5A 2KLRA 4QHKI 4NZ8A 1MCHA 2EDTA 4M5SA 4CBZA 3O4OC 1IEBA 4Q6KA 3S3BB 1MHEA 3GJFH 5LXGH 3P3RA 1KTRL 5CIPB 2I5YL 2XTJE 1N9PA 5L0QC 3QVAA 4DP2X 2AVGA 3U9PH 5DA4A 3E6HB 1BJ8A 4GXUM 2KS0A 4PJGF 3I6KA 5F1OB 1Q1JL 2HN7B 4FTVA 3O9WC 2VOTA 4I5BA 2NY3D 3O4LE 4V11A 3DX9A 1I1YB 4ILDA 5DC0A 2V6HA 1GZHC 4QHUA 2YQ2A 1HHKB 4MNGA 4P57B 5BQ7B 2MCG1 2EXTA 1JNLL 5DRXB 4IRJD 4JR9L 4HMEA 5A3IC 5DMKB 1AVAA 1KOAA 5C0AA 3ALPA 3M17A 4HZAA 4WENB 4ZQKA 5C70A 3DO7B 1O6VA 4M29A 4X5WB 4E42A 1BG9A 1PJ9A 4J27A 3CVBA 4XCCH 3MLZL 5PCYA 3IU3A 1JDAA 1NCJA 4M9OA 4UBDD 4YDNA 1PLGH 3CX5K 1B88A 4MCZB 1QR1B 3PF2A 2R9HD 4HH9A 2VZ1A 2VO5A 1Y18A 3HAEG 1AKJA 2YEZA 4PG2C 4CVXA 4PGJA 1JUFA 4JY6A 4HF5L 1I9JL 2L4OA 2D7TH 1ROCA 3EO0B 4HKBA 2YPVA 1T0MB 4YAQA 1AY1H 1H8SA 1OF2B 2B59A 3WIHH 2XBZA 1EGJL 1JP5A 1T3FA 1A2YB 3WJMB 4QTHB 3MPCA 3GI9L 4H8HA 3L1FA 1XD1A 4F7EA 2AJVL 3F3HA 3MLSH 1TETL 4GW4B 5HHQB 4FYSA 2VDPB 4YVUA 3FTXA 3QIWC 4R90H 4AEEA 1WITA 1FORH 5FKPB 5LBGA 3M8OL 1L0QA 2IV9A 5E8PA 1R17A 5D2LE 4HKZB 4UNUA 3GMMB 4OZ4B 1U92B 2FEDD 1D2PA 1JPFB 4BINA 3VD4A 1E5BA 3QXVA 4NN5B 1QO3A 4OUOA 4A68A 3VNZA 1U3HD 4FQXC 3NDZE 4U3SA 4X80L 4DESA 3NH7L 1D9KD 4P9ML 1Z0NA 1G9NL 1I1RA 3UDWC 3QRLA 2H7WA 5C0FB 3V4UL 3P4LA 5DFTA 1Q9KA 4G8EB 4TV3A 3C9NB 1WHOA 1H3PH 4BDVB 1E4JA 1NFDA 1OD7A 5KTEL 2E6PA 1UWFA 3UC0H 5I23A 2ZNWA 3PUCA 4DP6X 2Z7UA 5AD0B 5I1JH 2A0LC 3EO1A 2F9BT 4EN2A 1XGYH 3C60B 2H32B 2CDEB 4MX7A 2Y6SC 2FBJH 3N9GH 4UMGA 1EBPA 5F2FA 2WZPA 3RQ3A 4KPHH 4P2RB 4UNVA 3ULUE 2EE6A 1ZA6A 2HRPH 1KJ3H 1TYJA 4RGMC 1YDPA 2DD8H 2H6OA 4M1DH 4Y5YB 5GRJL 5HJ3B 3WN5C 4YSAA 5DD0L 3MRCA 4O9HH 4Z7UA 3IDNA 1USZA 3GSWB 4XX5A 4YFLF 4FN0A 4WEBL 4PLJD 4WCYH 1L9SA 4HEPA 1PNCA 3QDAA 1YPZA 4HH8A 1OIOA 3SJVE 1WBYB 2JJUA 5HI3D 5BO1L 1RK7A 3IDNB 4O02B 