5LNGA

Lectin domain of e. coli f9 pilus adhesin fmlh
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
157
structure length
152
Chain Sequence
b'FSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDLSQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGDKTPMPLPLKLYITPGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Fml fimbrial adhesin FmlD
publication title Inflammation-Induced Adhesin-Receptor Interaction Provides a Fitness Advantage to Uropathogenic E. coli during Chronic Infection.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 152
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5lngA00
4LOVA 3MCYA 4AVHA 4XOEA 4AVIA 3BWUF 1KLFB 3JWNG 5IQOA 1N12A 2VCOA 3ZPDA 5LNEA 4AV0A 5ABZA 5FX3A 5IQNA 3BFWA 1UWFA 2J2ZB 5AB1A 4AVJA 3RFZA 3JWNE 4XODA 4X5PA 4AUUA 2JTYA 1QUNB 2JMRA 5CGBA 4XO9A 5F3FA 3ME0B 2XG4B 2W07B 1KIUB 4AV4A 4BUQA 4J3OG 4XOBA 3JWNH 4X5QA 5F2FA 5FWRA 2UY7B 4XO8A 4XOCA 3SQBB 4ATTA 5AALA 5LNGA 4CA4A 5JQIB 5AAPA 4CSSA 5IQMA 4AUJA 2XG5B 2UY6B 1ZE3H 1TR7A 2WMPB 4X50A 3ZL1A 1N0LB 3ZL2A 4CSTA 4J3OF 4AUYA 4AV5A 4X5RA 1PDKB 3BFQG 4J3OH 4AVKA 5FS5A 5FLUA 4XOAA
chains in the Genus database with same CATH superfamily
5EIVA 3ARED 4AVHA 4QO1B 4E5XB 1TZ8A 1MLCA 2OKMA 1MHEA 1UYWH 1WS7A 2O5XL 5DVKA 1OAXH 2XIDA 3FONA 4L5FH 1IGIH 3NFPA 4KDWA 4PGZA 4NKIH 4CRPA 2AQ3A 4QHNB 1BQUA 2ZUXA 4U1KB 5D93B 1AFVH 1MCWW 4ZMVA 2JJTC 5D6DA 3HZKA 3WLBA 4GAGL 2Y23A 3IDNA 5EPMB 4PJ8C 5A3ID 5CWSA 1DSFH 2ENPA 5CHNB 4F8OA 3WIFB 2PXYD 3RG1C 2E7BA 3ES6B 3TYGL 2P7TA 3VXRB 5HI3C 4LPWA 3IMTA 1YZZA 4G59C 3W3BA 1WZLA 4X6CB 5GHWH 4MA7H 3TASA 1DR9A 4C59B 3COOA 4FFTA 4DEUA 1H8SA 1TXKA 3ARTA 5FW6A 3V0GA 3QJQB 2APBA 3U30B 4HXAH 1KEMH 3AJ7A 2CLRB 4JFZH 4F7CB 1KCVH 5KVMC 1A5FH 5J0BA 2SODB 4JGNA 2AV7A 3FTWA 1NMCB 3H9ZA 4X6DE 2L04A 3WBDA 3MLSL 2XTSA 1BQLH 1XIWC 4GRMA 3LQAC 3EUUA 4I2XE 4OLYH 2P5ED 1F3JA 4PRPB 3F8UB 1PAMA 5IJKA 3QZWG 1XFPA 4XOBA 5D96B 1PKQA 4KK6D 2ARWA 2G9HB 3FQNA 3V7MA 3WJJC 1WS8A 4APQB 1I3GL 3VQ1C 4Z7IA 5JHLA 2RTTA 3NJJA 3RVTD 4XPAL 3II3A 3QUZD 3R19A 1UOWA 2NXZB 2J4WL 2IFFL 1AXIB 3UTTB 1WUNT 3R4RA 1W0VA 2E7MA 4WW2F 1FVCB 3PWUA 1KCRH 5EO1B 1WZ1L 4GEJA 1WAAA 4IM8A 1IGML 2NLJA 1KJMB 1P1ZA 4X6FB 3UMNA 5E9DD 1QWNA 4C4KO 4M00A 3DUUA 2QFPA 4AYBA 3GS7A 5CILH 4U1SA 4FXTA 4D7PA 1LHZA 3H3BC 5F89A 3OMZA 2XOTA 4PCSA 2X0UA 4JFYB 4DKAA 4RDQG 4BD4A 4RVBA 4YDMA 4K2UH 3V5HA 3G9AB 1WSST 5JHAA 1A1NA 1JTOA 2NNFA 2QV2A 4DP1X 4PRHA 5GGVH 1X9RA 4OD1H 3HC0A 1BYOA 3C5ZB 3T2NL 4CUCA 5C0RH 3X11B 2XTJB 1PYWB 1AKJD 4K8RL 4LCWE 5D7LD 3HCVB 1CYGA 4AUYA 2PWFA 1ONQB 4FX5A 2FJHA 4XX5A 3VMOA 2BLFA 1XR9A 4FFVC 1NAKH 5HPMB 4MNHA 2CR6A 4LLMB 3DRTB 2EIBA 4S1QH 4J6IA 3FUDA 2LVCA 4W9ZA 1BX2B 5IOPB 5A2AA 2OR9L 1AQMA 2DM7A 5LGJB 5EWIH 1NC4A 1C9SA 1L4IA 4YSRA 2Y22A 2I69A 4KNSA 4DT2A 1MFEH 4U1HA 5AOKA 5HHNB 2AJVL 4MJ2A 4P49A 2VDKH 2Y7SA 3VGHA 3UC0H 1S7VA 3NDZE 4U6XB 1QFOA 1GC1L 4ZUTB 2UYLA 3L3KA 4G9FD 5ADPL 1FFOA 5F3HA 1KYFA 3UJJL 5I17B 4K5MA 1B2YA 1FC1A 5L7XH 2ZT9C 4Z7OF 1MF2H 3DROA 4NI6A 5D6DC 1XB8A 1ZHKB 2X1XR 3PHOB 4BFIB 1HCYA 4QRPA 1TJGL 5FKAA 5L8KB 5EZOH 3QJXA 4ZTPH 2FO8A 1KZYA 4O4YL 1A6PA 1CLZH 1FLRL 1Z5YD 3MRNB 1CD1B 5DJ8B 2YR3A 5T5NF 4PGJA 4Z7VF 5C86A 4FLOA 4KROB 4XWGH 2V17H 3I2CH 1WEJH 1BGXH 4LAQL 4KJYA 1CJYA 3NEEA 3GTNA 2VW6A 5IFJA 3WUWA 2FK9A 2RA1A 1FN4A 2B2XH 2WIMA 3LRGA 2CXKA 5C0ND 1PEZA 4X2UA 3LKOB 4LEOB 3P3TA 2R23A 1KB9J 4AYID 5GZOD 4TMPA 3FSVA 2BDNH 3HC3H 1NBZB 4XOCA 4GRWB 5AW2B 4F1ZA 2AS5M 3FUHA 2HA1A 2NT1A 1RSYA 1T7XA 3MLXH 4U1LB 2Y06H 5E6IA 5INCA 3LS5L 3JWOH 3DARA 5HHOB 3VXQB 4N0UB 4UAHA 2NR6A 3TC9A 2WLYA 3GHPA 2W65B 2Z35B 4BH7B 2FD6H 3BD4A 2L7QA 1U8HA 4APXB 4AUJA 2VLKA 32C2A 5I30H 4P57B 6PCYA 2F5AH 5KOVC 2H3NA 3OX8B 4FFYA 3T2QA 5TQ0H 2DLIA 1JGLH 3PIQA 4HX1A 4GKZA 5GGQH 4FFZL 1CI5A 3CFJA 4P46B 1CL7H 3AY4C 3F7PC 4Q9QL 4ZX3A 1GAFH 3KPQB 4G2AA 4O00A 4U3XA 3S37L 1N0LB 5HYSG 2P5WE 1U3ZA 2JKWA 2EDOA 5TQ2L 3TM6A 4LSTH 5C0BA 4N8CL 4WIQA 3BDYL 3FPYA 4ZODA 1B4JL 12E8L 1J87A 1VIWA 4PHXA 2ZAGA 4ZMOA 1KYDA 1WBZB 4DGVL 4AC2A 2A77L 1PDKB 3GO1H 3OC8A 1OCOB 2WXIA 4TUOA 5DMIH 3EH2A 1CICC 3FU0A 4LQ1A 4MNGA 5EBMA 3I3BA 1PLAA 3ARBA 1OAXL 4L5FL 4JFED 1IGIL 2XWTA 4NKIL 5EBLA 5J13C 1FVDB 1KF9B 4PCYA 1U8JA 1XWVA 2ALAA 1AFVL 2FYVA 4QI3A 1EPFA 1FFNB 3VQ2C 3Q0HA 1TMQA 2CCLA 2LU5A 3O9WD 3VDAA 2WBJB 1YMMB 1NLDH 1HDMB 1OPOA 3VO0A 2KLRA 1DSFL 2JFCA 4CADB 1UT1A 1QO3B 1IQWL 5JMOC 4EUPB 2P9RA 1XBRA 1ZHLB 3KCPB 4OH2A 3JWNC 3OHMB 1EJOH 1VSCA 4BQ9A 4CGTA 5GHWL 3L16A 3M8OH 1FI8C 4MA7L 1TQVA 1FJ1A 2IV8A 2NY1B 3OLIA 4JFHD 2ZXDA 1CPUA 4ETQA 1Q90A 4MD0A 4HXAL 1KEML 4JFZL 4Y2DD 4JREB 4RAUB 1KCVL 1A5FL 2XN2A 5ABDE 1UATA 3AACA 3QRFM 4M5TA 4ZMAT 1G7PB 3DJZA 1BQLL 1ZSHA 3BGMB 7PAZA 4LRIC 2I5YH 4OLYL 4O2CA 1OCRB 4BV1A 2NZ1A 3GSWA 2FWOB 3ME0B 5T3XH 3RWDB 3DIFA 1MREH 4OD3H 3HE6C 4Z95H 4KBPA 3SGJA 4ZZKA 3IWVA 4FQHA 5CMAB 4G5AA 5GS2H 3O4LA 3LKQA 4RGMB 3IJHA 3GFUA 1ZDQA 3L2LA 1DEEA 1FV1B 1ZV2A 4G1EA 3W5MA 2CJSA 4N1HB 2DQHH 5MENB 4I7ZC 4LAJH 5DJYB 4WI3A 5DEZA 4LLDB 2UZXA 4YXLL 1F18A 3CCHB 2Q20A 3A6OA 4WQOA 1CGWA 1KCRL 5IBTH 