5LNGA

Lectin domain of e. coli f9 pilus adhesin fmlh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
152
Chain Sequence
FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Fml fimbrial adhesin FmlD
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 152
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lngA00
3ZL2A 4X5RA 4CSSA 4AVJA 4CA4A 4XO9A 4XO8A 1QUNB 4ATTA 5CGBA 5F2FA 3ZPDA 4XOAA 1UWFA 5AAPA 4J3OG 5IQMA 3MCYA 3JWNG 4AVIA 4AV0A 4X5QA 3ZL1A 4AUUA 3RFZA 5AALA 4AV5A 2J2ZB 4XOCA 5JQIB 1N12A 3SQBB 2WMPB 4AUJA 5FLUA 5FX3A 4XOEA 4AVKA 5AB1A 3BFQG 3JWNH 5ABZA 4AV4A 2JTYA 3BWUF 3JWNE 2UY6B 4AVHA 1PDKB 5IQNA 2UY7B 4AUYA 5IQOA 3ME0B 5F3FA 2JMRA 4LOVA 1TR7A 3BFWA 5FWRA 4CSTA 4XODA 4X5PA 4J3OH 1ZE3H 1N0LB 2XG4B 4XOBA 4BUQA 4J3OF 2VCOA 5LNGA 1KIUB 5FS5A 2W07B 1KLFB 2XG5B 4X50A 5LNEA
chains in the Genus database with same CATH superfamily
1BQRA 4Y2OA 5C71A 1TZGL 4P5TC 3F6LA 1AI1H 1FVCB 5C8JA 4ZMVA 4Y16C 2W94A 3TF7C 3J8F7 1VRSA 4ZUUA 2BJMH 2F53A 3WN5C 2OSLB 4ETQB 1X6LA 4N2BA 3NQIA 5E8OA 5FDYA 2B9BA 2QKSA 5DO8A 4MXVE 5DHYA 1A7BA 3SHSA 1OGSA 4Z7OE 2H3KA 4ODTH 1A5FH 1CFTB 4Z7AA 4XXCC 4RGND 5C0AD 4IGBC 3T2NH 2JNZA 3NZHL 1BQLL 4RGMC 1ND0B 3FO2B 4WK4B 3UYOD 2K7PA 3OKKA 2AXFA 4MA7L 4UQ9A 2NY3B 4BCZA 4EI5B 4F9LA 1BQLH 1MH5B 4J3OG 4MA7H 4FKHA 4GQQA 3EAKA 4K15A 3HB3C 3CCHB 2C3WA 5I30L 1U3YA 3QXTA 3T6ZA 3MXWL 3FU5A 4P4RB 3HVNA 3CFDA 3JWDC 5TD4A 4JFDD 1NGPL 4YGAB 2HVKA 4ODXB 4X8XA 3CDFA 3PWJA 2WXMA 4UZGA 1NGPH 1DQVA 4L8DB 3GHPA 4R4FL 5I24A 3QEQE 3BVXA 3EBAA 3CFEB 2DLIA 2EXTA 3KPNB 3KYOB 5B38A 3FRPB 3QIBC 4XVOA 3Q6FB 1AG0A 4WTXA 4GIAA 5KJRH 1R24A 2E9GA 3RUGB 3GSUA 3EJTA 3N06B 3VDBA 1D9KA 3PXJA 3C9NB 3RL2A 1F1DA 1PZ5A 4ODBD 3OR7B 4ZMPA 3P3YA 5AEAA 2J1WA 1XCTA 3Q2NA 3VU2A 4EVNA 4Q97A 3D5OF 3X13B 4F1SA 3LV3A 3QHFL 3QZWG 5F96H 2Q8BH 4Q9RL 4K7FA 4Z95L 5CAYB 5FUCE 4KKLD 1TETL 1MVFA 1NMCC 3QHFH 4Q9RH 1QRKA 5LQBL 4HKXB 1T0NA 5D7IE 4K8RC 4S10A 2VQTA 1TETH 1NIFA 1NEZG 1ZD6A 2VISA 4ZMQA 1HJBC 5KYYB 2N3JA 1DSYA 4HMDA 4L29B 1A47A 3BP6B 5C0BE 3LKOB 1TQBB 2X4SB 3AXLA 1IEBA 1QKZL 1OAUL 3BP7A 2JK5B 4AM0B 3VYOA 4P2OA 2ADJB 3WYRA 1QKZH 5ECGA 1OAUH 1LEIB 4RIRA 1U8QA 1XD0A 5DF0A 2H0JA 5C09D 3AT8A 4E9XA 3V6FA 5E4OA 1TOXA 3ARGA 1QFOA 3SYPA 2HAZA 2LTQC 1ETB1 2Q10A 4G80B 4UQAA 5B1JA 1S7VA 1U3ZA 2Y1AA 4F37F 2H3NB 1FH5L 3LMJL 1UH4A 4PJEB 4F92B 5C1MB 4TTGA 1R5VA 1FH5H 2IANE 3LMJH 5D1ZC 5CBEA 4QLWA 3D69A 5DJZA 5L6YH 4WFHD 3VNZA 1OGTB 5DUML 3GSWA 1E9PA 1ES0B 4R97C 4Y2DD 4FG2A 5E8PB 3RG1C 3ZK0A 1E5BA 1H8LA 1ZLVH 4CVUA 4MJID 4UM9D 5AW2B 6FABH 3P0VH 3IB4A 1A7PH 2OMUA 3MRJA 4X6BA 3QI9A 4HLEA 1H3GA 3D18B 5T3XD 1IZKA 2G30A 3OGOE 4N1HB 1QSFD 5C0GB 1XF2A 5IF0A 1OQXA 4PRPE 4X8JA 3RNKB 1C08B 2FBJH 4YHZL 1WAAE 2XWXA 1ZT7A 5CLZA 3BZFB 2DS4A 4YHZH 3PHAA 4DKEL 2CLRA 4FMFA 5FDWB 1SDAB 2ZXEB 3BXNB 1HKLL 1DJGA 1QZNA 5A16A 1UB5A 3L7EB 3IRZA 1FHNA 3L2MA 3D0VB 2XIIA 2H32B 4P48A 4ZFOL 3UTQA 1X9RA 1FVDA 4OZ4B 4U6HB 4LU5H 4S0TD 4UV4L 3MV7A 4YDMA 5ETUB 3OKDA 1DJZA 5I6PA 4LSQH 4UV4H 4FNLL 5I1KH 3IGFA 1L0XA 3LNDA 1WBXB 4XPAH 3GEWB 5GRWA 5C0IA 1F4XL 3OMNB 3NCJL 1R34A 1BZ7B 4FNLH 4IS6B 4NQVB 3ZQ9A 2UWEF 4BM7A 5CEYA 3EH1A 4D0DA 3TO2B 3VQ1C 1F4XH 3NCJH 4JO1L 1ZLVK 1SQ2N 1CS6A 1UZ6F 3C5SB 1IAOA 5I76B 3ZR5A 4NQED 3U46B 4FI8A 4TKWA 3OKLB 3T8XB 1OCCB 2GCYB 1YEGL 5B3NA 5CZRA 4YGVB 4BBWA 3PAVA 3VXUE 2OMZB 3FB6A 2BFGA 4ZT1A 2QGDA 2YN5A 4GW4A 4UT6A 5DS2A 3KBPA 1M4KA 4KHXH 3VD0A 2YC1A 2ZSWA 3VRLE 1JRHL 1EERB 1JF5A 4BH8A 1KFAH 1Z5YD 2UXFA 4RAUA 2Z34A 4JKKA 3T1FA 5KSVB 4QRUB 3BN9C 3HPLA 4OCRL 1ODAA 1M7DB 1XEDA 3A22A 3MBEA 4F27A 1RHFA 1XGUA 1E7UA 5J8OA 3CBJB 3FOMB 2HRHA 3RY4A 1E42A 4POZC 2XRAL 4MFHA 1Z1WA 2XQBL 5E6IC 4L18A 3H2PA 4X7TB 4JANB 2VDLL 1T22B 2VR4A 2IJ0C 4JHWH 2XQBH 1D5IH 2VDLH 3GTVA 4FG4A 4LSUL 1A4KA 1FAKT 1FNGA 5HHOA 2G3MA 4LSUH 3VFUA 1NM9A 1U36A 3AS3A 3QUZC 4PGEA 4HS8L 3MCKB 4KKCD 3WL9A 3WDHA 4TRPL 4ODHL 5BS0E 1VKXA 4XOAA 2VLKA 3FTVA 3WE6B 4GAGH 3TYGL 2G60H 3LKNB 3UAJA 3F8UB 5DZAA 1F3RB 5HJGA 2EIBA 4M8QB 4F5CA 1CZ8L 4ONGH 3FN9A 1TZ8A 2O72A 3DVFA 4HKBB 3LNFA 3TYGH 3OJDB 2XY2A 3UXFA 2HG5B 1CG9A 3OWRA 2OLDA 3KLSA 4H25A 4QRBA 2IADA 3S8FB 4UTBA 4F7MA 3E1ZA 5DA0B 1WHPA 2ZWNA 3DX3A 3SD2A 2FJGB 4BIKA 3U7WH 3IDJB 2EIZB 4U7MA 1J8RA 3CDZB 4N9GA 5IR1B 1WHOA 4OU3A 1G7MA 5IHZB 2P28B 4XVJL 1A22B 2WZ6A 4KMTH 4IBUA 1VEOA 2P5WE 3WAKA 1UFUA 4XVJH 4ELKA 3FFCB 1OP4A 3A67L 3SDDA 5F7KC 4HSCX 2FL5A 3OM3B 4P8QA 1LNUA 2X09A 4WTQA 1FQ9C 1WEJL 2HKFL 5DTFA 5DC4B 2P80A 1U21A 4W68A 4XNMB 2MNJB 2AQSA 4AUYA 1WEJH 4XPBH 2H8PA 5C2BL 2NY3D 4ZPTB 2AAAA 2WJ5A 4B9PA 4LDLB 3IN2A 5C2BH 4KTEH 5E1GA 1G9NC 4LOUC 1RZ8A 2VABB 4QRAA 4P2CG 4FN0A 5DQDL 5A1AA 1BOGB 1EK3A 2ZUVA 2AV1A 1XQ4A 4KK6C 5DQDH 1H9DA 3T6WA 1N5AA 2HN7A 1R75A 1CLOL 1RZKL 1ZHBB 2B7DT 2DH2A 3IDNB 4X99B 1M6OB 3SKNB 3RWJB 1RZKH 1BGXL 3BAYA 3A6BL 3K6IA 1W0YT 3P4OB 4RFEA 1OY3B 1I3VA 2YFNA 4XNQB 4MA8L 1BGXH 4Y4KA 4HIPA 1T5WA 4OZFB 5GISL 3BSZA 3P30L 4XCYB 5CSZA 5DYOA 2KUTA 5FGSA 5BMFL 3QUYC 4NDMB 1KCVH 5GISH 4G9FB 4IMLB 2PNDA 1OTTC 1NFDE 4HUNB 3OKOB 4KZ0A 