1ND0B 1B6UA 3FU6A 4NKOA 4FTVE 5HDLA 1H5BB 4JGUA 4EUPB 1BOGA 4P2RE 2XNAB 4IEFA 2WBXA 3ZDZE 4HUVA 1RUPH 5C0CB 5CLWA 1D5XA 2B8OT 3HE6B 4TSCL 4JEGB 2FT8A 4U1JA 4U4BA 5GRVL 5IVXB 2GHWB 3EYUH 3CCHA 3M88A 4OT1L 3I2CL 4MXWH 4ORGB 2Q8AL 4BGLA 2Z4TA 4PY7B 1YN7A 3GS4A 3HHSB 3MOBL 4P4RB 3V6OE 1VIWA 3J8F7 2Y2YA 2YGNA 2IEPA 3TJEH 1YHPA 1R47A 4JFFB 2A1WH 1JMZA 1JHKL 3VD9A 3TBWA 2NOYA 3IDJB 3MLRH 4FNTA 2VLJA 4P5TA 2R15A 5AL0A 3MXWH 1TQSA 2ATPB 3WUWG 4YK4C 2JI3A 1K5NB 4KJQD 4XNAA 1UD2A 4WU5B 1JRHH 2ZICA 1IBGH 5GRXG 1YCSA 5F6IB 1A7RL 3M07A 4IBUA 3MRJB 2QPEB 2F18A 2WIIB 4AXWA 4NXSA 1P4UA 2LU4A 4OD3H 4PREA 4PGEA 4WI7A 2EDKA 3SE9H 4JFWA 3QCUL 1TJHH 3MRFB 5E2TL 2AEQL 5CWSA 4MA1B 1AC6A 3MUHL 5KOVC 2DQFB 1WWBX 1XGTA 3IFNH 4KAQL 3IXAB 4CVZA 1HNGA 4HXBL 1NCDH 3OWRA 4S1SH 1HHHB 2FT6A 4UAHA 1R5VA 3UCQA 3PJNA 4GQ9H 1KSRA 3D87B 1EK3A 5AW4B 3LHPL 4G9DA 5EU6E 3IMTA 3DX0A 4Q9RH 3ZZQA 2X6MA 4U2ZA 5F3HA 1UUSA 3OPZH 3I02B 3LD8B 4AJVA 1OHZA 3L3DB 1KTKE 2IADA 4YFDB 3OAZH 4AGQA 3PNRB 3H8NA 2FD6H 1NCHA 4G8EA 3VFPB 1J5CA 1QFWH 4DVBB 4JMXA 3NIGF 4ZPVB 4JFYA 3HTLX 2Y1YA 2XXCB 5DUPL 3PWLA 3MRDB 4NFBA 2FJHB 2XWZA 3D48R 4EIGB 3TGXA 5ACZA 4NNYB 3BZ5A 1A6VL 1VLXA 1NMAH 3OKDA 2WO2B 4JFZL 4PJEA 4TLTA 4WAFA 3I6SA 2DQCL 4Y16A 4G7SB 4A1RA 5EOTB 4XOCA 4KZEH 1KT2A 4MD0B 5E9DE 1BZ9A 4E9VA 5FUOL 1GJIA 4ZNCD 4PJ9D 3O8XB 4RFEB 3SDAD 5F97E 5DFVC 3W0WE 5FUCC 5FW8A 1S4IA 2VAJA 4PJDF 3QRGH 4Y2LA 4AL8H 4LSRL 5IMKB 2Y1VA 3G6DH 4MVBD 2BMKB 1S9WA 1A0QL 3V0WH 4YHKL 3CVDA 3AUWB 3DXAE 1GZPB 4JRXB 5IIEB 2F5BL 3ARGD 3VRLE 4WKZB 3UOAB 2B1AH 2X0UA 3P0GB 4J5VA 2VW7A 3Q2VA 3RTQA 4JRYD 4PRHB 2CSPA 1HYSD 5EZIH 1QOKA 1E4WL 1KN2H 2WPGA 3STLA 4DO5A 3WENA 1N18A 1L9RA 1EDQA 4IJ3B 1TIUA 1Q0EA 2OTWB 5BZWB 3SKJH 4Y19E 1JN6B 3MV9E 4NZRH 4M93B 1IGMH 