5LNRA

Crystal structure of arabidopsis thaliana pdx1-plp complex
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
b'SPFSVKVGLAQMLRGGVIMDVVNAEQARIAEEAGACAVMALERVPADIRAQGGVARMSDPQMIKEIKQAVTIPVMAKARIGHFVEAQILEAIGIDYIDESEVLTLADEDHHINKHNFRIPFVCGCRNLGEALRRIREGAAMIRTKGEAGTGNIIEAVRHVRSVNGDIRVLRNMDDDEVFTFAKKLAAPYDLVMQTKQLGRLPVVQFAAGGVATPADAALMMQLGCDGVFVGSGIFKSGDPARRARAIVQAVTHYSDPEMLVEVSCGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyridoxal 5'-phosphate synthase subunit PDX1.3
publication title Lysine relay mechanism coordinates intermediate transfer in vitamin B6 biosynthesis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 99
structure length 267
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.6: Pyridoxal 5'-phosphate synthase (glutamine hydrolyzing).
pdb deposition date 2016-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01680 SOR_SNZ SOR/SNZ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5lnrA00
4FNPA 4XTDA 1MEHA 4MFDA 4LRSA 3RU6A 5G1YA 4MYXA 1QPRA 4UTTC 2J9YA 3W88A 2FPVA 4FX8A 5FF0A 5AYXA 3E96A 4LS1A 5F2MA 3W7JA 3NO5A 2FLIA 3LB0A 3MP5A 2E5BA 4UC5A 1RQEA 3LDVA 3S5OA 1CI1A 2ABAA 1EWDA 2YW4A 1NAL1 4JX4A 2CLOA 3WK1A 1LTDA 1QR7A 3S0CA 4R34A 3W1PA 4I7WA 3U6WA 4PODA 1JCMP 2F7FA 1HO4A 3NQDA 5KZDA 3L0GA 3GK0A 4JIQA 4FX7A 4GUHA 1KM2A 2H6RA 3DFOA 1EB3A 4AHOA 1PS9A 1DORA 1VH7A 5HR7A 3MWAA 3TV8A 1JJKA 3MHGA 1G6CA 3TJLA 1K8ZA 4I9AA 3P8IA 2R91A 4NJIA 2NLIA 1LRTA 2FB3A 4JDBA 3UWQA 3ABSA 3GXNA 1H63A 3W7HA 3HGOA 3PM6A 4W9TA 4WY0A 3TROA 2ISWA 1L6YA 3L0KA 3UXDA 4AVFA 2DP3A 3LXAA 3GR8A 4O10A 3W7RA 2RDWA 3PAJA 4PH6A 1Q45A 3QPYA 1GVQA 5IBXA 2TRSA 2R14A 3MI2A 3O8AA 3LHVA 3G1SA 3S42A 2GUUA 5CSSA 1XBXA 4XKYB 1G7UA 