4FXKC 1FNHA 3OX8A 4DO6A 3RGVD 3CC5B 2K70A 5KSUB 5ICZA 2X2HA 3H7BA 4LL4A 4D3CH 3QYCA 4GG8A 4CRPA 2VR8A 3V7AE 1UATA 1Z0MA 3KAAA 3CVHA 1DL7L 2VXUL 4PP2B 3RRQA 2VLME 3UTZB 2WTOA 5DD6B 2YGVA 5DVOA 5F93C 1P84K 5L9DH 3ME0A 1G6RL 3L48A 1Q9OA 1ICTA 3NSFA 1YMME 2JF1A 2W07A 3P3SA 4Y4FD 3SYOA 5CCKL 1OW0A 5GSRA 3UG3A 5L0QC 3B6SA 4OZIB 1WE5A 4U1IA 3NGBC 1E2VA 4N0UA 3H85A 2EIJB 4OV6F 2AJVL 3GJFB 3FQXA 4P9HL 2GHWB 3T5WA 3ZIYA 2YPLB 1U6AL 2AJVH 4LHUA 4XRCB 4P9HH 3REVA 4PTUB 3KPLA 2OJ1A 5AG9A 2FWOA 4YSCA 1NCOA 4KV5E 3EJQA 4JO3L 4PRDB 1TPXC 1KGCD 4G71B 2WANA 2QDVA 5CIPA 1L3WA 1AIFB 1H3WM 3MLUL 1T03L 3T3PE 2F54D 4AUJA 1MFDL 1ZLEA 5KSAB 5IB4A 2Y06L 4PJIA 1XCQA 3UIZA 1KJ3L 2NY1C 1N2RB 1UH3A 4LVOC 4YHYB 5DYFA 3UZEC 1RIHL 1KJ3H 4QTHB 3CN2A 2J88L 1F4WL 2YIHA 1COBA 1MAJA 2C7UB 3CSPA 1XMEB 4I9WE 3HKZA 3ZMEA 2J88H 3UMTA 1N64L 2CRZA 5KVGE 1ZHKB 4GRWB 2Y9RT 4G72B 4KGJA 1T5XA 5ACLA 1CFVH 4CDHA 1S7UA 2OMXB 3WXVL 2FIRT 5FGCE 3KPSA 2C9XA 2KT6A 4J3XA 4X6DA 5EUOA 1KXQE 3WXVH 1CIUA 2DWXA 3Q48A 5E8DL 5E9NA 4PJFF 4UNVA 4JFDE 3QDMA 5IROA 2BP0B 2WIIA 2CPUA 3IXAB 4NYLB 1E5CA 2VR7A 3RX5A 3WJLC 1CTMA 2Z8WC 4MCZB 4Z7WF 3TJHD 2CD0A 1SHSA 3QYMA 2X12A 2R0ZL 1PG7H 3CHQA 4GLRH 1RJLA 2VLLA 5EU6D 3AREB 1BSIA 2P24A 2X4UB 3DJ9A 3U9UA 1RPUA 1DQQA 4XGZB 5IVXE 4TL5A 2RD0A 3GSNL 3OR6A 3ZO9A 4QOKE 2YD8A 1MCWM 4O2EB 3VFVB 4NB7A 3K5SA 1ET5A 1G1CA 2I32A 3S2CA 2IPUG 3ARFA 3BW9B 4UTCA 3ARPA 4TQIA 1HSBB 2H0FA 4XNYH 4DPCX 3FSOA 3FTUA 4G2AA 4KI1A 1T7ZA 2J8UF 2WUBL 4P05A 1KJMB 4U3SA 5TK4A 3SGEI 3TVMA 1N7MH 2CBQA 2EIDA 1ZMYA 4G9DA 4KKRA 2Y24A 4MDRA 1EQWA 1F6AA 1IFGA 4FYRA 2BIPA 1DFBL 5GSVB 1H6EA 1Z2KA 1OD7A 3N91A 2YXFA 5DCCA 1WWAX 2CH8A 3NIFB 4TM9A 2P3YA 4Z5RB 5D6DC 3O81A 2H2PC 4H1LB 5CN3A 5KBDA 2FQFA 3DVNB 4BXVA 5I15H 2ADYA 4G8GD 5AW4B 4B9IA 4NN6C 4MKTA 5H4ZA 2BNRE 3E3QC 1PX8A 2HA1A 3HZVB 1MY5A 5AVXB 1D5BB 3WELA 5KG9A 3OV6A 1QVOA 4IEFA 1CE6A 2XC8A 1KLUA 5HVHB 4AXWA 3HE6A 1H0DB 1XCXA 3DYPA 3O45A 4E9TA 4LLQB 1IGJA 2JQMA 2QADB 4ZBJA 1D6EA 4F2EA 4MQXD 4I18B 1G7QB 2K78A 3V10A 1YHPA 1H3UA 2IBZX 2OSYA 1QBAA 2DQEH 5HP5A 4PSPA 5FM8A 4APQA 1JPTH 3CIAA 1ASOA 3Q2LA 1WZAA 4L3CB 4WFHE 3UC0L 3CV5A 3VD7A 3BIBX 5FAAA 2CK0L 5IMOA 3TBSA 1T0OA 4YSUA 3DOSA 1QI4A 2YMTA 5EIQA 4IOIA 5JHDD 1HAWA 2BP8A 3ZLQC 1SJHB 4ZW5A 1ZVSA 4FL4C 4X7EC 4WHYH 1QR1B 5T3XE 1TYJA 3MRGA 3DX6A 3QAZC 2ENQA 4WW2A 1HNFA 4J3SA 3B8SA 5DVPA 3ILPB 1IGTB 2WY3B 5EG6C 1G9MH 3D06A 3X2QB 1UVQB 4TUOA 1A6AA 5I74C 3MUZ1 2BRRH 2R0KH 3H3PH 5GS0L 3MV9A 4M4RB 2P46B 1AGBB 3C6LB 3PHOB 5ACZA 1ZVYA 3KZ8A 3CUPB 2EECA 1R0AH 5IJBC 2WAHA 4J2XA 1Y0LA 2NY4D 4ECNA 3EGDB 5EOTB 4W9DC 1HWGB 3L3GB 5J57B 4JR9L 5F1KC 5TF0A 5DZNA 3FFCD 4M03A 4BSVA 2Q76B 1J9CT 5JZ7C 2FO1A 4JR9H 2BW5A 4WI3A 3RWHB 4OCMC 2VZ1A 4M5YL 2FEJA 5DJ0A 1CL7I 1S5IH 3DBXB 3MMEB 4F8TA 1NLBL 1T7YA 1EMTH 2E7DA 3P0YL 4WI8A 1SBSH 2AVGA 2WB7A 3FUHA 3QB7C 4M5YH 3MRLA 5DJDA 4J23A 1NLBH 4HKJA 4HIIA 2O5ZH 4QTIH 2XOTA 3ZHFA 4NQEE 3MN8A 3FBQA 2EYRB 2W9EL 3CC1A 2XQYK 5DFAA 4JG0H 2ZOKA 5EC1A 5AW7B 2W9EH 4KKNA 4BFJA 4JJ5B 1IBYA 3F85A 4AIZA 4F58H 2PCYA 4OI9A 4PREA 5AW3B 1IQDA 3WHXB 1J9SA 4GG6F 1CVRA 2X0VA 4G8IA 3VU1A 4LCUB 4GO9A 4LSRL 2HJFB 2GTWB 4LEBA 1UC6A 1KTLB 4MHHI 5F7YC 5JLZB 3TX4A 3MJ8B 3S88L 2UXVA 5KVGL 4ZX5A 4F2MA 3ES6A 4K5LA 3DX2A 3MRRB 3S88H 3AU0A 4MYWB 4Y19B 5KVGH 1JHTB 1MCOL 5ITBH 3AM8A 1ODUA 5D1QA 2NY7H 3NH7H 5IGXL 1RHHA 1EIBA 3PWPD 4HYTB 3SKUD 1DQTA 1R3HA 3D85B 3UTSE 3B5TA 1KGUA 3QIUC 3OD3A 1KUMA 3EBGA 5DJ8B 5EBLB 2JJTA 3US9A 1IU1A 1ZA3B 4A2GA 2ZP9A 2FX7L 3ESNA 1LLAA 2OMYA 5F70A 3EIFA 3SDAA 3DGGB 4F9PA 3TZVC 4GJTB 3GF8A 3M7FB 3LEVH 1K2DB 4BFIA 1MEXL 2DW5A 3N50A 3ESMA 1L0PA 1ORSA 1DBJL 3GB7A 4YAQB 5F3FA 2CIKA 1CXHA 1DBJH 1J8HA 2A74B 2YPLD 3CFQA 1CXKA 3QORB 3AC0A 2BK8A 4LRNH 2DQHH 3MJ7A 3II3A 1P7KA 2BSED 2BSSA 3FCGA 3FRUB 2FR4A 3I9IA 3QIWB 4IU2A 4RMVA 2ZONA 1NC2B 4I0PA 5HGAA 4OT1L 1KBBA 1ROCA 4M1GL 4PGBB 3WIHL 1M2VA 1MFCH 5IB5A 2IAMC 2JJSA 3CVCA 4OT1H 4XXDB 1KPRB 4M1GH 3OPZL 4WLCA 1G84A 1MWAB 1QEWA 1KJ2H 2VN7A 5KSAD 1S7XA 3D25A 3OPZH 5C92A 1QLEL 1P7HL 3OC5A 4XNXL 3HB3D 4M29A 3NMEA 1QLEH 3BHBA 2QKIA 5ALCH 1IV8A 4JFFB 1B9KA 3OMAB 4Z7IA 4L8SC 3CHXA 3ISRA 5IJVB 2BNUA 3FQRB 4TXVB 2QR0B 4O02B 2E6PA 3VI3A 2OQJB 2HTKC 4ZDHB 1ZLSH 1HHIB 5H37H 4WDIB 2X9YA 4YMPA 2EXYC 2D7QA 3BZ4A 5D5MF 3N1MC 4JY5L 3T0EB 4WO0A 4DGVH 2FJFA 4R7NA 5IBUG 3RU8L 4QMEA 5T1JA 4JREB 1G7JA 1V3JA 3MRMA 3QIBD 4JG1L 2W60A 1EHXA 3C5JA 3RVUC 3O4OB 3SYCA 2NDGA 5KZCD 1CD0A 1K8IA 4POUB 4G6ML 4JG1H 3APCA 4YR6A 3VQLA 4F7TA 4PGJA 2WXGA 1CGUA 2QVFB 3L9RB 4G6MH 4MD5B 1QWHA 3WUZA 2DQCH 2I26N 5AENA 4WO4C 1IFHL 2F7QA 2UYLB 2X41A 3O6LL 3B37A 4U6XA 3V2AR 5F9WB 3N3EA 1IFHH 3RUGE 3ARED 2XZQL 1KTJA 1JF6A 2Y7QA 5DT1L 3I6LD 4L4VA 3U6XA 4K3EH 3UIYA 1BIHA 5T3XL 2XZQH 3PWLB 4FQHA 1HK6A 4YPGB 4ZFOA 5T3XH 5I1GL 3PWUA 1T0MA 1RZGB 3UGUA 3MJ9H 4HWEL 1JVOA 3HUJB 3TLRA 1MVUB 4HWEH 2ZWLT 4Q9CA 2DWDA 2WN2A 1JFHA 1XGQB 1OAKH 4WRLA 1SN0A 2UZIH 3L6FB 4PS8A 4NOBA 2CG9X 3VFSA 1GGBH 1YQVL 3AQZA 5CLXA 2IGFH 4AVHA 4HFUH 2G5BA 3K72A 5L8JB 5IMKB 4Y1TA 3BSHA 3P77B 