5LNRA

Crystal structure of arabidopsis thaliana pdx1-plp complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
publication title Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5lnrA00
2V2CA 1OYBA 4K36A 1GWJA 2YX0A 1YDOA 2W0UA 1TQJA 2R91A 2CLIA 3MBDA 1Z48A 1YDNA 4JX6A 2TYSA 4JX5A 3UWUA 4FB7A 4QJ1A 3WK2A 4JTIA 3NPVA 3MYPA 3E12A 7TIMA 3NQAA 4AAJA 4MFEA 2ZYFA 5AHIA 1TV7A 4NXSA 3GXPA 2FFCA 1K7XA 4K7YA 1TB3A 2QJIA 1A53A 2JGQA 1QAPA 2PCQA 2QR6A 3TH6A 1R46A 2VFEA 3CC1A 1NSJA 3PUEA 2VEMA 3N9RA 2BX7A 2WPBA 3LLFA 1FDZA 2E68A 3ANYA 1C8VA 1G7VA 1V5XA 3C2RA 4M7TA 4N4PA 3MHUA 1K7FA 4R34A 2J9YA 4TIMA 4S2BA 5MHBA 1ZJIA 1SO5A 5HNRA 3TKFA 4UMCA 2WNQA 4N9DA 3F4WA 4AHQA 1YPFA 3HGOA 1KV8A 4DXVA 3MJYA 5K4XA 1YLVA 3QW3A 4CQ9A 3HG5A 4AMAA 1D3GA 3ATYA 4R33A 2C16A 3NQ7A 3P5YA 4XTDA 4OHQA 2YCEA 3AJXA 1GEQA 2A6LA 4O1DA 4UFLA 4OE7A 5AHEA 1RVGA 4IGHA 1SFJA 3LRMA 5G2HA 3E0IA 1QOQA 3M7WA 5AYZA 3LXBA 1N8FA 1MXSA 1R2SA 2OT0A 2E1DA 4GUIA 4CQAA 3LBMA 1SUXA 3DHDA 4Z1AA 1K7EA 3I6RA 1JUBA 4JIPA 4KWWA 3NA8A 2QJHA 3MWAA 3NQMA 1PL9A 4JYDA 3P67A 3EX2A 1VYPX 2A85A 1LBMA 3O6YX 1C9DA 3EWUA 1F73A 1JJKA 2OZ0A 5D30A 2G5WA 5EMUA 2OCZA 2VFGA 1AG1O 5HQEA 4KKXA 3W7CA 1DQXA 5D2WA 1KM4A 2RH9A 2C19A 4NNCA 4NX0A 4IOTA 3VFLA 1XBVA 4WY0A 4NJKA 3VNDA 2GPTA 4K8EA 4JDYA 4K37A 2DJLA 3TC7A 1LLWA 1GTHA 1PVNA 3BLIA 5KZMA 2FJKA 3NZRA 5SWUA 1B4EA 2E6AA 1WXJA 2NX3A 4Q33A 4JICA 4U4MA 3CWOX 2NUWA 3TJXA 2EGZA 3GAKA 5EPDA 4GUHA 1GT8A 1ICPA 1L9WA 2TRSA 2XN1A 2CZEA 4MZ8A 3O6CA 3SY5A 3SR7A 3M16A 2RKXA 3ZS4A 5AC8A 1KM3A 3G0XA 3IV3A 3G24A 3LGEA 4GRSA 4RK8A 1FCUA 5EBUA 4MLRA 2CLHA 3HG3A 2YW4A 4ZMGA 3HJZA 4JR5A 1HTIA 2CLLA 3EX1A 3EWZA 4IMCA 3W7MA 3G8RA 4FO4A 3W7QA 3L67A 4UTUA 2YPIA 3BLEA 4DPQA 4DF0A 2YFNA 4LC6A 1EP2A 1JRCA 2VENA 5AHNA 1FWRA 1VQTA 1KFJA 2Q3RA 3EB2A 5K9XA 3B06A 4K7VA 3B0VC 1MO0A 2A5HA 2Y70A 3HPXA 5D2XA 3ZWSA 4JN6A 3W7HA 3GXTA 1GVQA 3WK3A 3M41A 1O60A 1L2UA 1S3HA 3QRHA 4W9TA 1XBXA 3CIWA 4JTFA 1W0MA 4FIQA 1OF6A 4K8HA 4QSHA 3ZR4A 4MVAA 2KZHA 4N9EA 5D09A 2YXGA 3M47A 4RZ6A 3OVRA 4NU7A 2Y61A 3UNDA 4IQLA 2DZTA 2ZBTA 5HR7A 1VLWA 3EX4A 2GJLA 3C56A 2A1YA 3W2NA 1HG3A 1P0NA 1F6KA 4O15A 3DGRA 3PVFA 4ML9A 3PSVA 2VEKA 3NQFA 2OT1A 4O10A 1HO1A 3T78A 2GQAA 2VFHA 1RQEA 1W5NA 3W85A 2AGKA 5FF3A 1GVOA 2CLEA 3TE9A 4EF9A 4A29A 1YTDA 5ABTA 5F1VA 3CM4A 4PH6A 2EKCA 3GVGA 3TIMA 1X6UA 1BKSA 3PG8A 3FLUA 1IXQA 3PB0A 3R89A 2UV8G 4HSNA 5K2ZA 2JGYA 4NJJA 3LOTA 4PEKA 1ZNNA 3P62A 3QMTA 2B4GA 4Q4KA 3V75A 2O7QA 1H7WA 1TPWA 3F1QA 4RKAA 3LCHA 2VOMA 3GKAA 3GR7A 4FF7A 3LV6A 4NNAA 1VRDA 1UUOA 3WJZA 3C3NA 2A21A 2B7QA 4NQ1A 1UASA 2FPVA 4GE8A 1WQ5A 4JYEA 4WY0F 4RZ5A 2P10A 4E2DA 2X1RA 1W5QA 2PRLA 1DKWA 2Z1BA 1TO3A 1K3UA 3S42A 1ZY9A 2Q3OA 3BVJA 5C5YA 6TIMA 1SU5A 5K9CA 3DFSA 3O8AA 3S8HA 3W7RA 1TCDA 3KVJA 3TU9A 2Y88A 4O12A 1RR2A 4UTIA 4N4QA 4RR4A 1VS1A 2WNZA 1SO4A 4RLIA 3EKZA 2VKZG 1N7KA 4Z1CA 1LCOA 4CQ8A 1YTEA 3W9ZA 3QQ1A 1M6JA 3NQEA 5I3IA 2FB2A 4G1KA 4IWWA 4O13A 3DKJA 4PL2A 1LYXA 1QWGA 2QDHA 1GVSA 1GZGA 2P0OA 5CPOA 4JTLA 4ALDA 4MUZA 2E5BA 4YWIA 3CEUA 2E5CA 4DF2A 4XKYB 3A9IA 2BZNA 1JUKA 3LHWA 1CW2A 1OFOA 4NT0A 1OX6A 1AL7A 3TQ0A 3NGJA 4QAIA 1FDYA 2TSYA 3LHTA 1KTBA 1YXDA 3B05A 4R53A 1KFEA 1LRTA 1W56A 3BARA 3PAJA 4CNNA 2EPHA 5I3JA 3TW6A 5KSWA 3NQCA 3OBKA 3KHJA 3QSRA 4Z0JA 1S5TA 1ZALA 4GUFA 5G2WA 2QUUA 3N14A 2I14A 3STGA 3HQ1A 4AWSA 1W3TA 4P2VA 2WKJA 3AO0A 3P74A 3DH7A 3PG9A 3H54A 1M5WA 5TBOA 3IIOA 1IXOA 4I7VA 4UTTA 1Q6RA 5KITA 3NQGA 2JKEA 2NZLA 4DO6A 1NAL1 4X3ZA 3A22A 3N3MA 3TXVA 1QPOA 3QMRA 2F84A 2X16A 1GYNA 3LI0A 3N2XA 1QMLA 4LY8A 5KMYA 4NJIA 1JCJA 4PFMA 1OFDA 4OT7A 4N9BA 1JULA 1AW1A 1DL3A 3NXFA 1TTIA 4FNTA 5G1YA 4BI5A 3P5ZA 1LORA 2CLOA 1HL2A 2DP3A 1S5VA 3H53A 1A5SA 4MY9A 1XCFA 5FF4A 1ME8A 1TTPA 1R30A 1OABA 1J4EA 4Y6GA 3DFOA 1CX9A 3W84A 1JRBA 2V81A 1QPQA 3WJWA 2VEIA 1LRNA 3T7VA 3F03K 4OQVA 1XXXA 1O94A 2YR1A 2VEPA 1Q6QA 4IPJA 3T55A 3INPA 3N2MA 1JVNA 2A4AA 1DHPA 4UCGA 3ZFHA 5D02A 1LLZA 3IIZA 1QNVA 4UNLA 1OX4A 3FYOA 5U7SA 1FCVA 3GDMA 2C3ZA 4JTHA 3DU0A 1DV7A 2H8XA 3P7YA 4J9JA 2DZVA 1UJPA 3QMSA 3G1XA 2WV8A 1HFBA 4O0KA 3L0NA 5G4WA 3L5AA 1H7RA 2NUYA 3G18A 3CWNA 1XUUA 2E09A 3BK0A 3QSTA 3E9AA 2QUVA 2V8ZA 3L5MA 2X1UA 3G1DA 2VFIA 4UFHA 2HSAA 4JTKA 4DO5A 2QCDA 2IQTA 1P1XA 3C8FA 1VYRA 1LTDA 2TMDA 5A8GA 5DCBA 4O0ZA 3O15A 3IIPA 3LRKA 5G5IA 3NQ6A 1OX5A 4HHPA 2NWRA 1H7XA 3OA3A 3L68A 4WD0A 2PRHA 5LGZA 1LOQA 1JCXA 3I68A 5CG7A 3UYCA 3W1MA 5L9FA 3LV5A 2H3BA 4O52A 2V82A 3W1QA 2CFFA 4E0CA 1KTNA 5F4WA 3UWWA 5CZSA 2CZ5A 4NX5A 4AEOA 4LT9A 4N6FA 4I9AA 2J9ZA 4PTNA 3OG3A 4HN4A 4IMFA 3QH2A 3DENA 2DU2A 5AHMA 5LGXA 2CLMA 1FY6A 4A22A 2QAFA 3BGJA 4GC4A 2FTPA 3P81A 1GOXA 4MOZA 2QUTA 3TJLA 1TIMA 3Q2DA 3QPYA 4C1LA 4NUWA 5G2IA 1W31A 1K8YA 3I7RA 4N9CA 4HNUA 3EX3A 1G4PA 4BK9A 4DQWA 3S0CA 4IPIA 3W7NA 3VE7A 3UY7A 3HOJA 3MHFA 3W7PA 3CPRA 3W71A 3TX9A 4WOQA 1G4TA 1TRDA 3HG2A 3TROA 1J5TA 2AQWA 4FEZA 2GOUA 1EP3A 5TQLA 1OYAA 3UWVA 3KRZA 2R8WA 3MW7A 3NQDA 5F2IA 4ORIA 4MZYA 1I2PA 4IMDA 4GXMA 3THAA 2CZDA 2CWNA 2NV1A 3LB0A 1KTCA 3BW2A 4LU0A 