5HI5C 5A40E 5BVJA 1FO0H 3MUY1 5E6IC 4MCMA 2CHNA 3ZT6A 1VEMA 3GI8H 1EXUA 3REVB 1HESA 1KJ3H 5CILL 2NR6C 1ZOXA 1JD7A 2HWZH 1NUGA 2Q3ZA 4LASH 2L8AA 3WNNA 5FV1L 3MR9A 5T1KA 3F3HA 2AVGA 4NI3A 2DV6A 2VR8A 5FYKU 1TJHH 3ZE1B 4Z18A 5SX5K 4XC1H 2CBPA 4KZDH 3ZDYE 1O7VA 5GGVL 1J18A 2DTSA 3IB4A 2NYKA 3MV7D 1AGBA 3QBTB 1QFWI 4DPAX 5C0RL 3G5ZB 1YDPA 2LABA 4YPGA 5DYFA 4H88H 2DWDB 4JFFB 4WV1A 3HAEH 1G7HB 1AZBA 1OT4A 5J9PB 5FUZH 1PU0A 3FBKA 1NAKL 1DN2A 1G0XA 3BO8A 2Q8AH 2F15A 4M56A 4S1QL 4OBRA 2WLJA 4AJYV 4U1MA 1D6VH 1PLCA 2BY0A 2VXQH 4M43L 3O3AA 5EWIL 1S7RB 2UXTA 3HTLX 4F8TA 1KJ2B 3BWSA 1ZA3B 2KZKA 1AQDA 5CR1A 5JA8B 1BVNP 1MFEL 3SGEH 4FKKA 2CH8A 1BZ9B 1LEGA 4MAZA 2IXQB 3ARBC 4Z77A 4PGEB 1ORQB 3MOQA 4UTCA 3UC0L 2E56A 4FADA 4HH9B 4O5LL 2X4NA 3TV8A 3P4NB 1Q0XH 4MJ6B 3SDDB 3G5YA 1IGCH 5L7XL 2IGTA 1MF2L 2YO3A 5HGGS 1VADA 1NIFA 1Q72H 1HTYA 2XQYA 5FO9B 1CFTB 1N70A 4I9WD 4RFNB 3MRGA 5EZOL 2LGNA 4ZTPL 3T3MB 4AQAB 5DFVC 2E47A 5J6SA 1CLZL 3IDYC 3WS6C 3ZIYA 1IVLA 4KUCF 4JGMA 2FO4B 3ZGHA 4M3HA 3W82A 2VLRE 4PGCB 1BGXL 1W91A 3N41B 2WOBA 3GMQA 4KJPC 1Z5HA 3U79A 3V0FA 1ND0B 3D39A 4PVLA 4YLCA 4KO5A 4LZKA 2B2XL 4HEPA 2B0SH 4P8QA 1ZVSB 3VFGH 1AHMA 3D09A 3PAUA 1Y1UA 2H7WA 2OMNA 3BQUA 4LEXH 5F96H 5F3BA 3WAJA 1JXDA 1HVXA 3STZB 4HKXA 5HHPA 2BDNL 3HC3L 1SXNA 3DWTA 3SGJC 2E8ZA 1ID2A 2Y06L 3CPLA 3TBYA 3ZHNA 2WD0A 3KWXA 4AQEA 3QISA 3JWOL 1UQSA 1DBBH 5AB0A 2MTPA 3V0AC 2Y2TA 2FD6L 1F11B 3IS1X 4JDVA 5I30L 3MUJA 1HYRC 1SNRA 4AQOA 1XF4A 1JF5A 2F5AL 1Z9SB 1KPUA 5CLXA 4NRZB 1T1WB 3SDAB 1RPQA 4NFDA 3GLEA 4BFJA 4DCQA 1KELH 5TQ0L 2QPSA 1BPLB 1ZY9A 3ARFD 3OV6A 5GGQL 2MOQA 4QXGH 4WFGE 1CL7L 5E5UB 4UU9B 2CGYA 1HJBC 1GAFL 4I85A 1OP3H 4KVCL 2WK2A 4G8AC 1G1KA 1E4KC 3K72A 5JW4M 3DDFA 2Y2YA 3QXDB 2DQTL 4LSTL 1Y18B 4PB9H 5I0ZA 1GHFH 1AIFA 3MRPA 4Z7UB 3B9KA 2HT4C 3WIHH 1IBYA 5F9OH 1AD0A 4FJYA 3MLYH 4V11A 1OK0A 2CO6B 3DTDA 3GO1L 4L37B 1B3JA 1TEGA 4MX7B 4JPSA 4WU5A 4F7TA 1S78D 2HX7A 2B1AH 5DJ0B 4HIJA 1KJVA 3RGBA 4J8QA 4OF7A 3ZIMA 3LXBA 1AR1B 1EZLA 4ZTOH 1U8NA 4JKKA 1EAPA 2EH8H 3G6AB 1IAOA 1UM4H 4Z7OE 3QH3B 4I0PA 1G0DA 3REWA 1HSBB 2DEYX 3W0WB 1N12A 1NLDL 1SXSA 3SE6A 1T0NA 4NCC2 2P4AB 3D2UA 1PBYA 3D18A 3VH8G 4NDMA 1DDHB 4PLJC 2VTFA 5FOJA 1I7UA 1AMYA 3QPXH 3D85B 2WIIA 4NAMA 1TZIB 4TQPA 3ESUF 3M8OL 4IRJD 4XXDB 1TTBA 1RIHH 2EUXA 4I18B 2ED8A 2E74C 4WHTA 3ETBF 4AZUA 1WHPA 3QQ4A 1N68A 3AUWB 1YEDA 1R9FA 4QHPA 4J23A 5AVQB 2Y7NA 1A2YB 2AK1H 4N5ED 2VZOA 1SN5A 3LQMA 3PXHA 2XN9A 1EHXA 3T0EB 5I1GL 2WO3B 3TVMB 2I5YL 5I1DB 3K46A 1MELA 4PCKA 1S7SB 1GKOA 3NZ8A 4OD3L 1QSVA 3RWEB 1E50A 3MRCB 1IGTA 4Z95L 5F88A 4U2YA 5DLLA 1G9HA 1WCQA 3O6MH 5AZEH 3V4VL 5ID0B 4WW1A 2BIPA 4X0KB 5I74B 2HXAA 1TENA 5F6IB 4PI0A 3BCFA 2DQHL 1C1EH 4HUUA 4DF9A 4F7KA 4Q4IA 1M6OB 2BSTA 5LUMA 1SN2A 1IAIH 4JFQA 5IBTL 3PV7A 3BMWA 3QG7H 4L1BA 1FO0L 3WFHA 4YDVB 4XCEB 5E95B 1MJJA 3GI8L 1KJ3L 3E6HB 4L8DA 4B5ZA 4L9LA 2CKBA 2HWZL 3VXSE 2XG5B 2ALWA 4LASL 4R4NC 3PFUA 1DEDA 1A7RL 3OHXB 3CH8A 1TJHL 2IANE 2PPCA 4K3DH 1UXMA 4XC1L 1JPEA 1U8MB 4KZDL 4GRLB 3ULUE 1DO5A 3NN8A 4KKCC 1F42A 2GITB 4IGBD 4OZGB 3UBXI 3RVWD 3WGUB 1MCEA 1MVUA 5GSRB 5CGMA 1MI5E 5F7EH 3TBVA 4OSUL 5HYQA 4PH8A 3OR6A 1NEUA 1SQMA 3S8WA 1D6VL 5F7WC 3B9KC 2VXQL 1OGAD 1H8NA 2NY2B 2DS4A 4J3OD 3MREB 3QNYA 1JHTA 4JY4B 3VI4F 4GI9A 3HZMB 3FU8A 3T6XA 3SDYH 3C2AH 4Q6IB 5FLUA 2A9NL 4NKDA 2O6PA 3ZRCC 3WTWA 4TPRL 1HQ4A 1HE7A 1RK1A 1EAOA 5L4JA 1HNYA 4MD4A 3GXDA 4QY8A 3VGFA 2BHFA 1Q0XL 1WBYA 1IGCL 3LJ3A 1GCYA 4I0PC 4ISVB 4K71B 3QEGH 2Z65C 3D25A 3W39B 2A4EA 3C6LC 3X13A 3G6JB 2J12B 2P80A 4MQSB 3OB0K 4G6JL 3KVPA 2W5PA 5FIEA 1QLRA 3SHSA 4KOBA 5J5EA 3EJPA 4FAAB 4JLRB 1MDTA 1AZZC 2PTVA 2E4TA 5DJXA 3DVGA 1Q9OB 4ZFFA 5FEBA 5T1MB 4JKNA 4HA1A 4UAOC 4XVSH 3O2WH 2AXWA 3RIAK 1KTRL 2CGRH 2C5DC 5D1QB 4MDIA 2JTYA 2DKMA 1BAFH 4NT6A 4KGJA 1V05A 1ZT1B 5EU7E 1CQYA 4H0LC 2B0SL 3VFGL 4LXFA 1AZRA 4LEXL 3RPKA 5F96L 2DQ6A 2W07B 5EBWB 2V2WB 3BPCA 3CLEH 5DZLA 3U2IA 4LEEA 2BWDA 3ZU8A 5ANME 1ZXQA 4XMXA 3BKMH 2QHLA 5HDBF 4WEEA 5C2BH 1LGVA 4BH8B 3EYQC 1DBBL 2JK5B 3BOVA 1JD9A 1EWHA 4JZNB 4ZAKD 4C47A 3CHSA 3VI3B 5JW4R 3SKNB 1M7IA 4HSQA 3QIWA 1T89C 3B8SA 1ZWIA 2DQJH 1V3JA 4FL4C 2JKTM 3I9AA 1KELL 3QCVL 3O8XC 4TVPE 4P4KB 4QXGL 5DS1A 1ZVYA 5E8OA 4FXLA 2X41A 2V3FA 4KKBD 4F37K 4MASA 5K9OB 2CLVB 1E28A 3JTSB 4XVUD 4DPCX 2N1KA 1EMTH 2G5BB 4PB9L 5ACMA 1GHFL 2WBXA 3F12B 4ZSOB 4HCIA 2P24B 3WIHL 1J0IA 1HS6A 3LXUX 3CAFA 5F9OL 4GUOA 3MLYL 4ZQKA 2ZXAA 1WPCA 4E5XG 3B8YA 4L0ZA 3KLHD 3B7RL 4WTWA 5K9JH 3IDIB 4G3YH 3KBPA 1WWAX 5EU4A 2IBGA 5JHLH 5FGBA 1UZ6F 3H0TA 3HLAB 4TS6A 4HG4J 4ZTOL 4QXVA 2XWBA 4MZRA 5GRYA 3Q8CA 3VFVB 2EH8L 2EE3A 4PU2A 2J71A 5GS1A 1FNAA 3V4VB 3IFLH 1UM4L 4LFHD 4W70A 2DLFH 4PP2B 3ZKXC 3POHA 4JO8A 5GRJH 1DQJA 4DESA 2YN3A 5AD0B 1M7DA 3RTQD 3V5DB 4UCFA 2O6EA 3U7AA 3VFUB 3HFML 3WJMA 3ABZA 1FGNH 3P2BA 4FG4A 5C9JA 4N26A 2FR4B 3QPXL 4X6EB 4MS8C 3CN4A 4WO4A 1I9RH 2LOEA 5CZRA 4GEIA 1RIHL 3QO0A 2YAQA 4XGZB 3P4LA 2VXVH 1R33A 4NCDA 1WAAF 4XPHH 1ED3A 1U93B 5IT2H 2AK1L 2GC4C 5C0CA 3IKKA 3DUSA 4H25B 1G7MB 5AQ0A 1V7MH 3B2XA 2A83A 3I6KA 4QCIB 1N5AB 3ARYA 2OM5A 3QDJD 4YAQB 