5LNRA

Crystal structure of arabidopsis thaliana pdx1-plp complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
b'SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
molecule tags Lyase
source organism Arabidopsis thaliana
publication title Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis.
pubmed doi rcsb
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5lnrA00
1I45A 3O16A 3LLFA 3GNDA 2H8XA 2RDWA 2XFWA 4DXVA 4JR5A 3B04A 4O19A 4WXYA 4Z1CA 4UTWC 3DKJA 2B7QA 1JQXA 4JYFA 1MZHA 4DO4A 1AK5A 1LBLA 2A5HA 4GUGA 4RCXA 3VE7A 2QCLA 5CGQA 4ZQOA 5BW6A 1V7YA 1H60A 2QCFA 1SO3A 3MHUA 3V75A 3HG5A 2PRMA 2FFCA 7TIMA 1BKSA 2X1RA 1EB3A 1X6UA 1YPFA 1F5ZA 3MI6A 3O06A 1FXQA 5D09A 3Q37A 2ZRZA 3C2EA 1YXCA 2Y85A 2A7RA 3C2OA 2QCDB 1A53A 3OVQA 4B5NA 1VHNA 3UXDA 1JR1A 3S5NA 3G18A 5F2LA 4WY0A 5E93A 1K02A 2BTMA 5HWNA 3HBLA 3B0UX 2GOUA 1SO5A 4KFNA 3KVJA 4UNKA 4JXCA 1W5QA 3C3NA 2BZNA 4Y6GA 1HO1A 1XCFA 4LC6A 3FJ6A 1TV8A 2BWGA 2WV8A 1J2WA 5HWJA 4CQAA 2GVLA 2C19A 4ZL1A 5G2IA 3P7YA 2YXGA 1GVSA 1GEQA 2E6DA 3HB9A 4PFMA 4NT0A 2E5BA 1JQVA 4EIVA 3QM3A 2B7OA 3QMSA 2GQ9A 3G1DA 5T26A 3EKLA 3EX1A 3NQFA 4NXKA 1LBMA 4JX4A 2CU0A 4NJJA 2FTPA 3EB2A 4JIQA 3T7VA 4OE7A 1VHCA 3G24A 2Y62A 3PSVA 4JTUA 4Y9AA 3BLEA 4JTGA 3W85A 3ZS4A 4XQ6A 3SY5A 1U5JA 2E6AA 1KTBA 1O5XA 1OHLA 4UR7A 2X16A 4TMBA 3W72A 5G4WA 4BI7A 4WXZA 4UTHA 4QNEA 4IQLA 3P82A 1QR7A 5KZMA 3TMLA 1N55A 4HSNA 4IMCA 3LI1A 3EX3A 3NL3A 4N9DA 3R8RA 4BI6A 3JR2A 4A21A 1QFEA 1G4TA 4U4MA 2ZA1A 2DJLA 1ME7A 4DQWA 1LCOA 1R2RA 5EL1A 5C2XA 1DKWA 1TPB1 3W87A 1KBIA 4K8EA 1THFD 4O1CA 3M7WA 5D38A 2VFGA 2A85A 4PL2A 4UMAA 3O6DA 4Q4KA 2EPHA 3BG3A 1ZALA 3S5YA 2V8ZA 1SQ7A 4E0CA 2TMDA 2XN1A 5F2GA 1DQXA 5BMWA 1DQWA 1ICSA 3PG8A 5D2VA 1LM1A 4QISA 1H7NA 1J4EA 1B9BA 3NGJA 1TPDA 3L5LA 2BSLA 3H55A 1G7UA 1NSJA 2ABBA 3GK0A 1E51A 3SJ3A 5G2WA 1GZGA 3MP4A 3PAJA 1CW2A 1H5YA 2ISWA 4JTJA 1L6SA 3SECA 3WK1A 5DBTA 1W5NA 2QUUA 3KFTA 4ZZ9A 1K8XA 3GAKA 4FXSA 5LNUA 4MZ1A 3T40A 1QOQA 4JEQA 4ALDA 2I9EA 3W73A 1I2RA 1LRTA 4FO4A 2NWSA 2QDHA 3EXTA 3Q94A 3CEPA 4NXSA 1HL2A 5CG7A 1MXSA 4O13A 4QAIA 2QCHA 2CLEA 1VPXA 3FLUA 4LU0A 5IBXC 1DJQA 1F73A 4GBUA 4TR9A 3CEUA 5FF4A 4JTHA 4YXGA 2A4AA 3STGA 3W1TA 3W7MA 2E09A 4IX2A 2NXHA 3N73A 5D33A 2B7PA 3R89A 3G1VA 3W7CA 2NXGA 3MMTA 2YDAA 1IXPA 1TPWA 5K4XA 1LLWA 2J9YA 1WBJA 3S5OA 4MLRA 1TJPA 1AL8A 2DZXA 5TBOA 3UZ5A 4AF0A 3PBYA 2NX1A 4EVZA 3BGJA 4MJMA 4JTSA 3BLFA 4HNUA 1GTEA 4YCOA 1OFOA 1NVMA 4M19A 5CPLA 3IIOA 1JUKA 3SSJA 3NL2A 3TMQA 3OG3A 1KFKA 1B4KA 4FNUA 1KLYA 3W3OA 1T96A 1LOSA 1VH7A 1OYCA 3CQ0A 3S42A 3KVLA 1ME8A 3T55A 4C1KA 1BEUA 3DAQA 3KVKA 4NNAA 5CZSA 1V5XA 4LVBA 4X9SA 5IM51 3BV4A 1GG1A 4LS1A 3THQA 4MJZA 4A22A 2Y7EA 1F6KA 1QAPA 2J27A 2YPIA 3S8HA 4J9JA 4WOQA 1I2PA 4ZQNA 1LROA 2X1UA 4WY0B 4TIMA 3HGOA 4GWEA 3B0PA 4FHAA 5DXXA 1W3NA 2QCNA 2DJXA 2R94A 1P1XA 3PC0A 2BX7A 1H1ZA 3BPWA 3MP5A 1PHWA 4GUHA 4LRSA 3QFEA 3HG3A 1DVJA 2PE4A 1G4EA 4NJHA 5AHMA 2E5CA 5I3IA 5AOUA 1MEHA 4X3ZA 1D3HA 2VEKA 2PCQA 5J5DA 3TSMA 1SZNA 3HIJA 3W7IA 3DFOA 1H50A 4N9BA 4L4LA 1PCWA 3SZ8A 3VKJA 3NYZA 3HGRA 3U6WA 1KM5A 5LHFA 3KRUA 3DGRA 1KM2A 3ZWSA 2C1HA 2HTMA 3IVUA 1RQBA 2C16A 1WA3A 2C13A 4GRSA 4CCDA 3FA5A 1G67A 4RV8A 3G1HA 1TPVA 1SW7A 3MHFA 4JTIA 3CT7A 4O1AA 1QMLA 4AVFA 3EWUA 4Y96A 4UTUA 3LHWA 1J5TA 3BLIA 3ANYA 2H3BA 5L6UA 3HJZA 2EKCA 1HUVA 1L6WA 4UUIA 1F2JA 1W5OA 3E02A 2V30A 4ZQMA 2C14A 2ZRYA 1SW3A 1S3HA 1JUBA 2DZPA 3A5VA 1P0KA 3S1WA 3GYEA 4LUIA 3ZWTA 5AN7A 3VI2A 4BWLC 3L68A 3TK7A 4JX6A 4OHQA 5C54A 2A7NA 1A5AA 2FDSA 2C15A 4Y8FA 5K3VA 3WJXA 4FIRA 3RK8A 4Z1BA 3QYQA 1ZENA 4N6FA 1TTIA 1VS1A 3G3DA 4OT7A 4RZ5A 5EYWA 4Z1DA 2G96A 2Y70A 2C0AA 2FB2A 2ZTKA 5KITA 2W79A 5K2ZA 4LRTA 1KM6A 5D2WA 1K03A 5KINA 2YW3A 1K7XA 5F2IA 2FIQA 1TB3A 4NUWA 2G95A 3O6YX 3LI0A 4FX7A 4LVFA 1G6CA 2RDTA 4E2BA 3TW7A 3NQVA 2TYSA 1Y0EA 2YX0A 3AO0A 4UMCA 3WK3A 5D30A 3NEVA 2PC4A 3R13A 2QKFA 3P61A 3LBCA 3O8AA 2NV1A 4AWUA 2H6RA 2XN2A 4FF7A 4CCEA 3QJAA 3UWYA 3P67A 2QCGA 4Z0SA 3QZEA 3LXCA 2QJHA 3EXSA 5G1TA 1YDVA 3PUDA 3PBVA 3L2IA 2XN0A 3N2XA 2V5LA 4RZ6A 4DO5A 4OWGA 3S9YA 3IVTA 4K39A 3NDOA 4MYXA 2NLIA 3NQMA 3TQ0A 3BW3A 1SFLA 4O50A 1SFJA 2X30A 1XFBA 2CLLA 2OT0A 5HUPA 5FF0A 5AFDA 2NUWA 2GVJA 3LV5A 4WD0A 2AAMA 2PURA 1EIXA 4MUZA 1SZFA 1I4NA 5CZ0A 3L66A 5G2HA 1I8JA 4LV9A 1XC4A 4M6VA 3RF9A 1ADOA 3CM4A 4JTKA 4CLMA 1FWTA 1A5BA 2ZDRA 2Y89A 4I7VA 4IOTA 3GKAA 3W6YA 3PULA 4UTTC 1WOAA 5IBXA 1DORA 5LSMA 3NR0A 2E1DA 1AMKA 4WX2A 1S5TA 3GIYA 1RR2A 3W84A 1TPC1 3B8DA 1NEYA 4GXMA 1I2OA 4HPJA 3LBMA 1S5VA 3A23A 1SO6A 4K7YA 3M16A 4P2VA 1FWRA 1M7PA 2AGKA 5EY5A 1GQNA 1OYAA 1TTQA 4JY9A 4BI5A 2R14A 1IXOA 3NO5A 3QMTA 3TXVA 3A22A 4MFDA 3NL6A 4CNOA 3IGXA 3MBDA 4RR4A 5EMUA 2OX1A 1WBHA 5AHLA 3IVSA 4X2RA 1TREA 4UCGA 4OBTA 3INPA 1YADA 4NJGA 3F4NA 1KM0A 4O4WA 2WKJA 3GNNA 5AYYA 4GUFA 5KSWA 3TX9A 2J88A 3EX6A 4M6QA 3G0UA 3EWWA 3GDKA 3ABQA 3ATZA 4M6PA 1R46A 1ZY9A 1H7XA 4FNPA 3HF3A 4YL2A 1JULA 4OV4A 1GVFA 1ZHAA 5EBUA 1UASA 3L0GA 3GVGA 3RMJA 1CI1A 4AWTA 4IPIA 2CLKA 3AJXA 4WQ6A 1VCFA 3P80A 3FJLA 3WJSA 2E5DA 3BARA 3W2JA 2WSRA 