3BVTA 5KAQF 1G7IB 1FL3B 1BVNT 5D4IA 3NVQA 2F74B 3KYNA 1HH6A 2IQAA 3BWAA 4YIQB 1KEGH 3OXRB 3K2KA 2AJSH 1D2OA 1HFUA 4FULA 4MLIA 2NQDA 5INDB 5D1ZD 4LCYA 1A1OB 2AEWA 3CDGA 4ABQA 1KGCE 4JFED 3O8XB 5EF3A 1B4JH 1MCPL 4RBPH 5BV7H 3GIVA 1MRFL 1RZFL 1UEMA 2E86A 4PJ8C 2BNQD 3DI3B 4WSJA 3WO3B 1MCPH 4W4NA 5F9JA 2OCJA 1URIA 2WVVB 1MRFH 4PJEE 5DK2A 5IUCA 4MCYA 4X80H 5D2LB 1HWWA 4N1CA 5KVEE 2YR3A 3HRZC 4R0LC 2VC2B 4LGRB 2OKMA 1U8IB 2KZ1B 5KVFE 4MNHB 1LO2L 1BIIB 1LP9B 3THML 3TO4A 1J9QA 4IRZH 4LVHC 1BJ1J 3BVUA 4OJFL 3FU8A 3QEQA 1LO2H 3THMH 1H8NA 3FCUB 4OJFH 4U33A 1RURL 4NQDD 3DUSB 4J6IA 4J3UA 2PTUA 4NBZB 1RURH 1E5ZA 4FAAB 4Y5XC 1FRGL 4A6YL 4U7SA 2VQUA 4HC1L 5FO9B 4H5SB 3FTWA 4ZXBB 4MS8D 1FG9C 5FHAL 3MO1B 3NPZB 1J8KA 4S2SB 4GH7B 5BRZA 4XB3A 7PAZA 3V4LA 5IKCA 5FHAH 3SY0A 3C6LD 4DZBB 5AYTA 4RBPK 1VADB 3WO4C 3RWEB 2XX1A 4JPWL 2OXGB 2WTPA 3EG9B 1NWOA 2CHZA 2E5EA 1RZ7L 2IWFA 4LVEA 5CS7A 1A4CA 4HCRL 2C9UA 3NCCB 1GC1L 4JPWH 5IVNA 1N8OE 1TVDA 2NX5A 3APNA 4HCRH 2PW2A 3G5XB 2Z9TA 5FM4A 4RWYL 1I8AA 1S7RB 5C0BA 3TNMB 3PXLA 4KI5D 3HE7A 3QXDA 2CALA 5IFAL 1U8KA 4NJAL 4RWYH 5E2UL 1A1NA 2YWYA 2ZICA 3FTXA 3H8NA 2BCKA 5GS2D 1DQLL 5IQLA 5IFAH 3OJMB 3BVNB 2QDWA 3ARVA 4LPTA 2BVPA 5EA0L 3TH2T 2WQVA 4NZFA 5F7UA 2NR6C 5E8EB 3FZUC 1V8HA 5EA0H 5SV4A 2FYYB 5DRXB 4MMYA 4Z7VB 1Z5LA 2V9RA 3MJWA 5A2LH 1IVTA 3CZJA 3FSZA 3RA7L 2UZXA 2E7LA 2E76C 1Q94B 3EO1A 3QWOA 2NUTA 4OVUA 5I0XA 3D39A 3MXVH 1PDKB 4WI0B 2HWZH 2X70A 1ETJA 4F8OA 2GTZA 3VWKC 2IANA 3ARBB 1JZGA 3PJNA 3MOBL 1GOGA 3L4TA 4YXLL 4AC2A 3BD3A 4ZOAA 4W93A 4PJDF 3VYNA 2Y07L 1KLGA 1OAXL 2DBLL 3MOBH 1CDBA 4YXLH 1YYLH 1U0QA 2Y07H 4R3SB 1HN1A 1DUYB 1CDUA 3S48A 3DX7B 4YZFE 1UWEL 5AFAA 4Y4HA 2Z31C 3MNZA 3D85D 1DVFB 2ARJA 3VRJB 1MG2C 4XCEA 1UWEH 2DTSA 4HIJB 4HX1A 2R0LL 1PS3A 4ZS6D 5CEXB 1WAAA 4JO8A 3V4PB 1Q90A 2E9BA 3VGDA 4WF7A 3FK3A 1CFSB 5GRJH 1UCBH 3W37A 3WY3A 3Q1EA 1NGZB 3W9DB 1WPCA 5I5MA 2IQ9L 4J3WA 3B2UD 2BIHA 1BFOA 4DQOL 2CDGA 4N90D 2PXYB 4NOFA 1UM5H 4OLEA 1AD0A 2IQ9H 4LARH 1MRDH 1DSFL 1SY6L 3ET9F 3IDMA 5C0EB 3FOLB 4HWBH 1F8TH 1OWWA 3ROLB 2H3XC 5D7LD 2FE0A 1SY6H 4X8CA 4ZD3L 5IW6B 5LWYL 5IFHH 3O4LD 2CBPA 4ZD3H 3FB7A 2WQRA 3VB8A 1KDIA 1NANH 3D7PA 5JYLA 3M7OA 4JM4L 3L4UA 4HS6B 1THAA 3FFCE 4RAVA 1IGMH 1MDTA 3HBZA 4G8FA 1SFDA 3UYPB 4JM4H 1JOIA 2JKSA 1NCDL 4WJG3 5GGTL 4LOUD 1UJ3B 4ES9A 5HI4C 5CP7B 4MD4A 1DBAH 3SDYL 1NCDH 4F7EB 4MX7B 1KB5H 2Q86A 4KK6D 1YUKB 5JUEL 4PJ5A 3SDYH 1TJXA 1GZPB 4J8RA 4X4XB 5JUEH 1LDSA 1K5NA 1CFQA 2ZX6A 4LCIL 1LYQA 4XCFL 2DQTH 5D1XA 4OBRA 5ERWA 1PEZA 2FT7A 4FQIL 2K3TA 3DJSA 4CL7A 5FLVA 1OHZA 2DMHA 2DQMA 4A68A 3QXUA 1N67A 5DZJA 2ZOOA 3PF2A 2C9PA 4FZ8H 1GGIL 4YLQT 2WLLB 5FCUL 3WOVA 5BVPH 4R4NC 4G5ZL 4HJSA 1PZUB 3WTWA 1GGIH 1CC3A 5FCUH 4DFIA 3EHBB 3VXSB 1J10A 3H0TB 4G5ZH 4QO1B 4MZIA 4MNGA 2PW1B 15C8L 1UACH 3FN0L 4LPCA 1ZGLB 4UB0L 4C56A 2YD5A 3JSSA 4G9FE 2PPEA 15C8H 1MPAL 1CR9L 3QZBA 5EOCL 5FW8A 2B16A 5DHXB 3ESVF 4KDWA 5EOCH 3HI6L 5AB9A 5F6IB 2P8PB 5DMGC 3EH5B 5I19H 5EO9B 2IV8A 4L4JA 2RA1A 3VFOA 1IEAA 4QHKI 4EN3C 1MXDA 3BWUC 1G0XA 5I28A 4AEIL 1F5WA 3FTZA 5HHQB 3D0LB 1IBDA 3J27A 4UILL 5K9OB 1OALA 3BIKA 2KLSA 1OAYL 4AEIH 1NZRA 3N85L 1F3JB 4KK5C 1DO6A 4UILH 2O5XH 3L7FA 2DYPA 4Y8AA 3O3EB 4DKAA 4OZIE 2IDTA 4FKKA 3WHE1 1OAYH 3N85H 4X7FC 2F8OA 5DS8B 4AEFA 5BZXA 3DC0A 1O6TA 4G1EB 5CJXC 1OCWL 4AJVA 5I1AA 5TGBA 4HEPG 4CJ0A 2QHLA 1OCWH 3PAYA 1XB3A 2FT8A 5I73B 1NDGB 2YPLE 3N42F 1V05A 2BWQA 1KC5L 2QFRA 5AUMA 4JRYD 4NX0A 4YN3A 4XHQA 5EZPA 3EO9H 4J3OC 3KNBB 1O5PA 1NIAA 4XP6L 1AS6A 1H15A 2CKNA 2CJTA 3T6VA 1TJIL 1U8PA 4GIOA 1V7NH 4XP6H 3ECVA 3OQRA 2A77L 3QARA 1BQKA 1M1XA 3MNMA 1B6DA 2NY1D 1JWSB 4Q8BA 4DT2A 1TJIH 1QFWI 1WFNA 1ZSHA 3F5WB 2A77H 2AFNA 4TQEH 3LCYA 1J0ZA 5EIIA 4N5EC 5HD8C 2LLGA 1SDYA 2N7AA 3MRHA 1EGJL 1ORQA 5B8CA 5F88A 4BUGA 3WSQH 5GS1B 3DWTA 3W5MA 3WIFB 5HGDA 2A3TA 2XETA 4IBZA 3EH3B 4WUKH 5I0YA 4HKZA 4N2LA 4B9FA 5JOPD 1HQ4B 3UBXI 3HAEB 5BZWB 3V6ZB 1XH3B 3LEYH 4U1JB 4GRWE 4BFFA 3QO0B 4OD2A 1PZ3A 4CAGA 4PGDB 1KFGA 3GS0A 3MRPB 4L3EB 3BUQA 2YMXL 1A14L 2XY1A 1QPXA 3S4SA 1L0YA 3Q1SL 2R9HD 3VAEA 3KPTA 5FYKE 4XZUA 1A14H 1INEL 3SO3C 3AS0A 1A6TB 4ZXBD 3Q1SH 1INEH 1CWVA 3T65A 4HZLA 2HMIC 1I1AB 4TVPE 1WH0A 2VZVA 1II4E 1WFOA 3GS4A 2GJPA 3NJNA 2F61A 3QWRD 4JM2F 3BKCH 4FFZH 3DROB 3N1FC 5GGVL 3AADB 1EUUA 3ZKXB 1X9QA 4NKIL 1P9MC 1ZV9A 1AG6A 5GGVH 3DRQA 4B6ZA 2J1ZA 3QJZA 3KYMB 5HYSB 1CDGA 4JPVL 1OARL 1MIEH 3NT0A 5ITFB 4YFEA 3EOAA 1MCFA 5K1VA 2GSIB 3GXIA 1FGNH 3EYOA 1IBFA 3I75A 3L3OC 3FSVA 4LCCC 2E9JA 1OD9A 3O6FD 3P9WB 3O3BA 5D93B 3RHWK 1Q0YH 1YECH 4GRLA 4IU3A 3HNSH 1SM3H 4RMRA 1EH9A 2PO6D 3D50A 4U1KB 3ULSB 5CJ5A 4AIEA 1NCJA 4HLZG 1DQJB 4IRSC 3NIFE 2GAZB 3QPXH 4F8NA 3CAFA 1ZXQA 5T1KB 3CK0L 4QRPB 4NAJA 5T5FL 5HPMB 4WSKA 1BD2D 4U6TA 3ARBD 4QRSA 1CGSL 5C0AA 1V27A 2AXJA 2OJZH 4R8WL 4HK0B 3UCRA 1CE1L 1W2KT 4CKQA 2FECI 1CK0H 3TBYB 4Z7NB 1CGSH 3LKPA 5DC0A 4XO9A 2BSRB 1DSWA 4ODSL 2V2TB 2VRAA 1E5UI 4YX2H 5JOFA 3R8BB 3AY4C 4BA8A 1DVFD 3JTSA 2DH3A 4MZRA 3KCWA 5EZIH 4MMZA 5BJTB 1OZTG 1IGYA 2XJLA 3FL7A 3QNXA 4YEEA 4NBYB 4XP4L 