1PHWA 3QQ0A 3NPXA 4UTMA 3QF0A 3E96A 2ZCGA 3IVUA 5D2YA 1F2JA 1FWSA 5G4EA 3S1UA 4O19A 4LOCA 5D37A 5DLCA 4LNYA 2YSWA 1PHQA 1SZEA 5C55A 1LP6A 4L4LA 1TJRA 3O07A 1H60A 3DAQA 2V0TA 3NL5A 5CSRA 1H51A 5FESA 1ZAIA 3SFKA 2BWGA 3Q94A 3SW6A 4ZZ9A 4GUJA 3RLVA 3TCEA 2JK2A 3W76A 5DCDA 4UTWA 3NL6A 3LHUA 5K9DA 3QPZA 1XDLA 1FX6A 2RDWA 4Y96A 1ZAJA 3TFCA 3W7JA 4E38A 3O63A 3S1VA 1PIIA 3WJXA 3WJYA 1T8XA 5CZJA 4LVAA 3G1VA 1OJXA 3B0UX 1DORA 1UUMA 1YTKA 4BWLC 1RQBA 3LCXA 2ALDA 2A2IA 2FB3A 1A5BA 2EF9A 3W1NA 4CCEA 3TSDA 3ATZA 5CZTA 2ZTKA 5LNWA 4CNPA 3W2MA 4HT3A 4DPPA 4OU1A 4DBEA 5CZ0A 1H7PA 1L6WA 3TQVA 3LCWA 1XC4A 4O16A 4M6VA 3TQKA 2ZA1A 4JYFA 4ONVA 4XWUA 1AW5A 1F76A 2ZZ4A 3FJ6A 4FXSA 3L9CA 3JS3A 3LI1A 1RQHA 1SO3A 3WJSA 4O4WA 2Q8LA 2WJZA 1O4UA 1JCMP 3UPWA 5DY3A 4AF0B 5AFDA 3HGRA 1M7PA 1I2NA 3B04A 3MI2A 4A21A 1C29A 1FWWA 2E5DA 1A50A 2DZWA 2QAPA 3ABRA 3PF3A 3WK1A 4AWUA 1VJIA 1JQXA 1GTEA 1WV2A 1X1ZA 2YW3A 1GPWA 5HMSA 2DZSA 1OX4B 2GQ9A 5K7JA 3NG3A 5DBTA 1KM0A 3L5LA 2WOQA 4AVFA 1WBJA 1LDCA 3JR2A 1OK4A 5LHEA 3A24A 4JDBA 3PBUA 3NL3A 1F05A 3EXSA 4LV4A 1F7BA 1UBSA 2A7PA 4WOZA 2QEZA 4Z1DA 3V1PA 1OF8A 4M5PA 3M44A 2D73A 1OYCA 2W79A 3EEGA 4HNVA 1FDJA 2Q8ZA 6ALDA 1VCFA 3LTYA 2ZRZA 5CPLA 4LVFA 5FF7A 1MEWA 4EIVA 3STEA 1B57A 1EB3A 4K39A 3W07A 4UMBA 1TMHA 3NM3A 4KFNA 4JTJA 2GUUA 1I45A 2WO5A 3W7EA 4FHAA 2QCDB 4UR7A 5D03A 3NZ1A 4CLMA 2C13A 3I65A 1XKYA 4GJ1A 4FX6M 5BMWA 2QCGA 3S5YA 3TDFA 1W3IA 2GVGA 3MHGA 5G1TA 3UZJA 3I7SA 4XQ6A 5BNKA 3TV8A 1SQ7A 4QIUA 5CSSA 1R2RA 1DBTA 2QF7A 4ADSA 3CB8A 3KFTA 3O16A 1NVMA 2NLIA 2YGYA 3PUOA 4JXCA 4JX4A 1Q45A 3TC6A 1P0KA 3SSJA 3M9YA 2QCFA 5U4NA 2CU0A 3P61A 3HPSA 4XBKA 5DELA 2E6FA 3IRDA 4FNQA 2ZRUA 3IGUA 1QO5A 1LBLA 3KX6A 2WSYA 1XUZA 3IIVA 1ZHAA 3P84A 4AXKA 3KRUA 2A7NA 3G0UA 2DZPA 3B0PA 3HBLA 4MZ1A 1TJPA 3UWZA 1W5OA 2E77A 3WFAA 2BSLA 5CPMA 1KM1A 1SW3A 4FNUA 3NOEA 5LNRA 4FIRA 1K03A 4WX2A 1KFBA 2JKAA 3PR2A 4Z0SA 1OFAA 2VC6A 3W72A 4BR1A 1YYAA 1G7UA 2ABBA 4O50A 2P1FA 2V5BA 3E49A 1IIGA 4WQ6A 3GDKA 3G1AA 2G97A 2XN2A 3RFAA 3OVPA 3DI1A 2RHGA 4LUIA 3TSBA 4IX2A 1Z42A 3LDVA 2LLEA 4HSOA 5D38A 1VPXA 5KZDA 3TUUA 4UIOA 4UTHA 3GIYA 5LSMA 1R47A 3EKLA 4U28A 2J9XA 1SZFA 4O8RA 3SIZA 1TPC1 1OFEA 2B7NA 2GJNA 3NYZA 4Z1BA 1FXPA 1KM5A 1FXQA 4HNTA 2A6NA 3Q58A 1TPVA 4PL1A 3M5ZA 1MEHA 1G4SA 2FPYA 2QCNA 3FFSA 5EL1A 3GDLA 5HWMA 1QFEA 1ZFJA 3EX6A 1NF7A 2ISVA 5AB3A 3VE9A 2B0MA 1KBIA 3P80A 3L0GA 3MP4A 2WSRA 3LHYA 3R5EA 1GQNA 1KV5A 3GK0A 4TR9A 3S1XA 2OJPA 3TAOA 4BF9A 1BWLA 4ORMA 3QW4B 3G8EA 3VCRA 2GQ8A 2X2GA 3T40A 3NQ2A 1X7FA 3P8IA 2PE4A 4JGDA 3TNOA 2WQPA 4Y8FA 5L6UA 3B8DA 4IMEA 1H7NA 3MI3A 3RLUA 4O14A 2R14A 4HNNA 4WY0B 3GX9A 1X1OA 4M7SA 2V9DA 4X2RA 1ME7A 3VI2A 2E6YA 3S9YA 3HG4A 5F2GA 3NO5A 2FLIA 5C6MA 4B5NA 3EWWA 4POCA 2VFDA 2I1OA 4MYXA 3G22A 1IGSA 3O6DA 5DXXA 4PCFA 3BO9A 4WXZA 1Z44A 3GB6A 2ZRWA 1EWEA 4UTTC 1HUVA 1QO2A 5HR6A 2OMAA 3CQ0A 1WBHA 1Q3NA 4UTKA 1GYLA 1RPXA 4EOUA 1DOSA 3JRKA 1K02A 4N2YA 4Y90A 5E1QA 3M1ZA 3CT7A 3DBPA 2ATMA 1O5XA 3W1RA 1EWDA 4XBSA 4QNEA 5D2TA 5LNVA 4MKNA 1TSIA 4IXHA 5F2LA 4AB4A 2ZQ0A 4BI6A 3NM1A 3R13A 1EA0A 3HIJA 3W2JA 2I9EA 3DFTA 1VLIA 3LHVA 1OG0A 4RCXA 3HGSA 1H61A 1PV8A 1W8SA 4TU1A 4DEFA 4YXGA 2ZFAA 3TFXA 5F4XA 1THFD 1VCVA 1M7OA 2ZZ1A 4OV4A 3DFQA 4JD4A 1OFBA 3Q37A 3GNDA 2V2DA 1ZAHA 3IGXA 5FEXA 2YYTA 3C2OA 3UXDA 4OV9A 3A23A 1TREA 1OVDA 2OX1A 3W2UA 3RNDA 4O4VA 4LS2A 3HMJG 5HINA 1MSSA 3NPWA 3PUDA 1B3OA 4RX0A 1FWNA 2E6DA 4RZ4A 1FUYA 3TR2A 2R94A 4N6EA 4A2SA 1PCKA 3BLFA 1MZHA 1Q6OA 3UWYA 5HJLA 1SZGA 5LZLA 1K8XA 1TPUA 5TIMA 3MMTA 1SFLA 2Z0IA 4H6KA 4JY8A 4JTUA 1YXCA 4MY8A 4YCPA 3LTSA 4H4IA 4LUJA 3DXIA 2X30A 3NL2A 5T26A 5FI8A 1AMKA 2YFOA 5E93A 2A0NA 2B7PA 2GVLA 3RMJA 1EEPA 3TW7A 3LTPA 2ZZ2A 3OIXA 1I2RA 1LM1A 3UXAA 2C0AA 3TSMA 5IBXA 1TPH1 1JUEA 2NXGA 4UMAA 5HWJA 3W7LA 2Y7GA 5CGQA 1IF2A 3FKRA 4WUIA 1TV5A 4LRTA 4NNBA 1AW2A 5F2MA 5FF2A 4EVZA 1TPEA 4QQ3A 5D33A 1WYIA 3USBA 1KLZA 3C0JA 4WZHA 1UB3A 1T99A 2NUXA 1F5ZA 3TK7A 5HWNA 1FBAA 4IUOA 5DN1A 4AWTA 4BFAA 4Y9AA 3STCA 1XM3A 3NNTA 3NR0A 3NAVA 3W7GA 3W1XA 3L0KA 1G4EA 1GG0A 5D04C 2ZRVA 5FEZA 3PBVA 5LNSA 3GLCA 1H7OA 2V5LA 1ZENA 1EUNA 4NJHA 5D05A 1W37A 3DHFA 4LC8A 2ZZ6A 1KFCA 1SPQA 3N34A 1EP1A 2Y63A 3TMLA 4A3UA 5CPNA 4FX8A 4LVBA 3W74A 1WAUA 5I3KA 1U5JA 4LW7A 5CKSA 4E2BA 1BTMA 3QZEA 3A21A 4D2JA 3W7DA 3FS2A 2VFFA 1L6YA 2Y7DA 1XDMA 4TMBA 1J2WA 5AC7A 3C6CA 3A5FA 4NZFA 3LCFA 2NXIA 3MYOA 4UXDA 1A5AA 3QEZA 4YLWA 4AHOA 3FYPA 3HF3A 3IVSA 3FJLA 1VYSX 3LLDA 1I4NA 5I3FA 1IXNA 3W1TA 2QCCA 5D2VA 5HUOA 1MEIA 3FEMA 1ICSA 2Y7FA 2TPSA 4OGZA 3QJAA 2ATSA 1OFQA 3RU6A 3NQVA 1TPDA 5AOUA 1DQWA 5EYWA 4AH7A 4UTLA 1N55A 1EIXA 4MY1A 3M5VA 2ZTJA 3BG3A 4UTJA 3ABQA 3C2FA 2VXNA 1VGAA 3OEXA 4O54A 4P61A 1LBFA 3CU2A 3PBYA 4K6AA 4LVGA 3RF9A 4Z08A 3W75A 4XKYA 1I8JA 2FPTA 3EWBX 1G69A 1JQVA 5I3HA 1W54A 4UTWC 1JR1A 3LCIA 1FCQA 1PE1A 3GR8A 3M5YA 1ML1A 3LBCA 4UR8A 3E02A 1RD5A 1H1YA 2O7SA 5KZEA 2H3DA 4TO8A 1KFKA 4BWLA 3CTLA 3M6YA 4RJEA 3C2VA 4O1BA 4EWND 4EF8A 3EXRA 3A5VA 3FA5A 2Z6JA 3M0ZA 4RV8A 2DZXA 3O06A 5KINA 1KM6A 