3TEXA 3X14B 4NAQA 1EA9C 3TIDB 5C09B 5FA3B 3PNRB 4G82A 3PPEA 3L45A 2VXTL 4L3ED 5I1CL 2Q76A 2VLJD 1XT5A 5AZEL 2D0GA 3O6ML 2DKSA 3AREA 3QDMD 5EUKA 3WE1A 2HVJA 4P5KB 4JL1A 4Y16D 3UYRL 1C1EL 1K4CB 3K0YA 2G60H 2DKUA 2XTLA 1EHNA 3CNKA 1ETB1 4EQ2A 3ESVF 1IAIL 4DSYA 3JWNH 3QG7L 3U1SH 3A22A 3B37A 3F65A 3ISRA 2W0KA 3VXMA 2HVKA 3D50A 5KVGH 5CXPA 4EI0A 4YHIA 1CFNB 2UVEA 4XHJC 1DYZA 5F1OB 5AB9A 2MEJB 3LHPH 1IBZA 3MNDA 3MV8A 2QVKA 1QZNA 4AIXA 2Y6SC 3AMKA 2HB0A 5AAPA 4CSSA 3QIWC 4G7SB 1R5VB 4K3DL 3SGEI 3TCLA 4ICXA 3UG5A 1FNGB 2EH7H 4M7ZB 1M3IA 3LQAL 4AGOA 1IGJB 2CG9X 3RZCD 4WF7A 1SDAB 4FG0A 4R3SA 4FXKA 2GT9A 3CBJB 5I1LB 4G6FD 2YMTA 4RA3A 3BSZA 4YO0A 2X28A 4UTBA 2ZONA 1IAKB 1D7DA 2IBBA 5F7EL 3TBCA 4YX2H 2QGBA 1NOLA 2P47B 5CP7B 2RB8A 4F24A 4JO1H 5ALBH 5LCVA 5ESAA 4Z0XA 3FCGA 4PJXA 4FMKA 4NB7A 1AGCA 4C54A 1TPXC 5C1MB 2OSLA 4G11A 3MV01 1CGUA 3PLYA 3HB3D 3QO1A 1BD2E 5CZXD 3KWTA 1U3HB 4B97A 4NZTH 1OGTA 4L8SB 1UASA 5CEYB 1F8TH 1JE6A 5GS1C 3ARGD 2X05A 2AJYH 4B9IA 5H94B 3S35X 4L1SA 1GGTA 2FRGP 3LZQA 3QEGL 5DJAA 2F74A 2WJ5A 2FEJA 1XV8A 2ZSWA 4POZC 4K0OA 2QVIA 1IM3D 4QKXB 1XH0A 2CE6A 1QUPA 3I75A 1AANA 5BS0D 4OFKA 3Q9QA 4YS4A 3M1CA 4K3HA 4L1HA 2WV3A 4NRYA 2C4FT 4GAFB 5L2JB 4BFOA 3O2WL 4BFRA 4YSEA 4RMTA 2WUBL 2F19H 2D3JA 3JUYA 4K5NA 2IIJA 1BAFL 4FG2A 5EZLB 3VD3A 3NEXA 4KVNH 3C6EA 5DJZB 3RWJB 4MCYA 3F83A 3QS3A 2XZAH 2ROXA 5BZWA 1D2PA 2RD0A 2ZKXA 4OQTL 4DZ8A 2YBRA 4YSSA 3FT9A 1NBQA 3CLEL 4IYKA 4XE0A 1A3QA 1FIGH 4PG2C 4U3HA 3R0NA 5KSBA 3BKML 3BD5A 2DL9A 2I85A 3OAZH 4FTVE 4F9LA 5C2BL 4D2NA 2NY4C 2JCCF 4ELKB 1OSZA 2YA2A 3G6DH 3K4DA 4FKHA 1C5BL 2CO3A 2F8VA 1W0WB 3KPNA 1OCWH 5D2LA 5IVXF 4YHNB 3VQMA 3J7HA 2PYFB 2DQJL 4WJ5B 3CN3A 2IPKB 3PP3K 2VDNH 1FORH 3GSRB 4C58B 4Z7AA 1U8QB 4KJWD 2OMZB 3KYAA 1AO7A 3DMMD 1DJSA 5IMMA 5LXGH 4B53A 1ZLEA 2WB1A 1TU2B 4Z7NB 2IAMA 3D07A 3QQ9C 1JYNA 3HBQA 3FFCA 3DVFA 1QLFB 4K3GA 3ABLB 5GIRB 1P0SE 4YSDA 4HP5A 4M4PA 2FIRT 3HNTH 5AYUH 4ZMYA 3VI4E 1PG7H 3ELQA 4R7DB 1NUNB 4FXKC 5K9JL 1KNOA 1L9PA 5HJ3B 4G3YL 4P5TB 3V7AE 5JHLL 1BZOA 1YYLL 2NY0C 5EF3A 3GUTA 1PNDA 2DIAA 4N2GA 4Y5XB 3PAZA 1CFQA 4WWNA 2W60B 2WTRB 1TQBC 3F2LA 4XAKE 2CLZA 2ZKMX 1CFBA 1PW3A 2DLFL 3ULUC 4PJIB 5GZOA 1E2ZA 4LL9A 4PJ8B 1U42A 3C5SA 2Q7YB 4L4VB 1AR2A 2A6IA 5LN8A 3OPUA 1H3TA 4YSPA 5D7SL 5CGYD 5IB1A 5TF1H 1FGNL 5AAMA 5KSUB 4GXVH 3JZ7A 1EDHA 4FP8H 1Q9WA 2WZ5A 1P69B 1J10A 1I9RL 3KH4A 4FRWA 3L3GA 1I8MA 1U36A 4QT5A 4Y4KA 4PVBA 4HC1A 1JNJA 4LOFA 3SDCB 1A02N 3BAWA 4QXUH 4IEFB 4R2GB 4BK5A 4DUXA 3EXLA 3JV4B 2RFXB 2NUPA 1NC2A 1IAII 2R9HC 2VXVL 1LDPH 2XYCA 4XPHL 1A6AB 4QAMB 4YGAB 5IT2L 4GKNB 1CZ8H 2AMUA 4DP7X 1XIWB 1WICA 3QORD 1ZLUH 5F9JB 4N2NA 1BFVH 1TSHA 1OD7A 3U83A 1BMZA 3UTSD 2WYZA 3EO1B 9PCYA 2FYYB 4IRSD 2UX7A 2F54E 4NRXA 3VE0B 2WANA 3BAJA 3K3QA 5HDBE 4FQXA 3FKUS 2YPLA 2UUDK 3EO0A 6FABH 4BWWA 3NCYS 3KW8A 5K39B 2BP8A 2PYEE 1QNIA 4ONFH 2WXNA 3QUYC 2G60L 3RWGB 4YXHH 5AW6B 1KB9K 3MNZA 4GAYB 2IGLA 2OMVA 2K3HA 4KMLB 4JM0A 4N2OA 3UYOD 3U1SL 4LVOC 1A7PL 5TH2A 1S2EA 2DWXA 4AQ1A 1WA2X 2F53B 1H5BB 3GLAA 4PYGA 3STLB 1CVRA 3IKCA 3WDHA 2BHYA 4X7FC 5K1NA 3RI5K 1GJWA 2WVTA 3LHPL 4MRCA 2AJ3A 3S6CA 3DBXA 3BUPA 1PZ5B 1MJUH 1T1ZA 5IMLB 1NGXB 2I9LB 3KLLA 3VXUE 4FQQA 2Y5TB 3FSWA 2EH7L 5C08D 4N9OB 1ET5A 5JO5A 3NUKA 3D0VA 3IPFA 4ODWA 3LZLA 3UERA 1N3NA 4AYEC 4CMMA 1V3LA 5DRXB 4YN3A 4R7VA 1UZ6E 1ZMYA 1A0QH 2IAMC 3G7TA 4GW5B 1WRFA 1ZPLA 3EOBB 4Y2DA 5AW7B 4YX2L 5I71C 3WS3A 5J3HD 1CO1A 3RPIA 3IXTB 5HBBA 2GSIA 2BRQA 3DOHA 1DO6A 3NCXA 3CK0H 4JO1L 4QRRD 5ALBL 4FS0A 4P2QA 2WB7A 5JIQA 2VN3A 3H3KA 4JQXA 4R26H 5HHMB 2ZKHH 2YSSA 3GMPB 1B0GA 5FECA 4A55A 2UY6A 2IALB 3TF7C 3FAWA 4KXCA 4JPQA 6PAZA 1QSFA 2AQ2A 1EEZB 1FF5A 3IJYA 4ALAC 4DP9X 5LAXB 1IFRA 4K7FA 4UILH 2DL2A 2NY5C 3DK0A 4NZTL 1BQHA 5AAWC 2XKUA 1NBVL 5BRZB 4D94A 1NCCH 1F8TL 2G3NA 3D0LB 2H2PD 2AJYL 5DD0H 5GS0C 1RAMA 1YCSA 3LRSA 1HC1A 1M1SA 2YQ3A 4ZUWA 4ZUVB 1KXVA 3NH7L 1JK8A 4OZIB 1X4ZA 1GVIA 3KPTA 1WAAE 4DVBB 3EJZC 5SWZE 5FO8B 2XWZA 3QYMA 5AAMC 3PYCA 1I8LC 1KIQA 1UZGA 2APXA 2J8UB 1RZGA 1X5LA 3HE7A 3IJEA 5EU6A 1Z1WA 1OP9A 3GRGA 5KVEH 5EEXA 4YHLH 3AFLA 3L3IB 4GW1B 2A0LD 2F19L 3UAJD 3RYMA 3VG0L 3FW6A 4OIBA 2RCSH 4X4YB 1F3DH 4KVNL 4N2MA 4AYFA 2XZAL 2CUMA 4M1DH 3SE3A 3GTVA 1O9ZA 4WI7A 3FUIA 1T1YB 3Q43A 2NX5A 3OSVA 2ESVD 1PKQB 5L4FA 3NSCA 2VABA 2D7NA 5C0EA 2FWSA 3MRBA 1DQTA 1FIGL 3UZVB 1X9LA 4LVEA 1E5BA 5C7XH 5LQBH 3CN2A 4LLYB 4NUJB 2BC4A 2NY3C 2QGDA 5E0FA 5A2JH 2B3RA 5FW7A 3G6DL 3AS3A 4EIBA 1GR7A 4JY6B 1QSEB 1G7JB 1OCWL 4NNPL 3PGDA 3GSVB 3W9DA 2W95A 1LEKA 1FORL 4BJLA 4X4XA 4YGVB 4LVHB 1AP2B 1VFAA 1Z9OA 1AE6L 1BBDH 2VZVA 3QA3A 3VD0A 4GBXA 3N3EA 5LXGL 2BOBA 5E8DH 3ABGA 3KJ4C 1ZS8B 3G9VA 4E9VA 4CA4A 4H26B 5E94A 2VMEA 3ZKNC 4NPJA 4HWNA 1YEKL 1A9BB 2FQDA 2J55A 1A1NB 3TV3H 3L6FB 3HI6H 2ERJB 1DE4B 2X2UA 2GVYA 4OUOA 3HC0B 4JJHA 5AYUL 3RVUC 3HNTL 5IEKA 2VE6B 4PJEE 1PG7L 2ADIA 1DUZB 3UCRA 4NZFA 1CICB 1I3RA 1MCSA 3AQYA 4YSQA 3UC2A 4OCNC 5HD8D 1OHQA 1L5GB 1A4KB 2WGXA 5DLML 1OALA 4FNSA 3PNWA 4OU3A 5IMOA 1XF1A 5J13B 1GZPB 4QGYA 1EAQA 3VFMA 1SYSB 3LXAA 5B7EA 4CSTA 1J0ZA 4YSTA 5DUBB 5FYJD 5BRQA 