5C07A 1YLBB 4JLRA 3POHA 2WBJD 4P5RA 1A2YB 1JNHB 1NLDL 4OZFH 2QV4A 5F7WC 3MRFA 4XP4H 4DP2X 2IDUA 5IQ7L 5L7XH 4PJHB 1NLDH 4IIQA 4NZTH 5F1IA 3JV4A 1AKPA 1TQSA 2ORBL 5IQ7H 3NABL 1TVHA 2ORBH 2EAEA 5IHUH 4H44C 3RKDC 1QAWA 3NABH 1VEPA 1FZMA 4PWKA 4JFVA 3PNWB 1H6FA 5BVJB 5IVXA 4QRQB 5JA8B 1IE4A 3M8OH 3LZNA 4D94A 1O0VA 1CI5A 3VVWA 1RIUH 5TDPB 4QTFA 4MXQC 4HULB 1BQ5A 1E9OA 2MHAA 3IGAA 1AGDB 1FN4B 2J5WA 4CVZB 3GT6A 4L3FA 4LP5A 2LU4A 2RCSL 5IQNA 5ABAA 2MPAL 3VW3L 3DDGA 4NNYA 1Q72L 4NERA 3BKYL 5IV2A 1UD6A 2B4CC 2RCSH 5D6CB 1T89A 1ZA6A 2HH0H 3CSTA 4C4KO 3VW3H 1VHPA 3UPRA 4HIEB 1Q72H 3HBPA 2Z0BA 4KY1L 4NP4H 2WIMA 2HJLA 1KJ2A 5SX5K 1BZ9A 5HI5C 5EBWA 1LWHA 1SXCA 4KY1H 1UEYA 1EXGA 3B3BA 3CDCA 4YHLH 4APXA 3FBKA 3CFKB 5MEQB 3CSYB 3QUXB 4XP5L 1MLCA 3IE4A 4KROB 4R2GB 1GYVA 3KGSA 1OF2A 4O2FA 1F11B 3WDIA 5C7ZA 1SUHA 5C09A 1QMUA 4J6RL 1P6WA 3HS0A 4EZMA 5H37A 2WYTA 5LVEA 35C8H 5L2JA 3E6FA 4Y2LA 4J6RH 1LO4L 2JB6B 4NQCD 3GHBH 1D5ZA 3CHOA 3CXHJ 5EZLA 4HJTA 5K9KB 5DGQA 3DSFL 3T4AB 4OI7A 5TF1H 3VXSD 1DQDL 1YYML 2DMKA 3IF1A 2EDLA 4X8GA 1GW0A 2PWHA 5FO8B 3RLSA 1EVTC 1DQDH 1YYMH 4QGTA 3ULAB 1A3LL 4LBEB 5HY9B 4R96A 3ECUA 2GBUA 3QIUD 4Y19E 3KXFB 5IP4A 2A9NL 2NTSP 5KAQG 4Y2DA 3HI1A 4BHUI 2ALWA 3KEHA 2YAPA 2A9NH 2Z92A 1TYEB 1QUNB 3DMMD 4MJIA 4UM9A 5TDOA 4JGMA 5JIQA 2NUPB 3NZ8B 4RFOL 4AENB 2NZ9C 4UDUA 2B08A 3EZ8A 2IC2A 1QSFA 4DNLA 2FQDA 5ESAA 1YQ2A 1I8MA 5DMIL 3MJ9A 5D55A 4E5XB 1ADQL 4GW1A 4TVPL 3MLXL 3R06A 4X98A 3SZ6A 5DMIH 4MA3A 3FFDB 1F56A 1N26A 1FAIH 2MKLC 1XBDA 2JKLA 3G08B 4BCYA 4WWKC 3IPFA 2FJHA 4W9KC 3VFWB 4QHKJ 3BKJL 5H35A 2VKWA 4HUVA 1VA9A 2W0PA 4LSVL 2APBA 3BKJH 5E1AB 3MLSL 5DRZA 5AVSB 4OLWL 4JHUA 5DJXA 1E6JL 3MLSH 1WFJA 3QEUB 2HT2C 4ZUTA 1PSKL 3CFIC 2ID5A 3L2LA 3U30B 4UIMA 4B60A 1LO5A 4KRPB 4LF3B 4BWUA 1N5YH 4GXVH 3T71A 2DJSA 2C26A 4NKDB 4MSWB 1RUKH 3QSKB 4P23B 3P69A 2C1PB 3GHEL 4S1RH 5ID1B 4R90L 3LZPA 2J20A 3GHEH 5EO0A 4CVXA 1WA1X 1EZVY 1NIEA 1HHJB 2LOEA 4U6YB 3BPOC 4B9KC 3KJ4B 1GH7A 1BM7A 2H6UA 4XXWA 4I3RL 4M93C 5AWNL 5IB2B 2EXYD 2C3GA 4FFYL 2VTFA 5HVHC 4JFFE 1KEMH 4K5NA 2GT9B 3IVKB 3ARYA 2CUHA 3STZA 2QADC 3T8MA 3C60C 2FEDC 2FUTA 2VR6A 4I18C 3E6HB 3AUVA 3S3BB 1SDDB 5HVWA 3UAFA 4IRZA 3T0EE 1OP3H 2HT3C 1EBAA 2YAEA 2AV7B 2SEBA 2VITA 2AZAA 3UJTH 4X9FA 5J06A 1WITA 1IM3D 1LMIA 3O0RH 5DJ6B 4BK4A 5GPRA 4LRIC 1S7WB 3WDJA 2EYSB 2XNAB 1EVUA 2WXPA 3P3TA 4A37A 3M86A 2VLRB 1I1AD 3JUYA 5GS3A 3ZBMA 1J0HA 2X6MA 5GGSB 3RTQC 3R1GH 2W91A 2WLIA 1H8SA 3ULVE 3I9AA 2F8IA 4H8VA 2W9DL 3U2SA 3UJJH 1UUNA 1G7PB 4GUCA 1YDPA 2X4TA 3VI4A 3RZCC 2UY6A 4QCIA 4I85A 4X7DC 3IJEA 2KPWA 3Q8CA 2QQLL 3Q5YA 3LKRB 1NA8A 4HCRA 4C57C 3O2WL 4IBLT 3HUJE 3FT1A 2Q7YA 1XZWA 4PY7A 3Q05A 1BQHA 1UXSA 1OP3K 3KG5A 4ORZC 1AGCA 4WEMB 1OP5K 2ED8A 1PY0A 1UA6L 5A7EA 4PI2A 1FVCA 4M1CC 4QXWA 3HZKA 1A6ZB 1C5DA 3HG1D 2R0WL 4L4TB 4JJOA 1E8YA 5C0CD 5K9JL 2OP4H 4TN9A 4M43H 1NUFA 1RK1B 2R0WH 5H2BB 4QWWC 2W38A 1F90H 2R2HB 3NEOA 2V8MA 2DKUA 5FKAA 5C08A 4PJ8D 3FAWA 1H8OA 4XO5A 5GS2H 1N12A 3NA4A 1AY1H 2C8NA 3QXAB 1N6UA 5BZZA 4QPEA 1A3RH 3FF8A 1AD9B 5DFWH 3MRCA 3GSOA 2JTYA 3NCXA 5HYIA 4OAWB 3LIZH 3FUFA 4CDGC 3R18A 1LTXA 5D2LE 2X1QA 2FIKA 1OQOA 2Q1EA 2IWGA 3DIFA 4FS0A 4OGYL 3QULB 4OKVA 5LGYA 5JOPE 2DI7A 1CGXA 1LP9E 3P3RA 4JFOA 4OGYH 1P2CB 3BKML 2CKBB 5EN3A 2R2BB 2KS0A 2R56L 1UQSA 3HPJB 1O9ZA 2N59A 3P2DA 1OF0A 3BKMH 3NEEA 4N0FA 3QG7L 4R7DB 2YZ8A 4IJ3C 3WIAA 3EGSB 3Q9PA 4NWUL 3BDYH 4PRHD 5HDBF 3MGAA 3QG7H 1X7SA 2YAFA 3RUGA 1BX2B 4IKLA 4Y9CA 1RZQA 3RGVA 1E4KA 5E4EC 3C9NA 5E4AA 4BQ6A 1CT8B 1SQMA 3OR7A 1D7DA 3JUZA 2DKMA 4HWBA 4Z78B 1SY6A 4OGXL 3DARA 1ZPUA 3HS9A 1EDYA 3H9ZA 4ZJ9A 2A74C 4OGXH 3VM5A 3IJYA 4PJXB 4I0CC 3UBHA 2W0KA 3LB6D 4Y4FA 1NC4B 1EBPA 3SKJH 1C8QA 3ZDXF 1E28B 2ICWA 2NW3B 3LKOA 3OHXB 4X5RA 3MREB 1N59A 4R26H 4GI8A 3FZUD 5JPMC 3KPRD 1DBBL 1L9PA 3WKML 2H4EA 5I1EH 1TJMA 4PB9L 2EDBA 1KB5A 1DBBH 4LL1A 4ONFL 2Z7YA 3WKMH 4KROD 4PB9H 5CJ8A 1BVLA 1T2JA 1MCJA 2K6YA 1IEHA 2VM3A 1EEZB 2NZ1A 1U8OA 2RH0A 3AQYA 2E7HA 3B1UA 1CLVA 4D8PB 2F7RA 1RPQA 3FW6A 3QJTB 2JCCF 4PJAB 1MWAL 2WLKA 4WY7L 4Z7VE 5LG6A 3VWKD 4OCWL 4CKVX 2IH3B 3DURB 4WY7H 2VDQB 3F7LA 1MWAH 3T0VA 3U0TA 2R1YA 5CEZD 3F7VB 5M94B 2F54A 3A6OA 1TEGA 1G9NH 3ATAA 5AVRB 1F58L 4Z0BL 2IOMA 3QUHA 4O02L 2ZNXA 3O9WB 4ZNCD 2K7QA 4BZ2L 4QR7A 4V2BA 3EJPA 4Z0BH 4UUJB 2EDDA 4YSPA 3RIFF 1S78C 1WBYB 4O02H 3D3VD 4BZ2H 4WCYL 4PG2C 5I75C 1ES0A 1G5GA 3K2UH 5CR8A 5BOZG 2ICWJ 3D12B 4LAQH 4YVNA 3MLVL 3GK8L 1CYXA 1GS8A 2JJWA 3K6NA 2LVEA 3O3UN 3UO1H 3TBBA 2DQGH 1JN6B 4G6FB 3D4CA 4ZUSB 3RNKA 1DJWA 2LLNA 3C5ZB 3M46A 1WTLA 5EWIH 2PMZA 1ZS2A 2WC7A 4FI7A 3ATFA 5AL0A 4FJZA 4LLUB 3HOGA 5FO7B 5F7MC 2VXVL 2R4SH 3ULVL 1NKGA 4QI3A 5IREA 1XFPA 2EC8A 2VXVH 4RGOH 4GXUN 1E4XL 4JFPB 1EXUB 2OL3B 5EU6A 1AKJB 4U6HA 1BVNP 4K94L 5HGBA 1E4XH 3AXHA 4QRFA 2UX7A 2A7BA 4H8WC 3IDYB 3N9GH 4MXWL 4RDBA 3WFEL 3PNRB 4GO8A 2HXAA 4Q74A 4AT6B 4KZDL 2G9HA 1XGPB 4NQVA 4DFHA 2JVUA 4HF5H 4L9LC 2N56A 4OJCA 4OR1A 5SWSD 4HFWA 4F33B 3B9KB 2H9GB 4OUUA 1CF1A 3UBXG 4DK3A 2A9ML 3C5SA 4WEUD 4PJ9B 1T04B 4XNZC 1RP8A 5FM5O 