2VFIA 5CSRA 3NDOA 1U83A 2VENA 4HNNA 4G1KA 5AHMA 3MI3A 1KFCA 2C19A 3N2XA 4TIMA 3SGZA 5FESA 3HOJA 3LTSA 4O16A 3LHTA 4K36A 2G97A 1FUYA 4AWUA 5DY2A 3MMTA 4DQWA 4RKAA 5U4NA 4R7JA 4XQ6A 5AYZA 1FDJA 1X1ZA 1DJQA 4FX6M 1THFD 1XM3A 1J2WA 2VXNA 1TTJA 3V1PA 3W2LA 5LKYA 4HNUA 3LI0A 5LGZA 4O15A 3AO0A 4I7UA 4XUGA 4BI6A 3M43A 4RV8A 2QUUA 3PBWA 3TE9A 5L6UA 4BI5A 4O1DA 3QPZA 2O7SA 1I2QA 3LM7A 3EXTA 2Y85A 3SY5A 1MXSA 1A5SA 1DL3A 4NNBA 1KW1A 5BW6A 3U2OA 3NQ8A 3ABRA 5HWNA 3UWVA 4RXFA 2V8ZA 1PHWA 5H2ZA 2NV1A 4UUIA 8TIMA 1FXPA 3TIMA 3NOEA 3IEBA 3CEPA 3L68A 1OF8A 1VCVA 4CCEA 4Q4KA 3M41A 1R2TA 2WJZA 1DQXA 4UCGA 3INPA 1JR1A 1IIHA 5FF7A 5AC7A 3I7SA 4O54A 4O18A 1KBIA 1E51A 4DXVA 3TJXA 4JEQA 1WQ5A 5F1UA 4CNOA 3SFKA 3E9AA 2ZRXA 1EA0A 1T96A 2ZCGA 2ZQ0A 3G0XA 4OHQA 3LERA 4O0ZA 4Y8FA 3W22A 4QJ1A 2Q3OA 5DBUA 2QCGA 4CQAA 3M0ZA 4ORMA 3W70A 2DZXA 3GNDA 4TU1A 3W7DA 4RK8A 4GBUA 1H7XA 1HFBA 3BGJA 1VQTA 4O53A 1F5ZA 4JYDA 4B5NA 4L4MA 1LLWA 1SFJA 3G1HA 3FEMA 3W1RA 4Y6GA 3QC3A 4DPQA 1ZENA 2YW3A 4JYEA 4ML9A 1ONRA 1JCJA 4U4MA 3AJXA 5CGQA 1AW2A 4QQ3A 2E1DA 1PCKA 2WV8A 2HMCA 3HG4A 4O50A 4JY8A 1W54A 5KSWA 3RF9A 1TREA 4Z0SA 2J6XA 1MEWA 1OFDA 2B7OA 1VHNA 4HKPA 3M6YA 1EEPA 2I1OA 2ZRWA 3WJWA 3NL3A 3C2EA 4JTFA 2AQWA 1YXCA 3PUOA 3TFXA 3N9RA 3A5FA 3VFLA 4NJJA 3BW2A 3TQ0A 3W7PA 1H60A 1EP3A 5CZTA 4UIOA 1ZFJA 4UR8A 2OZ0A 4ALDA 3C61A 1P4CA 1WDWA 2YZRA 2Z2UA 3KX6A 4JTLA 1DJNA 4D2JA 4UR7A 1O5KA 3EWBX 1GQNA 1H1ZA 3K30A 3W2JA 3CQ0A 2H8XA 3GDLA 5AHNA 1YPFA 2GQAA 3E49A 1SQ7A 1ZALA 1OHLA 1OFAA 3I7RA 4Z1CA 1OYAA 4Y96A 1LROA 4HNTA 3GB6A 3L2IA 3MBFA 1RVGA 2ZFAA 3KOFA 1W0MA 4UMAA 3P7YA 3DAQA 2X1RA 3A23A 1OX4A 4TX9A 3NL6A 1Z44A 3DFNA 1KFLA 1UJPA 4JYFA 3C2RA 1ZAJA 5D2VA 3OBKA 1I45A 3DHDA 