3TXAA 1JIBA 1VEPA 1V5JA 4JQXC 5BUPA 3C9NA 1RZIB 4P2RD 4HDIB 4Y4HC 5I1AB 1V7NH 4LMQE 1L3WA 1MDAA 3AABA 3K6SA 1JS4A 1S9XB 2GUOA 3AGWA 2EECA 1N8ZA 1R24A 3FQWA 2CKBH 2FEEL 2UYLB 5T5FA 3T6ZA 4FP8L 1KLUA 1FYTD 4XP1H 2BNQD 2RALA 3N43F 2J3SA 4WHYG 4AL8C 4QRSA 4QR7A 3U4EB 1SGKA 2AJXH 4FG6C 1KXVC 4QXUL 5C7ZA 3ARFA 2E59A 2AF2A 3US1A 2CA4A 3JVGA 5TDOB 1LDPL 4Y4FA 4F57H 1WLHA 3CFDA 3ZYJA 2P1YA 2AXGA 1CZ8L 2SEBA 3S36X 2ZX6A 4YIQB 1KLGA 2DIEA 2WHVA 3N40F 5HYJA 1BFVL 1UUNA 4C83A 1K8IA 3HE6B 4JK0D 4XMLH 5FB8B 2OL3H 2Y6TE 4P05A 2E27H 1W72B 3L5XH 2GTWB 4PRNB 3NCWA 6FABL 3U25A 3AZUA 2JCCE 4D0CB 5JHDE 4ONFL 5IVXE 4NNYA 1GH7A 2PABA 2YPKB 2Z64C 4RAVA 4YXHL 2CU9A 5DHMC 1K2DA 2FLBT 3EF4A 3FB7B 5EIIA 1QRNB 5IEHA 4ZJ9A 1MZYA 3KPRD 5EOCH 3ELAT 5I5IA 1MH5B 2CPCA 4LDOB 3GSOB 2AV1A 3QR2A 3FQUB 4PRID 4PREA 4LT7A 4U3CA 3WIIH 3RNQB 3MRKB 4ZYKA 1JZ6A 3QUXD 4G7VL 2XV3A 1YUHB 4LMQI 1IJ9A 1D6EA 1DCLA 1ZHNB 1YPZE 2BOLA 4X99A 1MJUL 4D8PA 3IE9A 5DVNA 5DJCA 1OW0A 2N7SA 4XXCC 1UJ3B 2HKFH 2LE9A 3LKNB 3AXLA 4OF0A 3Q9PA 4YSCA 5IVZA 4FMFA 1YEEH 4DK5A 3MRRB 3WNLA 5L8LB 1JZ2A 3FQRB 1RZPA 5AUMB 3KWUA 3ENEA 4NQDE 4KX8A 4X7TB 5AL0A 5IQMA 4Z1PA 1ZA6B 4PJDE 1I1FA 2D3LA 3Q5YA 4KDTC 1GYCA 3ERXA 4K7PH 3RJOA 4C56D 4GMTH 3V6OA 4Y0GA 2O5YH 1JGUL 4XMVA 3AG3B 4R26L 5HYFA 4HS8H 2JKNA 5HPOA 5EBGA 1YG9A 3NIDB 5EBMB 3AUVA 4WUUA 1BOGA 5H37G 5CGTA 3CFNA 4J8RB 5DD6B 1B90A 1ROCA 2FQGA 4W9JC 5E6YA 4MQ7A 2DBLL 4UILL 3RX5A 4NLHA 1NKOA 2ZUQC 1EK3A 1NCCL 1CE1H 4JFDD 2V3EA 2VDMB 3B3IA 1KXTB 2KI6A 3GEWB 3NIFB 5DD0L 4AKPA 3P77B 1AZNA 2JE8A 2YWZA 4OZHB 4TNWF 1P6AB 4NENB 5ACZA 2WWKT 3BH9B 5E8NA 1F58H 4LLUB 4NERA 4FCAA 4AVIA 4WGWB 1SHMA 2WCPA 5AVSB 2BSSA 2EXYD 1OP5H 5I6PA 2KYIA 5KVEL 4WCYH 5FM5M 2DWEB 4YHLL 4XRCA 2MPAL 4HIIB 5D5ME 1AG6A 1DP0A 1Q94B 1U8LA 5AOMA 3RA7H 1TYRA 4AITA 1KMGA 3JVGC 1PFCA 3BN9C 5E1AA 3S97C 2RCSL 3BZEA 5IJVA 1FBIH 3SJVB 2PLTA 4MLSA 5K1VA 2CO4A 3MA7B 1DL7H 3SO3C 2HJFB 4I87A 4N2HA 4OD2B 3P3RA 3PUCA 2CDEA 4CVXB 4AEIH 3BVWA 5CBAB 2ZXEB 1HT6A 2PO6A 1BQ5A 1NCDH 2YMXH 3LKQB 5ECJE 4IRZA 1BHGA 5FUCC 4JDZA 3L9RA 5C7XL 3ULAB 5LQBL 1EJ8A 1AGDB 1OO2A 4IBQA 1C5CH 4JRYD 5GGRB 4BSVB 2PW1A 2HTKD 2BMKB 2YLHA 2EDRA 4LU5H 5DHVA 4I2XB 4E36A 1QA9A 1RJLB 4HHWA 2C1PA 1UWEH 4EPSA 3TLRA 4NQCD 1TCMA 2DEWX 1BBDL 3D30A 3E0GA 1WBXA 2YGPA 4EI6A 1HHGA 2NQCA 4O2EA 3WKQA 4MSWB 5E8DL 4Y1TA 4HIPA 2QELA 1MHCA 4OLZH 1YEWA 4UT9L 2HP4A 3ALPA 4YHZL 1PZCA 3TV3L 3HI6L 4JR9H 2EUVA 4EMZA 5KBNC 2UWEA 2ZOWA 2NQ3A 4L3FA 2EIJB 3D8MA 5DZPA 4ZS7H 3KMDA 1TFPA 2L7UA 1JDAA 2K0RA 3F5WA 4F3FB 3CDGA 1BM3H 5DWPA 2A6KA 3F7VA 1NGZA 1YC7A 3B1TA 1F97A 5I1JH 3V6OC 4MXQC 3APCA 2Z8SA 3HG1B 1IBHA 3N44B 3ZYIA 2EE9A 1HXYB 1IEHA 1AQDB 4PJGA 3WKYA 4LCWB 4PS3A 2W88A 1WUZA 1XH3B 3SD5A 1V7NL 4LSUL 3O3DA 1OTSD 4PY8I 3KBEA 5DGRA 2DMCA 3UTPE 3D3VA 1KACB 3SKMB 4AEFA 1CDHA 2VXUH 4XR8C 4AVKA 1J11A 3FU9A 5AYQA 4HOMA 4G43A 3K2IA 2QZQA 2AJUH 4PRPD 1A3ZA 3BVUA 3ULSB 1XSOA 2O93L 3U82B 4APQD 2EZ0C 5FGCE 2HKAA 3K5SA 3D4ZA 4PP1C 5D1XA 4F57L 3P0GB 2NXZD 4FABH 2YEZB 3BSZH 5JIKA 4UTBH 3IS0X 3MVSA 4L4TB 3UTTD 2VYRE 5ESVB 3CHPA 4MD5A 2FX8L 3IDMB 1WD9A 5EEZA 3EHBB 5LCVH 1YEHH 2OL3L 1A9VA 1GOHA 3RWCA 2E27L 5I8CB 2PR4H 2FL5B 1C5DA 2DN7A 4NFBA 3SPVB 3TN0C 1MUJA 1PD0A 3ILPA 3O41A 5I8OH 4PTUA 4AIZA 3K91A 2DQUH 5T3ZE 2VC2B 3CFQA 5JPNB 3A23A 4QRQB 3W38A 2K9FB 1MKFA 4HJUA 2HFGH 3WG7B 3E6FB 2PO6C 3CXHJ 5MEOB 1ZTMA 1HAWA 5EOCL 4RZCB 4LDEB 1DQQA 1IKNA 1DLHA 1MWAB 1SOKA 4HS6B 4UANA 3WIIL 4M5YL 1DQLH 5JYLA 4K07A 3RTQA 4AXWA 5KSAC 4PJXF 3T3PF 4V1DD 5C0FB 3DK2A 1RZ8B 1KPUB 4YE4H 1B3IA 1BV8A 2YXMA 5DFTA 3OKOA 4XI5D 4QRAA 4NIYE 2HKFL 5DURB 4B9JA 3FAXA 2A3TA 3CSPA 4GG6F 4I1RA 4OLXH 1YEEL 1OAYL 3UGEA 4YHYC 1CLOH 3WD5H 4X7DC 3AB0B 5K9QI 4IKKA 3QZWA 5IHZB 5GSVB 4OAWA 1XGTB 3OG6B 1CGVA 2X53A 1S9WA 4PHZA 4IU2B 3B9KB 3T8MA 3ZX1A 4K7PL 4FULA 4GMTL 4B0MB 2O5YL 3J2PA 3U4KA 1NL0H 3EFOA 5LLIC 1D5IH 3W5NA 1LO2H 2VAAB 4HS8L 5CLWA 1EZVX 3MX0B 3VCLA 3NCBB 2EVIA 2OXGA 4JM2C 3GDBA 4LCIH 4PFEA 3DIDA 4HG4K 4BINA 3ALXA 2P5WB 3QDMA 3DXAB 3MLZH 4UOW0 4G9DB 5D4IA 2IF7A 1J8SA 3L81A 3EYSH 2OQJA 4M7JL 4XPBH 3SO5A 4F80A 2O61B 1ASQA 2VDLH 3HN3A 4YR6B 2WWMD 2Z92A 3C6LB 3MHZA 5J1TC 4GG8B 4HMDA 4F15C 3D2UB 1XCTA 4M6OH 1F58L 4TNGA 4WI2A 1TVBA 3BAKA 4L3CA 4P3CH 1C7TA 2UV3A 1D5RA 4F7MA 3QR1A 1EDQA 4N0CC 3A21A 1MW0A 3GD1C 4WCYL 3MFFA 3ZPDA 3RZCA 5D2LF 2R8SH 3RA7L 3WEXB 4ZMPA 3H9SD 5HHOD 5D1XC 3DO7B 4JFWA 1FBIL 5BW7C 2ICCA 3IRPX 1EVTC 5DYOB 4ALAH 2FIKB 1DL7L 4PY8J 1KGJA 1XF5B 3FRPB 4UQEA 2NY5H 3U4AA 2W0FA 1OM9A 5J1SC 1UWFA 1NCDL 35C8H 4N0FB 3TBTB 2YMXL 2Z31B 1BWMA 1WQVT 5GGUA 4ADIA 3SPCA 3EH4B 5CD5D 4PWFA 4UM9D 5AW4B 3NRPA 3F58H 1NCTA 4UQBA 4A38A 4ZX4A 4OR1A 4KK9D 1C5CL 1G7IA 1K6QL 1JN6B 2K3TA 1QHPA 4LU5L 3OM3B 3TO4A 3V4PL 3BYYA 4PJFA 1IEBB 2X4RA 3PDOA 2VQ4A 4I89A 4FQJL 4UQIM 3DTXA 3O8XB 2HFEB 4U0QB 4CVUA 5K93A 3MI6A 3B9AA 4HC1H 2ZCLH 4QKTA 4IBTA 4L8DB 2JVUA 5I75C 2IADA 1CURA 3LEVH 3UP6A 2H8PB 2IPTL 4OLZL 5CSZB 3PPSA 3W9EB 1DVTA 1KN4H 3JQOB 4JR9L 5IHLB 3BKYH 1X6NA 4ZMQA 4ZS7L 2Q86B 4NO0B 3EH3B 3LV3B 3TH4T 5IHUH 2AEOA 4OUUB 2VDQH 3RWIA 