2Y22A 1DJXA 1NPJA 3OKLA 3P3UA 1E2ZA 1CD9B 1VIWA 2CRIA 1QLFB 5T1MA 2WGXA 3DX8B 4WIQA 5KUKA 1U30A 2OMZA 3CVBA 1E27B 4PWGA 1P4IL 4FNUA 5E23A 43CAA 4BH7B 3CZFA 4PLKD 2E4TA 2X4PA 4OD3H 4NGHL 5SWQA 5DRWA 1SF5A 5AVYB 4FHKA 5JHAA 3BP5B 4G8GA 3RNQA 3IFOB 3LD8B 4KO5A 1Q0XH 5B39G 3SCMC 1S9YB 5DEFA 4YNYA 1SUJA 4NN7C 5LLIC 1JD7A 3NIGB 3FQ1A 4WFED 2VXQL 3IU3A 3TM6A 3GINA 1PFCA 3ZXAC 4Y5YA 2ZAHA 3DHUA 4JANA 4LMQE 4MRBA 4ZOCA 2CDFA 2VXQH 3G6JA 4ZQKA 5EU3B 3VSTA 3VXSE 2ZYHA 3S3DB 3AQDA 3UTTB 4GRMA 2VLRD 5DMGD 3RL1A 1LHZA 5E00A 1KIQB 1N4XL 1GMEA 2A73A 3WGVB 1J1XL 4OCNC 4NQTA 3CFUA 3RX9A 2DBJA 3TFKD 4ZUVB 4M5ZH 4N2IA 4J12A 1J1XH 3KR3L 4FFZA 5I2IA 4PV8A 4JDTH 2EDWA 4P04A 4YSRA 2XG5A 3ZU8A 3KR3H 3EGXB 3LKNA 3NJJA 4LT7A 5D96C 3V5DB 5JHDA 3RP1A 5MENB 1L3NA 3TA3C 4HXBL 3ZY7A 4Y2OB 3L9BA 3LQAC 4A2LA 4K5PA 2JLLA 3CX5J 2OSWA 4F57H 5C8JB 5K59F 4HGKC 4ZUUB 2HTLD 1AJ7L 1I8KB 2WKOF 3MV8D 1I53A 3F65A 3PL6C 5E1HB 2QPFA 1GZQA 5E8OB 2V2XA 1RU9L 5DHYB 5SWZD 4HHWA 5E2WH 3P73A 1RU9H 3IAPA 3Q6GL 4MWFA 4GUOA 1KV3A 2AQ1A 4B53A 1NBZA 2FLMA 4DN3L 3Q6GH 4L0ZA 3OKKB 5DD1L 4M9OA 2PPCA 4DN3H 4XVTL 3AB0B 5DD1H 3VQMA 5JOEA 3SBQA 1QSZA 4K71B 1JDDA 4C8XA 3D8MA 4GXFA 5HD8D 4KXCA 4FXGA 5HVGB 4WUUB 1MZYA 3AACA 3IT8D 3ZDWA 1Z9SB 4DEWA 3S96A 3CFDB 1QABA 3QQXA 1TQUA 2HVKB 1IARB 4X4ZA 2WZ0A 3PWJB 2ITDA 2VQ1A 2O5NA 3H2WA 4JJHA 3HMXL 4TMPA 1YEFL 4X99A 1ZHBA 3UFIA 5B38B 3IDNA 1RK0A 2LU7A 1M6OA 4QAMB 3HMXH 1R24B 1CUOA 3KLLA 3VXTA 2AJZA 5CP3H 4AQEA 3U79A 4PWEA 2EINB 1D9KB 5AOJA 1JRHI 3DRTA 3F58L 3ZKSD 2R15A 4OZFA 5JXAH 1PZ5B 4QHLB 2AKRB 4BKTC 2ATPA 4L3EE 2KDGA 4M8VA 3MRDA 3BZDA 1KCKA 1YEHL 1XCTB 2VDKB 3WS6C 5JW4Q 2R4RL 3Q01A 1TKWA 2G5RA 3OKOA 4EVNB 1F6LL 3LV3B 5K1NA 4MXVF 2PYEA 2G0LA 3AS1A 1KULA 2R4RH 2DIAA 1M71A 2KYIA 3NSXA 4K7FB 4Y5VC 3GJEA 4EXKA 4Z7OF 4WWNA 2X1XR 5I9QC 5DVMA 2X4RA 3PWPA 1T0NB 3OXSA 3V4PL 5KYUA 1NIBA 4OFYD 3HCVA 4K9EL 2VISB 5J13C 5DZOA 1QR4A 4YDLC 1I8UA 12E8L 3AXLB 4BSWB 2PXYC 1C16A 2MQCA 4AVIA 2DM3A 2X88A 1J5HA 1OAZH 1IEBB 1XV8A 1C9SA 4JO2L 4WHTB 3BP7B 3B2XA 12E8H 2Q5BA 4P2OB 3EF7A 1NC4D 4JO2H 5DSCA 3V8CA 2B77A 1YCSA 3JWOC 1EJOL 3F05A 4RISH 4WKXA 1JHKL 1U8QB 1T66C 5ADPH 2BVYA 4KTDH 1EJOH 1W72H 1I9JH 3NYKA 1JHKH 3B7RL 4JGUA 2EDFA 4NUGL 1EWHA 4DUVA 4X83A 5LBGA 3IDUA 4OF0A 3FO0H 1E40A 3Q13A 1OXYA 3CJJA 4NUGH 2AK1L 4A2FA 4IRSD 3MHZA 1S7VB 4PTUA 1SXZA 4FERA 3TOPA 4WGWB 7FABH 4C4KT 2BSEA 3BVWA 4KHTL 2SODB 1GCFA 1B90A 3UZQA 1IGFL 3WNOA 4XHJC 1CB4A 1RY7B 1AXIB 4KHTH 1R5VB 3FB5B 4KJPC 1FA4A 1QFPA 5CBEB 3TL5A 2G75A 4OY9A 4DP5X 1R33A 3D69B 5DJZB 5B1CA 5ICXA 2ODIA 3VB9A 3GSWB 3NRFA 1AIFA 1E9PB 2IDCA 4QRPE 5HDQH 5KSAA 2VH5H 4PCSA 2ZUQB 3O9WD 4ADGA 1FE8L 2C3HA 1MFBL 2OMUB 3MRJB 1WWCA 3C09C 2WP3O 4B9ZA 2IFGA 4Z7NE 1MFBH 1XF2B 4HWNA 1MVYA 5D7IF 5IF0B 4X8JB 1YEKH 3EHBC 4WFGD 3ULUE 1ZHKA 1ZT7B 4CC0A 2BMKA 1SPDA 2B1AL 1M1SA 2CLRB 2D4DA 2OMXA 1YPZA 2QGCA 2MIZA 1Z0NA 3ASWA 5HPOA 2AEPL 2B1AH 3D33A 3EADA 3HBGA 4YHIA 5MHSD 1UB5B 3QIBA 3RFRA 4XT1C 3IMSA 4C4UA 4S1QL 1UJTA 4X0NA 2AEPH 3AJ7A 3UTQB 1FVDB 5D71L 4BFGA 3GSXA 4JRLA 3WFHA 4EZKA 4YBLB 4PJHE 3LS4H 3OKDB 3TEYA 1HILA 2AZUA 4MCZA 4WHCA 5AKRA 2MNWA 4ENEC 5DLML 2UY7A 5C0IB 3M17A 3IKKA 1M56B 1MJ8L 3AREA 4OGAC 1NAKH 5DLMH 5KEZA 5CEYB 1DDTA 3QPKA 4D0DB 9CGTA 1CURA 3L54A 5HI3C 4PW9A 3BPLC 3NP4A 3B43A 4O2EA 5A2AA 3DTUB 2PKDA 3FO9A 2JI2A 3EOYG 2IEPA 4KKAC 1F45A 3WTYA 3UDWC 2NY2B 3BW9A 5GRYA 3VFNB 3BQUD 4YXHH 3DOIA 3EJZD 3B9KD 4GW4B 4LHUG 5I6LA 4YL4A 2YC1B 2CXKA 2ZSWB 3RIKA 1SLXA 4PVNA 4BH8B 2BVOA 5F9DC 5I6XC 4RAUB 4LDCA 3N6YA 5CR1A 4TLKA 5D7KD 3U6RB 4PWIA 2VO8A 5J3HC 4GI9A 1A6WL 3H55A 5LGJA 3HPLB 4FLHA 3RB5A 1WAAF 5AALA 3UABA 3PGDA 3MBEB 1J05B 2OMTA 4KXDA 4GB9A 1C5CL 1XGUB 3NAAL 2WMPB 1IC7L 1C5CH 1YY9D 3DVNA 4YEFA 5ILTH 2BHYA 1BV8A 4GS7C 1IC7H 3IETB 2GITA 2F7PA 2X4NA 1NTDA 4XNDA 1M6UA 5I82A 1X44A 1E6OL 4PW3A 1UADC 1WG3A 1D5BA 1A4KB 1FNGB 5DK3A 5DJYB 5HHOB 4EZJA 5D1ZA 1J87A 3HRPA 4MJJA 4JFEA 2F58L 4PGEB 2WTRA 3VFUB 4UQIM 5CEZE 4LLQA 3WL9B 2BNQA 1FDLH 2F58H 2Y7MA 2ZAIA 1H5BA 2CHWA 1VKXB 1M57B 4O2CA 3UTTD 2VLKB 3SEPA 2HRPH 2DWEB 3T0WA 2VE6A 3STLA 1OAQL 2KL6A 1VCBC 4L3CA 3KXFE 5HYEA 7CGTA 1NINA 1OAQH 4LPXA 4AE0A 1VZGA 4FQLL 4E9WA 5DJCA 1TT6A 2QT6A 4H25B 3F7RA 3L1OL 2IADB 1UWGL 2WKLA 2MOQA 3B2PA 3V0VA 4F7MB 1TENA 5MEND 3L3JB 5C2UB 4NQDA 3VRLF 1QR1A 3QYNA 4Y0GA 5SV3A 5J1TC 1IILE 4N9GB 2F7OA 3FU6A 3H54A 1T6WA 1M2OA 4K3JL 5AVUB 1G7MB 5IW3A 2KH2B 2OAAA 3SO5A 2GHZA 4OFVA 1OZUA 2EE0A 5GIRA 5JO5B 4N2FA 4RESB 1OO2A 4ELKB 3IE9A 3WUWB 3EJRA 3SDDB 4B5ZA 3C6LA 4GMTL 2XN9B 2FL5B 4OIBA 1LNUB 2M83A 1P4BL 2VDPH 3F6JA 5DTFB 3U4EB 4G5AA 4GMTH 1JYWA 1XTLA 2FEEL 3CN0A 3LTVA 4P2RD 5JHMA 3ZDYB 2H8PB 4KK9C 1JXGA 2VERN 4PY8J 3SE4C 1OM9A 2IFFL 3RWHA 1KYOK 4H4NA 4PFEA 1RZ8B 2PTTB 1SVBA 4WWPA 1GYAA 2D9CA 2AV1B 2JELL 4NLHA 4WUUD 2HN7B 2JELH 5I6KA 4ZTPL 5E7FA 3ZKMD 4UV7H 3SBPA 2E0PA 1J1PL 2E59A 2PR9A 4RFEB 4Q0XL 3VGHA 3C60D 4Y4KB 3E7JA 4Q2ZA 3LIZA 5CSZB 1AO7D 4Q0XH 4PIRF 5F7DA 4KITB 4JJ5A 3HI5L 1JBJA 3RFZA 2EE9A 5JXEC 4WZ9A 5IEHA 5TK2A 5DC2A 3ULUC 1NGWA 3OX8B 