3QSRA 4O13A 1RV8A 1ME9A 3I7QA 4NXSA 5G4WA 5C6MA 2BTMA 4NJKA 3GAKA 2ZZ1A 1VC4A 3LCLA 4O1BA 3GVGA 4LWWA 1A53A 5AHLA 3IVTA 3FLUA 5LGXA 2V0TA 4K7VA 4EIVA 3HO8A 3S1XA 1I2OA 2BZNA 3C2VA 5FF2A 3RFAA 3KVKA 1G7VA 2V9DA 3R89A 1AL8A 5FF4A 4LVDA 4Z1DA 1KFJA 4UMCA 2VKZG 5I3IA 2YFOA 4WJEA 5DXXA 4UTIA 3IIZA 4JIPA 3PG8A 2WO5A 3WJZA 4DBEA 1OX6A 1K8YA 4HHPA 3W1TA 2H3DA 2RDUA 3W72A 3E12A 3QMTA 5BMWA 1WBHA 5HR6A 3UWYA 3NQ2A 4IXXA 1A5BA 2Y7DA 1JUEA 3ZS4A 5LNRA 1TPEA 2TSYA 4N6FA 5D33A 1B4EA 1SZFA 2EAWA 4XBSA 2C15A 3W1AA 3W7MA 3NZ1A 3YPIA 3W84A 3KVLA 1TRIA 2FTPA 5H91A 3P60A 4E38A 2B7QA 2Y7EA 4ORIA 4BWLA 1M7OA 5KZMA 3LHWA 2QCEA 5C2XA 4OGZA 3CHVA 1FXQA 4ZQNA 4FXSA 1EP1A 4N6EA 3B05A 4IMGA 4ZQCA 4YLWA 4O4WA 3P67A 5LNWA 4AXKA 3UY7A 4LOCA 3STEA 2XFWA 1TV7A 3P5ZA 5KITA 1H7OA 5FEXA 3H55A 3ATZA 1O95A 3PB2A 1TPUA 3SI9A 1UCWA 1EIXA 2P1FA 3BLIA 3DI0A 3RMJA 1BKSA 5D05A 1TIMA 1LBLA 1SW0A 4M6VA 1ALDA 3EWZA 2HS6A 2C6QA 4LRTA 5DY3A 1WX0A 1M5WA 3G1AA 3DKJA 1B9BA 1F74A 5G4EA 2G96A 2X30A 3MUXA 3NVTA 1OVDA 2H3BA 6TIMA 1KA9F 1TQJA 3O15A 4LNYA 4FB7A 2PE4A 1R30A 2A0NA 3LV6A 1I4NA 1YPIA 2TYSA 3LHUA 2QCDA 2E5DA 1YADA 2OT0A 4WXZA 2VFFA 1C29A 3SSJA 4TO8A 4K7YA 1NVMA 4M19A 1VGAA 5CPMA 3NPWA 3TA6A 3W7LA 1OFQA 4MZYA 4E2DA 2OCZA 3I6RA 3TSMA 4AF0A 4DF2A 4UTWA 3SECA 2OX1A 1B57A 4ZMGA 3TQKA 3DENA 3GR7A 3S5NA 2JGQA 3ABOA 3NGJA 1P5BA 4JGDA 5K7JA 5AC8A 3IVUA 2C13A 1X6UA 3BO9A 1CW2A 1W3IA 2A6NA 2DJLA 1Q3NA 4ZQPA 3M7WA 4RR4A 3M5YA 1MO0A 3N14A 2WNQA 2XN0A 1JULA 4UTJA 1R46A 1Z41A 2YSWA 3DH7A 1TV5A 2Y7GA 4WY0B 3UD6A 3PUEA 5TIMA 1ML1A 2VEPA 4JTJA 1B3OA 3W1UA 3A5VA 4YCPA 4K8HA 1SW3A 2OJPA 2C3ZA 3IVSA 1JUKA 3BLFA 3EKLA 3LRLA 3IRDA 5LHFA 3SGUA 1GOXA 1NFBA 1ZCOA 1TPB1 1JRBA 3C56A 3DGRA 