1KV8A 4ZQRA 2A21A 4RK8A 2NUXA 4YCPA 3GZ3A 2JK2A 3PUOA 4O28A 4FNSA 1EWEA 4FXRA 5BNKA 4BFAA 1GT8A 5I3HA 3LHTA 1AW2A 1OFAA 3IEBA 4POCA 4ADSA 1C8VA 1PIIA 3MUXA 2EF9A 3WJYA 1A5CA 4UNLA 1LOLA 3PWAA 4AEOA 4NX5A 4N02A 3C2FA 3TNOA 4DBEA 2NUYA 4I7UA 1OJXA 3LHZA 2YFNA 1W56A 4JTLA 5BMXA 1VR6A 4IJBA 3NQ8A 1NF0A 2Y61A 4AH7A 1OFEA 3ATYA 3TSDA 4WJEA 3DI1A 4O57A 4GJ1A 3N19B 3ELFA 1W5MA 2J24A 1YDOA 2ZTJA 3L21A 4L4MA 2TSYA 4UIOA 3IIPA 2F84A 1KM4A 1PHQA 1TPH1 3DFQA 2TRSA 5MHBA 4U28A 5LKYA 4LW7A 1PS9A 2C3ZA 2CLFA 2Y63A 3B05A 4ZQCA 4O17A 3I65A 2Y7DA 5FEZA 4ADTA 1A5SA 3FYOA 3UWQA 5I3FA 3NPVA 2DZVA 1TCDA 2Y7FA 3NXFA 4PC8A 2Q3RA 3GKFA 4MOZA 3W70A 4MYAA 1VRDA 1JCMP 1ZAIA 3P5YA 1LTDA 1H7WA 2BXVA 4JDBA 3BG5A 2ZZ4A 1X8FA 3M9YA 4S1FA 1FDYA 1W0MA 2CW6A 5BOOA 1H7PA 1OF8A 4ML9A 2FB3A 3LCWA 3W7OA 3DFPA 2ABAA 3DZ1A 3TJXA 5CSSA 5HJLA 3W1QA 3UY8A 3GB6A 3LTYA 4LTSA 2J6XA 3IIXA 4LWWA 1T99A 3LCGA 2HS8A 4O10A 3KHJA 5F1VA 1Z41A 1OFRA 3CC1A 2DZTA 1Z48A 4CCCA 2ZZ7A 2QAFA 4O4VA 2WNNA 4FX8A 4TMCA 4UTJA 2Q8LA 3G1FA 3O63A 5DCEA 3PM6A 3UWZA 3ABRA 3CWNA 1LORA 5C6MA 1UBSA 4M7TA 4UFMA 4M5PA 3FYPA 1FXPA 2WSYA 3NZ1A 3HMJG 3BVJA 1OVDA 1LRQA 1QWGA 1F74A 2WPBA 2OZ0A 3RU6A 2A2IA 2QCMA 5AC7A 5DY3A 3LHYA 1QCWA 4I9AA 2NXIA 4LVGA 5J5RA 4CNNA 2ISVA 3T78A 4ZMGA 1OFBA 4KWWA 2ALDA 3G1XA 2Z0IA 5HR6A 4JYEA 4N6EA 1P4CA 2Z1BA 2ZCGA 1A50A 4HNVA 1WXJA 3GXTA 2J9ZA 4JICA 4N4PA 1Q3NA 3W86A 4PTNA 4O0ZA 5G5IA 1FQ0A 1QO2A 1DJNA 1QPOA 1LOQA 4O18A 2GPTA 3QPYA 5HNRA 3GLCA 3I6RA 2QR6A 1SR9A 1W1ZA 3K30A 5C55A 3MHGA 3UXAA 1L2UA 4UFHA 3WJZA 1JCYA 4MKNA 2RFGA 2CZDA 4IMGA 1DOSA 3GXNA 4G1KA 1R2SA 2B4GA 3TQKA 3UZJA 3F4WA 4LC8A 4QSHA 5HQEA 2FPVA 4Z1AA 1M7OA 1P5BA 2FPYA 3TH6A 4UR8A 2ZYFA 1XBXA 2UV8G 3MP3A 4BWLA 3G3MA 1VJIA 2Z6JA 4R34A 4HSOA 3CTLA 2FJKA 2DP3A 1XL9A 3HG4A 4FX6M 2CLIA 3HG2A 2EHHA 3NQEA 4MY8A 3UPBA 4LT9A 3LCXA 3W7LA 1OX5A 3W22A 3W88A 4IXXA 1QO5A 1QPRA 3WK2A 3F1QA 2QJGA 2VFIA 1IGSA 4KFOA 4K7VA 2YR1A 4ZVJA 1O4UA 3P8IA 4YWIA 1K8YA 1UCWA 4DF1A 1H63A 2X2GA 2X1SA 3HPXA 4JTTA 3DBPA 2YYTA 3GAYA 4MFEA 1ZNNA 3JRKA 2QAPA 3NQ7A 1XBVA 1VLIA 3G22A 1ZAJA 5AHEA 2R8WA 3QPZA 3M5YA 1HTIA 1SW0A 1GWJA 3NQAA 4IMFA 5GVJA 3LLDA 5DCDA 3C2RA 1IIGA 1XXXA 2QJIA 2A6LA 4ONVA 3ABOA 2A6NA 3PY2A 1HO4A 2I14A 3LM7A 2V2CA 5U7SA 3QEZA 5CZTA 2CZEA 3FS2A 4MZ8A 1W5PA 1TRIA 4Q33A 5CPOA 3W75A 3B03A 2V82A 4MY9A 3S1XA 3HQ1A 3LXBA 2QUVA 2EGZA 3I7QA 3GR7A 3W2KA 3LTSA 2NZLA 4I7WA 4UC5A 3U8GA 1K7FA 1ONRA 2E6FA 1DV7A 4EOUA 3UY7A 5LNRA 1WAUA 4TX9A 1LDCA 5I3JA 1AG1O 1QDSA 2Z2UA 4WUIA 3SI9A 1CX9A 4JDYA 4XTDA 4MIMA 4NZJA 1TPUA 3STCA 1H7OA 1QPQA 3UYCA 2GJLA 4UTLA 2A0NA 4N9CA 2JKPA 4OGZA 1RZMA 3MBFA 2W6RA 4RKAA 2GJNA 2V2HA 4FNQA 4O1DA 3IRDA 1TSIA 1NF7A 1FCQA 1VZWA 3O07A 3S6DA 5I3GA 4K8HA 3STEA 1TTJA 2OJPA 4PEKA 1SZGA 4JY8A 2WNZA 2OT1A 4C1LA 1RQHA 3A21A 4OQVA 2VC6A 3CHVA 3NQDA 3C8FA 3W2LA 5ABTA 1GPWA 4IXHA 1XUUA 1EP2A 3M44A 1TYGA 3DKLA 1TPFA 4WY0F 3LTPA 3TA6A 4K36A 2Q3OA 3WFAA 4UFJA 2AQWA 2ZZ2A 5CPMA 2ZRWA 2GQAA 2D73A 1TMHA 2V9DA 4R33A 1OFDA 4FNTA 2P0OA 3G8RA 4HN4A 3W7KA 5DN1A 5LGXA 4H6KA 4EF8A 1SU5A 4AHOA 2QUTA 3W71A 1GYNA 3CPRA 1TV7A 3SW6A 3N34A 4PL1A 5HR7A 4Z0JA 3G0XA 3SFKA 5A5WA 1P0NA 1UUMA 3L0KA 4PH6A 5HWMA 3I7RA 1WDWA 1JCJA 4UTKA 3DHDA 3W7NA 4HKPA 2JGQA 2RDUA 3M5XA 5LHEA 4AAJA 2I1OA 1JCLA 5FESA 3N3MA 3NNTA 3C6CA 4BR1A 4FNRA 5AB3A 3C4UA 5HMSA 4XZ9A 3HGSA 3L0NA 1EEPA 4KKXA 3W07A 3C0JA 3E9AA 5AHNA 2OMAA 2Y6ZA 3EWYA 3L67A 4AF0B 4AHPA 4LVDA 3W9ZA 1ICPA 1WV2A 3O6CA 1GTHA 3W1UA 1Q45A 4QQ3A 1X7FA 3BG9A 4LV4A 1RVGA 2YW4A 3G8EA 2RHGA 3YPIA 1H51A 2E77A 3SR7A 1Q6OA 4AMAA 2CFFA 3PF3A 3GX9A 4ZQPA 3QSRA 2JGYA 2VENA 1IIHA 4TO8A 1VCVA 4JS3A 2P1FA 3UQNA 3G1YA 1PV8A 3EKZA 3UPWA 5H91A 3E49A 2BLEA 4DPQA 4JTEA 2FPTA 1JVNA 5D37A 1Q6LA 1GYLA 3O15A 3LGEA 2QCEA 3BGGA 3S0CA 2ZZ6A 1ZAHA 3VNDA 4PCFA 3DI0A 3QH2A 4GFSA 4JX5A 4QITA 3UWVA 3CIXA 1Z42A 1PVNA 4NQ1A 4NJIA 3HPZA 2H90A 6TIMA 5KTLA 1DHPA 3QSTA 2ISSA 3D0CA 2VFHA 4KWVA 1R30A 1TTPA 3HO8A 4NX0A 5FF7A 1I2NA 3LRLA 5AC6A 1H7RA 5F4XA 3DXIA 3TFXA 3P8JA 5DY2A 4DPPA 2R91A 3H54A 3C61A 1EA0A 4EF9A 3CIWA 1WOBA 1OX6A 3NG3A 3BW4A 4N9EA 3TJLA 2ATMA 5LNWA 4N2YA 1U83A 4W9TA 3NZRA 2A1YA 1H61A 3WK0A 3THAA 3M6YA 4NJKA 5LZLA 3SGUA 2QEZA 4IMDA 2TPSA 2DZSA 1GOXA 4Z08A 1XBZA 3R5EA 4X22A 4O12A 1YTDA 1T8XA 1FCUA 5AHFA 1D9EA 1KTNA 2B7NA 3NQCA 3TQVA 4K37A 1K3UA 2E6YA 3GDLA 2ZRVA 4TU1A 5U4NA 3L9CA 4LUJA 4AB4A 3USBA 4K38A 3GR8A 3TCEA 4KFPA 3QRHA 3LHUA 1RV8A 2YYUA 3EEGA 3HGJA 3ZFHA 3C56A 3MW7A 2DORA 3NQGA 1FWSA 4NZFA 3P74A 1SO4A 2WO5A 5FF3A 3EX2A 5D02A 3FFSA 1LYXA 3A24A 3U2OA 4JNMA 3SGZA 3DENA 1KFLA 1FWWA 3I7SA 3M41A 3WJWA 5D2TA 3TAKA 1GVRA 1YTKA 3GXPA 3NQ6A 1JRBA 3PG9A 4EWND 1XM3A 4QJ1A 5LNSA 1VC4A 3PSWA 3PR2A 1B4EA 4HIBA 5AC8A 3PVFA 1W37A 1W31A 3MI3A 4OV9A 3GDRA 3LCHA 5F4WA 4XKYA 4UFLA 4IPJA 2FLIA 3LX9A 2ZRXA 1KFEA 4FIQA 4R7JA 5G1YA 3LCFA 1BTMA 3W23A 2YGYA 3DHFA 3E12A 1VYSX 6ALDA 2ZZ5A 2ZQ0A 3LDVA 5D32A 1OF6A 4Y90A 2VFFA 3LCIA 1AW5A 3TE9A 3BO9A 1C29A 3M5VA 2FQIA 3PB2A 1TQJA 1WX0A 4LNYA 1OABA 1BWLA 5HINA 5DLCA 3SIZA 2ZFAA 3FOKA 5H2ZA 