4OFDA 2QPUA 3DX4A 3ZZ1A 5ICZB 1OM3L 4Y9BA 3H7BB 3PY9A 2X5PA 2GTWA 3WGUB 3IWVA 5E6IA 1SEBA 4LNRA 4GG8B 3NCYP 1OM3H 3JWNH 2QLYA 2NYKA 3QDJD 1ZIAA 3HMWL 4B95C 3CVHB 4N8VA 4MA1C 4WNQB 2CSPA 3ZYJA 4BD4A 4WFEE 3HMWH 3EFDH 5CFHA 4D9LH 4DWHA 3RTQD 4M1DH 4OIFA 2QPSA 1A25A 3ME0B 4U1HA 1Q9OB 3F84A 3D85A 1JHLH 2V5TA 2VLRE 3B6SB 5AVVB 4EEEA 4CMHB 4U1IB 1ZA3A 1JZEA 4EQ2A 4N0UB 3HC2A 1NSNL 4UYQA 4AK2A 3CHPA 2X2IA 1NSNH 3AXIA 3FQXB 5C9KA 4P2OD 1H3XA 3GXFA 4I1RA 5IG7A 4KXZH 4HCIA 5TE4L 3TGXA 3KPLB 4A7UA 3K81A 1ETZA 2VZOA 3DX0A 4H7VA 2EH7L 5TE4H 4YAQA 3AROA 5CZXC 2YPVL 1HYSD 3PAZA 3LPGA 4RMWA 5IQ9A 1BYPA 5LHDA 4N0YH 2HJKB 3BMVA 5CIPB 5D7LA 1IKOP 2Y0SA 4HK3N 4JDZA 2BINA 3N44F 4QWWD 1Z32X 2EKJA 1NFDF 4AY0A 1YNTA 3VCLB 4PJIB 5IB4B 4UNIA 1UASA 4PU2A 3FS9A 3O4LA 4L4TE 4OFIA 4MJ5A 4WTZA 3F04A 3QUXC 3HG3A 2VMDA 5JIKA 5D7JC 1MWAA 5B4MD 3SKOA 4R84A 1MCBA 1I7RA 3DIVA 2EEAA 3BRGC 1T5XB 3KVQA 3MCG1 4R5XA 4AEHH 1PCSA 4P4KC 4MJ6A 5IJVA 3QHZL 5FKPA 3KPSB 4X6DB 1EFQA 3FQRA 2NY6D 5EUOB 2QR0A 4O02A 25C8L 3ETTA 2DDQL 5E9AA 4ENZA 5I0ZA 2R8SL 4BZ2A 3QHZH 2P48B 1HHIA 4WDIA 3QDMB 2E4FA 2WIIB 3EJYD 1RAMA 3AZUA 2P7TB 1Z9PA 5CEZL 4JL2A 3IDXL 2TRHA 5CO1A 4QRTA 1TSHA 2G2PA 4JFYA 5CEZH 2P5PA 3TT3L 3IDXH 3COOA 3TWCL 1KSRA 1RJLB 2VLLB 4MB1A 3TT3H 2P24B 3U1SL 4FXKA 3U9UB 4YHPA 2LGNA 4KV5F 1FCCA 4QYAA 4LO9A 4KO7A 5AKSA 1Q0EA 4PBDA 3U1SH 4DVBA 4LOFA 4DW2H 5HHMB 2DTML 2Y2YA 1A9EA 2MQ3A 3ARFB 1T20A 3BFQG 4CADA 3BUDA 2DTMH 3T3PF 2FNWA 1IRAY 3SQOL 1BG1A 3PWLA 4U3SB 3TVMB 4E36A 3SQOH 4NBXB 4NI3A 1ZS8A 2XPZA 4FYQA 1GZHA 1GYWA 2ESVA 3LNGA 5E24E 1GW6A 4PJXE 2B5IC 4K3GA 2ZKWA 5F89B 4LSPL 1XGQA 1KWKA 2F8XC 3L6FA 3DECA 4UOW1 4KRPC 3A5VA 3AU1A 1BBJA 3VYPA 4LPYA 2O6CA 2O4EA 4OB5L 3S8WA 2J8OA 3WEBA 4DZ8A 1XWVA 4RRPG 1ET8A 2ZJSL 3I85A 3LRGA 1JWMA 3T0XA 4EQ3A 4ZFGL 5KG9B 1BBDH 4OB5H 1YY8A 2P42B 4IEFB 1CE6B 3VFMA 4U0RB 2ZJSH 1I1FA 4AXWB 1TQWA 4JRYA 4ZFGH 3O45B 4D9QE 1EAJA 1KENL 1IGJB 3E9TA 1CPUA 5J6HA 4G82A 3NACH 1D6EB 2AI0L 5E5UB 4YIQA 5T3ZE 1P1ZA 4G6JL 3VVVA 4S0HA 1R3KA 2C9QA 4PJAE 5GRXG 1NFKA 2AI0H 1U3HD 4YFLI 5DO2D 5KVMC 2NY0B 4G6JH 4APQB 2V5MA 2GUYA 3EFFA 1U2HA 1YAZA 5IVXF 3QRGL 3UZVA 1JUFA 3UZEA 5KSBA 3U83A 4ELMB 1QBLH 1FFQA 3S9DB 3TBWA 4QYOA 1WA2X 4M02A 2XV3A 4PI0A 4OZHA 5IMOB 4O5LL 2WVVA 2NSXA 3TBSB 1Q38A 2VXQA 3DOSB 1BYOA 2XVBA 3K80A 3Q43A 4YXKL 4M7KH 1JNJA 4BKLA 4IOIB 2YD2A 2BP8B 1DDHA 4YFLF 4B9YA 1K72A 1ZVSB 3RPKA 5CGBA 3CHRA 3D34A 3ZMRA 2CJ3A 2Z0UA 3MRGB 1MY7A 3I50H 3ZPDA 1BIIA 3SOTA 4WW2B 3MUGA 2NNXA 4WFGE 4RAHA 4X7SL 1NOFA 4JL1A 4XMPL 5JIPA 1JGEA 4F80A 4N2OA 3I2CL 4TUOB 4XMPH 1A6AB 4X7SH 3DUSA 1J0KA 4KO6A 3CFNA 3MV9B 2I07B 2L7JA 3I2CH 3MPCA 3WTSA 4N24A 5ACZB 3H3BC 3MRNA 2DOCA 4H0GA 4NKMA 5FO9A 1Y0LB 4ZXBA 4N8CL 3KH4A 2QQNL 2LT9A 5AAWC 4N8CH 4BSVB 1FC2D 2D31A 3GTTA 2XN9D 4PCKA 4L1LA 4LK4A 5H94B 3QWRA 1J88A 2P80D 2JFCA 1HIML 5DJ0B 1B9ZA 2FJUB 2K3HA 2PCFA 5FA4A 1M9WA 2AQ2A 2YKLL 4NPJA 3CQFA 2CIIA 3HEIB 1B4RA 4XNUL 3MRLB 5D8JL 1YO4A 3T08A 1OT2A 1WWWX 2DY2A 4HKJB 2MFNA 2YKLH 3D07A 4MCNA 3EXLA 2AAVA 4XNUH 1KPVA 4FG0A 1I9RL 5ENWA 3GLAA 1PKQA 1N8ZB 2EIMB 3GIZH 4EXPX 3SBRA 2ZOKB 5EC1B 1I9RH 1IMHC 5A3IC 3O6FA 4UT9H 3SE8H 1TU2B 5D72L 1S6NA 4AIZB 4LOVA 3BVNA 4PREB 2ZSVA 4AGQA 3CQPA 4PP1C 1IQDB 5D70L 3KDMA 4G8IB 4J3OH 5D6DA 5F7EL 4I3SL 2PO6A 4EUPG 4Z7VA 4E0RB 2AK4B 3LXCA 2YUXA 3ES6B 1UOVA 1XZ0A 2FATL 1KGIA 2I5YH 3DK0A 2WKGA 3Q5TA 3PFUA 1PDKA 5I71C 3HMXA 3WLWD 2FATH 4BZ1L 3CFBA 1AC6A 2IWKA 2UUDH 5CP3A 5LNDA 3BD4A 4PS4L 4UT7H 5G5DA 1MCNA 1BD2A 1Z9MA 3K0WA 3K71A 3ARBA 1RIVL 1RHHB 4GBXC 1KIRA 1R3HB 1DVZA 1CU4L 1OHQA 1RIVH 3NIGE 3PDOB 1B0WA 5FFOA 1XAKA 1EFXD 1CU4H 3MUHL 1DEEA 2OMYB 3E38A 4PSRA 3GRWL 4NAQA 3MYJA 1PD0A 3HTLX 5CLWA 3KLHC 2XCMC 3FSAA 1X9UA 3GRWH 3UTTE 1THCA 3LRMA 4HIJA 4KQ3L 2CKBL 3GTNA 5CSGA 5EOQL 4BFIB 3TU6A 1AR2A 1HE7A 5FYLD 1JGLL 2J25A 1WA0X 4KQ3H 5DD3H 3ARDC 3GB7B 3TA3D 2WBJA 4J1UA 5F21B 1GA2A 2CIKB 3D08A 2TSAA 4KTYA 1TZOA 4U7KA 3QHTC 3WNKA 5CXPA 1CFSA 2WZPA 3PL6D 4AJ0A 7PCYA 1WS7A 3WD5H 5MENE 1P7KB 1E30A 2BSSB 2MKWA 3ZDZB 2FR4B 1XMWA 4IU2B 1UENA 4HDIA 4OM0L 4ZAKC 3QA3A 4I0PB 4Z7UA 1XAUA 5FIEA 1W72A 2MEJB 4PLJC 5HGAB 1QNIA 4AGPA 3X11A 4ZTOL 5IB5B 4OM0H 3UTPD 1WK0A 2R69L 3KYKL 1NCCL 4M8UA 4ZTOH 2YO3A 4IKKA 1CI3M 5EZOL 3IBEA 1QEWB 3KYKH 2WVUA 1NCCH 5G4MA 1YN7A 3D25B 1L9NA 5IW6A 4AUUA 1IAIL 5DQ9A 1PTZA 1X5YA 3IJ9A 4MDJA 3BHBB 4ODWA 5IM7A 2QKIB 4MLSA 1KLFA 2BNUB 1HVXA 2XKNA 4JBSA 2P44B 3VI3B 4KQ4H 4X9GA 3ATDA 4MNQD 4UOZA 2BHUA 1MCWW 5I8OL 4HQQH 1AXTH 1UJ3A 3BZ4B 3S37H 3GQFA 1PEWA 1TYRA 3DUHA 1I3UA 4WUUE 2FJFB 3SGJC 2DQDH 1MHPL 4ODVH 1G7JB 4ZNEA 5JIMA 3BC9A 4KDTC 5T3ZL 5J5EA 3MRMB 3TCTA 2W60B 3C5JB 1BM3L 1MHPH 4NZJA 1K8IB 5ALBH 2MRYA 4QXTA 4YR6B 3HC4L 4F7TB 5KS9B 1BMGA 3JYBA 2CNZA 5TE6L 1UT2A 2WP3T 3HFFA 1N3NA 4NQCA 1DJYA 3PQYD 1AHKA 4YHMH 1V7ML 4U6XB 3QQ9D 3US0A 4JDVA 1BW8A 3FHAA 1V3MA 2Y7QB 1TTCA 2B0SH 2Z65C 3NJKA 4H8PA 4L4VB 1V7MH 1VFBA 5KW9H 4X4MA 3D2TA 5B1AB 1Y1DA 5KBMA 2WQWA 4G1MB 4A67A 3PUUA 5DUPL 4ZFOB 3FH8A 3G04B 4G8AC 4LASL 3PWUB 1T0MB 3GMNA 5DUPH 