1LDCA 3EEGA 3P74A 7TIMA 3NR0A 1EPXA 1XBZA 3ZWTA 3FS2A 1IGSA 3L67A 4QIUA 3G22A 2QR6A 1QDSA 3W75A 4DF1A 1M6JA 5G1TA 2YYUA 3L21A 4A2RA 1F6PA 1GT8A 4O14A 1X1OA 4IPIA 1LP6A 1W5QA 3G0SA 1T8XA 1HUVA 2EHHA 1KFKA 4P61A 3G0UA 1OFPA 1F76A 3PSVA 2YDAA 2BWGA 5I3FA 3CLMA 4GUJA 3P8JA 5DCDA 4NX5A 5DN1A 3HPZA 5AHFA 1TJPA 3PF3A 1T99A 2J9XA 3P62A 3SZ8A 5F1VA 2A5HA 3S1UA 1ZNNA 2NXGA 2ZRUA 5K9XA 4AMAA 4PL2A 3PB0A 2QAPA 4IMDA 3W1LA 1XDMA 2ABBA 4KFOA 1PL9A 1K3UA 4N9EA 1GTHA 3S5YA 1XL9A 1F7BA 3HPSA 1SZEA 3F4WA 3DFTA 1TRDA 3HG3A 3KRUA 3MYOA 3BLEA 1X7FA 3NM1A 3L5AA 2ZA1A 3HJZA 3P5YA 1HO1A 3ZR4A 2WNNA 4FNUA 4LTSA 5K9CA 4QISA 3LBMA 4NT0A 5HULA 3W73A 3B8DA 2VFHA 2WKJA 3QW4B 4FIRA 1AW1A 4FNQA 5CKSA 3C6CA 4EWND 3DI1A 3M44A 4OWGA 3TNOA 2FIQA 4OU1A 4NU7A 5F4XA 3OIXA 2W6RA 4PC8A 4HSNA 1H7RA 2JBMA 4RCXA 3LTPA 3PS7A 1SO5A 1GZGA 3PUDA 2ZTJA 2J9ZA 1S5WA 5D03A 4P2VA 1EX5A 1IF2A 3R12A 4PTNA 4HPJA 1GYNA 4WOZA 5LZLA 5FEWA 4ZL1A 1QOPA 3NQMA 2PC4A 1FWRA 3EX4A 3IGXA 4MYAA 2WOQA 4FIQA 2ATMA 3GLCA 3CEUA 5K3VA 2G5WA 2B4GA 4FF7A 1RR2A 3T7VA 4Q32A 3MHFA 3CIXA 2FQIA 3UPBA 1YYAA 2Y89A 4C1KA 2FB2A 3LHYA 1K7FA 3JS3A 2DJXA 4X3ZA 1JVNA 1I2NA 1LLZA 4IMFA 2GVLA 4ZZ9A 2Z1BA 3TR2A 1J5TA 1TPWA 1C8VA 1H51A 3PBUA 3G24A 3FJLA 3CWOX 1I2RA 2BLEA 4R33A 3S5ZA 4LC6A 2ISVA 1H7PA 1A50A 5BMXA 3QQ0A 1G69A 1DV7A 4MFEA 1UB3A 2O7QA 3OVPA 3W86A 1H1YA 3UYCA 1WV2A 4NJGA 4UTLA 2YR1A 4K38A 1A5CA 4IJBA 3TC7A 3LLFA 2Z6JA 1K03A 3PULA 4IMEA 1N8FA 3Q94A 4IQLA 3MJYA 4J9JA 4XBKA 4RZ6A 1H5YA 2JGYA 2V2DA 5I3HA 4LW7A 4OV4A 3TFCA 3G1YA 1G4PA 5K4ZA 3NM3A 1B4KA 2FPTA 4C1LA 2GJNA 5I3KA 2VOMA 5AHEA 1SW7A 3W7GA 4A21A 1VLWA 3UWZA 4I7VA 3S8HA 1I8JA 2NZLA 2Y62A 4S2BA 2HTMA 4GE8A 4FEZA 1IXQA 1TTPA 1QAPA 1EUAA 4PEKA 