4LFHD 5HVWA 1QHOA 4HS3B 4CGTA 4HUWB 3ZDZB 4WFGE 3I74A 4NCC1 4NIKB 2YBRA 3P3YA 4FQXD 2E47A 4N2LA 2IGTA 3CZFB 2WZAA 5B38G 5IEHA 3QJRB 2O5ZL 3ERXA 1GS7A 3NSJA 4LBEA 1T0NA 5IZ7A 3WLWD 3WE6B 2QL1A 1PY0A 2WKOF 1S7UA 1PG7L 2FT7A 3HEIB 2A9BA 1IILE 2F7RA 3BPLB 4LLAA 4BZ2A 2BSED 1UB6A 2NY5H 4GAGH 4PGDA 3GGWA 4FI6A 1AS6A 5FCUL 2YWYA 4ELMF 4C56D 3COOA 3CBRA 4MZ3A 2AGJH 3LH2L 5EULV 3LD8C 4K9EL 5JA9A 3NTCH 1CS6A 5C86A 4LPXA 2XZAL 3QDJD 2H8PA 3JV4A 4ZTOH 3QUMH 2VMDA 3QB7C 2ZAGA 4NENB 4MS8D 3L9RB 4JPKL 4OZHB 3IXAA 4XODA 1PD6A 2YOAA 2ZUVA 4I0CC 3HZVB 2E76C 1NUFA 2D03L 4S1QH 2AJXH 5D2NE 3UEZA 1FL6B 4PJBB 5C6TH 5F0JB 4HPOH 3P0VH 4G9FD 4XB8A 1URIA 2WTRA 1S9VA 4BH7B 2W9LA 3I3DA 3U2IA 5ACLA 1ZAGA 4RWHA 2VISB 5HHME 1OQXA 4FQJL 3ZTEA 4Y4FC 3F7VB 5F7LB 1ORQB 1INDL 3TV3H 4AQ8A 2CK0L 4JM4L 5EOCH 3D09A 2HJKA 3NCYP 2XQBL 2ZYHA 1CFBA 1KCKA 4R26L 5TGBB 2WNXA 3T2NH 3RBSA 4NUJA 3QZOA 5GJTH 5EOTA 3TBVA 1B0IA 3IDGB 1Y6MR 2VMCA 4UT9A 3K71B 2VLKA 1S3RA 1HXYA 4IMKC 1EFXA 3SDXE 1F1GA 4P9HC 3VE0A 4DEUA 4BZ1A 2MSPA 3F5WA 4K8RL 3RU8L 4NO3A 5CIPA 1WYJA 1QWUA 1TTGA 4BK5C 1A02N 3I9AA 4GLRH 4MJJA 2GY7B 4LCIL 2W5PA 1AQHA 4LRNH 5IB4B 4PRAB 4MXQD 4JHZA 4HK0A 4F9LC 4FG4A 4ZMYA 4GMTL 4I8DA 4CNIA 1DFBH 2YUZA 2YFNA 4ZTPH 1W9XA 1V3LA 2OBGA 3S5LB 4YE4H 4EI5A 1PAMA 2EAEA 1UXWB 4K15A 5LGJA 2JELH 1KXTA 2O4EA 1B4LA 3MA7B 1DVXA 1DJXA 4PRHE 4UV4H 3AS0A 4FCHA 3VXOB 5CEYB 5ICZA 4F2FA 2Q76A 4HAFA 1CYGA 4UANA 2XXFA 4X4XB 4AIXA 2WOYA 5DMYA 1U2YA 1ZT1A 4KZ0A 4FMVA 4GP5B 4HYTB 5JIPA 5T3ZH 5IOKA 4PLKC 1HKLL 1T4WA 1SBSL 1TOXA 4K55A 3KPQA 4XAWH 5B8CA 4B96A 2JMRA 3BE1H 2R29L 3EJZC 4XHQA 4WWKC 4GMSL 1PD1A 2XN0A 3ECBB 3O3EB 4P3WA 2C26A 5FV1L 5J8OA 4ALAL 3TA3A 1EUTA 3ULUC 4HHAB 5GRWA 2E7BA 4DAGL 4G1MA 2K6YA 4WFFE 4HW6A 2IGFL 3GM0A 