1YMMD 2WBJD 4WTQA 1EJFA 4Z76B 5D7KE 5A43C 1BM3L 3FT4B 4WNJA 4CDHA 4OGQC 1M2VA 3IMRA 1ZHBA 1A6TB 4JCLA 5IIEA 1OTTC 5J6HA 5I1JL 2OL3B 5HGAB 2D7PA 1J12A 1CXKA 1QATA 3B9DA 2BVQA 3FN3A 1TQSA 3ZKXB 2FT7A 1DVYA 4Y2OA 5F70A 5A16A 3PABA 5C07A 1KV7A 5I2IA 1B0RB 3AITA 2XNAA 3KEHA 4RGNE 1AQKH 3JZYA 4AW7A 4ZDHB 3QDGA 4HULB 5ES4B 3NJIA 2PPEA 4WWOA 4F2ME 1LE9A 3VB9A 2NY6B 3CZSA 1O7SA 1FNEB 5JIDA 2DMHA 3FXIC 5HYSA 2AJUL 4GQQA 3LS4L 4K8RD 2Y1VA 3N04A 1GKEA 3IU3A 1P2CB 4N20A 2YMOA 1A4AA 3NJNA 3DTUB 3KXFE 3MUZ1 3QAZC 4LF3B 4P3DB 1BXXA 5EO0A 1SXZA 2AEPL 4DGIH 5EG6C 3GT6A 1SDYA 2D03H 3TESA 4FABL 3WNJA 3BSZL 5D1ZC 2EDNA 2J43A 5MEND 1HE8A 2LLGA 3KWWB 3BUYA 3O3UN 3R0MA 1TSRA 4BA0A 1GGCL 4KTEH 4NZ8A 4WFHD 4X98B 4ZW7A 4D9QE 3HOGA 5LCVL 1YEHL 1J5HA 1KFAL 1SEBA 2NTFA 4XNXH 4MDIB 1U8KA 4GNKB 1D7CA 1F3DJ 1F13A 2PR4L 3U7WH 1UJTA 3I6LD 2N3JA 1ECZA 5I8OL 1LK2A 3CSGA 4NKQB 2DQUL 1B4LA 4P48A 3WN6A 2B39A 1MRDH 2GG1A 4BSWA 2HFGL 4HCRA 4JZOA 1G43A 15C8H 2NDGA 2A73B 2VLRB 4HAKA 3KLAA 4OGAC 3DV4A 1BSIA 1DQLL 4JFFD 1Q8MA 3E8UH 3RFZB 4J12A 2BOCA 3EFFB 5E51A 4OI7A 4LGPB 1HFUA 3QEQE 4A7QA 1YMHA 4KDVA 5F7AA 1MCWM 3RX8A 2WLKA 3SKOB 4LSSH 4OFIA 4EIGB 1JV2B 1HQRA 4PLKD 5DXWA 3SBQA 4ELDA 1U8OB 2XBDA 4OLXL 1R5IB 4GUPA 4PJHF 1HL4A 1VGKA 2E46A 3MRDA 2VN5A 1ETA1 4IMLB 4MZ2A 5KSVB 1XAUA 2C9SA 1N9PA 1OK8A 1WCBA 3BPOB 3GGWA 4ZFOB 2BVOA 2B4CC 1G7LA 2FX7L 1NBYA 2YPVA 3PL6B 2NY7H 1DJWA 3W1ZA 4WSJA 1RUAH 1EZVY 1YEFH 2MCPL 5KYYB 3V9EA 3IDXL 1NL0L 1P9MC 1TPXB 5DFAA 3TZVC 3MN8A 4MLIA 3SDXF 3UTSA 1D5IL 4QTHA 1LO2L 4ZXBC 4WU7A 5CZVL 2QL1A 5ESQB 5IK3A 5T1LD 1G94A 4G8GD 4NBYB 3FO9A 3MLZL 2D7MA 1TVHA 2ODHA 2GBVA 1OAQH 3T1FA 3PE9A 4PBDA 5EEYA 1ROWA 4XPBL 1NICA 1U92B 3U1PA 3HEIB 2VDLL 4X6BA 4UDTB 1BCIA 5EN2B 5IW1B 1E4XI 1KIPA 4TUKL 1NLBL 3OWRA 5G4MA 1NCAL 3T0BA 1WFIA 3ORJA 5J1AA 3VFOA 5CCKH 3LMJH 3MUUA 4TVSa 4OZFB 3ZHFA 3O45B 4M6OL 3V4PB 2ICWB 3ARPA 4XBGB 4ZW8A 1MHHA 4P3CL 4PV9B 1WP6A 3CVIH 4MA1B 3F7YB 1T04B 3M46A 1PZAA 1SF3A 5IB3A 3FCTB 1K8DB 4O9HH 4XWOC 4KKLC 2BCMA 1M53A 5DUMH 4KOCA 3WFEH 1ETJA 3IFOB 2R8SL 1JWUB 3DECA 3RDTD 3FTZA 4AGMA 4WK4B 3VFRB 1XZ0A 2V9UA 2AK4A 4POYA 1QR1A 4ALAL 4KI5C 2NY5L 3SDAD 2P8LA 2Q8BH 3BCDA 5GJSH 2FHCA 4S1DD 4DUWA 2Q76B 4QTFA 3FUNA 5DJ6B 3I02B 1BMWA 1FG2A 2NY4B 4G5ZL 3F58L 3EUDA 2P5EE 3JV6B 5JLZA 4NO5B 3T3PE 3U1QA 1A8JH 3OJDB 4WI9A 4MDJB 3RJDA 5ILTH 4DFHA 4KNTA 1FLTX 1BXUA 2EADA 3EZJB 2HUEA 3DX7A 3CH1B 5EOCJ 5PAZA 3FH8A 5T5FH 4DKTA 3B7TA 3IDGB 4GG6E 4J4PD 4OKVB 4KKNA 2EYRB 5D7JD 1CDIA 5C92A 1Y07A 2R39A 1OL0A 1FL6A 4FFWC 4G6AD 1OAZH 4HPOH 4R4BB 4HC1L 5I1IH 1RJYA 7TAAA 1NGWA 5EOTB 3LEVL 4TL5A 3ZK0A 3MO1B 3JXAA 3AU1B 4RDBA 4GQZA 4ZZFA 4L48A 3DPDA 2WAQA 1DBJL 5E9DE 4N6RA 5JPMA 3A4DA 2Y1AA 3HKFA 1BWWA 1OP3K 2OTUB 4KZEH 3BKYL 2ZXWB 3EH5B 2PWDA 3RB7A 3GQFA 1JGEA 3WEOA 1X9UA 3CU1A 2X1QA 4FXKB 2VDQL 3S2CA 5AB2A 4X5WA 1EANA 2Z93A 1BEYH 3QFDA 4WWPA 2QGCA 3GK8H 1BIIA 3TNMB 2GPZA 3G08A 4OF3A 1NFIB 2NY0B 3UAJA 1M71A 3WTVA 4MXVF 1D9KA 2HT3C 3NIGF 1G9EA 1XR8A 1ZV5A 2EEFA 2UZYA 3DX9B 2VR4A 4WK2B 5D7LE 4MB5A 1F0LA 2W9EH 4NGHH 5CBEA 3QWOB 1OF2A 4TYUA 3HRZA 1VDGA 1LD9A 4PB0H 4XCNA 1F00I 4E9LA 3BP6B 5F7DA 4WVRA 1DVZA 4KFZC 1WA1X 4Y19D 1MI5B 2ZYRA 3X12A 5AZUA 2V3DA 4QOKA 1ORSA 3MZGB 4Z3TA 4F8QA 5KYWA 4ODUA 2A2QT 4YBLC 2PW2B 5D2LE 2X2HA 4J28A 1OKEA 4CKVX 4DGIL 2QR0A 4G9FE 2D03L 3BUIA 4PJ7B 1BJ8A 5C9KA 1A4CA 1E3XA 2B14A 2IWKA 3KLSA 4PGBA 1L0XA 4YEEA 4KTEL 5FXCH 2FO1A 1P6WA 5IUSA 1KBWA 4XNXL 5G4NA 3T9WA 4NPKA 5KAQG 5KYUB 2CBMA 3WLWC 4RGOH 3U7WL 1AYRA 4XO5A 4MKMA 2K8MA 4Q8BA 5FDYA 3X3FL 4QF1A 3QUYB 4JNXA 4MHHI 4QHMB 5DRZB 1HHHB 2JF1A 4DZ8B 2EDDA 4NAJA 1MRDL 1IC4H 4Q97A 4JFPB 4LVOB 5ECGA 5I82A 3VH8A 4GRLD 1P7QA 1CTNA 1SRDA 3T08A 3PY9A 2PP8A 1TTGA 1SJHA 3O3EA 3BVNA 1OSZB 1XMEB 2P46B 3E8UL 1FFPB 2VQ1B 5GGSB 2OMWB 2VDRH 4P2OA 1YNKL 1KTCA 2ZSVB 4RX4D 4Y1AA 2AQPA 3FOMB 3VJ6A 1AG0A 3LNGA 1Z66A 2XFXB 4GJTB 3T1WA 4LSSL 4U1JA 1FYTA 3KYKH 3VGAC 2OP4H 4EVNA 2IJ0C 4NJAL 4FNUA 4TLKA 4Z6AT 1KIUB 2LU7A 1YN6A 4N2EA 4N9GB 3DX6A 4G8EB 4K23H 3ATDA 4W9LC 5I71B 1UCBH 5IROD 1QVOB 5JOFA 3TJHD 3FFCB 4RFOH 4AH2B 2NY7L 5JPMC 3IGLA 3ZHDA 3P11H 1BZQK 1YEFL 4IOIA 2WKGA 5DEFA 3BD3A 1FNFA 4ANWA 3DX0A 1LDSA 1WK0A 2ZXGA 2VNCA 4IRZH 2YFOA 3IGFA 8FABB 1D9KC 1CFSB 3MQIA 4OCRH 1OAQL 2DM4A 2R83A 5DHVH 4A66A 2Z91A 4NHUB 1GMIA 1TCRA 3FUEA 1NGYB 2H26A 4H20H 3CZGA 4JFEE 3LMJL 5GRVL 1MFAL 2XN1A 1KT2A 4PRIA 2Y36H 3JYCA 3GBNH 1LJMA 1D5ZB 2GJ6D 3QUXA 1BFTA 3PGCB 1F86A 3PRZA 3IRCA 4LCCA 4HIHB 4J3OF 3PXJA 3CVIL 1KUMA 1HWHB 2R4RH 4HD9A 2ENQA 1INQB 4TUJA 4ZG1A 4CVZB 3QI9C 5GISL 4O9HL 1HKFA 2QPEB 4MMZB 4P9MH 5DUML 4BK8A 2CRZA 3WFEL 5E5LA 1E0OB 3VFTB 5LN4A 2ATPA 4FQCH 2ZG1A 2DQFB 2Z7WA 5HDOA 4NO2A 4PJAB 3UPRB 4FQIH 3VDCA 4W9FC 4JFHE 5DI8A 1L0PA 5F71A 3MV9D 4OFVA 5GRUH 1DN0B 3QHFH 4UWQB 3TT3H 3MRLB 4EOWH 2FVNA 2VDQB 2NXYB 3C5JA 4C56A 2Q8BL 4P9HC 5GJSL 3ZY7A 3T0VA 2D4DA 1ZJBA 4XNQA 3V4UH 3PJLA 4FERA 4P4KD 2OCCB 1NUFA 2UWEF 3QR0A 4PRBB 4KO6A 2CDGA 3PHQA 1HH6B 2V33A 2Q2LA 4XPFH 5DHEA 2PTTB 4A2LA 1NDMB 3CMOH 4IDLA 4TNVF 5ILTL 1TKWA 2YXFA 4ATWA 3MJ8B 4YDZA 5T5FL 