1YTEA 4MVAA 3M47A 4FEZA 1B57A 1OK4A 2V0TA 2Q8ZA 4ADUA 2QCCA 1EWDA 3LRKA 3O1NA 3VFLA 1H62A 2NV2A 5DBUA 2CZ5A 5K9DA 1TIMA 3CU2A 1R2TA 1LZOA 1KFBA 3QW4B 2VKZG 3GDTA 3F03K 1F05A 5FI8A 3STFA 2C6QA 4GNJA 3RFAA 1K7EA 3H53A 4O15A 1OK6A 1MSSA 4PODA 4K6AA 1VYPX 3KVMA 3ABSA 3OEXA 2WSQA 1EPXA 1Z44A 3NQ2A 1G4SA 1WYIA 4P61A 4XWUA 3TXZA 2A7PA 1YXYA 3M5ZA 1F6PA 4AWSA 3L5MA 4LVAA 3W1PA 4RX0A 4GUIA 5FEPA 1XDLA 4DF2A 3MI2A 2WQPA 3N2MA 1SSDA 1KLZA 1TV5A 1XUZA 1SPQA 3LOTA 1IXQA 3G1AA 1KM1A 3L65A 2IQTA 1VCGA 1GVQA 4A2SA 5KZEA 3VCRA 1G69A 3HOJA 3G1SA 3A5FA 4NNCA 3W1MA 3W7EA 1KA9F 3PUEA 4UTWA 1FBAA 3EWBX 3EWXA 3TC6A 3UD6A 4XKYB 2PRHA 3V1PA 3QW3A 1OYBA 4LOCA 3KRZA 3NPXA 4UXDA 2VFDA 4JGDA 3TW6A 1HFBA 3TROA 3TV8A 1UB3A 3S5ZA 3CWOX 2V5BA 4WOZA 3MYOA 4QIUA 2E68A 5AHIA 4E2DA 4O54A 3TAOA 1XDMA 5HULA 4NU7A 2P10A 3TFCA 3IGUA 1JUEA 4H3DA 2V81A 4ORIA 1NFBA 3LERA 1OX4B 3CB8A 3KAOA 4IWWA 3A9IA 5CKSA 3MO7A 5CPNA 3C2VA 3W7JA 4CNPA 3MJYA 5F2MA 1RQEA 2CWNA 4BF9A 1KM3A 3TC7A 1MEWA 3NPUA 3NM1A 3DFTA 2CLOA 2B0MA 2QDGA 4O52A 2H3DA 2VXNA 3TDFA 2H8ZA 3W7QA 1LRNA 3DU0A 1UUOA 1M5WA 1W54A 3DFSA 3B4UA 5FEXA 1F76A 4HNNA 1EP1A 1O95A 8TIMA 2Z6IA 2RKXA 1I2QA 1KFCA 1QPNA 4JN6A 3UWWA 3QF0A 3KOFA 3W2NA 1FUYA 1L6YA 3W2MA 3IIVA 4QM1A 2JKAA 3P84A 4MZYA 5I3KA 1W3TA 3W7HA 1GJPA 5FEWA 2VEMA 1UJPA 4OU1A 1C9DA 1FWNA 3P62A 5D05A 5AYZA 1MEIA 3NL5A 1TPEA 2W0UA 1MO0A 1NAL1 1YPIA 5C5YA 2HS6A 2CZFA 5A8GA 3TSBA 4DBDA 3E0IA 5D03A 3P81A 4YMZA 1LP6A 3L5AA 1L9WA 4LS2A 3W7DA 1DBTA 1QNVA 1PL9A 3W7PA 3T44A 3UNDA 3P5ZA 3TIMA 5E1QA 3Q58A 2Y7GA 3S1VA 3R12A 3W83A 3W1XA 1GG0A 5SWUA 1OFQA 3CLMA 4MY1A 1LBFA 3N9RA 5EA9A 3B0VC 1SSGA 3G0SA 4LS0A 5AYXA 2ZA2A 3KRSA 3QQ0A 4JTFA 3OA3A 1T0OA 2GVGA 1IF2A 1O94A 4XBKA 1YYAA 1N7KA 3E96A 4HHPA 3NM3A 1ICQA 4GUJA 2VOMA 4A2RA 3NOEA 2PRLA 3MYPA 3GDMA 3HPSA 4BK9A 1KTCA 3EXRA 5KMYA 3T4CA 1YLVA 1KV5A 4A29A 2V2DA 5LGZA 3LCLA 1WQ5A 1G4PA 2EAWA 1FY6A 1ME9A 3DFNA 5CZJA 5G4EA 4S2BA 1TO3A 4PA8A 1BWKA 4AXKA 3EX4A 4RXGA 1B3OA 3S1UA 2ZBTA 3FKRA 2J9XA 3QMRA 3W1NA 4JIPA 5TIMA 3IGSA 4WZHA 1EX5A 1KBJA 2Y88A 3W7RA 3TU9A 4YLWA 1FDJA 3IV3A 1OG0A 3W74A 4O8RA 1W8SA 3KX6A 3I68A 2VFEA 3W1LA 4NVTA 3LXAA 1M6JA 3QQ1A 4JYDA 1KW1A 5BRBA 4GC4A 4O1BA 2F7FA 5DCBA 3FIGA 3W2UA 1TQXA 4NNBA 4DELA 1W3IA 2C18A 3IIZA 3NPWA 4N4QA 5DXYA 1XKYA 1YXDA 4O53A 1D3GA 4IUOA 4XUGA 4O0KA 5K4ZA 4Q32A 5D04C 2WOQA 4UMBA 2WJZA 5HUOA 3ZR4A 1FCVA 3RNDA 1Q6QA 1QOPA 1ML1A 1OFPA 1OX4A 1ZCOA 4MLJA 3UWUA 3FKKA 5EPDA 2JKEA 5KZDA 4R53A 4UFKA 4HNTA 2WNQA 4O11A 2YSWA 4GE8A 2VEPA 4XTIA 3DH7A 2G5WA 3P60A 3B06A 4S2CA 1RD5A 4IMEA 3W76A 1ZJIA 3PS7A 2LLEA 3W1AA 2ZA3A 3JS3A 1XI3A 2QF7A 1TJRA 2NX9A 4CQ9A 1TRDA 2OCZA 1ALDA 4DO6A 5FF2A 1H1YA 1X1OA 2DU2A 3NVTA 1FX6A 3PB0A 2NX3A 3RLVA 1F7BA 3OHIA 5LNVA 1X1ZA 3QC3A 4CQ8A 3LHVA 4IX0A 2ZZ1A 2CLMA 1HG3A 1RPXA 4UTMA 3LV6A 1JJKA 3LRMA 1DL3A 4H4IA 1ZFJA 1AL7A 1R47A 4ICNA 1O5KA 2GUUA 5K7JA 1XBYA 1GVOA 3TR2A 5L9FA 3M1ZA 4DEFA 1G7VA 3BK0A 5F4SA 3Q2DA 4MPQA 3NA8A 1VLWA 4O16A 3TKFA 2G97A 4RLIA 3N9SA 5D2YA 3KXQA 3OVPA 2VEIA 4E38A 4UTIA 2YFOA 3PBWA 1S5WA 3N14A 2O7SA 3C52A 4JD4A 3FEMA 1FDZA 3R2GA 3RLUA 3M43A 3M0ZA 3MWAA 4ORMA 5K9CA 4UTTA 2JBMA 4LY8A 1Q6RA 2GQ8A 2ZZ3A 4IGHA 1JRCA 2O7QA 4D2JA 2HSAA 5CSRA 3LB0A 2QCDA 3VE9A 2DZWA 4RJEA 1EP3A 1IXNA 4QNWA 2CLHA 3NAVA 4M7SA 2ZRUA 3W7GA 3EWZA 2X1TA 4RZ4A 1K8ZA 1O60A 4AHQA 5K9XA 5DELA 2RH9A 1PE1A 1SUXA 1YDNA 3OBKA 4UFIA 2ATSA 5EKYA 2KZHA 3BW2A 4HPXA 3TUUA 1EUNA 2HMCA 3O05A 1PCKA 3W1RA 1FCBA 5TQLA 4A3UA 1VQTA 5E0KA 1SZEA 4DF0A 4XBSA 4HT3A 3PBUA 4FB7A 2NWRA 2DZUA 2VELA 1KFJA 1N8FA 1LLZA 1JCXA 2YZRA 3OVRA 5D2XA 5F1UA 1VYRA 1AW1A 1VGAA 3OIXA 4RXFA 1EUAA 1JCNA 4O14A 2YCEA
chains in the Genus database with same CATH superfamily
1I45A 1WDPA 4HGXA 3O16A 3GNDA 2H8XA 2RDWA 4S3EA 2FZ8A 1ENUA 2B7QA 3FGCB 1LQ0A 1QASA 1V77A 4WVXA 4HA1A 4TVUA 2ZUSA 1KGXA 1X96A 1XYAA 5FJJA 4ZXOA 1VJSA 3O0FA 3SCVA 1SO3A 3V75A 3HG5A 4DLFA 1BKSA 1QNSA 1X6UA 3IGHX 1KBKA 5D8ZA 4LBSA 5D09A 1A5LC 2ZRZA 5E9XA 3C2OA 3KWXA 1HGYA 4S39A 2D0GA 1A53A 4I9JA 5M1TA 5F2LA 3BCJA 5H8PA 2GOUA 3MMWA 1DIOA 4UNKA 4JXCA 5A95A 5FKYA 3QR0A 2NQLA 1J0IA 3B8UA 3K13A 2PF0A 8RUCA 3P7YA 1FWIC 1GVSA 1F61A 1C8QA 2E6DA 3ITTA 3HB9A 4QG9A 1Q7MA 2AL2A 1O1HA 1FWEC 2GDVA 4G6CA 4EIVA 2B7OA 3QMSA 2GQ9A 3EKLA 4NXKA 2PDNA 2CU0A 3U5UA 4JQ4A 4F2TA 3EB2A 4IP7A 4D6JA 1S1PA 2BDQA 2CCRA 4Y9AA 4FALA 4JTGA 4C6NA 3URBA 2PWGA 3ISIX 2REQB 3MVTA 6XIMA 3CMJA 5HXMA 2PP1A 4LQ1A 2DQWA 2BHUA 2D20A 5CCZA 4IQLA 4XAYA 1VJZA 1GUVA 4IMCA 3IK2A 4ENLA 2OGJA 4BI6A 3LMYA 4YS1A 1IWPA 1QFEA 1ME7A 5EL1A 1FH8A 3BOFA 4K8EA 4DYEA 1THFD 1K4HA 3M7WA 1XLGA 2A85A 1NTHA 1BYAA 3U7BA 1ZJAA 4ZXLA 4XO6A 3E1F1 3I4KA 2VZUA 1X6NA 3AHTA 3WDRA 2ACUA 4XBJA 1SQ7A 1DQXA 2QUNA 5BMWA 2A3EA 3F4VA 1E6RA 1Z89A 4QISA 4QJ4B 1H7NA 1XPGA 4JIRA 1E55A 4AIUA 3WY1A 4NYUA 1HP5A 3H55A 5TAOA 3N13A 1ODZA 4NRSA 1E51A 3SJ3A 2CBJA 1W17A 5G2WA 3ARXA 3PAJA 4YYFA 1CW2A 4S3CA 4JTJA 3WK1A 1EF2A 1UR9A 2YOCA 5JMUA 5C2GA 1K8XA 4X2PA 4LAUA 1YNPA 3BAKA 2OWWA 4JEQA 3W73A 3DX5A 1I2RA 5BXSA 3RDKA 2Z7KA 3L12A 4FO4A 