3QIUA 3C5ZC 3MCLH 2HG0A 3VXRD 5HYJB 3NSYA 4L8BA 4KVCL 4AG4L 2GFBA 3NUKA 4AGOA 4ELDA 2P8PA 4GAJL 4AG4H 4KVCH 3LHPH 3DMMA 4XMUA 4HPOL 2DIJA 4DGIL 3IFNH 4JFWA 4MAUL 2IBZY 1PJ9A 3P54A 4HPOH 3PJSA 3VFSB 3AAZA 4DGIH 1J5IA 3ZE1B 3D0LA 5AVTB 5AD0B 2G5BB 4ALAL 2JKRM 1UG9A 4NUJA 4FZEL 4L23A 4ALAH 2OL3L 2EKSA 3MZGB 5A2JH 1PF3A 2CCLA 2QVKA 4JVPA 3L8QA 2YSTA 4HOMA 2BPBA 1UA3A 1WO2A 2OL3H 3KYNB 1HH6B 3RY6C 2IQAB 3BWAB 6PCYA 1XVSA 3BISA 2E7BA 1W0VA 3M1BA 1USZA 3I02A 1E8WA 1Y7VA 2VRQA 2ADIB 1QG3A 1Y6MR 1LILA 3GEFA 3GIVB 2GYSA 2B4CH 2LAAA 3E2HC 1T83A 1G4RA 2CUAA 4XCCH 1NAML 1A7NL 5F9JB 1ZANL 3RUGF 4PIBA 3H6JA 4MCYB 2X05A 1NAMH 3QQNA 2NY0D 3LNEA 2VDLB 2QV2A 1QYGL 5DD0L 3DO7A 2JJUA 1TXKA 1QYGH 2C7FA 4L8SA 5DD0H 3TO4B 3QG6B 4U1GC 4JZNA 5GS1A 3CMOH 3B7YA 4XBEL 3EYFB 4PJBA 3MGOA 1A65A 1QW9A 2J3SA 3ZYIA 2DQIL 4DP4X 1ZWIA 1J86A 1UM4H 4N2KA 4RWHA 1T1ZA 4YSDA 3SOBL 5CMAB 2DQIH 4KDVA 4HIHA 2QQKH 5GGQL 4OGQC 1TQCB 2XPYA 2IALA 2FD6H 3MRPA 2ADGB 3SE9L 3WMPA 4TNVK 3SOBH 5BRZB 4EI0A 4DK5A 5GGQH 2EDEA 3SY0B 4WI6A 1IM3A 3WEAA 2VJXA 4GXUM 3VWJC 1A6TA 3CH8A 4D0BA 3PFQA 2YRBA 3QFGA 2VMJA 2H47C 1I1AA 1HJCA 5K93A 2NX5B 1QNZH 1HHHA 2ICES 2PW2B 4ZO9A 3HE7B 3PJLA 3QXDB 3DROA 3QCVH 4JZJC 4TNWK 3X1BA 1E50A 1U8KB 1A9VA 1A1NB 1MHCA 3VH8A 2BCKB 4PJEF 1N6VA 5HYSA 1A0QL 1OT4A 2XLLA 1KN4L 2C9VA 5HBBA 5LBVA 3V79C 3V0EA 2BVPB 2ICCA 1XBRA 1KN4H 4IHBA 5F9OL 1ZJBA 1S7QB 1KYOJ 2LVCA 3FH5A 1F4AA 4MMYB 5F9OH 1Z5LB 5J3HD 2UZXB 4GKSA 4XVSL 2NUTB 3EO1B 3QWOB 4YE4H 4O58H 2Q2LA 3AB0C 3D39B 3RAJL 3LVEA 4XMTA 2X70B 3VGAB 3BT2H 1AE6L 1T80A 4TUUA 5C3TA 1AZCA 2GTZB 4PB0H 1X5LA 1C12A 5FGBC 3JTBA 5E8NA 2AK4D 1AE6H 3HG1A 5C0CA 4OLVL 3MDJA 1MWOA 4O9HL 3S5LA 2ITEA 1KLGB 4TSCL 2I69A 3DV6B 5ANMA 5EIVA 1OLLA 4OLVH 4F8PA 3EYSL 2E8ZA 2FYVA 4HUCA 4LEOA 1MW3A 4O9HH 5FW6A 1KBGH 4B27A 3CHSA 1YJDL 4PJCA 5TH2A 1RJYA 3ZJAA 4FFVC 3ESPA 4PJ8A 4Y4HB 3MNZB 3RVWC 4Z3IA 2VMEA 2ARJB 4XCEB 5EMYA 4HX1B 3N0AA 5HHOE 1PZ2A 5E9DD 1PLGL 3N04A 3UCQA 1D9KC 4R0LA 2IBBA 3QZMA 3DUUA 2UVFA 4GAFB 4JGJA 4N22A 2VLKE 1F1GA 3EH2A 5ISZD 3I3BA 2APWA 1ACYL 3ECBA 1HNGA 3BI9X 4F5CE 2ZT9C 2XQYG 4JO4L 5JQHC 1ACYH 3EKCA 1TZAA 1BFOB 5I8KL 2CDGB 3J7HA 3V7AG 2VDKL 1AD0B 2X6BA 2PPAA 3IDMB 3QDGD 4NC1C 4Y5XA 3FTGA 5I8KH 5BQ7A 4TVSa 3TBVA 3ZTJG 4FMKA 3T9WA 2X0WA 5EBGA 2X2YA 4BE5A 4PRHA 4I3GA 3FCSA 4I0PD 4RQQA 4X0KA 4D8OA 3FQYA 1P7QD 2FWLB 3FB7B 5BVJA 5GZOC 3MNDA 2IO5A 4I89A 2IF7A 4KK9D 1KCRH 4RAVB 4G8FB 4DTGL 5KUMA 5KTEH 4GEIA 2XN9E 3HNTL 3IPBA 4LSTL 5LXGH 3QC6X 1FN4A 4DTGH 1PVHA 4CVZA 4DERA 4JPIA 2OTPA 3ARGC 4MD4B 1IJ9A 4PRIB 2Y36L 1NPNA 1YC8A 4YZFF 2CJUL 4JM2C 5B1JC 3ZDYE 5C6TL 4PJ5B 2EXWC 2Y36H 3HFML 2XZAL 2CJUH 4J8RB 3GMOA 1CFQB 5D1XB 4BKSC 5ERWB 1SGKA 3HFMH 1EEQA 4KO9A 4YDJB 5EF2A 2F5AH 1BPLB 1U8MA 3KPRA 3U0WL 1FP5A 5FB8B 3CVIL 4XE5B 3KLKA 3U0WH 3CVIH 5FFGA 5JXED 2C9AA 4HA1A 1F11A 4Y7OC 5F1NA 3UL4A 3QI9C 2YFOA 3AMKA 4W9JC 4MNGB 3QCUL 3RWFA 1B6UA 3VWKA 4W81A 4C56B 2APVA 3K74B 1JGUH 1NMAL 2NDFA 2D03L 3SDCC 1EJ6A 3SE6A 4BZYA 3FCTA 3VXMD 4AIOA 1RPKA 1YG9A 1IEAB 3NJLA 5HY9A 3VFOB 3D3VA 2FX8L 5HYJD 5I5JA 2XG4A 3CH1A 1Y6NR 1AR1B 1UT1A 3A23A 2FX8H 4WV1A 2RAMA 1IBZA 4FA6A 3BIKB 3ZHKA 4A7GA 1FFTB 5A43C 1HL9A 1QUNA 2FX9L 1GJIA 4TLUA 3GBNH 3KGTA 3L7FB 4QXGL 3BE1L 3QPQD 1VFAB 4KJQC 5BCAA 3BE1H 5I5IA 4N0UE 4JN1H 1WS8A 4E5XA 5I1AB 5TGBB 1F4YL 4FNRA 1GGTA 1NBVL 5CZXD 5E2TH 1HZLA 2B14A 4UAOC 1F4YH 5B7MA 3NSJA 1ZT1A 1NGXA 3P02A 2A9DA 1CDYA 1NBVH 4MQTB 2X6UA 4Q4EA 3ZIMA 2NY2C 2XWZA 3PREA 1H15B 1XF5A 2EDJA 5JMRA 1R3LA 3K8KA 1U8PB 1NCGA 3CE1A 3DDFA 4GW5A 4P49A 1MHHA 5CLTA 2Q6WA 3G6DH 4R7XA 4GQZA 2AJUH 3BPNC 3L5WA 2CO2A 4NO0D 2ZXDA 4X6CA 3X1GA 4UT6L 2NMSA 4QGYA 4YSOA 5EIIB 4AL8L 2MTAA 3D52A 5D7JD 4B41A 4H88H 4PJIE 3MRHB 2CCVA 3MBEC 4AL8H 1ORQB 2EUZA 1ZKAA 2F6AA 5SWSA 5B8CB 1XGRA 1UCTA 2YOCA 1WFIA 2DQ6A 1U8HA 2NZIA 5HGDB 1BJ8A 2ZP0T 3DJZA 4P4KD 2CU9A 4HKZB 4XWGH 2DLEA 3BDBA 2VDRH 5C0FB 1P5UA 4HEMA 4GT7A 1X3DA 4NQSA 4NFBA 4K5MA 2W5PA 5JPNC 2CM6A 1EEYB 2RQEA 4YE0A 5J4MA 3KPSE 4X6DE 1J9TA 5EUOE 3S4SB 4MBRA 3RB7A 4KNUA 4OZIF 4YOKA 4WNJA 2DWTA 4XZUB 3L81A 4HOXA 5GZND 2VKXA 3QDME 3O41A 2XSKA 5LNEA 1OEZW 1BLIA 3LN5A 3UAJC 1DJSA 2ROXA 3NBNA 4BRJA 3RVTC 1N18A 1RKRA 2FK9A 3KPPA 4HZLB 3DOHA 1XB8A 4N6RA 3GO1H 4N1EA 3CZLA 3QUGA 2E56A 1SMDA 5DJ6A 1T3FA 1T4KB 1U3NA 5CGYD 4JQXA 3GXPA 2CCWA 5JDSA 1BZ8A 3DRQB 5EORL 1KBPA 1AXSB 2NX5D 4KUZL 4Z7QB 3EOAB 5EORH 5HHME 5GGSA 2WNWA 3EYOB 3HE7D 1AFVH 3I75B 3OQ3B 4UTBL 3SBWC 4EN3A 1O5DT 1WF5A 3V0WL 4DPRA 3VGFA 4B96A 1I7TA 1R6VA 1OTUD 1VZHA 3H56A 2ZTBA 5E1QA 3EJCA 1MLBA 2X6CA 4IU3B 1UOLA 1IC5H 3PLYA 1PZBA 3DX9A 4RSYA 4GRWF 5LGHL 3IAGC 3MV8A 4LCWD 4PTTA 4UT9A 2VNCA 3UH8A 4IW4C 5F7HA 2FO8A 4TSBL 5SWZA 4QHNA 3FT0A 3CSBA 3MLZH 4QRSB 1E7VA 4RGNB 5C0AB 1GMIA 1W80A 5AVWB 4L37A 1HSAA 5JIIA 2EE2A 4I5BA 3LKPB 4P9ML 4JMNA 4XMVA 5GJSL 2BSCA 2N7BA 2NXYC 2CO4A 4Q89A 4XPTH 4MS6A 1SZNA 5GJSH 2FAUA 1O6SB 3QNYA 5JOFB 3QZPA 3JTSB 2N4IA 3H4HA 3S37X 4MMZB 5IIEA 4DP0X 3RX8A 3V0FA 3PRZA 4UM8B 4YZWA 3B7UX 3QNXB 2CO7A 4ELME 5C07B 5EEUA 1KXHA 