3DFNA 4JTGA 4YMZA 1H5YA 4X22A 2ZA3A 4AHPA 1DVJA 2YYUA 2FQIA 5AHLA 3L21A 3LX9A 4UFIA 3BW4A 5H91A 2ZZ5A 1IXPA 3T44A 4ZQPA 1YPIA 3ELFA 3NPUA 1OK6A 3EWYA 3WK0A 4I7UA 1WX0A 3G0SA 1YXYA 3YPIA 2V2HA 1VC4A 2EAWA 1B4KA 3ABOA 2BXVA 4ICNA 3UQNA 8TIMA 5FF0A 3W6YA 5AHFA 4R7JA 1JCNA 1ONRA 1WDWA 3CIXA 3QC3A 4UFJA 5BOOA 4LS0A 3O1NA 4MFDA 4H3DA 4BI7A 2QCEA 4JIQA 1K8ZA 2C6QA 4I7WA 1G6CA 2BLEA 5HUPA 3MBFA 1TYGA 3LCLA 2H6RA 3HGJA 1G67A 5C54A 1SW7A 3KRSA 5E0KA 4YL2A 3GDTA 4NJGA 2GVJA 1KBJA 3EXTA 2ABAA 3L65A 5K3VA 3MUXA 3P8JA 3IIXA 1WOAA 1A5CA 3MO7A 3DZ1A 3S5ZA 2C14A 3B4UA 3BPWA 4JTSA 3HO8A 4QM1A 3GDRA 3THQA 2F7FA 2CLKA 2FDSA 4FX7A 4IX0A 4WJEA 4XZ9A 1FQ0A 3S5NA 3W1LA 3HB9A 3GZ3A 3NQ8A 1XFBA 3GYEA 4GBUA 5H2ZA 1WOBA 2AAMA 3UY8A 4L4MA 5EKYA 4FNRA 4QNWA 4O1CA 2ZA2A 4C1KA 3KOFA 2C1HA 1QOPA 3MP3A 1XBYA 4HKPA 3IVTA 3SECA 1E51A 2X1TA 3GNNA 4PODA 2PC4A 4CNOA 3GXNA 3KVKA 4OWGA 2CW6A 3SJ3A 1SSDA 4YCOA 1VHCA 2J6XA 4CCCA 4GUGA 2H8ZA 4ZQRA 1F74A 1B9BA 4M6QA 5C2XA 5AN7A 3TMQA 1LROA 1WA3A 1T0OA 1OFRA 4PC8A 5F1UA 4DELA 4XTIA 1CI1A 2ZZ3A 1H62A 3LERA 4TX9A 1W5PA 5FEPA 3S6DA 1W1ZA 2QCHA 3C52A 3GKFA 5LHFA 3FIGA 1RV8A 4M6PA 1JCLA 4FNSA 1QPNA 1I2QA 1W3NA 3R12A 2QKFA 4ZQOA 5LKYA 3W1AA 4N02A 4TMCA 3U2OA 3PB2A 1SZNA 5FEWA 5DXYA 1XBZA 4GWEA 3W83A 4LS1A 4A2RA 1F6PA 3IEBA 3PM6A 1P4CA 1QDSA 5GVJA 1GVFA 4S2CA 3RK8A 3KAOA 2ZRYA 2ISSA 1PS9A 2FIQA 4WXYA 3W86A 4X9SA 3NDOA 2XN0A 4MPQA 5KTLA 1KFLA 4ADTA 1PCWA 1XI3A 2XFWA 4GNJA 3TXZA 1R2TA 2YZRA 4JEQA 3UPBA 3BG5A 3W87A 1T96A 3R2GA 3LXCA 3PC0A 4GFSA 1QPRA 3W2LA 2Y85A 1TTJA 1NFBA 4O28A 1IIHA 2G96A 4ZVJA 3SZ8A 1AL8A 2WSQA 4HPJA 2PURA 1HO4A 1S5WA 4HIBA 4O18A 3G1HA 2QCMA 3DFPA 3LCGA 1GG1A 2RDUA 1ME9A 4NZJA 5BW6A 5AYYA 1OHLA 4ZQMA 2JBMA 4ZQNA 2DORA 1O95A 2V30A 1YDVA 3S5OA 1H1ZA 1QR7A 1TPB1 3B03A 3C4UA 5DCEA 1LOLA 3MI6A 4S1FA 3BG9A 3P60A 1NEYA 2C18A 2A7RA 4O57A 4MJMA 3NVTA 1LRQA 3N73A 2NXHA 5I3GA 3STFA 3ABSA 3BGGA 3GAYA 4DO4A 2J27A 5DY2A 1GVRA 3UWQA 1QCWA 1D3HA 1VR6A 4JTEA 4O11A 3W73A 4ZL1A 1ALDA 3P82A 5LNUA 4QITA 3EWXA 1EPXA 3DI0A 3K30A 3N19B 3PBWA 3W1PA 1VCGA 3W7OA 1OFPA 5HULA 3PWAA 1ICQA 1DJNA 3O05A 1TRIA 3NEVA 4K38A 1VHNA 2Y7EA 4NVTA 3UD6A 4NXKA 2Z6IA 4UUIA 2YDAA 3OHIA 1SSGA 1Z41A 1TPFA 2CLFA 5J5RA 4ADUA 1DJQA 2HS8A 1FCBA 3PS7A 2NWSA 4Q32A 3KXQA 5BRBA 1FWTA 3I7QA 2HMCA 4KFOA 4OBTA 3CLMA 3HPZA 1VZWA 3H55A 1Y0EA 2J24A 3FKKA 2B7OA 2X1SA 2NX1A 1LOSA 5J5DA 2BTMA 4XUGA 3W88A 4KFPA 3CEPA 2RFGA 3PSWA 3SGUA 1SW0A 1JCYA 3W1UA 3C2EA 3W3OA 1EX5A 3G3DA 2ZDRA 3D0CA 5A5WA 4RXFA 4UC5A 3LHZA 4JNMA 4MYAA 3U6WA 4LTSA 4MLJA 3G3MA 4UFKA 3KVLA 1VH7A 4QISA 5DBUA 4JS3A 4DF1A 4ZQCA 3M5XA 2ZRXA 2Y89A 3L2IA 3OVQA 2QCLA 4JTTA 1KA9F 1LZOA 3T4CA 3W70A 5BMXA 2H90A 4O1AA 2NV2A 2Y6ZA 3W7IA 5K4ZA 3QM3A 4AF0A 3G1YA 3F4NA 1P5BA 1D9EA 3IGSA 3BW3A 2J88A 3DKLA 4JY9A 4UNKA 2JKPA 3SI9A 5AC6A 3CHVA 4LV9A 1KLYA 4O17A 3G1FA 2EHHA 3VKJA 1KM2A 1EUAA 1SR9A 2WNNA 1L6SA 3ZWTA 1V7YA 4M19A 4MIMA 3MP5A 3W23A 2W6RA 2QJGA 3N9SA 1TTQA 3S1WA 1U83A 3TA6A 1UCWA 4HPXA 3QYQA 2PRMA 4CCDA 4PA8A 2CZFA 1NF0A 1XL9A 2ISWA 1TV8A 2RDTA 1Q6LA 2HS6A 4MJZA 3L66A 1H63A 3LXAA 2ZZ7A 2HTMA 4FXRA 2C15A 4IMGA 4IXXA 3SGZA 2NX9A 3M43A 3W22A 1RZMA 3KVMA 4O53A 4LWWA 4KWVA 1H50A 5D32A 5AYXA 5IM51 3PY2A 3R8RA 5EY5A 1I2OA 2DZUA 4UFMA 5IBXC 4LRSA 5F4SA 1BEUA 3LRLA 4DBDA 3LM7A 4FNPA 3U8GA 3FOKA 1SO6A 2G95A 1BWKA 4IJBA 3PULA 3G1SA 1ZCOA 5EA9A 1ADOA 1GJPA 2Y62A 1X8FA 1W5MA 2VELA 1KW1A 2DJXA 4RXGA 2QDGA 3C61A 3BV4A 3W7KA 3W2KA 3UZ5A 1YADA 1AK5A 4LVDA 3TAKA 3QFEA 1O5KA 1TQXA 2Z2UA
chains in the Genus database with same CATH superfamily
3SCWA 1GWJA 2YX0A 1YDOA 3UJFA 4W4QA 1I60A 1IGWA 5C8BB 2QYGA 4JX6A 1YDNA 4H41A 3CT2A 5BYWA 3UWUA 3J7HA 1E72M 2UY4A 5EMYA 1PWMA 1ZGDA 3GTIA 3NPVA 4D72A 1GOIA 1S38A 4X9YA 4AAJA 4K8GA 3URQA 4J40A 3GXPA 1IEIA 2FFCA 3LSCA 2PD5A 4BF5A 5JQ9A 3U2ZA 3D5HA 3QV9A 2NQLA 5H6HA 4IUGA 2VFEA 1VBGA 2VEMA 3AU2A 4ATLA 1M53A 3A4JA 5FAGA 1G7VA 3WQ6A 2C91A 4E2OA 1K7FA 3ITVA 4R34A 4TIMA 3FCPA 1ZJIA 1SO5A 5HNRA 1HJWA 3RIKA 4FR1A 2BGSA 2DH2A 2GDVA 4ZGYA 3WQCA 3MJYA 4HHMA 3HG5A 4R33A 3H2CA 3NQ7A 2XVPA 4I9MA 1Y65A 3BWWA 4OE7A 3VKAA 3ZT5A 4C6IA 3MDUA 4IGHA 1EC7A 2QPSA 3E0IA 4YHEA 2Z7KA 3LXBA 3VZYA 2OT0A 4GUIA 3FXGA 4PR4A 1SUXA 3I6RA 1WKYA 2EJ1A 4Q4QA 4Q8VA 4A8LA 1UA7A 4JIPA 1GHRA 2QJHA 3MWAA 4L80A 3QC0A 2VR4A 2A85A 1LBMA 3E2SA 3EWUA 4BEUA 1TFVA 1JFHA 2HK0A 4V2XA 3REQA 5D30A 4P8UA 2VFGA 3PTKA 4GD0A 1KM4A 5M2FX 4NNCA 1OADA 1VEPA 5REQB 3KWSA 3VFLA 3VU2A 1P6BA 1KCKA 5I5RA 4JDYA 1TUFA 2DJLA 5DO8A 3TC7A 5EGRA 3BLIA 1CCWB 2FJKA 1B4EA 2E6AA 1WXJA 2CZVA 3H4GA 1P48A 3C5QA 4GUHA 4H9MA 1XLMA 4OUIA 2CZEA 4RZBA 3SY5A 3O6CA 4TV6A 1L6FA 3R8GA 4AIUA 1OCNA 2XGIA 1QW7A 3TW9A 3G0XA 3ITGA 4GZEA 3LGEA 4RK8A 3RMEA 3H7RA 3MKCA 3R0UA 4BF7A 3W0KA 4ZMGA 1BF6A 3EX1A 3AU6A 3EWZA 4P7OA 4GGHA 2AQVA 2VCCA 1CGVA 1TKKA 2OQHA 2W92A 2VENA 2QS8A 1KGWA 2Q3RA 3EB2A 1JZ3A 1FVPA 3VZXA 3GRIA 1MUWA 2VUNA 3K4AA 3MUAA 3W7HA 1GVQA 1ZBCA 1S2AA 3M41A 1L2UA 4YJ5A 4W9TA 1XBXA 4AEEA 3KOYA 4FIQA 3N12A 2WLZA 3ZR4A 2VMFA 2KZHA 2V38A 5I07A 