4PB3A 1XYZA 2J77A 3EMCA 3MSYA 2WQDA 5CBIA 1HL2A 3KOZA 4O13A 5XIAA 1VPXA 3FLUA 2IUZA 4LU0A 4A8NA 5IBXC 4OOZA 4C1NA 2PLKA 1PYMA 5FF4A 3JU2A 1DXEA 1AQMA 3IJ9A 3W1TA 3W7MA 3IACA 1QATA 2NXHA 1YX1A 4HHMA 2D22A 2NXGA 5MKGB 1LLWA 1FWFC 1TJPA 4M82A 4EVZA 4GYPA 3BGJA 5BU9A 3E2SA 4QLJA 1J0KA 3AXMA 3R43A 4HNUA 1AFSA 1XSKA 4M19A 2PTYA 1PX3A 4QP0A 4R7OA 1JUKA 3VKBA 4GIRA 4FXFA 3PFMA 3TMQA 1O1ZA 1TVPA 3VOIA 1KFKA 4IG2B 4FNUA 1KLYA 2XH2A 4YVXA 1VH7A 1XDJA 3CQ0A 4J3VA 3S42A 5AKQA 2FGLA 3ITCA 3KVLA 1ME8A 3ZVHA 3T55A 1QNOA 1BEUA 3KVKA 3RM9A 4U33A 2XINA 1IQ8A 3EOOA 3BV4A 4LS1A 3FN9A 3THQA 1S2UA 4OVXA 2OYLA 3ARUA 2V68A 1FA2A 1LROA 4KGLA 4WY0B 4TIMA 2G50A 2G41A 4EXQA 1XG3A 3B0PA 1W3NA 1P1XA 2BX7A 3MP5A 4DAIA 2GJRA 4LRSA 3AXXA 1ADDA 2PE4A 4H00A 4PZVA 2DSKA 3H2NA 2G3MA 2VZVA 5XIMA 2PCQA 1UWSA 3VIHA 3CH0A 1U1UA 3CHDA 4FSAA 3SZ8A 3TZFA 4AMCA 5LHFA 3VNJA 1PBGA 1CB2A 1ZPTA 2ODOA 2XIMA 3WBEA 2HTMA 4B5SA 4H6QA 3M07A 1ZU8A 4JHZA 1BYCA 3EOUA 1N2VA 3G1HA 2Z1SA 1QMLA 3LSCA 1JI1A 1J5TA 3K4AA 1PKMA 1DPMA 2EKCA 3CHCA 2OKOA 3HQOA 1F2JA 4RUBA 1F3XA 1W5OA 4GA8A 4HYRA 3E02A 2V30A 1BYDA 1PWLA 2OX4A 5DMYA 1SW3A 4J4KA 5I02A 3A5VA 4LUIA 3ZWTA 1VFFA 3A12A 3VI2A 4BWLC 3L68A 4OHQA 2FDSA 1WDQA 5FL1A 3S2NA 3WJXA 1S2WA 4Z1BA 4IL0A 2BMBA 1R9ZA 3TN6A 1VFOA 1IZJA 4OT7A 3JZEA 1UMLA 3EDDA 2G96A 5GNYA 2Y70A 4ZTYA 2GFTA 2YBUA 5K2ZA 1KM6A 5LA2A 5EBAA 3F2CA 4LCQA 5KINA 2JALA 3KDNA 2G95A 1VKFA 4P7RA 4LVFA 1WO2A 2PLMA 1RHCA 3UT0A 3PNUA 2VGIA 3AO0A 3REQB 3FXYA 3WK3A 1Z3NA 4JL1A 5ECUA 1JDAA 1J79A 3VM5A 2PC4A 2QKFA 3L4TA 3P61A 3LBCA 3V0SA 3U57A 2XN2A 1NDWA 2O4MA 4FF7A 3QJAA 4CCEA 1JDFA 3MVIA 3LXCA 3WLKX 4X63A 2WMJA 1MYRA 1TWZA 3VKAA 4PMNA 3RRAA 2V5LA 4R7WA 4OWGA 3HM7A 4I5UA 4GZIA 4K39A 3NDOA 1FHUA 4MYXA 1UA3A 1ZBWA 4O50A 2X30A 3NYDA 3E5BA 3VGBA 2NUWA 3LV5A 1E1FA 4WD0A 3U3HA 2PURA 1EIXA 1SZFA 5CZ0A 1M3UA 1I8JA 4LV9A 4DNHA 4OUEA 2OLHA 1RSCA 3TYUA 4MG4A 1ADOA 1RUSA 1FWTA 3DHPA 2ZDRA 1JPDX 2E7FA 2VQUA 1RK6A 1JYXA 1Q8AA 1ZUAX 4EK7A 4PBEA 3W6YA 4DJEA 4UBPC 1NIUA 3FGCA 1EGZA 1WXZA 4WX2A 5HOSA 3UXIA 5E70A 5TF0A 5ENLA 1RK5A 1NEYA 3H2CA 4ZB2A 3UR2A 2YLLA 4AC1X 5GNZA 3BC9A 2CLPA 3A23A 1SO6A 2W3ZA 1FWRA 1TTQA 4JY9A 1BGGA 4XK2A 3QMTA 1K4GA 3TXVA 2ZUUA 3A22A 5IRPA 3GG1A 3BAYA 1A5NC 3C86A 3IVSA 4OBTA 4NJGA 4LCRA 2WKJA 5AYYA 3EOSA 1MDLA 3AWOA 4GUFA 2WCGA 2J88A 4S3FA 4DM2A 1H7XA 5DT5A 4YL2A 3HF3A 1VBHA 4XV0A 4DY1A 2A3LA 3CAQA 3GVGA 1E15A 2L5HA 1VAHA 1VCFA 5HJXA 3WQVA 2YCLA 3J7HA 5FD0A 6PTDA 4HOXA 3P80A 3FJLA 4H1ZA 4P8WA 2WSRA 4ZQRA 1CLKA 4AXNA 4S3AA 4FXRA 1XIEA 3OHMB 1KRBC 1B0IA 3LHTA 1OFAA 3IEBA 4ADSA 3MUXA 2EF9A 3NTYA 1NARA 1BWVA 1LOLA 5M17A 3BJSA 3M0VA 3C2FA 4JQ2A 4YWSA 5I00A 4GVHA 4B4HA 5BMXA 1LQAA 4Q4PA 3XINA 4Q4QA 4WIWA 1GQJA 4WJEA 1UD6A 3C0LA 4GJ1A 1XIJA 4L1GA 1YDOA 4KEZA 4UIOA 1DJHA 3V3WA 1KFWA 3GNPA 3SCNA 2ASHA 1KM4A 1TPH1 5MHBA 5KETA 1DIKA 3S1GA 3AYTA 3CUZA 2C3ZA 2CLFA 2Y63A 3B05A 4O17A 3I65A 5DFAA 4ADTA 5I3FA 2ZE3A 1XF0A 5KEZA 1TFVA 2UWFA 3NXFA 4XVDA 4MOZA 4AWEA 2G3NA 1VF8A 1JCMP 2O9TA 1YE4A 2TAAA 1DXFA 4WLCA 1LTDA 1SYTA 5CG0A 3N18A 1OF8A 2FB3A 3WSUA 1AUSL 3UG8A 3DZ1A 3TJXA 4N0RA 2F6XA 4C6MA 1OGGA 4LWWA 2HS8A 3ITXA 5GQBA 8CGTA 3M0IA 4CCCA 3GXMA 1G5AA 2A3BA 2Q8LA 3O63A 1X97A 2ZUWA 1GZJA 4MB3A 1E4MM 3SCQA 3TJIA 4FA3A 4D6DA 1BRLB 3UA3A 1ZB5A 3NZ1A 3N3TA 3GSMA 4EP8C 1QWGA 2WPBA 1KCKA 2A2IA 5LIYX 1QCWA 4I9AA 3Q45A 2GL5A 3G5EA 3AMLA 1OFBA 3QV9A 2CHRA 4AU0A 4UOJA 4JYEA 1UD2A 1P4CA 2OGYA 1A50A 1WXJA 1XIFA 5A8NA 3OPSA 4YTQA 4YPJA 2GQ3A 4N4PA 1Q3NA 5AVNA 1A3HA 1PTDA 7PTDA 2DSWA 1FQ0A 1QO2A 1QPOA 2GPTA 5E6YA 3RR1A 2BNJA 2KX9A 2QR6A 3KL0A 3K30A 3L4WA 4J3XA 2PA6A 4MKVA 1L2UA 4UFHA 1JCYA 3VNMA 3UBPC 2RFGA 4IMGA 4QBXA 2WXDM 3USZA 1KRMA 3ZZ1A 3ZO9A 4LC8A 4QSHA 3L4ZA 4IFOA 4HA0A 1CEOA 6TAAA 2CZVA 1P7TB 1M7OA 3PJTA 3TH6A 3CUGA 2ZYFA 4ZBCA 4YTSA 1TWIA 4Y9NA 2UV8G 1PUDA 1IEQA 2Y8UA 5EU9A 1VJIA 4IUGA 4E2OA 2FJKA 3HG4A 2CLIA 3KRBA 5I5RA 1POKA 2EHHA 2BVWA 3NQEA 4MY8A 2OG9A 4Y7EA 3CMFA 1JDDA 4NKCA 3W22A 5JBDA 1H5VA 3WK2A 3F1QA 2QJGA 2VFIA 2BHYA 3QY7A 1IGSA 4HMCA 4AEEA 3HN3A 4ZVJA 4EE9A 4C5ZA 3W27A 1IT7A 1PDZA 2NQ9A 1O7AA 4MGGA 3GRIA 2YYTA 2CHNA 1ZNNA 3JRKA 2PODA 3GW0A 4GZ7A 4MKSA 2VEFA 1VLIA 4HD5A 4W8LA 1V7AA 2YDSA 2R8WA 4ATDA 1SW0A 1IIGA 1XXXA 1Q65A 3KP1A 1HO4A 1UIOA 4AIBA 3FS2A 1TRIA 5CPOA 3B03A 4HPGA 2A3CA 3I7QA 1UKOA 3KCJA 1AMYA 1JF5A 3W2KA 1E1EA 3U8GA 2YA2A 1H49A 3NSNA 2PDQA 4XD3A 1H41A 1R86A 1DV7A 3UY7A 3RAOA 1EHNA 5I3JA 1AG1O 3WMBA 3KWSA 3VD4A 2Z2UA 2V3DA 5DMMA 4AVNA 3GG7A 1ELSA 3AIBA 4HNOA 2IPFA 3LMZA 4GY1A 1NQ6A 1E5NA 1WKEA 3ZSSA 3UESA 4KW2A 4HA4A 1EPVA 3STEA 2OJPA 2WNZA 4C1LA 4FF5A 1ESWA 2GWNA 5DEZA 1U30A 1GQIA 4DJDD 2EPMX 3C8FA 4NAEB 3M44A 4QG8A 4H2CA 1E70M 3TA6A 1GQKA 2AQWA 2ZZ2A 4IFKA 2GQAA 5HPCA 3LSBA 4QQUA 3U4FA 3W7KA 3MUY1 3S2MA 3T6CA 5AC5A 3W71A 3R1ZA 4AQLA 4M6UA 1GYNA 1TV7A 3SW6A 3ITLA 4JTDA 3TYBA 1CXEA 1F8MA 4BJHA 2PWDA 3H2OA 3I7RA 2EPOA 4UTKA 1EGVA 2VURA 3AMCA 1OGSA 1DIDA 2IPWA 1G94A 3N3MA 5JBEA 4KCTA 3UP8A 3WQ4A 3AZSA 5AB3A 3C4UA 1XYBA 1OZQA 3L0NA 3AHYA 3WD3A 3DG7A 2Y6ZA 3RO6A 