2DEXX 3VWJC 1XGYL 1PEWA 4I13B 4XT1C 5B8CC 3AXHA 1OXYA 4HPOL 4PJHE 1FZOA 1IGFH 1OAZL 4LLVB 3ZUNC 5I1IL 3I6GB 2BXYA 3KJ4B 3RWFB 4W9KC 1OB1B 3HJ0A 3C75A 2YOAA 2E7LC 5EC1B 4ANVA 1B4TA 4ZUSA 1KTJA 2VDOB 1QASA 1S5HB 1HX0A 4FQQB 4LHUD 5IMKA 1N7MH 4YNYB 4KZEL 3F62A 3NCEB 3NCMA 5GS2D 3P2DA 3QW9A 3SDXE 2WXQA 4LP4A 3RGVD 4DVRH 3J07A 1BEYL 4ZMWA 1DJYA 1YYMH 4XNMA 3C8KA 1P5VA 1W6WA 3KGSA 3M17B 1GZHC 4MNQA 4YEFA 3ET9F 3MV7E 1T0OA 1BAGA 2NNAB 4AYMC 3QULB 4P2QB 3W11C 2IDQA 4JFOB 3DSFH 4NGHL 2PCFB 1R3LB 4RZKA 4GT0A 5I23A 4X7SH 2UY6B 3ASWA 4PB0L 4Y4HB 3NCFB 3FS9A 1F4XH 3QXWA 4AQ8A 4GXFA 4KQ3H 4JG9A 5HI4C 4LSQH 2CIIA 3D05A 5CSBA 4FNPA 5AKTA 5I1EH 3KNBA 3LQZB 3U6RA 2WOYA 4HW6A 3LRSB 3SCMC 1FRGL 5DK2A 1E42A 5C09D 1J8KA 2WCSA 3PWLB 2X2JA 2R0ZH 3P9WB 3QEHA 3IJ9A 4F7PA 1RIVH 3HG2A 3MLVH 4H5SB 5DSCA 2OAAA 1OAUH 1F41A 4J3UA 4QO1A 1BD2B 4E5XA 3UACA 2OW7A 4RSVA 4WEBH 4HFWB 4WI8A 4PJCE 4PJBE 3IJEB 3JUZA 3NK3A 5HDRA 1GCFA 4I9WE 2F5BL 4LLQB 4MZ3A 4QHNA 3KG5A 4G7YH 4U1KA 3WEBA 2EO7A 3EJYC 3OJMB 4KUCD 1WFJA 2A1WL 4UT6A 2N0KA 3RE0A 1WD8A 5IOKA 4UIKH 4LEBA 5CHNA 2EKSB 3VWKC 3SQRA 3WIFA 2NX5B 5JORB 2XZZA 2Y4SA 3ES6A 1MFVA 3VXRA 4TL4A 2H3XC 1IC4L 2ZX5A 1RK0B 3ZE0F 1HHKB 1M3JA 1ZT7B 3PXLA 3O4OC 1ZLWH 3TX4A 2D7QA 4NBXB 5DS8B 2XIBA 3NEOA 5KS9E 1V8HA 3VNYA 1J86A 2VDRL 3QCUH 4IQHA 2CLRA 5TDNB 1NIDA 2E7HA 2WCGA 3B43A 4YUEH 3RVVD 4F7CA 4EZJA 2AP2A 3W9DB 2IH8A 1TQCC 3OKMB 2KBGA 1VERA 2CUIA 4OFYD 5AOZA 5HGHB 3KYKL 3QA3B 4PRPA 3B83A 5F3FA 4FXGB 2C3HA 1TQUA 4FTVB 2G9HA 5E1HB 4K23L 4APQA 2UZIH 1UCBL 3VD1A 4MXVE 1CGTA 3DKHA 2EC8A 3NIGE 4RFOL 1HJCA 2HYMA 1U3HD 1IC1A 3MNMA 3P11L 2FJFB 3UTTA 2GSGB 3VD5A 1FVCA 3BLPX 5EO1A 2XPZA 1CLVA 1E5ZA 3TWYA 4ATTA 5FOBB 5FA4B 1KJMA 4IRZL 3P2TA 4X6FA 1SLUA 3TURA 3PNWB 4MKTA 4LVNC 1O6TA 2AFNA 4OCRL 4AENB 2ZUQB 1MCLA 3IGUA 1MFBH 4JFYA 1S7TA 4F1SA 2YAPA 4A2DA 5KW9L 3NFSH 3VI4B 1HXKA 2J6EA 4H20L 3MJ6A 2EDFA 3GXMA 3K6SB 3C5ZA 3X11A 1PYWA 2OS7A 2HRHA 2Y36L 3BWUC 3HCVA 5HVGB 1ONQA 4NQED 4ZPTB 1JZ7A 3K1DA 4WNSA 5HPMA 2I27N 4LLMA 4N86A 5E6UB 3DRTA 4R7LA 4FJZA 1RUQH 2R4RL 3QG6B 1BOYA 1BX2A 5IOPA 4HETA 4LSDA 4P9ML 3QFJD 3O6FB 5LGJA 1CBJA 4JHZA 4PJFF 4NQXB 3AXIA 2WWOA 4WGVB 5IB4B 1M57B 2AXGB 4LLWA 4FQIL 5D9SB 3SO3B 1MY5A 5HHNA 3FRPG 5KVFH 4G6KH 5L9DH 5GRUL 3TT3L 3QHFL 1EHLH 4EOWL 3OAYH 4U6XA 2ZNWA 4ZUTA 3Q01A 2BZ7A 2VERA 5EU5B 4R83A 4HJIA 2EE2A 3HZ3A 1ANUA 5D93C 5I17A 3V4UL 1CD8A 3R7QA 5L6YH 1CFVH 3RX9A 2BNRD 5KG9B 2NPLX 2OX5B 4XPFL 4ANUA 3DURB 3PHOA 1CR9H 4BFIA 3CMOL 3KYNB 3BEWB 1Y1DA 2AGJH 2IH9A 3CXHK 1OE3A 3ALWA 1K5NB 3MRNA 3OAZK 3OL2A 2L7JA 4MJID 5IV2B 1CD1A 5DJ8A 2F54B 5ANHA 1IGFL 5HDBB 2GYSA 4ZMXA 2BSRB 2PYEB 2GUYA 3U30C 3S98A 4MYWB 3S3CB 4MXWH 1N7ML 4L29B 1NMCC 5DJ2B 3H1ZA 4LARL 4W6YB 3LKOA 4HMEA 4ZTEA 3VTTA 4PJ8D 5D96C 2PCPB 1FAIH 5BUAA 1NBZA 1YYML 5EEWA 3VGEA 4L4VD 4U1LA 5C0NC 2V5YA 4U3SB 5HHOA 5HI3D 3VXQA 2DLEA 4N0UA 5I16B 3U46B 2W65A 2Z35A 4BH7A 4APXA 3VXUB 4N8PA 2JI1A 4DQOH 1KN2H 3DSFL 3UOAB 3ZRFC 2VO8A 3OX8A 4R5XA 4HCRH 4X7SL 2MH4A 4QAWA 1AMXA 1F4XL 3QJUB 4PR5B 3S37X 2VIRB 1HHIB 4P46A 4KQ3L 1OGAE 3KPQA 4LSQL 4XNBA 1N0LA 1T5KA 1XIWD 4A2HA 1OD9A 4N1EA 2YD5A 1EAJA 4HJ0D 4JGJA 4I1PA 2BS9A 3N42F 1A64A 4KKPA 4W9GC 3UROR 2NW3B 4WWKD 5L88L 1D5BB 1TJMA 2R0ZL 1WBZA 1RIVL 1PDKA 2ZX9A 2YD6A 3C5ZC 3MLVL 3OF6D 3P0YH 2XTJC 1FH2A 1GSKA 1OAUL 2A9MH 4JFVA 5CZKA 5E8NB 4DTGH 4J39A 2PKDA 4XN5A 1EZUA 3OQRA 4M9PA 4WEBL 3UMTA 1E67A 3M1BB 3PQYD 2YPVH 1JNNH 3O2DA 1ACZA 3X1NA 3M88A 2BY1A 4JM4L 4DP5X 1FVDA 1U8LB 2XKNB 4FLQA 2VH5H 2PUQT 4G7YL 3EBGA 4XOAA 3ARSA 3TA3C 5I9QC 1UKTA 1AJ7H 3TN0B 2VDPH 1FFNA 1ZLUK 1XCXA 3PFQA 3QUKB 4AE1A 3KHOA 4Q9BA 1YMMA 2WBJA 1HDMA 5SWZB 4NZRL 3UCQA 4BFFA 2OYMA 4CADA 3UAFA 1QO3A 4X5XB 4S1RH 2WLNA 3BUQA 2FZ3B 3O9WC 3BX7C 1ZHLA 3KCPA 4N25A 3L95B 5DMKB 4UQAA 3QIBC 3VM5A 2X7LB 2W0PA 4KPHH 8PAZA 4UMGA 5LGKA 2WSDA 1T20B 2AW2A 4U49A 4PY7B 4AYDC 5BV7B 2MHAA 4FFVD 4FI7A 4W4OC 5KSAB 2MCG1 3W2DH 3GM0A 1Q9KB 3N1QC 4HJTA 4YUEL 1QA9B 2D0HA 4RAUA 2H0JA 5DVOA 2E86A 4H8WH 1DBAL 1YAIA 1JV5B 2EO1A 1W15A 3F7LA 1G7PA 2XQYK 3BGMA 3KL5A 1FSKC 4D7BA 2B9BA 4XCYB 4CW1A 3X3GH 4YHYB 5HHMD 2FWOA 1HHGB 3ME0A 3RWDA 3A47A 4XO3A 3FTGB 2XY1A 1U58B 1HEHC 4WFED 4KROC 3WNIA 2BZDA 3DIVA 3NT0A 3HNSL 3M86A 4XO9A 4OFDA 3G5VB 1KGXA 3B2UC 1YNTB 4FA8A 1FV1A 5MENA 3IMWA 4LLDA 3CCHA 4ABVA 1ULVA 2VL5B 4PV8B 2BS8A 3MRIB 3UADA 4JM2B 3R18A 4ABWA 2OSYA 4N22A 3SY0B 1CDJA 3LKPB 1FL5B 3D0AA 2H6PB 3HNVH 4IBYA 4X4ZA 1OPGH 3REVA 2QMJA 2J88H 4CJ0A 2QADD 1NIAA 5LNGA 4X7EC 1BMGA 1JXJA 1MFBL 1MG2C 2EDWA 3Q6FB 4PJEB 2IG2H 3KLKA 3ZL4H 3DHUA 3V0DA 2FNBA 3CZLA 3O3DB 4OZFG 4F15B 5EF1A 4HKJB 4LL1A 3G5ZA 3D3VB 4P46C 3O6KH 4WKXA 3ATFA 2DWDA 4JFFA 3UBFA 1G7HA 4K9EH 5J9PA 1EO5A 2IH3B 1VACB 2AHIA 43C9B 3L4WA 4PWHA 1CYWA 5DA4A 1I1AC 1RUQL 2HMIC 1KXQA 2Q5BA 4BCXA 3PV6B 1S7RA 3CQQA 3Q2WA 2VXSL 1KJ2A 5LBSA 3RUGE 1ZA3A 3W56A 4MQXC 5HGDA 1UKSA 2FJUB 2ZP9A 2AXHA 1BZ9A 1X5FA 2K4AA 4G6KL 5KVFL 3RBGA 2IXQA 3UIZA 5L9DL 2W1NA 3VD9A 4PGEA 1J8RA 1ORQA 2VMJA 4I3GA 1HIMH 4RRPG 5D70H 5ERWB 1EHLL 2JTDA 1SYVB 2KERA 3HMWH 3UO8B 1A6WH 4U33A 1Q0EA 