4FTVD 1GSMA 3MRFB 4XVUD 2OYLA 4IIQB 4XPHH 5F1IB 3JV4B 3WFCH 3DJRA 4EN2A 3GRWA 4MMXC 1KGWA 1PX4A 1UHVA 3X3GL 3IFPA 3TV3H 1TVHB 3GRBA 1P2CA 3CVHL 4TL4A 4BFRA 1FZMB 2VZ3A 4NENA 1OW0C 3SQBA 3QZWA 4XX1E 3EGSA 5CSBA 4CMHC 2FJSA 2VXTL 3KWWA 1KXTA 2CLZB 3MA7A 3NIFF 4OQTH 3MV9E 1OANA 2ERJB 3PDGA 4W9HC 3FB8A 1E9OB 5HHNA 2MHAB 1NEZA 3NFSH 5IOPA 1FPTL 1A6VH 1DFXA 3TONA 4KY2A 4WWOA 4EKJA 2FO4A 1FPTH 2YD7A 4QXUH 5L4MA 4NNYB 5IV2B 3UPCA 5FYLH 4OFYA 1IM9D 2HT4D 3UPRB 1ZVHA 2HJLB 1KJ2B 3AG1B 1BZ9B 3QQDA 1ESOA 5EBWB 3EYUH 4PRID 4PJXA 4APXB 4U3HA 1QLEB 4PJ5D 1NC4A 3VFPB 2CR3A 5I1JH 1Q9KA 1JNNH 1VAHA 2Y1ZA 3ABLB 3NRPA 1MLCB 5HJDA 2J1XA 4FG6D 4PP1D 4RCAA 4O2FB 3TJEL 4D9RD 5FYJD 5C09B 5HXMA 2QVIA 2AF2A 1Z3GL 3HS0B 4LVNB 4XTRC 4TTDC 1B0RA 1BCIA 3E6FB 5L4JA 3TJEH 5L2JB 3BGFC 3L4WA 4OSUH 1I31A 3EOBA 5EZLB 1WD8A 4NXKA 4AYMC 4NCC1 2NNAA 4IRSA 5L88L 4BK8A 1I9IH 4UQCA 4DPBX 1JDCA 4R7LA 5CJBA 1EEZA 3IF1B 5ANHA 3MLWL 1A64A 4LKCB 2AXHA 2OI9C 3D0AA 5GJTH 3K4AA 2E47A 4F3FA 2AK4E 3KGUA 5IFJA 3MLWH 3KCPB 3OVUB 3ZO0A 4GBXD 2HCZX 32C2A 3QAQA 4R96B 3F7VA 3U6XS 4CGTA 5IROC 4FQXB 3HI1B 1B4TA 3UGXA 3W57A 5CGMA 2Z92B 5HDWA 3O9WA 3TP4A 3L5IA 5JR1H 4MJIB 4ANVA 5TDOB 4UM9B 5KYNA 2VN4A 3AY4A 3RVXC 2CK2A 1KTDA 4UDUB 5DR5L 2XXGA 3S35H 3ZSTA 2P5EB 2AITA 1QSFB 1AR1D 1I8MB 1K85A 5F7AA 1HX0A 1YAIA 1OGPA 4GW1B 4WU5B 3FRPG 2YBRA 2QEJA 3R06B 4Q6IC 5J1AA 4MA3B 1UKQA 4FLSA 3VFTB 1GTNA 2CNYA 2HB0A 2JJVA 3ZN6A 1ZE3H 3JZYA 2RTTA 2FJHB 5E6YA 3ARFC 1L6XA 2V5YA 2AJYL 2QMKA 1S9VA 5H35B 4PHXA 3MZTA 4HUVB 3OKMB 4NNXA 4HUMB 4ZAKD 1G7LB 4FQJH 5DRZB 2VAAA 4K9JA 5C70A 5FO7A 5DJXB 1CICB 4ZO7A 4EKXA 4P99A 3AFLA 4WW1A 4ZUTB 4F8QA 4DUXA 3ETBF 1FG2B 3K91A 3ZDZE 1LO5B 3CFTA 4KJWC 5FPIA 1K3IA 1EXUA 2OL3A 3RY5A 4FC3E 1NDMA 4NKOB 3T2OA 1TJGL 4DOHB 4LSSL 2OCFD 2RQ8A 1JTTA 3BLKA 5I8CA 2WLHA 1TJGH 5EO0B 4CVXB 4N2MA 4Q58C 3JWOH 4LSSH 2DYRB 2VSMB 1AQDA 1VZIA 4WGVB 5BV7B 4ZOBA 2D3VA 4AVJA 5A6IA 3K8MA 1PY9A 1UGKA 4I13B 3BAEL 3BQUA 4K23L 2BSTA 2WVTA 4AGLA 3B9KA 2H9GA 3GZOA 1CTOA 1NAMA 3VG0H 1Y1UA 3HE6C 5CWSA 1AMXA 1A9BA 3RWIB 1MCSA 2FTAA 3STZB 1JXDA 3VI3E 1UZ8A 4AYID 4YUEL 4DP8X 5C0RH 2WNXA 4JFTA 3GGWA 4R5VA 4YUEH 1J0YA 4FQ2L 4APQC 2VITB 2SEBB 4NN5C 5LAXA 5G2NA 3RVVC 4HISA 3WXWH 2YARA 5GRUL 4CN1A 5M7QA 2FSEA 1DUZB 4FQ2H 5I8EA 4ERSH 1YEJL 3TPUA 3WY4A 3EXJA 3A21A 3IFOA 5KS9E 3FQTA 4CGUB 1YEJH 3FT2B 1S7SB 1T7XA 3SPVA 2XTSA 4LESA 3UO8B 2AQPA 4HBQA 4Z0XA 3QJSB 4L8CA 1XX9C 4IRJC 2WLIB 5D2NC 2DL9A 2DQJH 4J28A 4IYKA 4L4VE 3TH3T 2JE8A 4XNAA 3U2SB 2LE9A 2GJZA 1JMZA 1YDPB 2X4TB 4OCXH 1OK0A 3UTTA 2UY6B 1RJZB 4QCIB 3VI4B 4JFUA 3QJXA 3IJEB 2C9RA 4AYGA 4GQ9H 3KS0J 2ITCA 3PPEA 2XKSA 1UWYA 5AOMA 5J11C 5HYJE 5E08H 1SJXA 2I9LA 3KPOB 3U9PL 2D9QB 3E0GA 4FD0A 3ARQA 2Q7YB 5IJKA 1BQHB 1UXSB 2D7MA 4HJEA 1AGCB 4XC3H 4UINL 2ZUTA 5F71A 2EDYA 4J27A 1TTBA 2VLJD 1HCZA 5MENA 5DS1A 3GFUA 4UINH 1TFHA 3DLQR 4WWKA 2BJML 3ZE1E 3R4RA 1Q8MA 2X3AA 1TTAA 1C5DB 3HZKB 1I8KA 2K45A 4KQ0A 5LKNA 2YA2A 4H2AA 4ODTL 1A5FL 2AS5M 4CILA 4I8DA 3T2NL 5LDSA 4RFNB 4YK4C 5FKAB 5C08B 2DLHA 3DTXA 3DYOA 4FLRA 3S34H 2ADFL 3IFLH 3TIDB 4P2RA 1FL6A 5I16A 4UQBA 2ADFH 1E4XI 4N68A 4NZDA 1BMWA 1ZEAH 3N40F 3MRCB 3GSOB 3KM1A 2IOOA 1VF5C 4EAEA 1FYHB 3OLGA 4WUUA 3SYQA 3ULVF 2BZDA 2FIKB 1Q4NX 3W39B 1Z9SA 2EDXA 1G0YR 4OKVB 3DIFB 3AM8C 5C07D 1KZYA 3GBEA 4KZCA 5D1QC 1AHMA 4BFOA 3NCBB 3T4YB 3V9EA 4JFOB 1HAUA 3S36H 6CGTA 3WJJC 2ZCHH 1B3IA 1HYRC 3C60A 2OV0A 3HUJF 5KJ4A 1UQSB 5KJRL 1AO7A 4N0FB 5DRNB 5AW6B 1ZJAA 3NSCA 3NFNB 2KQMA 4AOFA 3WE1A 1CGWA 3DETD 3RGVB 2XV0A 4JQIH 3RURA 3SDAC 2EILB 3PXHA 3QZOA 2F0CA 3KBFA 3G6AA 4GPVA 4GSRA 3FDWA 3BCFA 4QHLA 4QEGA 3MSPA 2AKRA 4AV0A 4LRIA 3CFCL 5BRZE 3QDJA 4M6OL 4RMSA 5DZ9A 1OOAA 2Q8BL 2XTJC 5F96L 3CFCH 4M6OH 1RZIA 4JW3A 2OZ4H 1S9WB 3F12A 5CNHA 3RTQA 1YN6A 2F19L 3ZKNC 3IJYB 4AKQA 4K2UL 3PGFL 1TNMA 4RNRA 5B3SB 1H6UA 2VO5A 2F19H 4Y4FB 2R7EA 4K2UH 3PGFH 2RHEA 5DEGA 2A0LC 2NX5E 1X5IA 3OZKA 1HHGA 2ICWB 1DLFL 2R1XA 3C2AH 4BSWA 5A2IH 4LPUA 1N59B 4AIXA 1CMOA 3MC0A 4NPYA 4WHTA 1DLFH 2JJSC 1QI3A 5BOJA 2GKIA 1I7ZA 5DC9B 3D4ZA 5D2LF 1KB5B 3PABA 1BVLB 1L9TA 4YSSA 1U8OB 4KRMB 3C75A 4NZ8A 4ZFZA 2CR6A 2I7SA 1LP9F 2BRQA 2Q20A 4UNTA 3AY2A 3BN3B 3D4YA 3FHEA 1OV8A 3U0TB 2GBAA 4PRBA 3D39E 2R1YB 2F15A 2QJDA 2Y7NA 4FQQA 2GPZA 1OE1A 2F54B 3QW9A 4ZMOA 4E9YA 3PE9A 1LQSR 2LR4A 4B0MM 3MRIA 3SZKC 4QRRD 3FB5A 4M9PA 1REIA 5L6YL 4K7PH 3F7PC 4DN4H 3ZT5A 3OKEA 1F42A 4FHBD 1JZ5A 2V2WA 3HN5A 6FABL 4FQXD 1SXSA 3P0VL 2B59B 1A7PL 2W1NA 3BPCA 4S1DC 4AGMA 3NCWA 1PGRB 1XD1A 3ZR6A 4L9DA 5F7BA 2P5ED 1HOCA 2FBJL 1JZDC 2IDQA 3IPEA 4NRXA 4OZFG 2O5YL 1SOSA 2E8YA 4DEUA 1MW1A 3W2DL 4AQ1A 1URZA 3GM0A 3SGEH 5EEYA 1JZHA 2O5YH 4U1NA 3W2DH 2KERA 2XVGA 4N6QA 4PGZA 3MLRH 1NKOA 4LU5L 3N43B 5EU6B 1SJMA 3OAWA 2MMXA 3BAXA 4LSQL 4IKJA 2OSXA 5HGBB 5I1KL 1CICD 4F7KA 4Z7VF 3AG3B 4HBCH 1MFUA 4XPAL 5GZOD 4OZGA 3SDXA 3I6KA 4XO3A 2G9HB 1VEMA 3V9FA 4HFWB 4FI6A 1XXDC 3VD9A 3NCFB 4OUUB 4AYDC 1YEIH 1TMQA 4Z23A 4Y9GA 4JM2D 1BJ1H 1BLNA 4ZW3A 1L7TL 2QPEB 5F6HJ 5T1MB 4KHXL 1TITA 3VFNA 3TN0C 3ASNB 1KFAL 3DVGA