4AHPA 2OEMA 2QPSA 1NM9A 2J62A 1WV2A 3WD0A 3V4BA 1GHSA 1B90A 3PWGA 1E71M 2BVYA 4QQ3A 1X7FA 4D8ZA 4GH3A 3L4XA 2YW4A 2HWGA 4PTVA 3TJ4A 3LU2A 1Q6OA 4AMAA 2CFFA 3R0KA 4Y9PA 2P50A 1KB3A 2DZAA 4TO8A 4JS3A 2P1FA 1M7XA 1KWKA 3EKZA 3UPWA 4E3VA 3E49A 4GIYA 1A5UA 4M1BA 1NWUA 2JIWA 2ZZ6A 1YKWA 1ZAHA 1VBJA 3CUHA 4GFSA 4GBDA 1SFSA 3CIXA 5B7YA 2UY4A 2PLCA 4LNCA 6TIMA 3QSTA 3CV6A 2VFHA 2YJQA 1XCXA 2CIPA 3LRLA 1W1VA 1H7RA 5F4XA 3P8JA 3U48A 4DPPA 3AS3A 2R91A 3H54A 3VKKA 4L9ZA 4N9EA 2ATMA 4QGCA 3GVVA 3MCNA 1JZ4A 1H61A 3THAA 1UZDA 3BJFA 4B3KA 3SGUA 2Y5EA 2QNEA 2GK1B 3NURA 1XBZA 3AYSA 4X22A 2HXUA 1T8XA 5XINA 1QI5A 1UD3A 1KXTA 4H8VA 5AHFA 1KTNA 4NILA 2OOFA 2FZ9A 4K37A 2E6YA 4M51A 5LA1A 1UUQA 4TU1A 3WENA 3WMCA 3FDGA 4AB4A 5E5CA 2Q71A 1H09A 4HTYA 3QRHA 1RV8A 3HPAA 3NO1A 1JXKA 1NWRA 3C56A 3VILA 3W02A 2BOFX 3ABZA 3UZXA 4ZE5A 4NZFA 1UZHA 3P74A 1V8EA 3BL3A 1T41A 3K5XA 3ZVIA 1HKWA 4JNMA 1Q66A 1GVYA 3M41A 1AJ2A 3NZQA 2CWXA 1YTKA 3GTIA 3PG9A 4EWND 1XM3A 5GJNA 2NSXA 4EACA 5LNSA 4CNUA 2G8ZA 4UQCA 1TMQA 3LCHA 5F4WA 4XKYA 1AH3A 4UFLA 4IPJA 2ZRXA 4WJXA 4QDPA 3E12A 2OWCA 4IG2A 2ZQ0A 3LDVA 5D32A 3HA1A 2RDXA 3LK6A 2HV5A 4EKJA 2FQIA 3VOCA 3TW9A 3PB2A 2BG5A 1TQJA 3GW3A 1V6XA 1OABA 2XYLA 2GUYA 1VBUA 4ZCWA 3CYJA 3FOKA 2BY3A 5H2ZA 4MVAA 4AD4A 1LWJA 3B0YA 3O1NA 1VRXA 5HDRA 3POHA 2CZ5A 1OIFA 4LEQA 3C3UA 1KC7A 3CU2A 3W25A 1JL8A 2BB0A 4RE3A 4GO8A 1FH9A 3F03K 4QTGA 3B4YA 1UW9A 2NW0A 1K7EA 2HE5A 4PODA 2QHAA 3VAVA 4US5A 1WYIA 3PAOA 1MXDA 3VIFA 2OOGA 3W1PA 4RX0A 3UZYA 1R5YA 2YBTA 3N2MA 2FFIA 4YU1A 3LOTA 1PSCA 2DV0A 3GVWA 3TZNA 2ZX7A 1Q8JA 5ABEA 5H8UA 4Z2LA 1A3XA 2ZOXA 4C7DA 3APTA 1GVQA 1CGTA 2HJPA 1ONEA 3HOJA 3G1SA 3A5FA 1XLLA 4NNCA 3PUEA 1EXPA 4UTWA 7REQB 3UETA 4G56A 1UG6A 2PRHA 3QW3A 1ZSXA 3K2GA 3H22A 1IR2A 3HMCA 4X0VA 2VFDA 2XWEA 3K8KA 3EDJA 4WOZA 2E68A 4Q8UA 4E2DA 2YLAA 3TAOA 1H3GA 1J0JA 2VR5A 1FHDA 2XM2A 4ZSTA 1L8NA 4HK7A 4H7ZA 3M46A 4R9OA 4V27A 1AD1A 3VU2A 4GIEA 4IWWA 3Q65A 4E4UA 4TV6A 4IZGA 6A3HA 3CL8A 1XP3A 5F2MA 3UJFA 4L80A 1MEWA 3NPUA 4REQB 2CLOA 4QS5A 4DJFA 4O52A 3W7QA 1LRNA 1TR1A 5C70A 1GOOA 2HPMA 1M5WA 3VNIA 4ZOAA 5D9OA 1E5JA 2VX6A 3GHTA 4MMWA 3AJ7A 4JN6A 3UWWA 2DFAA 3QF0A 3P3BA 2HVOA 3BMVA 1HF6A 2JKAA 4FLSA 2XGBA 1W3TA 4F9JA 1TJ0A 4PN2A 5FEWA 3B9DA 1EO5A 3P62A 3SGGA 3VGEA 3WQ8A 4FOKA 5I7GA 3MMUA 3RX4A 4NSBA 3T1GA 1YPIA 1E6XM 5A8GA 3E0IA 4RNHA 2ZUTA 4C7GA 1FFQA 3DOPA 1E3ZA 4QXIA 5E09A 1DIEA 4V1XA 3OU8A 1R3RA 1E72M 2W67A 4HK5A 1E6ZA 3MZ2A 3BSGA 5I79A 2IS7A 2E9LA 2IPGA 3P5ZA 1Z69A 2NT0A 3TIMA 4PB5A 3BSHA 3EKGA 5E1QA 3Q58A 3GNXA 1R6WA 5C7VA 4FAMA 3S1VA 3R12A 4DUOA 1Y5XA 5SWUA 1EJXC 1OFQA 1LWHA 4AZGA 3CLMA 3KM8A 1A0CA 3CPUA 3LPPA 4KQNA 3ORWA 2OU4A 1BLIA 3KRSA 3UYIA 2XSAA 2EG7A 1VIWA 1YYAA 3WFLA 3E96A 4AY8A 1B9ZA 3OGRA 3MKVA 4BK9A 2BVDA 2BHZA 5REQB 2OYKA 4GCAA 5LGZA 1MQPA 3VX1A 3WUBA 1ME9A 4DYKA 1BVWA 5DX7A 1HQTA 5G4EA 1TO3A 4F66A 4PA8A 3OA5A 2YA0A 4AXKA 2FVKA 4MNLA 4GC3A 1B3OA 1R7AA 3B8TA 4JTQA 3UCDA 3FKRA 2J9XA 2VM8A 1VENA 1UOZA 2XVKA 3JZUA 1F3TA 3IGSA 2X8RA 4PMUA 3W0KA 3W7RA 1VFUA 3TU9A 4LGXA 1ISXA 1FDJA 3IV3A 4CN6A 1B3VA 4FOJA 3QTGA 1W8SA 4B92A 2EG6A 2NV9A 2FH6A 3FCPA 4NHVA 5I3DA 3M4HA 4Q4SA 4LALA 4LSBA 2ALRA 1XRTA 1M6JA 5T9CE 1N8WA 5E0FA 4GC4A 2HZGA 4O1BA 4WSKA 4GIAA 2VC7A 2J25A 3W2UA 7ODCA 4N4QA 4HOWA 4IPPA 3V5OA 2C71A 3E38A 2OWXA 4IUOA 2PZ0A 3WBAA 1EKOA 2GJXB 4XUGA 1MQQA 5K4ZA 5D04C 2OVLA 3PBGA 3ZR4A 1FCVA 3RNDA 4MWAC 3FXGA 2WKGA 3OLGA 1SVDA 3ANUA 3EPNA 3SJNA 3FKKA 5EPDA 5KZDA 4UFKA 4HNTA 1W6TA 4LY4A 4AZBA 3OW1A 3KLKA 5FAGA 4D8LA 3CBWA 2WVSA 3DH7A 2G5WA 3ZJ7A 3MZNA 2ZA3A 4MWAA 4AFYA 2E28A 4IH3A 3GM8A 4HB7A 4DO6A 1XX1A 5FF2A 1EXBA 3PB0A 1F7BA 3RN6A 1UIPA 4FLRA 3WF1A 1BVNP 1HG3A 2Z27A 2YCLB 5GNXA 2V6AA 1NDYA 3QN3A 1DL3A 2KAUC 1IT8A 1R47A 4GXWA 4MNMA 1V08A 3VDHA 3L23A 4S3KA 3SY1A 1X98A 1XBYA 3N17A 2QPUA 2PDBA 3BK0A 4H04A 4OKDA 3SCOA 5F4SA 3OVGA 4IQJA 4RLIA 4KETA 5D2YA 3OVPA 4UTIA 4QLKA 2YFOA 3PBWA 3VC6A 2O7SA 3C52A 5K9CA 3M0ZA 5EMLA 4MAZA 1JRCA 2O7QA 2HSAA 2F9RA 4BA0A 2DEPA 3LB0A 2QCDA 2AQOA 1HIZA 1QI2A 1XV8A 3W7GA 4BQ2A 4Y9OA 1TA3B 4AHQA 4NP7A 5F7UA 5K9XA 5IHRA 2ATSA 3FSTA 4B15A 4H9UA 4AYGA 2P88A 5FJUA 1MNZA 3OZMA 4J3ZA 4XBSA 1EC9A 2NWRA 2PS2A 4DWSC 4AZCB 1E1CA 1N8FA 3URQA 8A3HA 5F1UA 3T07A 4RXFA 4D1IA 3U0HA 2YCEA 2CC0A 3L4VA 3LLFA 4JR5A 4Z1CA 3CLWA 1JQXA 2YB4A 4XX6A 1I1WA 4DO4A 1UKQA 2OXNA 1LBLA 3VIIA 3ZR6A 1F6YA 5CJMA 4DXKA 1H60A 3WELA 3RG6A 3WUEA 3PUGA 2XH0A 2ZXAA 2X1RA 3AXIA 3MUAA 1F5ZA 3MI6A 3SUTA 5ABHA 5C9UA 3LQLA 2PTWA 3Q37A 1YXCA 2EG8A 2VDIA 2Y85A 1Q63A 2J75A 4UQBA 3S5NA 3B3DA 3NWRA 4WY0A 5A3HA 1CGXA 3MUCA 2WKLA 3B0UX 3K1DA 1SO5A 1O6IA 1W5QA 3OODA 2ISFA 2BZNA 1ISWA 3TTOA 4B9ZA 4A3RA 1HO1A 4B5UA 5A6JA 1TV8A 2BWGA 2WV8A 1J2WA 4IIDA 5HWJA 3T2QA 2GVLA 4HU3A 2C19A 1W1TA 3PJUA 2YXGA 3F2DA 1TR9A 4PFMA 3WLSA 4NT0A 2E5BA 4Z2IA 3N2CA 3QLDA 2X1IA 3G1DA 5T26A 2VJXA 3EX1A 3SRKA 5IHSA 2J7EA 4JX4A 3VNLA 1JPMA 3KLLA 2O9RA 3B8IA 1QXLA 3T7VA 3G24A 2Y62A 3PSVA 3AZTA 2QYGA 3SY5A 1HVXA 1IZKA 2FZMA 1KTBA 4AX7A 2VVNA 1OHLA 2ON3A 2X16A 2Z00A 4TMBA 2YBVA 1PKYA 2XM1A 