3P4NA 3FTXA 4MJ6A 1HK6A 1MJ7H 3SDDA 4GSUA 1KYAA 3G3LA 5L6YL 1KY7A 3QDJE 4QYOB 5FO9A 2YKLH 3CFTA 1CFTA 3NCJH 1CR9L 5I73B 3X17A 2IWFA 3FHEA 1D3CA 2AGJL 4L3EE 4XZUB 3MLRH 4AQAA 5B4MC 2VLJE 2QKSA 2Z1PA 4PRHD 5AOLA 3QDME 1SHSA 2V7HB 4OM0H 5SV4A 1AACA 1I8UA 3BH8B 4WZ9A 1EDYA 5I75B 3MRJB 4OGZA 2NY1C 2FO4A 4DGYH 2E7CA 2JCCB 4PGCA 4XTRC 5JMRA 3IMSA 5JHDB 2WC7A 2R2CA 5IVXB 1ND0A 1ACYH 5DCCA 4MXWL 2NSXA 4C4UA 4MWFB 3T4AC 1P4LB 1NC4D 1R75A 4P5MB 1IB5A 2RJMA 4EO5A 1S7UB 3STZA 4P9HH 3TEYA 5E00B 3EDEA 1FAIL 5AZ2H 2R2HB 2J21A 2WKOA 1YNLH 4HWZB 4DPBX 5K69A 1VCAA 1YPZB 4BFNA 2E9IA 2O5ZH 4FZ8H 1W8OA 3SGDH 4XH2B 1F11A 2EXWD 1UURA 4DQOL 1KN2L 2FT8A 1Z9SA 1UVQB 3Q1EA 4NRZA 1T1WA 3CQFA 4NWUL 1GZQB 1NFDE 4FHKA 4AYSA 1YEJH 4HCRL 3VCLB 2OXGB 1RLWA 3DPBB 3N50A 4NQDB 3UTQB 3FCBA 5BOJA 4QRPD 3LRKA 2KZWA 2V5TA 4UU9A 3RNKB 4PJDB 3BN3B 3US9A 1WG3A 3QRGH 3VRIB 3QXDA 1SOQA 1Y18A 3SYOA 4CC0A 4JX0A 4YLQT 3HE6D 4Z7UA 3EOTH 1U91B 2R56H 4FTDA 1QABA 4U0RB 5FGRA 2V7NB 2CO6A 2Z9TA 4L37A 3P0YL 43CAB 3FB5B 2A9ML 4MX7A 2CKNA 3U0TB 2J57A 1E30A 5D1ZB 5AENA 2X6CA 1G7QB 5DJ0A 1D7FA 2YPVL 1JNNL 5HI5D 3UJIH 2A99A 3HW7A 3LXCA 2APFA 2WNKA 2X5PA 1QRND 3CN1A 4U7KA 4NZDA 5E6ID 5KVGL 2VH5L 4Y5VB 3EDKA 1FHGA 5BS0E 5C97A 1AJ7L 3QH3A 2DRUA 2NR6D 1HSBA 2CHXA 3W0WA 5I15H 5KVDH 2VLKD 3HG4A 2OMUB 5SWQB 3QEUB 1IT9H 4S1RL 2X6MA 5IW6B 4Z7QE 1DDHA 1I9JL 3DI3B 1TOXA 2Y7MA 5AVYB 4KPHL 3V0HA 3D85A 1I3VA 5D5MB 1TZIA 1UZ8B 5BQ7B 4XXDA 1N18A 2HLEB 2M1KA 2XXMB 5D8JH 2XX0A 4OIFA 1UH3A 3N1GC 1UGNA 1DQMH 3FU7B 2Y3AA 3W2DL 3BHBB 4RH4A 3BSGA 3MRFB 5C0BD 3GINA 2YD9A 2P48B 1A2YA 3WFCH 1CVSC 3VSTA 2EACA 2AQ1A 4C57C 3MKKA 3CFMA 3T0EA 3TVMA 2FLMA 5I1DA 3NZHH 2G2RB 2VM3A 3VFWB 3X3GL 4Y9BA 1S7SA 2IADB 4YDJB 2XACC 2Q87A 3RWEA 3MRCA 4ZT1A 2E76C 3B5GA 3GPEA 3ARBD 5JW5B 1AHKA 4NM8L 3U6XA 3VFNB 2P42B 5ID0A 1FC2D 4YL9A 3CFCL 2P3YA 4X0KA 3TA4D 4TQEH 4TUUA 2Y24A 3NCYP 5AVWB 3DV6B 3TZVB 3N0PB 2F68X 2RBLA 3MC0A 1M6OA 3U4BH 4ZXBB 1J5OL 1YAZA 5D2NE 4PMFA 1N6QH 3GLZA 5TK4A 4YDVA 1IVTA 5L4IA 2DF3A 4XCEA 3FYEB 3HUJE 5IIEB 3HNVL 1I85A 5F2FA 1OPGL 5DFVD 2PWGA 3NA9L 4S1SH 3UFIA 4DN3H 2X9ZA 4TNWK 3E6HA 1PJWA 3DDGA 3LDBC 5I6MA 3KPSE 5GGVY 2XG5A 3WOVA 2O72A 5I66B 3OHXA 4WJKB 3SBRA 2WLIB 2DWTA 3MGOB 1TO4A 1A7QL 3ZL4L 3DYPA 1U8MA 5IW3A 4GRLA 1U41A 5J6GB 4KJPD 2GITA 1XGRB 1E8WA 3D2TA 1GGBH 3UAAA 4E9RA 4OZGA 3O6KL 2FWLB 4LCVA 4ZW5A 3SJVD 4K9EL 1GOFA 1JPTH 2EDLA 5GSRA 4RX4A 4IGBC 3B3BA 4NC0B 2X4PB 2DY2A 3WIAA 2K9UA 4XN7A 2B16A 2VO5A 2EDTA 4YPJA 4BKSC 3U9UB 2DJ4A 3O4LD 3O0LA 3AG4B 3MREA 4JY4A 4ORGB 1ZEAH 1QLEH 3WHE0 3FU5A 3HZMA 1LYQA 5HDWA 4LIQH 3S48A 4Q6IA 3QK0A 2DB8A 3L5JA 1VB9A 2B1OA 5IROA 3WTXA 1CGXA 5H37A 5D70L 4NPYB 1BLIA 3HMWL 3HBZA 3DOSB 1A6WL 1NAMB 3AT9A 3LY6A 4UOQA 3IVKB 4NWTH 4PMEA 5CINH 4ISVA 2CUHA 1J48A 7FABH 3W39A 2WXMA 2YKLL 2F7IA 2VLMD 3GIZH 3UTSE 5IQOA 2YOCA 3G6JA 2HVBA 5T1KD 3OXSB 1I7ZB 2ZQKA 5B1JA 2EYTB 3MLRL 1WH0A 2HT4D 1FG9C 4IHOB 3MUHL 2ARJQ 4JLRA 4OM0L 5HVHB 4TSBH 3IDUA 5D7EA 1FHNA 1Q9OA 1W8EA 2EVHA 1P7KB 4UB0L 5T1MA 5D6CB 3GSNB 2Y1ZA 4DGYL 5D1QA 1SF5A 2M2DA 1H0DB 3HFFA 2MFNA 2X38A 1ACYL 1ZT1A 1F1GA 1C8QA 3WDIA 4EZMA 3HG1D 4PRAB 4NC1E 3E2HC 5T1DH 4P9HL 2W07A 1H9VA 5EBWA 4N2DA 2V2WA 5AZ2L 5GZNA 2DYSB 3UTOA 3X1EA 1YNLL 3TH2T 2CR3A 4Z3EA 4UT6H 5C08E 2NSQA 2BP5M 5I74C 2XG4B 5JW4N 4BH8A 2O5ZL 4PLJD 4FZ8L 1BQKA 4JZNA 5ISZB 3CG8A 1MAKA 3L4YA 1TZHB 3VI3A 5J89A 1M42A 1SBSH 1T22B 5B38B 5ETUB 1YEJL 4V33A 4BM7A 3KDMB 4QHUB 5CEZH 2Z6FA 1HOEA 3IXAA 4QRRE 1WF5A 4CC4A 3PAVA 4X8GA 2AXFB 5DZOA 2IQAB 2JXMB 4L4TD 2CQVA 3QRGL 5K9OA 1O7DE 3JTSA 4EEEA 5HSFA 2G5BA 3LRLA 4YBLB 1IBGH 4PJ6A 4ZSOA 3F12A 3EOTL 2R56L 2B8OT 2VUOA 4WY7H 2ZXCA 2KL6A 2GQHA 4XVUC 4HQQH 5C0AB 3D39D 3DGGB 3LAFA 3IDIA 3KLDA 1MHHB 4X6CF 3E3QC 3WY2A 3BWZA 3BQUD 5CIPH 3HLAA 1H19A 2BRRL 3WYRA 1IE5A 1BDYA 4W4NA 4HK0B 2R0LH 1MCIA 4JPKH 4L2LA 4PG9B 3VFVA 1IFHL 2C9VA 2NY2C 1QACA 3V4VA 4C4BA 4PS7A 1LO5B 5E1QA 3S88H 4PP2A 4HWBA 4KKRA 5I15L 5AD0A 3V5DA 2YD0A 5KVDL 4R4ND 3CHRA 4YHPB 3MACH 4ZMTA 3VFUA 1MNNA 1IT9L 2RGSA 3KVDD 3T09A 3RY6A 1WT5A 4I48B 4EZKA 4KKCD 3QWRD 3US0A 2FR4A 4X6EA 5KYXB 2HN7B 1A1MA 5CLYA 1KLFB 3HIZA 1HWGB 3LB6D 2J6EH 5D8JL 3SPIA 2C26A 1Z9LA 5HYIA 1WC7B 2ESVE 2Y3NA 3H54A 4UZUA 4R6UA 3P9MA 1U6AL 1U93A 2QFRA 2XWEA 3WFCL 1VENA 2GABA 5KN5B 4H25A 3B9KD 1G7MA 1RMFH 3M7OA 3VGAB 2ZWNA 4RAHA 1D5MB 5F8QC 3FT3B 3RIKA 1KGCD 4QCIA 1N5AA 1U95B 1D5XB 1ZXKA 3X14A 4YAQA 5LDSA 1R3JB 4NNXB 3TIDA 1P1VA 5C09A 1LO4L 5FA3A 4Z5RB 5LHDA 2YRZA 1PIGA 1R3KB 3MRHB 4RMBA 3N5AA 5D1QC 1Y0LB 3QXTA 5EUOB 4CSPA 2ADYA 1AVAA 1QBBA 2XETA 3DXAD 4P5KA 2YGQA 4L4JA 3CFKB 4TQEL 5CU9A 3T0WA 3W81A 1PNCA 1K4CA 4HJSA 4KX7A 2FT6A 1JGEB 1RH8A 4I0PD 5KZCD 4WDIA 2WYHA 1N6QL 1U4EA 1DUYB 5GZNC 2C9PA 4Z8FH 1UD3A 3D2UD 1CFNA 3UXFA 4DN3L 1KENL 2LU3A 4S1SL 2HFFB 2A6JB 3DJSA 3E80A 4XVOA 2FBRA 2KC0A 1MFUA 5I8EA 1R5VA 4JMXA 5FV2A 3HS8A 1FNGA 4QEGA 2ARJB 3V7AG 1IGJA 2WNGA 3L08A 3GC3A 4ORZC 1GGBL 4OVVA 1T6WA 1MFCH 2IOOA 5CJBA 4A7GA 5I1LA 4CC4C 4JVWA 1EGJA 3L3HB 3QZLA 5FYJE 1CXEA 4YQXH 1GPOH 2XN9D 2CMRH 1JPTL 2EIZB 2YFNA 1IAKA 4P2RE 