1UMYA 3D47A 4ZB2A 3WNLA 1C7SA 1ZL1A 2GSEA 4IIDA 4WSHA 3NDYA 4IQLA 1Y7VA 2DZTA 3CB3A 2ZBTA 1XYMA 3EX4A 2GJLA 3FAWA 2WZTA 3A3WA 1HG3A 1YBQB 4PTVA 3UP8A 2QXWA 3DGRA 1KBLA 3NQFA 1EQPA 1JYNA 4Z2IA 4W89A 3T78A 3W85A 3NSMA 3QV7A 4FMVA 4W88A 3AZSA 4EF9A 5ABTA 3RYSA 5F1VA 1WZAA 2EKCA 4ECLA 3QGVA 3GVGA 4N42A 1QT1A 1TWIA 4H00A 1UOZA 3NEHA 4O1EA 5GJPA 1XV8A 2XHYA 4NJJA 3CUFA 1BXCA 5LA0A 4GX8A 1ZNNA 2DVTA 3P62A 1Y5XA 1WO2A 3M0IA 4Q4KA 3EPOA 3V75A 4MB5A 1KWKA 3BLOA 4V28A 3B4YA 5LA2A 2GJRA 3L4WA 4XZMX 1XLHA 5CG0A 5A69A 3GM8A 5LA1A 3C3NA 3ZR6A 4NQ1A 1WQ5A 2OWXA 1SVDA 4Q8QA 4QEHA 2P10A 3BLLA 3W38A 2Z1BA 1TO3A 3BJFA 4QRNA 1K3UA 2ZWYA 1VBHA 5D9OA 5C5YA 3TN6A 2VCBA 3DFSA 3O8AA 1V77A 3S8HA 2BHUA 1TCDA 4YNGA 3TU9A 1QBAA 5AC4A 1VS1A 2WNZA 1SO4A 2IXUA 4RLIA 2QGYA 4Z1CA 3APGA 3Q65A 1Q4NX 3QQ1A 3NQEA 1N8IA 1PX8A 2YLAA 7A3HA 1GVSA 1GZGA 5CPOA 4JTLA 5A6BA 5H8UA 2E5BA 3ARXA 3I3EA 5FACA 4TXEA 2OSWA 2OU4A 2V63A 2F6UA 4MMWA 2QULA 3N29A 3TQ0A 1XIMA 1OD8A 2VC5A 2D20A 3LGGA 4XAFA 3MKKA 1J10A 1FWJC 2NQ9A 3PAJA 3BARA 2EPHA 5CXPA 4NF7A 4NP7A 4GH3A 2NSXA 5I3JA 5KSWA 1LUCA 3OIHA 1E9ZB 3BUVA 2QUUA 3N14A 3K8KA 1C7TA 4LUSA 2I14A 3HQ1A 4HPGA 4HMDA 1W3TA 3EA2A 3LG3A 1UR2A 5EMLA 2JKEA 2NZLA 3ALGA 2X7WA 3M46A 4A3RA 3UPMA 4Q8TA 1OIFA 3QMRA 4AISA 2ZX6A 2XSBA 4C6QA 4CNSA 4DI8A 1GYNA 4Q7IA 4GISA 2PAJA 1OD0A 2ZDSA 2ZADA 3N2BA 1UWIA 1WDRA 1XF0A 5G1YA 2DT1A 5FJTA 4HA0A 4BI5A 2CLOA 1A5SA 1R0MA 3CL8A 5FF4A 4LEFA 2P50A 1ME8A 3H2NA 4Y6GA 1UD6A 1JDCA 1QPQA 3QXBA 1BSIA 3ZYZA 1LRNA 1KRCC 3GC2A 4DYKA 1VEMA 2VEPA 1Q6QA 4EXQA 4IFKB 3T55A 1JVNA 5FIPA 4UCGA 3WMLA 4I8YA 1QNVA 3HQOA 4ZOCA 3LA4A 4IZGA 3GDMA 3U2EA 4KCUA 3DU0A 3A12A 4J9JA 3FV9A 1HFBA 4C6KA 2X41A 3L5AA 1XH2A 1E4LA 2W62A 1H7RA 2NUYA 3WLKX 2PDJA 3AZTA 3UR2A 1ZBKA 3BK0A 4KCVA 1VPQA 3QSTA 3EOEA 3E9AA 4MG4A 1XRSA 4DUVA 3L5MA 2DGAA 3G1DA 4UFHA 4JTKA 1RLDA 3C8FA 1VYRA 1LTDA 3QFWA 3BTNA 5C9ZA 5G5IA 4PUNA 2V3FA 3AS2A 2PRHA 4WDUA 1HKVA 4A8RA 2GDQA 1JCXA 3I68A 4DUOA 2AMXA 3W1MA 3GY1A 5L9FA 1IT0A 1UR9A 3W1QA 4Q7BA 1RUSA 3WZ0E 3RAOA 5MKGA 2GWGA 4M1RA 1AZ1A 4NX5A 4AEOA 3MZNA 4N6FA 4I9AA 3NO1A 4PTNA 3OG3A 4M3PA 4DJFD 1DJYA 1Z8AA 1E6RA 3DENA 5AHMA 3S9ZA 1DIEA 1BXNA 3NYDA 4GC4A 4JN7A 3B9AA 4MOZA 3I6TA 4C1LA 4NUWA 4N9CA 3BZGA 3SUWA 4BK9A 3W7NA 3R43A 4DRSA 3FK4A 3UY7A 3TJ4A 2EPLX 3CPRA 4WOQA 3RCMA 3T0TA 2X7VA 1CXEA 4S3DA 1QNRA 2GOUA 2WHMA 4GYKA 2ONEA 1RJQA 1JAKA 2R8WA 5F2IA 1ONEA 3U3HA 4IGSA 2UY2A 5C7VA 3THAA 3LB0A 2JIWA 4IH3A 4HPNA 4LU0A 2Y5JA 3QQ0A 3AYTA 3WQVA 4L61A 3NPXA 5JBDA 3QF0A 3ARRA 1F8MA 3ARVA 3UESA 3VNZA 3RPMA 1DE5A 1GNXA 4AZBA 4GZ7A 3S1UA 1M01A 1PDZA 4W7VA 1EO7A 3PZMA 1YNQA 3UR8A 3WMBA 2FVLA 1JYXA 2WQDA 4H19A 4L4LA 4P8XA 3O07A 1AQ0A 5A8OA 2WZEA 3TZFA 4TUFA 3NL5A 4AU0A 4DJDC 3ALFA 4EXBA 1EOKA 3Q94A 4IPLA 3SW6A 5I6SA 5FJUA 3SCTA 2ON3A 1XDLA 3CASA 4XSMA 3THUA 1ZAJA 3TFCA 1JDEA 4E38A 3S1VA 2GQ3A 4ZSUA 2NQZA 3GG1A 8A3HA 2ALDA 3LCXA 2A2IA 1C8YA 2YDRA 4AVNA 5C2GA 2EF9A 4HMCA 3WD0A 2NVCA 2UY5A 2YDSA 2EEXA 4CCEA 3UVIA 5HJXA 1GZ1A 3TSDA 4LALA 2ZTKA 3GXFA 1BYBA 1XSKA 5LNWA 2WMIB 1Q5MA 3EOUA 4DPPA 1DJGA 3THCA 3VIIA 1H7PA 3LCWA 1GKQA 4O16A 1FP8A 1LL6A 3DC8A 2PZNA 3TYDA 4JYFA 2WLYA 4DZAA 1AW5A 1FFRA 3CAKA 3FJ6A 3L9CA 1SO3A 1TV3A 3LD5A 4WGHA 3RRAA 5DMMA 3PZNA 4J1OA 2A3EA 1B5TA 5DY3A 1CPUA 4GC3A 1I2NA 1TWSA 3B04A 3MI2A 1C29A 1FWWA 2E5DA 2DSKA 2HK1A 4DN1A 2QAPA 2WM0A 1CIUA 1RA0A 4WK9A 1JQXA 1WV2A 2YW3A 1OX4B 5K7JA 3NG3A 1A5UA 2JALA 5DBTA 3ZSSA 1WBJA 4GVFA 3A24A 1L8PA 4E8DA 4HK5A 3FYYA 3NL3A 4LV4A 1F7BA 2QEZA 2RUSA 3H24A 3M44A 1OYCA 1CDGA 4HNVA 2SFPA 1FDJA 3PZQA 4KMQA 3WY1A 2ANUA 1F3XA 3T0AA 1S2VA 4PMDA 1ITCA 3WQDA 1B57A 1TMHA 3NM3A 1K9EA 3S2MA 4JTJA 5HQLA 3GBEA 4FSAA 3TQPA 2DIJA 1I45A 4FHAA 5D03A 3NZ1A 2C13A 4L1XA 3VGGA 5I79A 4F0KA 3I65A 5LIKX 1W3IA 2VD8A 2GVGA 5G1TA 3CBWA 3I7SA 3UZJA 1SQ7A 4QIUA 1PX4A 2PDUA 3K2GA 4J3ZA 1DBTA 2QF7A 4OOUA 1RXOB 3KFTA 4XIAA 4QJ5B 5AECA 1US0A 2YGYA 2QUNA 4R85A 1P0KA 3SSJA 3R8HA 1CZ1A 3A4XA 5U4NA 5DELA 2ZUMA 3CAQA 1JZ8A 3S47A 1NQ6A 4GABA 3IGUA 3SY8A 2WK2A 1W1B1 3KX6A 1XUZA 3IIVA 3S2LA 4ZR8A 3KRUA 3G0UA 1BYDA 3B0PA 3HBLA 4MZ1A 4XD6A 1TJPA 5B7ZA 3UWZA 2CC0A 4EAYA 1V6TA 1O6IA 1B3WA 3N1AA 4HU0A 3NOEA 1K03A 2DVXA 5XINA 4GNVA 2VC6A 1EC8A 3TTYA 1YYAA 1M68A 2P1FA 2V5BA 4XZIA 4WQ6A 2X2YA 4D6GA 3G1AA 1VENA 4WCJA 4BY3A 3C0SA 4Q4SA 1Z42A 3LDVA 5D38A 2ODOA 3VGFA 5I00A 1XWYA 3EKLA 2PDYA 2B7NA 2GJNA 3NYZA 4Z1BA 1E9IA 3CYVA 1FXPA 3R94A 4HNTA 4U33A 3PNZA 1OQFA 1NDWA 3M5ZA 1MEHA 1JI2A 1G4SA 3SADA 2FPYA 5EL1A 2IQ0A 3GDLA 5HWMA 4W85A 3EX6A 3CAVA 2ISVA 1Q6GA 2YOCA 4DLFA 5AB3A 1CXIA 1XINA 2GVEA 4HZMA 4ZB5A 1VD6A 1UBPC 2PDGA 3P80A 3H2AA 3QHOA 1WDPA 2AL1A 3GK0A 4FLQA 4TR9A 2OO0A 2C1GA 2QDEA 2WC4A 3OW1A 5TF0A 3TNBA 5M5DA 1PBGA 5A8MA 3G8EA 1E0WA 2GQ8A 5BROA 4PN2A 3NQ2A 4BQ3A 3GDBA 5JBEA 4Q3MA 4S38A 2WJEA 2XWEA 4GQQA 4PMZA 3TNOA 2J8TA 4P7NA 4QLJA 3B8DA 4IMEA 5AKQA 2FDMA 4O14A 3VIJA 4W7UA 1JZ5A 1IQ8A 3QR3A 3TLLA 1ME7A 3AHTA 2OXNA 3S9YA 1J01A 3EWWA 2VFDA 4I9TA 2GYIA 4AX7A 1IGSA 4KRUA 1MQQA 1EWEA 4UTTC 1QO2A 