3RR4A 4WDXA 4UTHA 3QLLA 4HA3A 2INEA 4QNEA 3P82A 1P0DA 2PU1A 3LI1A 3NL3A 1Q6GA 4N9DA 3R8RA 3UJEA 4MDPA 3JR2A 5J04A 1G4TA 1EEXA 1JZ2A 4DQWA 1DWFM 5GJPA 3BUVA 3KOXA 3W87A 5LYRA 2E67A 3MUIA 4QROA 1EZWA 3PN8A 2ZC1A 4J7RA 4PL2A 2J7GA 3PTKA 3KCOA 4JL2A 2C0HA 2EPHA 2J47A 3BG3A 2V8ZA 4E0CA 2TMDA 2XN1A 4C6LA 2C91A 3PG8A 4JFTA 1TVLA 1TJ2A 4Q8VA 2J78A 2W5FA 1B9BA 3NGJA 4NI3A 2BSLA 3ENLA 1G7UA 2ABBA 3GK0A 2G3IA 4QDWA 1SJDA 1S2CA 1GZGA 3ARRA 3VIJA 1H5YA 2ISWA 2O55A 1L6SA 2VOTA 3VIGA 3KFTA 1JD9A 3P2VA 4OZOA 1KCZA 3WQEA 4FXSA 4ZE4A 5HMEA 4MZ1A 3KBNA 1QOQA 2C1GA 3WQDA 1IE7C 3A47A 1FWJC 4NL1A 4JFWA 1HVQA 1LRTA 4F2UA 2QDHA 3TTEA 5BOEA 4ROPA 3AS1A 4XAGA 2WMIA 3CEPA 3UVAA 1MXSA 2QCHA 3VD5A 4GBUA 3FHAA 3CEUA 4YXGA 4GKLA 2QF8A 3CQHA 1FRBA 8XIMA 2E09A 3Q67A 3N73A 5D33A 4D9PA 3GUGA 3R89A 1AJ0A 3MMTA 1IT0A 3U5YA 3AIUA 1WBJA 4P7NA 5FJPA 1GONA 4MLRA 3UZ5A 4YVVA 4CCZA 3APYA 3PBYA 2NX1A 2J7DA 1W2VA 3WEOA 3KL3A 1R7OA 1UD5A 3BLFA 3IK4A 4IL2A 2VRJA 4YCOA 4AEFA 1OFOA 3IIOA 3QXBA 4PUJA 2CBVA 4JQAA 3QHOA 4IISA 3WNOA 2WJFA 3OG3A 3MWCA 1V4YA 1D7FA 1OYCA 4HTBA 1EJ7L 1P0EA 1C8XA 2QJNA 5M2FX 1IR1A 4X9SA 5IM51 1GG1A 4A22A 4MJZA 1NOFA 1XLKA 1QAPA 1YPXA 1I2PA 1YIXA 4FXJA 3CL6A 1H1ZA 3QY6A 1H11A 1PHWA 4GUHA 4ECLA 4H9MA 3GVRA 2V3FA 1UBPC 3S9ZA 1XFCA 2F6UA 3RCYA 2DVTA 4FP1A 1HJXA 1V3IA 2PGEA 3SCSA 4AD5A 1F8IA 2VEKA 1DWIM 3KS5A 1NU5A 5J5DA 2INZA 3TSMA 4B2DA 1H50A 4N9BA 4IMAA 3PHAA 4B5TA 3HGRA 2YXXA 4GYFA 1MFUA 4DJDA 1HN1A 3IVUA 4PR4A 3W01A 1XIMA 2C16A 4I8YA 4CCDA 4RV8A 4ZFMA 3MHFA 3CT7A 5DO8A 4AVFA 3W6LA 3EWUA 1J0HA 1C8YA 6XIAA 2GGHA 1RY0A 2H3BA 3HJZA 1UWTA 4DVOA 4HPHA 4W7UA 1JCTA 1FWAC 3CV2A 4DNMA 2C14A 1UHVA 3O6AA 1UC4A 1PAMA 2DZPA 1P0KA 3S1WA 4XUYA 4DYJA 4KGJA 5C54A 2A7NA 1SMDA 3IUIA 4Y8FA 1FWCC 1N8IA 3CIVA 3RK8A 2E3ZA 3QYQA 2BGNE 3OLIA 3QV6A 3ARSA 1XQLA 1Z32X 1WUFA 4FR6A 1OWQA 1OY0A 5EYWA 4Z1DA 3MQTA 2FB2A 3VOFA 3QY8A 3TQPA 4LRTA 5D2WA 2V63A 4HVXA 5HMFA 2D3NA 4GZJA 3SRDA 1K9EA 3WH9A 3LI0A 4FX7A 1G6CA 1Z8AA 5I09A 3MJMA 3AHXA 2YXOA 3AC0A 1EHAA 3CH9A 3NEVA 4UQ9A 3R13A 1TV4A 1JZ5A 2H6RA 4XSMA 3TYZA 3BGAA 4JKKA 2QCGA 4Z0SA 2QJHA 2PWUA 3N2OA 1X1NA 3TTQA 2ZX6A 1ITXA 1JD7A 2E4TA 3IVTA 3T8QA 3BW3A 4R3UA 2I56A 1SFJA 2CLLA 5FF0A 5AFDA 2GVJA 3GFYA 4BZYA 1E0WA 4GABA 4B16A 1R3QA 2VWSA 3L66A 3OO2A 9XIAA 1L0PA 5A6BA 1XC4A 3UCCA 1UWRA 2R1NA 4JZ5A 3PULA 4UTTC 4DB7A 3WYZA 4XO7A 4DX3A 3NR0A 4MNKA 2IQ0A 4I9TA 1UP2A 1Z6KA 4PEEA 4Q22A 2EO7A 3B8DA 2R1PA 3WLHA 1V03A 4GXMA 5BOFA 4GNVA 3SM0A 1WNOA 3SCUA 2WYSA 4L5ZA 1S5VA 3MV01 4K7YA 4LBUA 4MHBA 1M7PA 5EY5A 5LIXX 1GQNA 4NAFB 4BI5A 1FP8A 1IXOA 3KTSA 3NO5A 4QEEA 4G7EA 3E0WA 1ZBVA 4GGHA 3ONCA 3NL6A 2GGEA 5EMUA 4TV5A 3AHZA 4X2RA 3ARVA 5REQA 1C90A 3INPA 3WKZA 1KM0A 3WLOA 3GNNA 4S3DA 1OC6A 5KSWA 3K8LA 2WVVA 5C7HA 4M6QA 5AZ1A 3G0UA 1JFXA 3GDKA 3ABQA 3SDOA 3WBWA 2XZ7A 5CSYA 2D0HA 3H4XA 2WVVB 4LX4A 3GWQA 1ZP4A 5EBUA 4CGTA 1UASA 3L0GA 1CI1A 1HKJA 5FSDC 4IPIA 5A8PA 2CLKA 4DRSA 4W5UA 1US2A 4GFIA 3ERPA 1BF6A 3W2JA 3V18A 1KRAC 2A21A 1HJSA 4RK8A 4YCPA 2JK2A 3PUOA 4O28A 5BNKA 1K70A 4EAMA 4PMVA 1AW2A 4POCA 3WJYA 1A5CA 1JFHA 3PWAA 5JIWA 4N02A 4W8BA 3ZLGA 3DHUA 1MRAA 1IEWA 2NUYA 2YFNA 1W56A 4AZCA 2ZKMX 4AH7A 1OFEA 1E0VA 4ZSUA 1ONXA 3N1AA 3ELFA 3KOWA 2ZTJA 4IQEA 4L4MA 1QTWA 2YA1A 2F84A 1PHQA 1B1YA 2XISA 1MQRA 3F4DA 2PD5A 1PS9A 5J8LA 4ZQCA 4AZ5A 3N6QA 5FEZA 3WQ5A 1A5SA 4PMOA 1Q4WA 2DZVA 3DFHA 1XKJA 2Y7FA 1CIUA 4ZODA 1TG7A 2Q3RA 4C6FA 3WLIA 3W70A 4MYAA 1VRDA 3LM3A 4GVIA 1FH7A 1XPYA 3P5YA 3EA3A 4QHRA 1X8FA 2FKPA 4IIEA 3CK5A 2CW6A 5BOOA 1FVPA 2D0FA 4AZHA 1H7PA 3C2YA 1VD6A 4CN4A 2ABAA 3UWEA 1XIIA 5CSSA 3WX7A 1TUFA 2PDGA 1J96A 1QBBA 3WQ6A 4LTSA 3VKCA 4Q8NA 2J6XA 2AL2B 1T99A 3LZ3A 4O10A 3CC1A 3FEQA 2F8QA 4BEUA 3BZJA 1UYQA 1D7KA 2WNNA 4IPNB 4FX8A 4TMCA 3G1FA 5DCEA 2QMJA 3PM6A 4LUSA 4E8CA 4UFMA 3BTNA 4GX9A 3FYPA 2JFEX 2WSYA 2PDFA 2A79A 5FAJA 1LRQA 2O9PA 4MM1A 3O9NA 1MW3A 2OZ0A 5HA7A 3HFYA 1R3YA 5DY3A 1GJUA 3LHYA 2Q01A 4CNNA 2ISVA 4EXBA 3EDKA 4ZMGA 2DSZA 1I75A 4NF7A 2ALDA 3FK4A 3HZ3A 2Z0IA 5HR6A 5C9WA 4A8RA 4N6EA 1V6VA 3THUA 1V0KA 2PWVA 2RJGA 3VOHA 4US5D 1QOXA 2J9ZA 2QDEA 5D9MA 3W86A 4CN1A 3MTWA 3WFZA 1JZ3A 4I8DA 1VFTA 2XG9A 4PSRA 5G5IA 2X0SA 5FOOA 1I0BA 1LOQA 4KWUA 3GNOA 2ONEA 1RD6A 3QPYA 3GLCA 5HNRA 2QV4A 3VUPA 1W1ZA 4C91A 4KRUA 2W61A 1QI4A 2CZDA 1DOSA 2IW0A 3GXNA 4XD6A 4NI8A 1R2SA 3FA3A 1P6CA 3TQKA 3RXZA 2Q6ZA 3F4WA 4BS0A 5I23A 5BROA 4XD5A 1XICA 4R88A 1FHLA 3BAJA 3QHMA 5IOBA 2FPYA 3KHDA 2CXGA 1VP5A 1UP0A 3CV7A 1W3HA 3RU8X 3LZ5A 3MP3A 3CAWA 4XD4A 2E0PA 4Q8MA 4R34A 4HSOA 3CTLA 2DP3A 1XL9A 4FX6M 4GG9A 1W32A 4LAOA 3RO8A 4PUKA 1ZJBA 1QUMA 1S38A 1WKFA 1EZ2A 1QO5A 4B3LA 3SIMA 2Z2AA 1MUWA 2PU0A 4KFOA 4K7VA 1J6OA 2YR1A 1O4UA 3P8IA 4YWIA 1L6GA 4CQCA 1K8YA 3CAKA 5H1WA 4KESA 2FMOA 4B9YA 4ZOEA 3DBPA 2ACSA 2Z25A 1GJWA 3GAYA 4PFHA 4MFEA 4P8UA 2QZRA 2QAPA 4EPBC 4IIGA 3B8WA 4B4FA 2ZX8A 3QPZA 1HTIA 2EPNA 1GWJA 2YDQA 3NQAA 5GVJA 4QEHA 4C6CA 5DCDA 1NDZA 2A6NA 3PY2A 3A9BA 9XIMA 3QEZA 2CZEA 1W5PA 4Q33A 3SB0A 2W4XA 4KCUA 4L1XA 4A3YA 1HKKA 1VEPA 4MY9A 3WLNA 2PZNA 3S1XA 4D1JA 