4X4MA 4YOKA 4WHCA 4DNLA 3QI9B 2H47C 5CP7A 4LOEA 2V5MA 3QUHA 2YJLA 1PF3A 4ES8A 3ARQA 4OT1H 5DDHB 3E7JA 1FYTE 5DRWB 1ZEAL 2BNQE 1FZJB 3EYQD 4GRWH 4D8OA 2NYYD 3L13A 1JAEA 3KYMB 4LIQL 4F2MB 1X5XA 1XBDA 4E9QA 3C08H 2O5XH 4OZ4B 3U6XS 4OV5B 4H8VA 4O02B 1P5UB 4FYTA 1U3HA 1KTDB 3OQ3B 1ZGLM 1R46A 4PLOB 3GMRB 4L8SA 1U21A 3TBSB 5CEYA 3HB3C 3QNXB 2Z0BA 1YRKA 2OULB 2X89A 3QJVB 5FCUH 5SX4H 4DAGL 4NWTL 3RY5A 5CZXC 5H94A 4ONOA 2NZIA 2WXPA 2XXCB 3D48R 4QF1B 7FABL 3L2MA 1E5YA 3FN0H 3GIZL 5HGBB 3RVXC 3ARGC 3JYBA 2OK0H 4JPIB 2YZ1A 4GRWF 3VWJB 1AOZA 3VH8B 5B8CB 1OWWA 3NGBC 3GB7B 2GJJA 1SXAA 4Q58C 1KTLA 4XHQA 5L2JA 1PZBA 3CFEB 4TV3A 4Q9RL 1NKGA 3KPRE 4HKZB 5DU7A 5EZLA 5JZ7D 4U6VH 3CC5B 5DJZA 3FHAA 4N2FA 4PRIE 3RWJA 3MJWA 2WJ7A 3LPWA 3O2DH 4UV4L 1MQKL 5T1DL 1OB0A 4BXVA 3OAUH 3T8VA 4HUVB 2FAUA 1F6AB 3GXFA 4Q2ZB 3K0WA 2YD2A 3QEQB 1H15B 3FTUA 1LWJA 4FI6A 3D51A 3ULVH 4MS8D 1W0WA 3D69B 1KCWA 2WQWA 4YHNA 2EDQA 2IPUK 1OAKH 2PYFA 3E9UA 3BKJH 4WJ5A 1I7TB 2J73A 2IPKA 3GSRA 4U6HB 1U8QA 4BUQA 5CEZL 1JZIA 2OMZA 4C56E 4UTAL 3Q1SH 1CS6A 3E1F1 3GZQA 1TU2A 4KJWC 3SQBB 4JHWH 5LJYH 3SCMB 3UX9B 1DQVA 4K15A 1IBGL 5BZDB 4PVNA 3R8BB 5J06A 2QQNL 2H26B 1QLFA 3L9BA 3O81A 3WHXA 3ULVF 4M7ZC 5GIRA 2E9JA 4WY7L 5D2NC 4LNRB 3ISWA 4K8RH 3HVDA 4HQQL 4R7DA 3VW3L 2E6QA 1LM8V 1TR7A 1TMCB 3UAEA 3L4CA 4JFDE 5HJ3A 2XWRA 2CJUH 4P5TA 5SWSB 5DEGB 3ESNA 2VR5A 4WLCA 2EO9A 4JHAL 3WFDH 3Q8AA 5F7MC 1ZK9A 4L9DA 3FF8A 1Q1PA 1JK9A 1HINH 2G75B 2J6WA 5I18H 1IAIM 2R0LL 2YEQA 4Y5XA 4JPKL 5IKCB 4Y5YC 1HL5A 2V4LA 2WTRA 3WL9B 3T2PA 5BOPA 3CX2A 1DBMH 3BLKA 4PJIA 4XHJD 4PJ8A 2O6DA 2J20A 3NYKA 2Q7YA 2ZKWA 3VWKB 3GZOA 1DQDH 2Y6SD 1ZLVK 3QIWD 4FHJA 3FULA 3G5WA 5KSUA 3RKDD 3EJSA 1VZGA 5ADPH 4HIEB 2PXYB 4L8SC 5BOZG 2YARA 2LTQC 3N06B 4WTZG 2J6EL 1E6OH 3SDCA 4IEFA 2OW6A 3JV4A 2CZNA 2RFXA 1TKWB 5DQ9B 3S3BB 3KPPB 1A6AA 1TQCB 4TQ8A 2B59B 1XGPB 4GKNA 2IDTA 4NQVB 1RMFL 4FEMA 1XIWA 5DZNA 5F9JA 3GJFB 4JRYE 2CJ3A 4UIMB 1P7HL 4YHKH 4MCZB 1M6UA 3EO1A 4Y2NA 3WJJA 2FYYA 3ZHLA 4CSZA 3QORC 3OXRB 2P5EB 5CO1A 3TONA 1L3NA 4JEGB 3T3PB 3BW9B 3VE0A 5LBSH 1KJ2H 3OF6A 1FE8L 4KHTH 4DH2A 1JGVH 3HR5A 3M1OA 1E27B 4OB5H 5K39A 4NQCE 5E1IA 1CMOA 3THMH 3KYOB 3V0VB 3RWGA 4GG6B 2YQGA 3QUZB 4GAYA 1EQWA 2XRAL 4FMVA 4O2FB 5C0GA 1FDLL 4AM0B 3QE5A 1PJ9A 3B1UA 4P0DA 2F53A 4POZD 1H5BA 1COBA 4PLNC 4Z8FL 2I7SA 3STLA 4IOFD 4Z7WF 3IAGC 3NAAL 4LVNB 3GXPA 1Z7JA 2KMWA 3C60C 5E9DB 3K80A 4BWUA 2ZYSA 4UQ3B 4WO4D 2QEJA 1PZ5A 1RD6A 4LCUB 3LEXB 2I9LA 1NGXA 2HSIA 3L2NA 2RH0A 2Y5TA 3VSQA 1MCHA 4NC1C 3NVQA 1TJXA 3AU0A 2ZF8A 4R4FH 2N1TE 3SIKA 1BF2A 1MFCL 5C0CD 1HL9A 2KLSA 4X6CE 1WO2A 4IBSA 5DRXA 5J11B 5I8KL 4YQXL 4AEEA 5J4MA 5TQ2H 5ALCH 1AKJB 4GW5A 3ZN6A 3LZFL 5D7LB 2WVUA 5GRVK 3IXTA 5K1JA 4TLUA 1T7ZA 2DQMA 4ZOAA 4X9BA 3R4DA 3K8LA 3MRQB 3T3MF 4OT1L 3L4UA 4W9DC 5FLVA 2NY4D 3GMPA 1PY9A 2X2IA 2IALA 4PRPE 4P5TC 5LDUA 4JAMB 1EEZA 1MEXH 3C08L 4ODBD 4YK4B 2CCVA 4OQTA 3QFGA 5LAXA 1T80A 3L1OH 3N41F 1PZ2A 4JY5H 4Y5XC 5BRZA 1FFQA 1E4HA 3K6FA 3VXMD 1ML0A 5CEXB 3D0LA 5FCUL 5HHXH 3D87B 3MPCA 4ZPVB 1KGIA 3UTTE 4IKNA 3HRPA 4ZUVA 1THAA 3MCLL 4OZIA 4G9FB 3QQ9D 3CSYB 1IQWH 1QQDB 3FN0L 1A22B 3MV8D 3RP1A 3FQYA 3VMNA 4FQ1H 4DVBA 2OK0L 2KDGA 5FO8A 4YVUA 3SKJL 2WKOF 4TLTA 3ZSTA 1MCNA 4DN4L 2WXGA 2J8UA 5EEUA 1T2XA 1J0JA 3RHWF 2YAEA 1DHKA 2MPVA 1I82A 2JIXB 2YA0A 3C8DA 2FH8A 4OF6A 4E9SA 2ZPKH 3SDCC 2AQNA 4R2GC 3L3IA 3UZQB 4AE0A 3K74B 4GW1A 1OP4A 1VPOH 3M6DA 3ZSSA 4UUJB 4FE9A 5E2TH 4JQVA 3WMSA 3E38A 4U6VL 4X4YA 1NWOA 1TF4A 4LNVA 2NSMA 4BUHA 3O2DL 4ZNEE 1T1YA 3C09B 1NCJA 2MQCA 3FZUC 4M5SA 5D71H 4V1DE 3UH8A 2EUWA 3OAUL 4GSDH 1AD9B 3UZVA 2VN7A 4XN2A 4XODA 4Z7UF 5CIPB 5LGHH 4LLYA 4NUJA 5LKNA 3ULVL 4YXLH 4JY6A 1QSEA 1G7JA 3SODB 3FN9A 3GSVA 1OOAA 1OAKL 3KL0A 3BKJL 4MAYC 5CJQH 4LP8A 4YGVA 3IWUA 2R9HD 4N2LA 1AP2A 3AY4A 1H5BC 1BEXA 2XBZA 3OZ9H 2G30A 1GGYA 2QBWA 1N19A 3Q1SL 1WITA 4WHYH 2A5UA 1ILSA 4N0YH 1UA7A 4X9YA 5MP6H 5JIIA 1ZS8A 1MSPA 4JHWL 5A2KH 1S7TB 2F7RA 4H26A 4E68A 4M4RB 1A9BA 4U1NB 3L6FA 2Y7QB 5E4IA 1PG7X 1DE4A 1VF5C 3ARWA 2BZCA 1KPVA 3S36H 2VE6A 2Q7NA 1DUZA 1X7SA 3OTTA 2HTLC 1CICA 1URLA 1Z5LB 5IREA 2CJUL 2J8HA 3QUYD 1XVSA 1VA9A 3EOYG 1L5GA 2WWKO 1A4KA 4HHGA 3WFDL 3BISA 1HINL 3ECWA 3LZPA 4GP5B 1GZPA 5I18L 3MUGB 5I6XC 1BJMA 2QJDA 3H53A 4I4WB 4JKMA 1SYSA 4M43H 5I9QB 3TA3B 5HVWA 3KPLB 5CR8A 5DUBA 4G8IA 4JFEB 3OVUB 1YO4A 1DBML 4LLWB 1E9QB 4WI0B 1RZIA 5JA9A 2XLLA 4HDIA 5IFHH 5I1AA 4A67A 3WGVB 1DQDL 1S9XA 1SOSA 5BPPA 3O9WB 3T2LA 1LMIA 3BRGC 1KCSH 4O5LH 3QIBB 4X5RA 3H9SE 5HHOE 3VRLF 1BZ7B 1UH2A 3EYVB 2C7UB 1AO7D 1AGEB 2EVJA 4HF5L 1ZTXL 4U6YB 3U4EA 1E6OL 3AG1B 1MZZA 1IAMA 2DMBA 4ZQTA 1J8HB 3D5OF 2IAMD 3BP4A 1ACXA 5TDPB 3TGXA 3QZBA 1WYJA 4HGWB 5TDOA 3FFCD 2VERN 2DDQH 2YEVB 2WZPD 5E0QA 4YIQA 1FSKB 5CCGE 4LRIA 4GW4B 4LBEA 5AKSA 5CCHE 2MRYA 4ZX5A 2N56A 3HE6A 4YHKL 5FB8A 4ELMF 3KGRA 5IESL 3TEWA 1W72A 5LBSL 1KJ2L 4KHTL 2GTWA 4PRNA 1JGVL 4JQVC 2FGZA 1SM3H 4OB5L 4KO7A 4D0CA 4LOUC 3THML 4PM1A 1YQVH 2YD4A 1TJIL 4OZGF 2EUZA 2YPKA 5H37H 5KANG 3QDAA 1RSFA 1WVZA 3PJSB 4YBHA 3FB7A 5JNYB 1QRNA 4PJHB 4N90D 1MH5A 3VG9B 2DZEA 3GSOA 3EJZD