3Q5OA 2WXRA 4CW1A 4F15B 1DSFL 3LIZH 2QHRH 4JO3L 4B0MB 1HK6A 1WFOA 1T5KA 3GD1C 4WTWA 2BRQA 2JCWA 2NUTB 1ESOA 3BWAA 4G6FD 3QH3A 5EWIH 4NXKA 4O02L 4ZZKA 3TCTA 1JRHI 2FEJA 1PKQA 4B9FA 3S8FB 1Z6JT 5IR1A 1LE5A 3ESUF 2F7OA 4GW4A 1V5JA 3GSNL 4PJ8D 4R9HA 5IV2B 2V8LA 4JJOA 4K07A 4UT9L 2QKSA 4YDIL 4WKXA 3DIDA 2GJ6A 3HRZB 1D5BA 1DJYA 2EC9U 5E8PB 5J6GB 2J57A 4PRIB 3X13A 5KUMA 2JVUA 3D0AA 2HMIC 2V17L 2ZCLL 1R5WB 3ZGHA 4KJWC 4P5MB 4IBZA 3V8CA 5H37G 4WEBH 1M7DB 1N2RA 3AT8A 1IC7L 2X88A 1OKEA 3P4MB 4WU7B 4Z7OF 4LBAA 2E4FA 1IAKB 1NCCL 1JYNA 4MBRA 5C0FA 2B20A 3RPIB 4Y8AA 1TJIH 2D73A 3EJCA 2W95A 2H3KA 3EFOA 3V6FB 4Q56A 4KK6C 4TSBH 3TOPA 1MVFA 2AQNA 1AD9B 4Z18A 4PW9A 1NEZB 3EJRA 3FUJA 3NP3A 3ZBMA 1KWGA 3VXQB 1LEGB 3DNKA 5D7JD 3WEXA 1YY8B 1E50A 5BMFL 4MXQC 2BINA 1Q8MA 1T80A 1YEJH 4HWZB 1A22B 2VMFA 4JRWA 4TYUA 1H6FA 2R2HB 3ZQXA 1KG0B 3ZZ1A 3DHJA 4KNTA 4YUEH 3PABA 1RU9H 3FQ4A 3NCBB 3ECUA 1NIDA 1WT5C 2OP4H 4WI0A 1I8KA 1I1YA 5FYJU 2DTSA 2EYTA 4OZFG 1YECL 3RX7A 4NERA 1ADQL 5DK0B 3JYCA 1F8TL 1WAAE 1KB5L 1Z9NA 4G70B 4FG6C 3ULVH 4X5RA 1DP0A 1BFVL 3F6LA 4G3YL 4OZIE 5K9OB 2C4FT 3DMMB 4KH2A 2ICES 3UZEA 1CYXA 4TVSa 4YDZA 5HDWA 2VC2H 2XXGA 1IT9L 3EF4A 4ZFGH 3TBWB 5BRPA 2UXTA 4WUUD 1ZVNA 2WXHA 4QMEA 2VABA 3CFDA 3VTTA 4DO6A 3EJSA 3PXJA 1A6TA 3H56A 2W81C 3CFQA 3CJJA 4X6CE 3I6KB 5GQBA 4YX2H 3TCXA 2FX8H 2NT1A 1DQMH 5KSBF 4JFXA 2AQTA 3SHSA 4ZOAA 3D12B 4XR8C 4H26B 5CU5A 3ULVD 4LL1A 3D5OF 4HZ1A 3ARGB 1A66A 3G6JF 3MRQA 4QHLB 3HIZA 4M7JL 2ARJQ 3A22A 1HXMB 5D7KE 5EF1A 5CWSB 1FQ9C 3HE7D 2YD0A 1THAA 1RH8A 1TQCB 5IBTH 5GZNC 3DJ9A 3ZE2F 4Z76B 3LVEA 1WVZA 3DX1A 3ZL4L 4POUB 5DJXB 5FA4A 2A9CA 3BIKB 5GGSY 2XRAH 4ENED 1KIPA 2NYYC 3NCJH 2WLHA 3OKKB 4PTTA 4OJEH 4Z3JA 5BRZA 2P80D 1A7BA 1G7PB 4PV1C 1T2JA 1AKJB 3BP7A 5AB0A 