3HQ1A 3OJGA 3GR7A 1BD0A 3UU0A 2CKSA 4LEFA 2IXUA 4I7WA 1FWHC 4RW3A 2AMGA 3VGFA 4EOUA 1WAUA 1TZZA 4ZEPA 1LDCA 3THDA 4KBXA 1QWKA 1CX9A 4MIMA 3V5CA 1QPQA 7TAAA 4N9CA 5GJMA 1JNEA 4HU4A 4OGZA 4MAVA 4RKAA 4DJDC 4WSHA 2V2HA 4O1DA 3P0WA 1TSIA 4GVFA 3VYLA 1QHOA 4PEKA 2ZWZA 3PZNA 1XC6A 3CHVA 4Z2HA 4KEMA 5ABTA 1GPWA 7ENLA 4IXHA 1EP2A 4UZUA 4MB5A 1TYGA 1TPFA 3GBEA 4K36A 1JXJA 4BCEA 3W53A 3SCTA 4AC7C 2D73A 4NRRA 2V9DA 4M8UA 2QDDA 3EDFA 1RJRA 4EPEC 3H7UA 2P0OA 3E0FA 3G8RA 5BRPA 3LEPA 4H6KA 4A6GA 4JOMA 1SU5A 3QR3A 3CPRA 1CYGA 3N34A 3N6JA 4PL1A 3ZVHB 4MSSA 4JBRA 3GTFA 4TX8A 1OEPA 3GFXA 1YEYA 1WDWA 3M5XA 4AAJA 1UQYA 1VFLA 1YE6A 3HV9A 3BLKA 4NASA 4CEXC 1DTUA 2WMHA 3C6CA 4LF2A 2EKGA 2XH7A 1GOKA 3HGSA 4EANA 2Q09A 2I5IA 3W07A 5HNTA 4GO9A 2R1KA 2W62A 2D1ZA 3O6CA 4F79A 2PBGA 3W1UA 1DJGA 1Q45A 1V0NA 3BG9A 4PMQA 1RVGA 5I2UA 3G8EA 2RHGA 3B40A 1H51A 2E77A 3KUMA 3SR7A 5T9BG 1VPQA 3QSRA 3M0XA 2ZICA 1NELA 1VCVA 3XIMA 4M24A 2HDJA 3G1YA 3BAIA 3B9AA 1KBBA 4ZGYA 1KWGA 4NAFA 2F38A 4DPQA 4JTEA 2FPTA 1JVNA 2WZMA 4HQVA 1Q6LA 2HVNA 1GYLA 1JYNA 1FHVA 2VMFA 1OCQA 5C8BB 3RRXA 3S0CA 3OGSA 3VNDA 4PCFA 4BQ5A 2WC3A 1RBLA 2F61A 1Z42A 3AMGA 4WKHA 1E0UA 1JZ6A 4NJIA 1W9XA 3HPZA 5KTLA 1DHPA 4OECA 3VCCA 2ISSA 3D0CA 3QTPA 1WE5A 4PCNA 1R30A 4GI9A 5AC6A 4E8DA 4DJFC 1XIDA 4XZHA 1EA0A 1U1JA 2VEGA 3BW4A 1J11A 2OYMA 1U83A 4WK9A 3A6OA 4GQ0A 2WZTA 3WK0A 3M6YA 1HP4A 2CBUA 5LZLA 1VFSA 1VEMA 3R5EA 3TWAA 4HNCA 2VL4A 1YTDA 3WF2A 4V33A 3L2LA 5EGRA 3T0CA 3TQVA 3GDLA 4BY3A 4LUJA 4J3UA 3USBA 1B3WA 1UWAA 4GGBA 1F07A 1TZ7A 4K38A 3IJ7A 2VWTA 4W5ZA 4D72A 3HGJA 1EJSC 3QZ6A 4LYQA 3WMSA 1OSEA 3CZLA 2D2OA 3TLLA 4CVUA 1SO4A 2WO5A 3FFSA 1LYXA 3U2OA 4A8LA 2HQAA 3D3FA 3DENA 4J2PA 1FWWA 5CH9A 5D2TA 1DJWA 5BCAA 1GVRA 3VZYA 1JRBA 1ZTVA 3T09A 4IHCA 1NWTA 5A2BA 3QKZA 1W37A 1W31A 4OV9A 4ILSA 2GLKA 3RJXA 4IIFA 3LX9A 1F4HA 1KFEA 3GFZA 3W23A 2YGYA 3DHFA 4RDWA 1P43A 1QNQA 1OF6A 2VFFA 3LCIA 1AW5A 3DECA 3BO9A 3NDZA 3WD2A 3H70A 1RJPA 1A0DA 4Q4MA 4UCFA 1XWYA 2QGHA 5HINA 3R58A 4G1NA 4F48A 4C65A 1XISA 3M47A 4FEZA 1B57A 2PD9A 2V0TA 2Q8ZA 4QG6A 4ADUA 3LRKA 4YTUA 1L2QA 3LGGA 5DBUA 1MVYA 1O5QA 1R2TA 3CXOA 1KFBA 3QW4B 4L64A 2VKZG 2O92A 2G0WA 2HNEA 1Y7VA 1SZRA 2VUNA 2X7WA 1JGIA 4JQ1A 4N7QA 2Z2BA 1KBLA 1V3JA 1OK6A 1ZS2A 4DXXA 1EOKA 1PKLA 3IAPA 3KVMA 3WF3A 4CU6A 5B7ZA 5IDZA 1Z44A 1G4SA 1XRFA 4XWUA 3M5ZA 1YXYA 3UEQA 2POZA 3L5MA 1LUCA 5FEPA 4IP5A 3MI2A 2WQPA 4MWAB 2O9OA 1SPQA 5AYBA 1V3MA 1IXQA 2UY5A 3WQFA 5E6ZA 2IQTA 2WANA 3M0JA 4PMRA 4GQQA 5KZEA 2ZVIA 2PDJA 3ONBA 1G69A 3KBWA 1FBAA 3VGDA 3TC6A 5HNNA 4XVEA 3AICA 4XKYB 3T8LA 4L4OA 1OYBA 4LOCA 3KRZA 3NVDA 2BXZA 4RNIA 3ALGA 4JGDA 1BXNA 1HFBA 1TWDA 3WL0A 3TV8A 3S5ZA 3MA8A 2ZX9A 4RPQA 1XRVA 3ZLHA 4XAFA 2V5BA 3T0BA 4LBRA 2PGWA 3JW7A 5AHIA 3CZKA 4JCLA 4GX8A 1XDMA 4NU7A 3TFCA 5FL0A 2JIEA 4E3TA 4H3DA 4E6MA 1ECEA 1NFBA 3LERA 3H7VA 3CB8A 3TVAA 2BFGA 5A69A 4RE2A 2CNCA 4MADA 5CKSA 5CPNA 4CNPA 4MWAE 2O4QA 3MJYA 5IFPA 2WVUA 2BGSA 2OQHA 4UQEA 3NUKA 2XVNA 4BF9A 3GHUA 1KM3A 4NAEA 3NM1A 1U2YA 1BFNA 3DU0A 3UJRA 3WLTA 2VQTA 2P5NA 3DFSA 4GVGA 5FEXA 3H8AA 4HNNA 3FSUA 2WMKA 3H7RA 5M03A 3ZQ9A 2FMNA 2WZHA 1UKSA 3CWHA 4B91A 1UR2A 3W2NA 1BSIA 1FUYA 1L6YA 1V51A 1AA1B 3P84A 5I6SA 5I3KA 3W7HA 1GJPA 1BGAA 1S39A 3GG8A 2VEMA 1UJPA 5DRIA 3JUGA 2MANA 1MEIA 4X61A 3NL5A 3S47A 1NAL1 1B30A 2HS6A 3V5FA 5C5YA 2CZFA 4B90A 1OG6A 1EC8A 3P81A 4YMZA 1LP6A 2X40A 1SMAA 4B2DD 4LS2A 3VKDA 4L4PA 1DBTA 3VINA 1PL9A 3W7PA 3T44A 1CLVA 1CT5A 2XVGA 2PWFA 2E9BA 4V15A 3W1XA 3S5SA 2I17A 3ES8A 3UZZA 3ARTA 1NOUA 3GU1A 3LA4A 2V69A 3GD6A 3MSGA 5CC6A 1OCBA 1SSGA 5AYXA 2R1MA 2PMQA 4ZO6A 4H8HA 2R24A 3NM3A 5JXQA 4FK9A 2VOMA 2WMGA 5EMMA 3MYPA 3GDMA 3NIYA 1KTCA 4QE1A 1UR3M 2V2DA 1BG4A 4EXAA 3DYOA 3LCLA 1A5MC 1WQ5A 3O7UA 1EJTC 2EAWA 1FY6A 2XZ9A 3QV7A 4GKTA 1GYMA 1I1XA 2CPUA 2DH2A 3B9OA 3EX4A 4RXGA 3LG3A 1T8QA 2ZBTA 1Y5VA 3AMKA 1Q5MA 3ABXA 3AXHA 3H2EA 1PIFA 4M0XA 1RCQA 5TIMA 4UQAA 4C6PA 1EX5A 3CZ8A 2Y88A 4YLWA 2RUSA 4PB4A 1OADA 2Z29A 3KX6A 3I68A 2X05A 1HW6A 1P6WA 4D71A 2V5KA 4K2SA 4AD1A 3LXAA 4JYDA 3RYSA 2WW5A 4Q3MA 2PP0A 5A94A 2WLYA 2F7FA 4CEUC 4DBSA 1TQXA 1W3IA 2C18A 3NPWA 1KD0A 3PZTA 5DXYA 2EXOA 1XCWA 2EEXA 3MKCA 1Q6EA 4YJ5A 1KR0A 4Q32A 1C92A 4Q6JA 4UMBA 1LUCB 2WJZA 1NP0A 5BWFA 3WEMA 4D6HA 2X7VA 3QGAC 4IPLA 4I90A 1ZJHA 3R11A 1XGEA 4R53A 1A49A 3THCA 4O11A 2YSWA 3CJPA 2P3EA 4GE8A 3Q4DA 4F0SA 4H2HA 3AAMA 1M41A 2NQZA 2RGMA 1RD5A 5CC5A 2Y0FA 1ZJIA 3JS3A 1TJRA 4CQ9A 2OCZA 4L6HA 1H1YA 1FX6A 1G1YA 3LHVA 3WNNA 4PTXA 1V0MA 1RPXA 3LV6A 3MDWA 3GS6A 1JJKA 3SUVA 2OTDA 1DE6A 1AL7A 4H6EA 3SO7A 2XPKA 3C0QA 3P14A 2XGZA 2PCEA 3QZAA 1O5KA 3NXLA 3TR2A 4P7OA 4GNKB 3GIPA 3M1ZA 2XIOA 1RXOB 4US6A 1H4PA 4MPQA 3NA8A 1VLWA 5B80A 3TKFA 4AY7A 3KXQA 4E38A 4PSPA 1XLFA 3N14A 1XLDA 1FDZA 4JAWA 4PCPA 3PTDA 4ORMA 3KBSA 2JBMA 4LY8A 1Q6RA 2GQ8A 3WLQA 1PDYA 1ONWA 3BOLA 1JDEA 2DZWA 2QVHA 3MT1A 4JKMA 1V93A 3NAVA 2QPXA 2ZRUA 3LNPA 4RZ4A 3V1HA 1O60A 1QPKA 1M04A 1AQ0A 5DELA 1BPLB 1UC5A 2E8ZA 3OBKA 2WNWA 2VDHA 3VK5A 4C60A 3WD1A 3PBMA 1EUNA 2HMCA 1UP3A 5TQLA 1OB0A 1EC7A 1SZEA 