2Z00A 5CZKA 1BRLB 1GYLA 1RPXA 4W8AA 1XPYA 3H70A 4N2YA 3NOYA 4EE9A 4E6MA 1UIPA 1EWDA 2D1ZA 4XBSA 4PMYA 4QNEA 5LNVA 1TSIA 4IXHA 4UTFA 4L4OA 3F5JA 3HIJA 1EA0A 5IFPA 3FVMA 1IT7A 1VBUA 4DEFA 4YXGA 1XIDA 3GU2A 4OV4A 1YNPA 4JD4A 1OFBA 4XSLA 1ZAHA 4OTKA 5IXEA 7XIMA 5ABHA 3C2OA 3QV8A 1UPMB 2EPOA 1E6ZA 5GNYA 4I90A 2PGWA 1WP6A 4A05A 5HINA 2R1MA 1FWNA 2CBUA 1BXBA 1FUYA 3TR2A 4AZ5A 4A2SA 3UWYA 2KX9A 3H21A 4AUBA 1DJHA 5LZLA 1DYSA 1J0IA 1YXCA 5FJJA 4YCPA 4X61A 1R3YA 2X30A 5FI8A 3RILA 3STPA 4EPBC 2A0NA 3K13A 2DEPA 3RMJA 3BOLA 2A3CA 1EEPA 3LTPA 3TSMA 3AICA 4J3XA 4H8NA 5HWJA 3W7LA 1IF2A 5HQMA 4LRTA 5F2MA 1AW2A 4EVZA 4QQ3A 5D33A 2OQYA 3USBA 3LPOA 4WZHA 4C1NA 3VCNA 5HWNA 1FBAA 1P6WA 3NAVA 3NQBA 3W7GA 3L0KA 4W5UA 3TVAA 5D04C 5FEZA 4CN6A 2KAUC 4H7ZA 1E5NA 1H7OA 3EBVA 1UKQA 1RLCL 2X0SA 1QI2A 2IQDA 1TA3A 2FZMA 3EOSA 2ZZ6A 1IR1A 2BODX 4A3QA 2EXOA 4A3UA 2AQOA 4C6CA 1ITQA 1P7TB 3VCCA 4FX8A 4U3CA 4HYWA 4LVBA 1LL4A 1RVKA 2CBJA 4HPHA 1YMYA 1E1EA 3OLEA 5M03A 3RDKA 4D2JA 3K1DA 2VFFA 3SN1A 1L6YA 3EZ4A 3CZGA 1UQZA 3QZ6A 2J6VA 5I02A 1GGOA 3C6CA 1LG1A 3WD2A 3SSZA 4UXDA 3AMDA 2VNCA 1F8IA 2ISFA 3IVSA 3FJ4A 1VYSX 4DM2A 1I4NA 2V6AA 2GJXB 1IXNA 3NDZA 5DQPA 4LB3A 1WAWA 4XZHA 4OGZA 3TLQA 3QJAA 4FLSA 1FWCC 4V33A 1W3LA 4AD3A 1Y8BA 5AOUA 3EOLA 5EYWA 3JUGA 4B5WA 3WBEA 1N55A 3UG8A 1EIXA 4S3AA 3HPFA 4DJDA 3SJNA 4MWAA 3SBFA 2DY3A 3R79A 4B3ZA 3RF9A 5CBBA 3EWBX 4XD5A 1KXQA 4UTWC 1FCQA 3GR8A 4NAEB 2VGIA 2O7SA 1GKPA 3AAMA 3B40A 2YA1A 1PKLA 4RJEA 4NILA 3MSYA 4EF8A 4CD6A 1QNOA 5CGMA 4INFA 2DZXA 3LEPA 4KT2A 1CEOA 1CLVA 5E6YA 1PDYA 3PZOA 1I1WA 5AHLA 2G50A 1UMLA 3WBAA 3F2CA 2ZZ5A 2XIJA 1YPIA 3NPUA 4KEZA 1OK6A 1R3SA 1YKWA 2AGTA 4WKAA 1NARA 1S1RA 2EAWA 4WF7A 2J77A 4M29A 2ZE0A 3CS2A 3BZJA 4UOJA 5BOOA 3SCNA 4UFJA 1K8ZA 3WDJA 1A3WA 3PZVA 4I7WA 1G6CA 2BLEA 1TG7A 1MW2A 3LCLA 2ZVRA 3U57A 4HK7A 1XJBA 2J78A 4YL2A 2YBVA 1US2A 4NJGA 1KBJA 3EXTA 5IHRA 3W00A 1ISXA 2XGBA 1R86A 1A5CA 3AUJA 4IIHA 3CUGA 2FGZA 3BPWA 4CN4A 3OO2A 4QM1A 3K8MA 1R3TA 5CJ5A 2J7BA 4S3CA 3GDRA 2CLKA 2FDSA 4FX7A 1VBRA 4FXFA 4WJEA 4WVXA 4XZ9A 5E70A 4M51A 3LNMA 1E4NA 3P0WA 1XFBA 3LUTA 1BWVA 4PBEA 5H2ZA 2P53A 3CUXA 4L4MA 1JNDA 5H8PA 1CXHA 4O1CA 1KR0A 1NFGA 2WKGA 2C1HA 3UCCA 4CNTA 4LF2A 4HKPA 1V03A 3IVTA 4UR9A 1R9ZA 4AD5A 1EJRC 3KVKA 4OWGA 3W53A 4QBXA 2G4FA 1SSDA 1VHCA 2J6XA 4ZQRA 1E4IA 1I1XA 5EFDA 4HD5A 2DSZA 2Z1KA 4M6QA 3T4WA 5C2XA 2REQB 4EANA 3MVIA 2YCLA 1W2PA 2GGJA 4XUYA 2CKSA 5F1UA 4XTIA 2FZ9A 1V4YA 1IEQA 2ZZ3A 4IP7A 1YHTA 1V3MA 1H62A 1W5PA 1VEOA 2F6XA 3GKFA 4CGTA 2YL6A 1HT6A 3VZZA 3FNDA 1S5NA 3VD9A 2QZRA 2QKFA 1Z32X 3AYRA 3T0BA 2VR5A 5DXYA 3H7VA 3WLJA 4AIEA 3IEBA 3PM6A 1QDSA 1IZJA 2P3EA 3BLDA 4P7QA 3VUPA 4KS0A 2G3MA 2ISSA 2RGMA 3CQKA 3R6IA 1VBJA 4PSRA 2GGHA 2XN0A 4MPQA 1KFLA 2XIIA 4ADTA 1PCWA 2XFWA 3HV9A 4JOMA 1T96A 4GFSA 2GK1A 1QPRA 4RPPA 3W2LA 2ADAA 1CGTA 2FGLA 4O28A 4DBUA 1GOKA 4WJ8A 2OQLA 4NYUA 3SZ8A 4AG0A 1AL8A 4HPJA 4PMQA 4Z17A 1SJDA 2W91A 1XLJA 2J75A 3ES8A 4GXPA 4NRSA 3O0FA 3IAQA 1ZJBA 3LCGA 2WB5A 1TWZA 1ME9A 3GFZA 3BOXA 1POKA 3U7BA 3W6MA 4LQ1A 4ZQMA 2DORA 2V30A 1YDVA 3H23A 1K1DA 1LOLA 4JFUA 4U10A 1B54A 2A7RA 3V3WA 1KBBA 3BQ5A 4AZHA 3KOXA 1JZ4A 5I3GA 4IQJA 5I24A 4DO4A 3GAYA 2J27A 2YB1A 3UWQA 2VGGA 1EJVC 2GFTA 1E70M 1D3HA 1VR6A 4IMAA 3TYZA 1ALDA 4QITA 4Z2LA 1REQB 1VFMA 3K30A 3N19B 3B8IA 5HULA 4CQDA 3O05A 2CLPA 4E4FA 4K38A 2Y7EA 1GW9A 5CPQA 4HNLA 4NVTA 2FMNA 2Z6IA 2QNEA 2YDAA 2VDHA 5HMEA 3OTRA 2HS8A 1OCJA 3N13A 3N15A 2HMCA 4KFOA 2FMOA 1E73M 1VZWA 3QPEA 2J24A 3FKKA 2V5CA 3UZZA 1ONWA 1X39A 5A6LA 1S5MA 1LOSA 4HZ7A 3T6CA 3N2TA 3Q4DA 1EEXA 5REQA 2PLKA 4BQ4A 2FFIA 3CEPA 3SGUA 4ZODA 1SW0A 1KKRA 4C6FA 1R87A 9RUBA 3C2EA 3W3OA 4LAZA 3G3DA 2ZDRA 5A5WA 4RXFA 1SZRA 3LHZA 4JNMA 4PUWA 4QHRA 1R7OA 1RCOB 1X97A 3UWEA 3KVLA 4JTQA 4QISA 2PWGA 4JS3A 5DBUA 1EH9A 2HQAA 3BICA 4ZQCA 2QW5A 4NIRA 3VK5A 1U30A 3ICJA 3T4CA 2NV2A 3W7IA 4QGCA 4NZ4A 3QM3A 2BHYA 4K1WA 3G1YA 2HCVA 1D9EA 1RALA 1NTHA 2I5GA 3M0HA 2W66A 3DKLA 3Q45A 1R8LA 4UNKA 1PZ0A 1E0UA 3SCQA 4ZOAA 4LV9A 3SI9A 5AC6A 1KLYA 4CU7A 3PBMA 2EHHA 3VKJA 3P14A 3N9KA 5E09A 2UBPC 1EUAA 4LPCA 2WNNA 1L6SA 3ZWTA 1YDYA 4IFRA 4ZOBA 3RJXA 2W6RA 2BVTA 5C9XA 4TX8A 4XAZA 1N82A 1GUVA 5H8MA 1QNQA 3WQ8A 1XL9A 3VFCA 2ISWA 1KKOA 2D2OA 2RDTA 3GIQA 4MJZA 3L66A 2E28A 3NVDA 2NX9A 3W22A 4MHBA 1QI5A 4B16A 4ZSTA 3POCA 4LWWA 4KWVA 1EF2A 3NURA 1H50A 5D32A 2HZGA 2VHLA 3PY2A 2VZTA 2YL5A 5IBXC 3IS4A 5F4SA 1BEUA 4DBDA 4FNPA 1YBQA 1EPVA 1XRVA 2IPWA 3OBEA 1HKKA 1JDFA 1SO6A 2ZC1A 3R4IA 2A3BA 3CHDA 5EA9A 4DI9A 1IR2A 1PYMA 1ZRQA 5MF5A 4HVXA 1W1VA 3E6EA 4UOQA 3UFYA 4IQEA 3KW3A 3UZ5A 2YIHA 3QFEA 2PWFA 4Y2WA 7CGTA 1BHGA 2V2CA 4GI6A 1RCXB 1QNSA 1F3TA 4GVIA 3WLLA 3UGVA 2CLIA 3MBDA 5DFAA 4X0NA 4FLOA 4QLLA 3WK2A 2PGEA 4HZ8A 4WIWA 3QYSA 3E12A 3HA1A 1DTNA 3QKZA 4MFEA 3O3RA 3EA3A 4NXSA 5A3HA 1OSEA 4BQ5A 3LGDA 4JQ1A 3DYMA 4K7YA 1TB3A 4D6HA 5LIUX 5LYRA 3AI0A 1R46A 1Y5WA 1KRAC 3PUEA 3WH8A 1T5AA 1QVBA 3BJTA 1C8VA 1V5XA 2AAAA 2ZUVA 3C2RA 2G37A 1EFZA 1XLFA 4NHVA 4GO8A 5BWAA 3UCDA 3F4WA 4AHQA 1AQHA 1YPFA 