5KMYA 3SIZA 3QFEA 3KVJA 3BGGA 2VEMA 3LI1A 4XKYA 1EWEA 3V75A 1TJRA 2V2HA 3N19B 3N3MA 5E1QA 1LZOA 1KTCA 5CZSA 1ICQA 3TX9A 3W7KA 1TYGA 2VC6A 2QEZA 1LM1A 1OFEA 4X9SA 3LHZA 3MHUA 2QCHA 5LNSA 2E6DA 2WSYA 1KTBA 4JN6A 2FFCA 1PE1A 4Q33A 4YMZA 1P1XA 2VFEA 3G3MA 4PL1A 3WJYA 1O4UA 4O17A 4LVBA 4N9DA 4E2BA 4NNAA 5D37A 1RZMA 4TR9A 2XN1A 4XTIA 4H4IA 3NL2A 3QF0A 2E6FA 2B7NA 3BK0A 3NA8A 1KM0A 3IIXA 4M7TA 2J24A 1W37A 3B4UA 5AOUA 2DZUA 3MP4A 3W85A 4CCCA 5E0KA 4LVAA 2J88A 5AHIA 2ZZ6A 3TSDA 2FJKA 3BG9A 2CLIA 1AW5A 3LRMA 1X8FA 2ZRYA 3VNDA 3QW3A 3FJ6A 4DEFA 1G67A 3FOKA 2CWNA 3O1NA 3C3NA 4UTMA 4AWTA 4KWWA 3L66A 1F2JA 1NF0A 1QFEA 1BEUA 1P0KA 3NQVA 4N02A 3DFSA 5D02A 1HTIA 2X1SA 3DFPA 4YCOA 3HF3A 3EXSA 3NG3A 3LBCA 3P80A 3UQNA 3W2NA 2NV2A 2H90A 4JTSA 1OFRA 3L5LA 1MEIA 1DVJA 2ZBTA 1SU5A 2QCFA 1Q6RA 5T26A 2OT1A 5DELA 1VR6A 3KHJA 5HINA 3THQA 3BV4A 3ZFHA 1DQWA 3HPXA 3EX1A 3T44A 1RPXA 4ADUA 4NJHA 3O63A 1W5NA 4GRSA 3HQ1A 5TBOA 1IXPA 3QMRA 3FA5A 3NQEA 5EKYA 1TQXA 5G2HA 3T40A 3EWUA 3EX2A 1SR9A 3O6CA 3W9ZA 3QH2A 3A21A 2DZWA 3W2UA 2YCEA 3HGRA 4AWSA 2D73A 5DCEA 1VYSX 5CG7A 4NNCA 1H7NA 1U5JA 5DXYA 4O57A 3WK3A 1G4TA 2ATSA 4O11A 1LORA 1M7PA 5AB3A 1V7YA 4KKXA 1VS1A 1OABA 5D2WA 2YGYA 2V30A 5G2WA 3FFSA 2WSQA 4H3DA 3NEVA 1QCWA 3W07A 2Y88A 1XC4A 1TTIA 3DBPA 3W7OA 4JTTA 4PA8A 3GX9A 2GQ8A 1S5TA 1Q6OA 2A21A 4RLIA 4UFIA 1BWKA 1YDNA 1IXNA 5IBXC 1HG3A 2TPSA 2HSAA 2GPTA 2CZFA 5LHEA 1L9WA 1ICSA 4O28A 2V2CA 4K39A 1K7EA 1KM4A 3PVFA 5MHBA 2A6LA 2G95A 2E6AA 2P0OA 4UFJA 4L4LA 4N4PA 3QM3A 2C14A 4K6AA 1TSIA 5D38A 4WD0A 1YTEA 4IGHA 1VZWA 5C5YA 1L6SA 4POCA 4OBTA 2R94A 3B0UX 3MYPA 4UFKA 3W23A 1DBTA 2ALDA 4JNMA 3VE7A 1GTEA 4UTKA 3W83A 2EKCA 5KTLA 1S5VA 5AN7A 3KVMA 1GWJA 3EWXA 2QJGA 