1BZEA 4MJHA 4LLVA 2YUVA 3AGWA 4EVNA 4EKJA 5IB3A 1CBVH 1XT5A 1AANA 4OD1H 3T3PE 4Z0XB 3HAEB 1PKOA 4JRYE 4RAVA 1IMHC 2CGRH 5EN2A 3X1BA 1G7JA 1U36A 2RJMA 2JTYA 4P48A 1U91B 1BVNT 2Y7QA 3CFTA 3ZK0A 3T0ED 2X10A 4WSJA 2DQJH 1RJLA 2FHBA 1I8MA 3B9KB 2R4RL 3EO9L 5CCKH 4NKIL 1EJOH 2KC0A 3MCKA 2DM4A 3QZLA 1FH2A 2IQAA 4J4PA 1UB5B 3NACH 2VLRB 4WFGD 3TYFB 2PO6B 5CP3A 2C8NA 3TBTB 5IT2H 1Q9OB 4XNXL 1WBZB 5GGQL 3SYQA 3B83A 3QQNA 4ZNEA 3RP1A 1HEJC 4PV8B 3EFDH 3CVIH 3D25B 4HK3N 3M45A 5G2NA 1IO4C 1UB5A 1FGVL 1NAMB 4JM2B 3BZ4B 3ZKND 3BSZH 2GK0A 2Q9OA 2GSMB 3GXDA 3EYSH 2XTJB 3IU4L 1GJWA 4U6YA 4WHDA 1Q9OA 4EUPH 1FSKB 2EEXA 4LSVH 3GHEL 1ZVSA 4ZAKA 3MRIB 2DQTL 1JFQL 4Y1AD 4HUCA 2VLME 1T21B 2NDFA 3ZKMD 3ASNB 2FWOB 4GO6B 1H6EA 2YSSB 3QWRA 2AHIA 4ICXA 4TS6A 1ZVSB 2JQZA 4JG9A 3C5SA 1IGYA 4M3KB 5HVFB 4Q97A 3QYMA 4K7PL 1YUKB 2FECI 2PCPB 3SDAC 5H2BA 3C6LA 5B4MC 3HN5A 1HNFA 5HDOA 2PYED 2WVTA 5T5FH 2CMRL 4JFDD 2PWFA 1UEYA 1P2CB 5C0CA 1F00I 1CFQB 1KLGB 1CL7L 3QNZA 3N1QC 1KBWA 2FQGA 4OFKA 4X7SH 4JRXD 4JN1L 1MIEH 1JPTH 2KDGA 3PGDA 4URTB 4FERA 3L4UA 4MB1A 1T04B 4Q89A 4BSWA 3N43F 3QNZB 1CI5A 5FHBH 2CM6A 3GSNA 1VERA 1U8QB 3FQNB 3RVTD 1SVZA 4XHJC 2XNAA 3WFDL 4FQ1H 3GXIA 1KEGH 2HLEB 5C0AE 1TQWA 3HC3H 2NY0B 3U9UA 2J8UB 3CX2A 4NHUB 4YXKH 2I32A 4G71B 4QTIH 4ODSH 2X9XA 5E4OA 1MZYA 3FQXB 4P5RA 4JO4H 4NX0A 3BGFC 1ZXQA 3GF8A 3BIKA 4FQ2H 4BZ1L 1F13A 1UB6B 3BLPX 4FFZA 3HR5B 3N1MC 1EO8H 1XF3B 3AG3B 3JWDC 1OP5H 1CD0A 4D9RD 4GS7B 4KWUA 2BVQA 3VQ2C 4ONGH 1XL4A 2WJ5A 4LEXL 3ZGIA 4UDTA 3ASWA 4W6YB 3L3JA 5C0RH 1NFKA 2QSVA 3BN9C 3NJXA 3U30B 4KXZH 3BWSA 3DX7A 3CMGA 3KGTA 3I9IA 2YXFA 5C0BB 3PP3K 1A9VA 4KK9C 5L4IA 2WJ7A 4CKQA 2NY1C 5I9QC 1NM9A 5FCUH 12E8H 2IF7A 4AZ8A 5GS1A 4AQAA 2BIHA 3OJMB 1ILSA 3FH8A 1URZA 3K72B 3HVNA 