4HQVA 2GZXA 1XFCA 3JW7A 1KV8A 5K4XA 4CQ9A 1MDRA 1D3GA 3P5YA 1Q65A 2YCEA 4UFLA 1IZCA 1QOXA 1RVGA 4GI8A 5G2HA 3VUSA 1QOQA 3M7WA 3UVAA 2PZ0A 1N8FA 1R2SA 2E1DA 2WWCA 3NO3A 4L9YA 1K7EA 4X63A 5FJOA 1K8CA 4KWWA 1PL9A 4M24A 3NSNA 4BCEA 1C9DA 1IWPA 4HU8A 1F73A 3RLHA 3CQIA 3KTSA 3H2MA 1AG1O 5HQEA 2Q71A 4AXNA 4L6HA 1DE6A 4XAGA 4IOTA 3D3AA 4Z42C 4GI9A 3VNDA 2GPTA 4K37A 3XISA 1PVNA 2F2KA 5KZMA 4D1IA 1NP0A 2NX3A 5SWUA 4JICA 4U4MA 3CWOX 3BV7A 3WD3A 2VZUA 3AMCA 4FI4A 1V3IA 4KH2A 2Z1SA 1GT8A 4AC1X 4ACYA 2RKXA 1FWAC 1EJUC 1KM3A 2GL5A 1FCUA 5EBUA 2QUMA 3KDOA 1Q66A 1XKJA 3HJZA 2D2GA 1EX1A 1EF3A 4IMCA 1FH8A 3G8RA 3ECQA 3L67A 1AQMA 2YPIA 4REQA 3WNPA 2YFNA 4MJ4A 1XCWA 1FWRA 1KFJA 3MZ2A 1QBBA 3B0VC 3HV8A 5J04A 1J6PA 2Z2AA 2ZKMX 5GNXA 3M07A 3RM4A 3WK3A 3QHMA 2PA6A 1DIDA 4JTFA 5TD4A 4XO7A 1C9WA 1FRBA 3BURA 3SUVA 1VFFA 4QG9A 5D09A 4JFWA 1RJRA 2Y61A 3TCSA 3P3BA 4P8WA 5HR7A 1Q2RA 1VLWA 1WZLA 4HJWA 3M6DA 2A1YA 3W2NA 4ML9A 1IV8A 1HO1A 3E3HA 1EXPA 5HOSA 2AGKA 5FF3A 4A29A 1YTDA 2WMKA 3WD1A 3VMPA 4PH6A 2E40A 1BPLB 3G77A 4IF2A 1ZP4A 1X6UA 1MQRA 3PG8A 3FLUA 4TTGA 3PB0A 2FH6A 2UV8G 2J74A 5K2ZA 3U4FA 1W9DM 3AWOA 3LOTA 4CD8A 2O7QA 2Z1VA 2VZSA 1VJZA 1H7WA 3F1QA 2VOMA 4NNAA 2VL4A 1J96A 1UUOA 2CERA 1UJQA 1M1BA 1HN1A 4XZNX 3GU9A 5HNUA 2PGRA 1T40A 4RZ5A 3TYEA 1XRTA 4DWSC 4L7ZA 2PRLA 2F9RA 2J13A 2YL8A 2FHBA 6TIMA 1SU5A 1EC9A 3KVJA 1MI3A 4O12A 1RR2A 4QFUA 3TYUA 4LBUA 3MPGA 2VKZG 1N7KA 5D9PA 2FB2A 4G1KA 5EMKA 3IGHX 4EPEC 1U2YA 2Z27A 1UH4A 1W3JA 1QWGA 4O0QA 2QDHA 1QUMA 3L2MA 1CB2A 2P0OA 1V02A 3ZSTA 4MUZA 3FHAA 2V67A 4YWIA 3OBAA 3KOWA 1KGXA 1MRAA 3B3DA 3V18A 1UP0A 4XKYB 3VDAA 1BYCA 1JUKA 1OFOA 2XZ9A 4NT0A 1EHNA 4JNZA 5CC3A 2D2HA 1BG4A 1PSCA 4Y9OA 3KBMA 4QAIA 1F9CA 1ESWA 3S3GA 5CEWA 3TC3A 4GY7A 1NOFA 1KFEA 1KRBC 4CNNA 4GQRA 3GNXA 3KRBA 4ACZB 1PZ3A 3TW6A 4GQGA 2O4MA 3QSRA 1JL8A 4Z0JA 1S5TA 1JPIA 3KLKA 1FWFC 3STGA 3AO0A 3P74A 5GQBA 3UW6A 3OVGA 5TBOA 3IIOA 1IXOA 2X0YA 1Q6RA 3OZPA 6XIAA 3NQGA 3MA8A 2CCRA 4P7RA 1NAL1 1S2CA 4HNCA 4PB3A 4TVCA 1GYMA 3KL3A 2Y1HA 1UUQA 4S3FA 3VIMA 2WMIA 3N3MA 1N8WA 5HMDA 2X16A 1DWGM 3LI0A 3N2XA 1QMLA 3BE7A 3VM7A 4LY8A 1NELA 2BG5A 4NJIA 1JCJA 4B3LA 2WM1A 4MNKA 4PFMA 4OT7A 1XLDA 1AW1A 1DL3A 4F2BA 1TTIA 1LORA 3AHZA 2R1KA 4PBGA 1HL2A 4LANA 1NWRA 3H53A 4E2VA 3LPPA 1Q63A 4IGNA 4GBDA 1J4EA 3DFOA 1F3EA 1SMAA 1AJ0A 1EJSC 2YXOA 4PUMA 2J8GA 3FSTA 4OQVA 4LCQA 1XXXA 2YR1A 3KBVA 3LENA 3N2MA 2DSVA 4HYVA 1GVYA 2F61A 5D02A 1HVXA 3FW6A 1WDQA 4C6PA 1OX4A 2OGYA 3FYOA 3TN5A 5U7SA 4KIRA 1DV7A 4LSBA 2H8XA 2DZVA 3QMSA 1LWIA 2PU1A 3G1XA 3MY9A 5C2CA 4W8BA 1B0IA 3L0NA 2VX4A 3BMVA 5CC6A 3GTFA 4Z2HA 3CWNA 4A3YA 2VWTA 2QUVA 2V8ZA 3AC0A 4W87A 1PIGA 2J7HA 4C6OA 1MUCA 2XVNA 1E0VA 5T8GA 2WZHA 3EMCA 4DO5A 1GORA 4J3UA 1LT7A 2QJJA 2TMDA 5A8GA 3WQPA 3VIOA 2GOKA 4O0ZA 5C9WA 5BXPA 3RXZA 3MUIA 1OX5A 1E1CB 3OA3A 1V79A 1O66A 2CHNA 1TR9A 1HIZA 5BXRA 3WNKA 2H3BA 2V82A 4L9ZA 1KTNA 5F4WA 3O0KA 2DT0A 1R6WA 2J9ZA 3EDEA 1PKMA 1DTUA 4QCFA 2W5FA 3UETA 4KETA 5LGXA 1VFOA 4A22A 1UKTA 1X8CA 1GOXA 2WSPA 1E9YB 2QUTA 3TJLA 1TIMA 4H2HA 5G2IA 1EDTA 4J5NA 3I7RA 4HNUA 4DJEC 3EX3A 3S0CA 3AZRA 1ODZA 2OYMA 4RW3A 3W7PA 1GCYA 3CAWA 3U2CA 1EL3A 3HG2A 5DMLA 4B5XA 1J5TA 1EP3A 2HE8A 1A49A 3ZJ6A 2OEJA 3KRZA 3NQDA 1XSJA 3C0QA 4ORIA 4GXMA 2CZDA 3MSRA 3SY1A 2CWNA 4HHHA 4GNKB 1DP0A 3QOMA 3ARZA 1TVPA 2ZCGA 3GVQA 3IVUA 1F2JA 7TAAA 5T9CE 4S3GA 3N04A 5B7YA 5G4EA 1R3WA 4LOCA 4PMRA 2FYMA 3ITYA 5D37A 4GJIA 4A6GA 5DRCA 5C55A 3QKEA 4KBXA 1A5OC 1LP6A 3WLIA 3FEQA 2WANA 3VGDA 3DAQA 1ONXA 4UNIA 4IG2B 3VXGA 4HNOA 1QNPA 5FESA 3UG4A 5C71A 4XZBA 1OG6A 2BWGA 3AMGA 4ZZ9A 1P6CA 1V7AA 3TCEA 3OQEA 4UQ9A 1E71M 4YTRA 3UZWA 4JQ4A 4YN5A 4S3BA 3UERA 4JCMA 2X8RA 3ISIX 1IE7C 3APYA 1T8XA 5CZJA 4LVAA 3G1VA 2G41A 5A2AA 1DORA 1UUMA 1YTKA 2GGEA 3TR9A 4GMEA 1A5BA 3ZO9A 4CNPA 5LIWX 2INFA 1W9UA 2JEQA 4JEJA 4XK2A 3AHXA 3TQVA 4C7FA 3RPTA 3TQKA 7PTDA 2YCIX 1CBGA 2E7FA 2DW6A 1E6PA 4ONVA 4XWUA 3OZYA 4ZO9A 1F76A 3TYAA 2ZZ4A 2J62A 4FXSA 3JS3A 2VP8A 2VX6A 6REQA 3ARUA 2YBTA 1W91A 1UH3A 2Q09A 4GG9A 2VURA 4PE8A 3CHCA 2NSOA 1V8EA 2IPGA 4W86A 1M7PA 3A13A 1WXYA 4LYQA 3PF3A 3WLOA 1UR1A 3AXHA 1MWOA 1GVEA 1CB7B 2DZSA 3VNJA 8XIMA 1OM0A 1KM0A 4S23A 1AH3A 1KRMA 1LDCA 5XIAA 3BXWA 1F05A 3EXSA 4HOWA 1VAHA 3V1PA 4Q4PA 3WL1A 1OF8A 4M5PA 3WQGA 4F8XA 2D73A 1RK5A 4GYFA 5HA7A 2Q8ZA 5FOOA 1HNYA 1VCFA 1XG3A 4K1GA 3LTYA 2ZRZA 1MEWA 4EIVA 2VQTA 4K39A 4UMBA 2OZTA 4KFNA 3PPGA 2DSUA 3W7EA 2QCDB 2PDHA 1TIWA 5HMFA 3KCJA 3W82A 2QV4A 1UR0A 4X60A 5AY7A 4XAYA 4XQ6A 3TV8A 2VTFA 3LZ3A 1VFUA 2QJNA 4CUCA 2P8BA 3CB8A 3O16A 5LIYX 1VB9A 4HTBA 1UWSA 1XDJA 2QCFA 5HPOA 3HPSA 4XBKA 3IRDA 2EG8A 4PB4A 1S1PA 4KWSA 3P84A 1ZHAA 2A7NA 1E3ZA 4R9XA 2BVDA 4XZLX 3XINA 3B8WA 3WDIA 3M0JA 3WFAA 1CYGA 2X05A 1E43A 4IICA 2MNRA 4FNUA 4FIRA 3XIMA 2JKAA 4Z0SA 3RRXA 1F4AA 4BR1A 3C8NA 1G7UA 1ZP3A 4O50A 3KTXA 1JZ7A 3GDKA 2EG6A 3S83A 3RFAA 1ZPTA 3OVPA 4H7VA 5EMJA 1J8VA 1XGDA 4LUIA 1Q85A 3QTGA 3TSBA 5CJNA 3N3TA 5CSYA 4J27A 1P7TA 3VDHA 4UIOA 1GVIA 1TELA 3D3FA 1Z7AA 4L56A 1XS2A 3KUMA 3WNOA 2ZUNA 4Q8UA 