4F8XA 4WRHA 3GBDA 4FB7A 4UOQA 2DIEA 4YHEA 2WCAA 1PTGA 1RA0A 1AW1A 1VGAA 2C7FA 4AZIA 4IICA 2PDUA 2YCIX 3RX2A 1UQZA 9CGTA 4NY2A 2XFWA 3B04A 4WXYA 3CUXA 2GVEA 4UTWC 4MPKA 4WR3A 4JYFA 4NG3A 1MZHA 1TV2A 3GTXA 3GZAA 2EPKX 3RM4A 2A5HA 3B0XA 5CGQA 4ZQOA 3AUOA 5HQMA 5BW6A 4CUCA 2VZOA 3PFRA 4LANA 4HZ6A 3KTCA 1BKHA 4HSHA 4EPDC 2NVAA 3PANA 1PTAA 3O06A 2Y8KA 8XIAA 4KPLA 4X0NA 1KQZA 1TVNA 2QCDB 3OVQA 3BJTA 1E9YB 3SEPA 3UXDA 2ZXBA 5E93A 3DUGA 1V79A 3VPLA 3QHNA 5HWNA 2Z4GA 1MNSA 2BY2A 1B3XA 4RNJA 4XAZA 1H2JA 4MB1A 4Y6GA 3A3XA 4LC6A 4TVDA 2VVSA 3ITVA 1R38A 5G2IA 2IPJA 1L6FA 2BGQA 1KCXA 1RAKA 3WH7A 3LPGA 1B31A 3L4YA 1JQVA 3QM3A 4HYVA 4QRNA 1WB0A 1DQUA 4J3WA 2IQDA 1GVEA 1LBMA 4NJJA 2FTPA 2P0IA 4OE7A 3W85A 4JTUA 3BLEA 3ZS4A 1CGVA 4XQ6A 1EJWC 4Z17A 2ACRA 2AAAA 1S1RA 3AUJA 4V28A 1O5XA 2YL6A 3EBVA 3W72A 4DWSA 1VIZA 3GE7A 4ZO9A 2G3JA 4BI7A 3T0TA 1IEIA 4WXZA 3TP4A 1FKXA 4C6JA 1W3LA 4JFVA 4F9DA 1YW1A 1K77A 3S83A 3TA9A 5KZMA 1AH4A 1N55A 4F0KA 4DZIA 4A21A 3ZR5A 4U4MA 2ZA1A 1T6MA 5DMLA 5C2XA 1DKWA 2YL5A 1JDCA 3BCFA 1KBIA 3CV1A 1D2KA 4O1CA 1GEHA 3PJWA 1PO9A 3VMPA 2XTKA 2HNHA 4NIRA 3ES7A 3WNPA 4UMAA 1R85A 4Q4KA 4Z1YA 3ZXWA 3S5YA 2NQJA 3W29A 4A35A 2WC4A 3GHSA 1J0YA 1DQWA 3BZGA 2VX4A 2VR2A 1LM1A 1J4EA 1DXIA 2Q02A 1Z9AA 3SN4A 3L5LA 1WDDA 3IPWA 3S6OA 3LY0A 3WCZA 1Q85A 5I24A 2I9UA 2PTDA 3MP4A 3LENA 3P6LA 5DBTA 3E2RA 1RCOB 1XYMA 4WF7A 2ZUVA 2DT2A 2IXVA 4FMVA 4KWSA 3GIQA 2XJ7A 4GXPA 3MCMA 3VNZA 4ALDA 1RCXB 4QDMA 1Z7AA 4FR1A 2ZUNA 3EXTA 1C7SA 1AZ1A 2Z1WA 5CG7A 5C9RA 2CLEA 4PRWA 3PTMA 1KQYA 4Y2WA 1DJQA 1F73A 4J28A 4PTWA 2A4AA 3R79A 3STGA 2ZE0A 4D8AA 3N29A 3B9EA 1MDRA 4PUWA 3K1GA 1QVBA 4RE4A 1JYWA 2FZNA 5BWAA 3W7CA 2YDAA 3PJXA 1IXPA 3RJYA 3S5OA 2QLYA 5TBOA 1AL8A 2DZXA 5A6SA 4EPKA 4AF0A 4LPCA 1EQPA 2XFFA 4MJMA 3FYYA 2VTFA 1AQFA 1GTEA 1SFTA 5CPLA 3T42A 1SJBA 3ITYA 2E9MA 4P7LA 5AECA 4PUDA 5JQ9A 3NL2A 2XFRA 4IIHA 1NQKA 1JPIA 1S5NA 1LOSA 4XZNX 3FW6A 3ECQA 4NNAA 1V5XA 4LVBA 4Y9MA 2Z26A 1F6KA 4KS0A 3WUGA 5EB8A 4ICCX 1Q7ZA 1C91A 3NCOA 1IWAA 1QI0A 5JUVA 4J9JA 4WOQA 4ZQNA 2X1UA 1E56A 1VEOA 4TVCA 3M0YA 4J3TA 3HGOA 2JE8A 1U1HA 4GWEA 4FHAA 2QCNA 3PC0A 3BPWA 1WKDA 2XIQA 4IFKB 3QFEA 4TTGA 1DVJA 2WMIB 2PDMA 2PDIA 3KOYA 4JIHA 1M53A 3M0MA 2OO0A 4NJHA 5AHMA 2E5CA 1MEHA 4X3ZA 1D3HA 4F0HA 1SZNA 4F0LA 2ZWYA 3HIJA 3DFOA 4IGSA 4L4LA 1PCWA 3UGVA 1KM5A 2C1HA 2OSYA 4LB3A 1RQBA 3W81A 1WA3A 4C6EA 5PTDA 3FA5A 4RV3A 1TPVA 4O1AA 4J35A 4ZB0A 3LHWA 5L6UA 3VO0A 1CTNA 3QOMA 1L6WA 1ZP3A 3URAA 4UUIA 5EMYA 2PC8A 2ZRYA 1JUBA 3GYEA 4ACYA 4WDUA 1TUXA 1QT1A 3TK7A 2UZ9A 4JX6A 2BY1A 1F3EA 2DUXA 2C15A 1IHIA 4N6FA 1KXHA 3VIKA 1VS1A 3G3DA 5G4HC 3FVDA 3CHEA 2C0AA 3FJ4A 1B2YA 1UKTA 2GGGA 2ZTKA 5KITA 1OD0A 3NZPA 1SM9A 2W79A 4A3QA 1K03A 3HU7A 1XLJA 5D4YA 2NSOA 5F2IA 1TB3A 2E1WA 3O6YX 4B5VA 5JH2A 3VNYA 2RDTA 4E2BA 2TYSA 3K4DA 1Y0EA 3U9IA 2R9RA 4UMCA 5RUBA 4H9XA 5C0QA 3O8AA 5DRCA 3UWYA 5DT7A 4C6OA 2Y24A 3EXSA 2PF8A 3T9PA 5G1TA 3PBVA 3H2AA 2XN0A 4MUPA 3RUBL 2D23A 2WZIA 4DO5A 1CPUA 3S9YA 1ITUA 3NQMA 1CXKA 3TQ0A 1SFLA 1RALA 1XFBA 4HMEA 1U5VA 4UTFA 4QCFA 2OT0A 3ID7A 4AVOA 2AAMA 4MUZA 1I4NA 3EA2A 2FYMA 5GPRA 3RF9A 4U31A 4JTKA 1UR8A 4CLMA 4DUXA 5FSEC 4X60A 2ADAA 1J10A 4IOTA 2W92A 1WOAA 5IBXA 1DORA 3TOPA 4O0QA 1AMKA 3OTRA 3CMGA 1S5TA 3LD5A 4ZTXA 3W84A 3GH5A 4ZA0A 3F7JA 1H1NA 1I2OA 5CQ1A 1GOWA 2UY2A 4PBGA 2AGKA 3TR9A 5HANA 3I6TA 2EBNA 4PCSA 2Y1HA 1F9CA 4MFDA 2FGZA 3MBDA 3HURA 2OX1A 1WBHA 5AHLA 3KZPA 1TREA 3IJLA 3DC8A 1YADA 5CLTA 2R6OA 3F4NA 3AIWA 4O4WA 3RGTA 2XDFA 3S46A 3BWWA 2PGFA 2JEQA 3ATZA 1XGDA 3UCQA 4A3HA 3GO2A 1ZY9A 1FKWA 1J9YA 5LIWX 4Q7NA 3BMWA 2I5GA 4FNPA 3ZT6A 2D2HA 1DWJM 1DWHM 1JULA 1TA3A 2QQ6A 4OV4A 1GVFA 5I77A 4WCJA 3RMJA 4W88A 4HHLA 1U22A 3QR1A 4QJ3B 4H41A 4GD0A 4CD5A 1RBOB 1S3TC 2Y4SA 3UJ2A 3WJSA 3BARA 1BSLA 2NUXA 3MUZ1 3RIKA 3GZ3A 1EWEA 2CKRA 1J01A 1BRLA 5I3HA 1P6BA 3RPDA 4JEJA 1YNYA 4AEOA 4NX5A 4FLQA 1XW8A 1CGWA 1WDSA 3TNOA 4DBEA 1OT1A 4ICMA 3KEHA 1OJXA 3IUDA 2F2KA 1NF0A 4U5KA 2Y61A 3ATYA 3TSDA 3TYAA 3DI1A 5BXTA 2D24A 2OODA 1W5MA 2J24A 3L21A 2TSYA 4OFCA 3DFQA 2TRSA 2ZUMA 3CZJA 4U28A 5LKYA 4LW7A 3IUHA 3O3RA 3UWQA 4L9XA 1TCDA 4U10A 4PC8A 2WPGA 1QBAA 3GKFA 4S3BA 5LXEA 4W8AA 4IP4A 1OBAA 5FJIA 4FPSA 1H7WA 4JDBA 2PBOA 2ZZ4A 4S1FA 2Y2WA 4W85A 3CO4A 1W0MA 5A6KA 1US3A 4C6KA 3GQYA 3IAQA 3W7OA 3DFPA 2E25A 3WLRA 3NO3A 4YNGA 3W1QA 3UY8A 3DYPA 5HBFA 4K1GA 1PWMA 3IIXA 3OIHA 1AJZA 3LCGA 3L7RA 3KHJA 4WDTA 1Z41A 2W63A 2DZTA 2WBKA 4MJ2A 1GKRA 1Z48A 2ZZ7A 2QAFA 4O4VA 1QW9A 2O0TA 3UWZA 3M0KA 3CWNA 3VIMA 1LORA 3W00A 5C6MA 1UBSA 2V5JA 4M5PA 2V3GA 4F0RA 2ZVRA 1E9LA 3LUTA 3IANA 1FWDC 4PTDA 2E8YA 1OVDA 2VP8A 1GW9A 3OBAA 1LQ2A 2C79A 1S2AA 4H83A 4Q4RA 4HZ7A 3RU6A 3EWDA 1LT7A 1HX0A 4R5EA 1A4MA 3H24A 3BE7A 1YRRA 1PB0A 2MNRA 3VD9A 4GI4A 4QJ5B 3V36A 2AL1A 2HBXA 2Z1BA 3GXTA 1EGMA 3TNBA 4C90A 3CPGA 3BQ6A 4JICA 1UOKA 1ZRQA 1XS2A 4HU8A 2DQXA 1Q13A 1REQA 4O0ZA 4GI8A 4QAWA 2H9AA 1DJNA 4DJEC 4O18A 1UWIA 3II1A 3AIRA 3ARQA 4FZIA 3LLXA 3I6RA 3SQMA 1SR9A 3UXAA 4ERIA 1A47A 1RPKA 4G1KA 5FJOA 5HQEA 5H8MA 2FPVA 3E2QA 1Y65A 4Z1AA 4G9PA 5HQLA