1A7OH 3NMEA 1W91A 3WXVH 3WKNA 5F3BB 4NPYA 3RYMA 3ILDA 1PLBA 5EZOH 4GRMB 1OTUC 2OCJA 1T1XB 3Q1EA 4U0RC 1SLUA 2UXFA 3RY5A 1M1XB 3QZMA 1F1DA 4AK1A 3D50A 5IWLA 3K4DA 1F4AA 5HJBA 1JPST 3ZO0A 1E9PA 2F53A 4MAYB 4Z77B 3HLAA 1DVFD 3KZ8A 2HTKD 1PJWA 3P9MA 2LOEA 1U4FA 4L3EB 4K5OA 4N9GA 1Z9MA 1MCPH 3QORC 4HCRL 5ENWB 1J9TA 4LRIA 4JREB 4YJZL 2OMXA 5HYJD 1SEQL 1H15A 4IDJL 1B4TA 3PY9A 1DN0B 3MBWA 3AABA 1A0QH 2CXKA 1SJHB 4GFTB 4OTXH 3IN2A 1NGYA 5EU6A 2WINA 4KNSA 4CADB 5L88H 3VGFA 5IGXH 4ZUTB 4GYBA 4AMWA 1XGQB 3Q2LA 3KWUA 1OLLA 3Q6FA 5KVFL 5JHDA 1ZD6A 4DK5A 3DX6A 4ZUUB 3T4AA 1UWEL 2YUXA 2CGZA 3BRFA 2Z1PA 5KG9B 2X4NB 1T04A 4AL8C 4RZKA 4GKSA 3TFKD 3F62A 2F8XC 4FL4C 1JGLH 3S35L 2VLLB 4WUUB 5TQ0H 5J1TC 3GPSA 5CJOH 3PUUA 4NN6C 4CW1B 4M03A 5C09D 1FDLL 3VM5A 1KY6A 2R0LH 5DQ9B 1IE5A 1BF2A 2F74B 5T1DH 3V0EA 3VACA 4R0LB 3PDDA 4LLUB 4ELMA 4YDMA 5FDWB 3K6OA 1Z9PA 3QNYB 3UAAA 4D9LH 4M7ZB 3UBXG 2YMTA 1GH7A 1IKNC 5CN2A 2O61B 3BH9B 1SY6A 5DVOA 3GSUB 5JPMA 3CPUA 4RAUB 2DS4A 4N2IA 5TQ2H 1CDGA 1L9PA 1JI1A 3MRPA 4JO2H 4HCRH 3RKDD 1CZ8H 1GOHA 4EZMA 3S35H 3ZUCA 2AZAA 4P2QE 1S8DB 3QPQC 5IM7A 2VZ3A 1VF5C 4BKSC 2QQLL 4N0YL 5I6LA 4YH6A 2YMXL 2Y06H 3WHE0 2B5IB 2KI6A 2VERN 5J9PB 5AYTA 3BCDA 5AB2A 3VG9C 4JM2F 2WHVA 2MOVA 3BW9A 3S3JA 3IETB 5FLUA 4XPFL 1QVOB 2WNWA 2B1HL 3QQ9C 5L8LB 3ZKQD 4N6RB 2Q3ZA 4N2MA 3NK3A 3H85A 5DA0B 4KMLB 1GZHA 3ZZLA 2IPUG 3B37A 4F2ME 4C59B 1MVUB 4ZD3H 5I1JL 5DHVB 3AXHA 3MLRL 4Y9GA 5TE6L 5FO8A 4P3DB 1ZLVK 2VR9A 1E3ZA 3C5JB 3TONA 3KW8A 3UTSA 1Z5LB 1MI5E 3U7AA 3WBDA 1QHQA 3IXTB 2WBJB 4NQVB 4KQ3H 4J1UA 3DTDA 3GMOB 4E9QA 3KPSB 2F68X 1OGTA 2Y3NA 1E7UA 3KPRD 2OK0L 5F88B 3VWJD 3FRPG 2CHXA 3C5JA 3H2QA 4H44C 1T03L 4KNQA 2RR3A 1E0OB 3QXTA 3SJVD 1XF2A 5AVTB 3CHRA 1FAIH 2WLZA 4MD4A 4Z7AA 4LSPL 3V5DB 