1TPC1 1OFEA 2OSYA 2ZICA 2MUCA 3R11A 1KM5A 3WMSA 2WCSA 1TE1A 2A6NA 3KTCA 4NL1A 3AIBA 2ZXDA 3BAJA 3GZAA 4MUPA 2OKOA 3AIWA 2P76A 3RPDA 1HKMA 4X2PA 4DX3A 1V6VA 3EEZA 1QFEA 1ITXA 3PJXA 3LBOA 1K70A 1HKWA 4FA3A 4G7EA 4Q22A 4C65A 3PP7A 3LHYA 3M64A 3R5EA 4KWOA 1OGSA 3S1XA 2ZUTA 2G3NA 3WELA 3VCRA 3WQEA 1HJUA 1XH0A 1X7FA 3OYZA 4WEVX 4JGDA 2HJPA 1QPKA 3REQB 2FZNA 3UXKA 4DJDD 3RLUA 2R14A 3LK6A 1OZMA 3QGKC 3IJLA 1IWAA 5HK4A 1KWGA 4X2RA 2E6YA 5F2GA 4H1ZA 4RNHA 4POCA 1E6QM 4H6EA 1B2YA 2I1OA 3F4DA 3O6DA 3NIYA 1A0CA 4PCFA 3BO9A 2VVSA 3CXOA 1HUVA 2AMGA 3SUTA 5C9RA 4W84A 1QWKA 2BVYA 4EOUA 1DOSA 3T9PA 4G5DA 1K02A 4ATWA 3M1ZA 3CT7A 2ATMA 4OKDA 2RGLA 3KBNA 2PMQA 1P0EA 1UD8A 2I17A 4AB4A 3R13A 3DFTA 6TAAA 3A6OA 1LT8A 3QQWA 1OG0A 2PUZA 3OHMB 3HGSA 4RCXA 1H61A 3VNIA 1W8SA 2E3ZA 3TFXA 5F4XA 3UG3A 5M1TA 4DNMA 3TOPA 3OGRA 3NZPA 1C3FA 4EP8C 1MZRA 2QHAA 3Q37A 3VPLA 2V2DA 3H2OA 3IK2A 3QR1A 4I3GA 1XSIA 1C91A 4QDPA 1EJWC 3QZAA 1TREA 2FKPA 4NYYA 3RNDA 2WHJA 1UHVA 4O4VA 4LS2A 3MV01 3POHA 1HP4A 3K5XA 3HQPA 1B1YA 4GLEA 2VO5A 4RZ4A 1EHAA 1CENA 4N6EA 4LEQA 1MZHA 1BQCA 3S9IA 5HJLA 3A4WA 3V5CA 3HURA 1TPUA 2Z29A 5TIMA 3MMTA 1M7JA 3T08A 4ZXLA 4J3WA 2OZ8A 2DW7A 4LUJA 4D9PA 4GH1A 2XSAA 1JXJA 2EPMX 4U2ZA 3WLPA 5HAOA 2J7GA 3N18A 1T7LA 4A8IA 1LM1A 2C0AA 2EKGA 3SRFA 4KQNA 2DVUA 2NXGA 4UMAA 2IPJA 2Y7GA 4Q8PA 3FKRA 1RBAA 2XINA 4KGLA 1Q6DA 2HBVA 2QT3A 4MNLA 2NUXA 1F5ZA 3SQSA 3QOKA 3TK7A 4AWTA 4F79A 3FSUA 5HNNA 4E4PA 4XIMA 2ZRVA 3PBVA 3MWCA 1CLKA 3GLCA 4QEEA 3M0YA 2PDKA 1ZENA 1EUNA 4F4RA 5D05A 3OJGA 3BMWA 3GTNA 4LC8A 2PEVA 4H04A 7REQA 2WC3A 1EP1A 3VM5A 1JPKA 1EJXC 5CPNA 5EU9A 3ZMRA 3GHUA 1WAUA 2IXVA 2HWGA 2WJDA 1KQZA 2J8FA 3VOGA 1U5JA 3HU7A 2PDFA 5CKSA 3QZEA 2D69A 2QMKA 3BCDA 1RY0A 4XD3A 3P6LA 1J2WA 3HJEA 3QTPA 5XIMA 1PTAA 3G5EA 3MYOA 1R3QA 4KERA 1K6WA 1B3YA 3B9DA 1O1HA 2E67A 3HF3A 2VCAA 3FJLA 4YTTA 3CUIA 5ENLA 2YBUA 3W1TA 4YVPA 4ZCWA 5ABEA 5D2VA 2OGJA 4PMVA 5I23A 1W1IE 2Y7FA 3EGJA 2TPSA 2ATSA 1OFQA 5AVHA 4N7QA 4B5UA 3RU6A 4WJXA 1DQWA 4AH7A 4UTLA 3MV11 3BG3A 4GYPC 4JN8A 2BS9A 1W8GA 1O7AA 2VXNA 3OEXA 1V0LA 4P61A 4QAWA 3PBYA 1ZBWA 2CXEA 4LUSB 4Z2GA 4K6AA 4G9PA 1V3LA 1OT2A 2V5KA 1I8JA 2GDUA 4F3HA 1EBGA 1G69A 1JQVA 1TVNA 3AWNA 4TX6A 2XIBA 3H4WA 3BL3A 2YL9A 3LBCA 3GFXA 4UR8A 3E02A 1RD5A 3EA1A 1HX0A 2X0HA 3CTLA 3MB9A 3R25A 4EWND 2E1WA 4QSFA 5JUVA 4TVUA 1TJ0A 3EXRA 4LXFA 1PO9A 2OLHA 3M0ZA 1KM6A 1W9BM 4X22A 1A0DA 2YYUA 1YX1A 2PP0A 1PX3A 4E3VA 4B4HA 2A3HA 2ASHA 3BW4A 2Z28A 4L1GA 6ENLA 3ELFA 3I3BA 3WK0A 4I7UA 1YXYA 3CL6A 2V2HA 3YPIA 1VC4A 2QDDA 1B4KA 3OZOA 3O6AA 4AC7C 3FVDA 3LMZA 4IL0A 1W9XA 3W6YA 5AHFA 4R7JA 4C6DA 3CIXA 4LS0A 2VD9A 3O1NA 4MFDA 4HCLA 2C6QA 4QJ4B 1UWAA 2WZIA 3MBFA 1A5KC 2QQ6A 2XVKA 2HROA 3V5FA 2J25A 3GDTA 3SUUA 2QVNA 4D6IA 2ABAA 3L65A 3OODA 1OY0A 5K3VA 3DOPA 3P8JA 4LAKA 1LQ0A 2PWVA 3IIXA 2CWXA 1NFPA 2WJFA 2ZE3A 1QHPA 3DZ1A 1M41A 1A0EA 4FR6A 5AVNA 3E1F1 3AROA 4H9TA 2NQ5A 2CKRA 4DBSA 2F7FA 3ARQA 4JZ5A 4C6EA 2Y0FA 1FQ0A 2WMGA 3S5NA 4DLMA 1DWAM 2I5IA 1DJIA 4L64A 3VIGA 4OIFA 3IJIA 2XPKA 4GBUA 2YCKX 1WOBA 1BTCA 2BOFX 3ZVIA 5BOEA 4QNWA 3KM8A 3BQ6A 1RD6A 3KOFA 1GEHA 1QOPA 3MP3A 3S2CA 4PCPA 4LBRA 5CQ1A 1R9XA 2WVUA 1E51A 3N6JA 2PC4A 2C79A 1RSCA 4Q8WA 3EPNA 1J6OA 1R5YA 1G9HA 4DJFA 3MSGA 2H9AA 4CNUA 5MKGB 4B2DD 5ABFB 5I77A 1AUSL 4GCAA 1MDLA 4GUGA 2H8ZA 2PWDA 1F74A 4GIAA 1UROA 1E9LA 3RX2A 1W32A 4D6CA 1LROA 1WA3A 2HRWA 3KS6A 4DELA 2O0TA 1CI1A 1DJZA 4Q8MA 3LERA 5FEPA 1ISWA 1CXKA 4HA4A 1RV8A 3CZEA 4AX6A 4A4AA 3SRKA 1V0MA 2WNWA 3R12A 4EPKA 1XD1A 5LKYA 4N02A 3BJSA 5HNTA 1SZNA 4I6KA 5FEWA 1Z89A 1XBZA 4GWEA 1MRQA 1F6PA 1N2VA 3MJMA 2W9MA 1X7IA 5GVJA 3RK8A 4S2CA 4QG6A 3WD4A 1QK0A 1ODUA 4R5EA 2Z24A 3GNRA 3BAXA 4WXYA 3L23A 3FX4A 3NDOA 3CPGA 4F48A 1EZWA 4JPGA 1QXLA 4GNJA 3UPBA 2XH7A 3VNMA 3LXCA 3FN9A 3NWRA 2Y85A 1TTJA 1NFBA 1ITUA 1Z9AA 5IDZA 4G7FA 4LUTB 1IIHA 3IUDA 1GONA 4ZTYA 3CUHA 4O18A 1XC6A 3G1HA 2OFJA 2RDUA 4QJ3B 4NZJA 3ZQ9A 5AYYA 2J66A 3LPFA 2XVGA 3W25A 1YPXA 2JBMA 2FZBA 4ZQNA 1J5SA 4PMNA 4QR6A 1IYXA 1HJVA 2GSHA 1TPB1 3B03A 4F40A 2DDXA 3P60A 2GVYA 3BAKA 1RY8A 4RDZA 1GVRA 1H1NA 1QCWA 4ZL1A 3SRHA 5LNUA 1EPXA 2VC7A 3DI0A 5FJRA 3W1PA 1VCGA 1OFPA 3LMYA 1ICQA 2ZUUA 5DX7A 1VHNA 1M04A 3WF3A 1S2WA 2FGBA 3UD6A 3VOIA 4E8CA 3OHIA 2XYLA 2AL2A 1DJQA 2RAGA 1FCBA 4GI4A 2NWSA 2HBXA 3KXQA 5FL1A 1FWTA 3LN3A 3MS8A 1I0DA 4DBWA 1XGEA 3SB0A 4OBTA 3HPZA 3WQWA 1ZU8A 1Y0EA 1B9ZA 4F66A 4D6DA 3IJ9A 1XHGA 2W4XA 3W88A 3ARSA 4LX4A 3PSWA 4FZIA 3CLWA 3P93A 3W1UA 1KR1A 1KGUA 2I7GA 4G2DA 2BY0A 4UC5A 4GY0A 2FTYA 4MLJA 1UP3A 5HANA 4DHGA 1J0JA 1JIBA 4XV0A 4PEEA 3IARA 1UPPA 2ZRXA 1C93A 4JHMA 2IS7A 1GOWA 1PIFA 1T6MA 4AF0A 1JAEA 1Q4WA 1DXEA 4XB3A 2J88A 4CN1A 3PPFA 4XISA 2JKPA 1GOOA 2PWUA 4W8LA 1RH9A 3IJQA 3L12A 5BOFA 1YW1A 3M0KA 2P0IA 1U1HA 4M19A 3L4TA 4MIMA 3WFZA 3MP5A 4HMNA 2QJGA 3N9SA 1TTQA 2D23A 1UCWA 4HPXA 2CESA 5DF0A 1I75A 1Q6LA 2HTMA 4FXRA 1CGUA 3E74A 1RBLA 2E25A 3SM0A 3AISA 1PTDA 3QVQA 5IM51 1AH4A 2BGNE 3MCMA 3R8RA 3KZSA 4Z1YA 5KZ6A 3KCOA 5D4YA 3LRLA 3ZT7A 4M8UA 3VO0A 3U8GA 5A6SA 3FOKA 2G95A 1E3XA 4IJBA 1KBKA 3VNYA 1POJA 2Y62A 2VT0A 2Z26A 2VVNA 1HJXA 2DJXA 2QDGA 1WXZA 3I10A 3W2KA 4KWUA 2YCJA 3DECA 3MQTA 4CU6A 4EX4A 4GIRA 1AK5A 4LVDA 3EOOA 4NI3A 3SQLA 3FJNA 1TQXA 3H2FA 4JCLA 3S2JA 2R91A 2J7FA 4DXXA 2TYSA 4JX5A 3PK7A 3MUCA 1W1A1 4FB7A 4QJ1A 4JTIA 1KD0A 8XIAA 1D7FA 3MYPA 4V1YA 5T91A 4YHGA 4RL3A 4U3AA 1K7XA 3IPWA 3I4EA 2QJIA 3MT1A 3RM9A 1QAPA 3V35A 2QR6A 3TH6A 4A35A 2BX7A 1A4LA 2WPBA 2E68A 2W67A 4HCDA 3ANYA 1GZJA 2ACRA 3BLKA 4GVGA 4M7TA 4N4PA 3MHUA 3DHPA 4KIEA 2J9YA 4Q6JA 4S2BA 5MHBA 4RE2A 4ATDA 4KEVA 3GVWA 4G6CA 8CGTA 4PULA 1FH7A 4DXVA 4JHZA 3IJ7A 4AMAA 3ATYA 2BY2A 4ZTXA 2C16A 4GYPA 4MPKA 4FALA 5I2UA 4XTDA 4OHQA 4FOKA 2A6LA 4O1DA 5AHEA 4MWAC 3LRMA 3ENLA 2VOTA 2OYKA 5I03A 2XJ7A 3ZOAA 5BXSA 4HCHA 4CQAA 1G1YA 3LBMA 3H2EA 4GA8A 4Z1AA 3P0XA 3NA8A 3SCUA 1TX2A 1EO5A 3BDKA 3EX2A 3PANA 4ICCX 3DFYA 3OLGA 4PCSA 3O6YX 3C0LA 2OZ0A 3LS9A 3N4AA 2G5WA 2OCZA 4XG1A 4KKXA 3W7CA 1DQXA 5D2WA 4X0VA 2C19A 1XBVA 1XLCA 3SRDA 4DYEA 3NZQA 4WY0A 1Q7QA 1HL8A 4K8EA 2E0PA 2PF8A 1LLWA 1GTHA 1MFVA 3PJTA 3VIFA 3A4AA 5JU6A 1ADSA 1D8WA 3VOJA 3NZRA 4Q33A 3GG0A 2NUWA 2HEJA 3GAKA 5EPDA 1A3HA 2BOGX 1E1FA 3V0TA 2YJQA 4L65A 3SR7A 3M16A 1EOMA 1O12A 4HZ6A 5G1MA 3B0YA 2IKGA 1H49A 3QY7A 3IV3A 3WQFA 1BG9A 3OOQA 3HG3A 2YW4A 4JR5A 5CJMA 5E6ZA 1HTIA 3B8UA 4FO4A 3VOFA 1Q8AA 3BLEA 5E9AA 3CL7A 3MDWA 4GACA 5GJNA 4LC6A 2DUXA 1EP2A 1JRCA 4MJ2A 2ZX8A 5EBAA 3UCQA 3B06A 3FA4A 3W6LA 4I6VA 3H26A 2WBGA 3UXLA 3F5KA 1MO0A 2F38A 2Y70A 2PTYA 1JPHA 3EWCA 1FTXA 3B9OA 4DNHA 1A3XA 1TJ2A 3ZJ7A 1W0MA 5HBFA 1OF6A 3OG2A 4K8HA 4QSHA 3RR4A 2DT2A 2WC7A 1PXGA 3ZIZA 1YQ2A 1US3A 4DB7A 3AS0A 4B9YA 3SN4A 3UNDA 2C7FA 3DX5A 3ARTA 1QATA 4QQUA 3C56A 4GKTA 1F6KA 4C1NB 1UR4A 3PZTA 4JAWA 4MB3A 4O10A 2GQAA 1RQEA 1W5NA 1XIJA 3E0FA 1GVOA 1FWGC 4PMUA 1G5AA 3HN3A 1TA3B 2DIEA 3RHGA 3VC5A 3R89A 4XBJA 1S3TC 1JPDX 4HSNA 5EB8A 4EACA 4PEKA 1TZ9A 4UQDA 2B4GA 4B15A 1JGIA 2PB1A 1MUMA 3GVRA 1I6NA 4ZOEA 2TODA 4RKAA 1HJQA 1SFSA 2ACUA 1J93A 1CNVA 4C6LA 1B3VA 2O9RA 4AZGA 2FPVA 4GE8A 4WY0F 2VX7A 4E2DA 2HPMA 2X1RA 1I9CB 1W5QA 3QY6A 4H9XA 4AY1A 3S42A 1ZY9A 3MTWA 3ES7A 1UZ4A 3W7RA 2Y88A 5A95A 3EMQA 4UTIA 1FOBA 4RR4A 4MKVA 2WCAA 3WQOA 2E8YA 2XU2A 5A6AA 3EKZA 1LCOA 3RO8A 5CPSA 4B5SA 1YTEA 3W9ZA 1M6JA 3GTHA 3DERA 2C0HA 5H1WA 5I3IA 4HU3A 3MMWA 4IWWA 4KGJA 3F5LA 4O13A 4BHYA 2GGIA 5A2BA 3I4KA 4MWAB 3VX0A 4ALDA 3CEUA 2PP1A 3KE0A 4B9ZA 3A9IA 3NSXA 3UJEA 2WAGA 3MVTA 1OX6A 1AL7A 3KL5A 3NGJA 2BHZA 4GIEA 5CLTA 1V08A 4KW2A 3S6TA 2TSYA 3LHTA 3PWIA 2V3EA 1YXDA 4PTMA 1W56A 4IP5A 3RLGA 2CYGA 3MCNA 3NQCA 3OBKA 3ABXA 4GUFA 1DWFM 3KOZA 4NG3A 3EPMA 3L7RA 1FKXA 3PG9A 3H54A 1M5WA 2UY3A 3V4BA 1C8QA 4I7VA 4OZOA 4NAFA 3QBUA 3CYJA 1YE4A 4V27A 3BCFA 1UWUA 3CO8A 3A22A 4XVEA 3IK4A 1UWQA 3UR7A 4DZHA 1JEZA 2NLYA 2DT3A 4N9BA 1JULA 3NXFA 5C9UA 5AZ0A 4J3VA 1NWTA 4MY9A 1XCFA 3MO4A 1R30A 1A5NC 1OABA 1CX9A 2OWWA 3W84A 4G8TA 1JRBA 4NZCA 1ZCCA 2V81A 3WJWA 1EYWA 2CXGA 1UYQA 4DXKA 1XIFA 4IPJA 1X6NA 2HDJA 2EQDA 4OOZA 2A4AA 6XIMA 3ZFHA 4U5IA 3IIZA 4C5ZA 1GQIA 4UNLA 3BSGA 3UG5A 1PYFA 1JD7A 1KNWA 4JTHA 3F4VA 4LCRA 1ZTVA 3P7YA 1UJPA 2V68A 1KCXA 2WV8A 4J4KA 3L4ZA 4L4PA 4EK7A 5G4WA 4PUJA 2D0FA 3UNTA 5M17A 2YXXA 4L6DA 3U5UA 1XUUA 2WBKA 4WDTA 2VUYA 3VYLA 4WSKA 2X1UA 3NGFA 3WSUA 2VFIA 2IUZA 2RJGA 3GHTA 3GR4A 4DAIA 1ADDA 1EGVA 2QCDA 2IQTA 3GHSA 2YCLB 4CEXC 3E0LA 5DANA 1FFQA 3VILA 3KEHA 5DCBA 4GXWA 2Z7GA 3IIPA 3NQ6A 4WRHA 4HHPA 1H7XA 3OZMA 3W27A 1W1PA 4XVDA 3L2LA 3A3XA 3UYCA 4R7WA 3ARYA 3LV5A 2HNEA 1E56A 2CFFA 1V6YA 2YA2A 2VC9A 4E0CA 1WKDA 1VFHA 3UWWA 2CBVA 4LT9A 3GS6A 4HK6A 9CGTA 4IMFA 4HN4A 1EGMA 1HKJA 2PDBA 3QH2A 2DU2A 2NQHA 3FDKA 2CLMA 2FZDA 1QI3A 3BGJA 2FTPA 3P81A 2FHCA 3Q2DA 3QPYA 1Q6FA 2V3GA 2ZOXA 3CHEA 4DIAA 4DQWA 4DYJA 3VE7A 5C0QA 3F7JA 3HOJA 3BH4A 2GK1B 3N11A 3W71A 4B92A 4XX6A 5A6JA 2OEMA 1G4TA 1PPIA 1TRDA 2OR2A 2OLSA 1E6SM 4FEZA 1JYWA 3AALA 4PGLA 5TQLA 1OYAA 4NRRA 3UWVA 4RW5A 4H6QA 3GC4A 5DMYA 1I2PA 3PPHA 4IMDA 2NV1A 3H8AA 3WLMA 3WX7A 4Y9PA 4I9JA 4ROQA 4DWSD 4PUKA 2QPUA 3N2OA 2I5QA 2ZX5A 3GXMA 2YSWA 2DH3A 1PHQA 3RX3A 3OA5A 1OGBA 3T8QA 3PTDA 2CNCA 3D46A 4GX9A 1H60A 4GYJA 2HISA 3AYVA 1DIKA 4IHCA 2POTA 4Q4OA 5CSRA 1H51A 1ZAIA 4JBRA 3SFKA 2V5DA 4AVOA 1UZHA 1XYLA 2W61A 4GUJA 3RLVA 4IM4A 4B4FA 1H41A 5DCDA 5K9DA 3EKGA 3IAPA 2RDWA 2IW0A 4HTYA 4MAVA 4WDXA 4Y96A 3SCRA 3UGRA 2JF7A 3W7JA 4OBRA 1PIIA 2PP3A 3W81A 4GK8A 5CGTA 1OJXA 3RITA 3B0UX 1D8CA 3VNKA 4HOZA 1U5HA 1RQBA 1XR2A 2VRJA 4A8NA 3RO6A 3ATZA 5CZTA 3AXXA 4G1NA 3T0CA 3H6OA 2PS2A 1Z69A 3CO4A 4OU1A 4DBEA 1ECQA 3VGHA 2HVNA 4Z2KA 1XC4A 4M6VA 2W3ZA 3M0XA 1OCBA 2A3LA 2F2HA 1M65A 3ITLA 2W27A 2QGHA 4D1JA 3VKDA 4JIRA 4GOAA 1RQHA 3QGAC 2R24A 4PYSA 1Z6KA 2Q8LA 2A3AA 1O4UA 1JCMP 3UPWA 2FTWA 4L1WA 5BXTA 4KRTA 3OLIA 2D0GA 4WHBA 5FSDC 1A50A 4LBSA 5JIPA 3WK1A 4AWUA 1VJIA 2P5NA 1X1ZA 1K4GA 1S39A 1GPWA 5HMSA 4DZ5A 5FKYA 2WOQA 1EDQA 4AVFA 2PLJA 4HA3A 5LHEA 4O8AA 5D8ZA 3BSHA 1ZQ5A 4LY4A 5JH1A 2QJMA 1J18A 4WDWA 2A7PA 4GZIA 3WDQA 2NT0A 3IJ6A 1WDSA 3RCYA 1UWTA 5C7HA 6ALDA 2GWNA 5CPLA 4Y9MA 2WZMA