1IQWH 4UT6L 3RGVA 1GRWA 3IDGA 2AEPL 1JHLL 2YKLL 5E7FA 4DPCX 3U0PA 3KPMB 4A7VA 3MKGA 2XFGB 2GY5A 3NZHL 5E8NB 1BXXA 2IV8A 3H6JA 3JYBA 2WN3A 4EI5B 1WFUA 1P1VA 4YSOA 1ZS8B 1IZJA 3LHAA 3QISA 4JMNA 5E5MB 2GQHA 2IAMC 1LILA 1DFXA 1NIFA 2RFXB 3QJUB 3RX5A 2A74A 3W0WB 5F0LB 3RVXD 4LSTL 4GIOA 1KGJA 1I9JH 2CPUA 2D7QA 1ES0B 2XKNB 5KVMC 1VZHA 2QVIA 3WNIA 3WFZA 4AGPA 1JYXA 4FXLA 1AXIB 1I1FA 4Y1TA 1T89A 1MUJA 4PBXA 3SYAA 3NEEA 2A6DA 4BZ2H 1UH3A 3V0FA 2VSDA 3FOMB 4NC2B 4XVTL 4ZAKC 3CZGA 1LK2A 4I18C 1E4XI 1M05A 4QGYA 5J56B 2BNQA 3CXHK 3EYQD 3H6AA 5IQ7L 3BO8A 1IIIA 4HKBB 1ZV2A 5E9NA 5HHXH 1QUNA 1AGEB 3CU7A 4PTTB 5IMOB 1D5IH 3DO7A 4OJAA 1K4CB 4QNPF 4P2CG 2JJSA 4B3EA 3UO1L 3T4YA 1RAMA 3Q8AA 1XBRA 3UPCA 1ET7A 2OCFD 1QW9A 3BH9A 4JLRA 1AZZC 2ZF8A 3C08L 2CK2A 1A6PA 1XL6A 1NDMB 1FCGA 3QQDB 3KMDA 5ESQA 1QSFA 2VRAA 4LAQH 3QORD 1G7LB 4DPAX 4O58L 4W9EC 5DI8B 1PKQB 1J1XH 3T4YB 4IU3A 2HFTA 4ZSOA 3CIQA 3K6NA 2F54A 2OZNA 3FMGL 1ZT4A 3SGJA 1VFUA 2B59B 3QXAB 3ZHDA 5F6HJ 2CR3A 4B9IA 2DIJA 4F1ZA 1ZLWH 2Q20A 1T89C 4FEIA 4HSAC 3FPXA 3DVNA 4L3CA 5CGBA 1GTNA 2OSLA 1YQ2A 3OAUH 1K3ZA 5I76B 1C16B 1SFDA 1VEMA 1RZ7L 3GM8A 1QRNA 4G7VH 1QP1A 1L6ZA 2FGWH 4JQXC 3P4MA 5DD6A 2O5YL 4JZOA 4HSCX 3UH8A 2WUBH 2L7JA 1ZHKB 4X6EB 5LKNA 1B6DA 2GTZA 1P7QA 4XNXH 3RUGE 5DO8A 4OSUL 2A9AA 4L3FA 5GRYA 5CSBA 4N86A 4WCYL 5I74C 4N8UA 5CJQL 3OKLB 3QEUB 2PXYA 4HUUA 3JWNG 4PJEE 3MLXH 5TE4H 1U8LA 1KYFA 1NCCH 4NFCA 2A7BA 1SYSB 2QMKA 4GRWE 4ZS6D 4E9RA 5ESVB 4Q4IA 1TZHA 5MEND 2H3NA 3L13A 3QEUA 4W9ZA 2X89A 1TVHA 3JSSA 4WFEE 1IAKA 2PCPA 4HCIA 1PAZA 1U3JA 2VW6A 1CXLA 3RVVD 2HT3C 3C6LD 5G5DB 3TWYA 3GIVB 1MFNA 3H3KA 4IM8A 1YEGH 3A6BH 4HSQA 3V79C 4UV7L 4AYFA 4YHPA 2DWYA 1ZGLM 3OHXA 3QULB 1BECA 2GJZB 4Z23A 3D7PA 3F58H 1TYEB 1U41A 4YHYB 2VJ0A </