1XUUA 1XI3A 5E93A 4IWWA 1FQ0A 1VRDA 3M5ZA 1ZAHA 3F4NA 1JUBA 1R47A 2C18A 4FNSA 3GYEA 1MSSA 4NZFA 4O8RA 3B0PA 2CZEA 4DO6A 3QRHA 5I3JA 5F2LA 2FDSA 1KM6A 4UFMA 5J5RA 1FDZA 5FI8A 4ADTA 4CLMA 1SPQA 2VFDA 3TCEA 4O19A 3O07A 2QUTA 4GC4A 1N55A 1NSJA 2DZPA 3QMSA 4KFPA 3GKAA 3S9YA 1FWSA 3I65A 3GKFA 3MO7A 4UXDA 3USBA 1ME7A 1KM3A 3G1XA 3LCWA 3R13A 3B03A 4MPQA 3QQ1A 3DZ1A 2F84A 3BARA 4QAIA 5BOOA 4LV9A 3IGSA 2ZYFA 3JRKA 4QITA 5KINA 1QO2A 3W7EA 1VHCA 3BG5A 1OG0A 1W31A 4MZ1A 1XUZA 1QPNA 1PCWA 4DO4A 3FKKA 5HJLA 1FDYA 2AAMA 5FF3A 4DELA 3VKJA 1YDOA 4DBDA 4EF9A 6ALDA 3NZRA 4KWVA 3RLUA 4R53A 1XCFA 4DO5A 2NUXA 2CFFA 4ZQRA 1Y0EA 2A4AA 2BSLA 2Q8ZA 1OYCA 4JD4A 4HPXA 3TC6A 3A24A 1KV5A 1D3HA 4AHQA 4K8EA 2WNZA 3CU2A 2ZDRA 1LRQA 2YFNA 1W5MA 1UASA 3Q58A 4HSOA 3UWUA 1J4EA 4X22A 4LVGA 1GVFA 3IV3A 3PBYA 5CPNA 1DHPA 1TPVA 1GJPA 5D2TA 3P61A 5EPDA 2KZHA 4QSHA 1WYIA 2ZRZA 2X2GA 2QAFA 3DU0A 3T4CA 2RDTA 5LNVA 5SWUA 3STCA 4CQ9A 1OX5A 3EKZA 3TUUA 3L0NA 3OG3A 2GVGA 3NL5A 2WQPA 3T78A 1GPWA 3S1WA 3VCRA 2X1TA 4UFLA 4LU0A 3PSWA 2EGZA 2VELA 3LXCA 3HIJA 3UPWA 3LXBA 2ZZ3A 5EL1A 2I14A 4H6KA 3UXAA 2VEIA 4MZ8A 4WX2A 4A2SA 4YWIA 3NPUA 1D9EA 4FO4A 2BX7A 4BK9A 3L9CA 5HWMA 4OV9A 1AMKA 2CU0A 3G8RA 3KRSA 4UNKA 1RQBA 2X16A 2JKAA 4Z08A 2Q3RA 3TMLA 2E6YA 2RH9A 5KZEA 3LV5A 1K7XA 1EUNA 1SFLA 3EX3A 4IX2A 3HG2A 4AB4A 2ZRVA 4AEOA 1KM5A 3N2MA 4MIMA 1W8SA 2RKXA 3IIVA 4MY1A 3STFA 1PVNA 3B04A 4ONVA 4WUIA 3PR2A 4LVFA 1VCFA 3GDKA 5HWJA 1T0OA 5CZ0A 4LC8A 3RNDA 2Y7FA 4M7SA 2X1UA 4IX0A 3W71A 5GVJA 1L6WA 4A29A 5I3GA 1XKYA 4JXCA 4JTKA 1VJIA 4GJ1A 3CTLA 4JTEA 1QO5A 3KXQA 1AG1O 3M47A 2NUYA 2E5CA 1KTNA 1FWWA 1PIIA 3IIOA 4IPJA 3W74A 3O6DA 4MLRA 5HMSA 1W56A 3BW3A 3NNTA 1QMLA 3PWAA 2CZ5A 3NQGA 4MY9A 1WAUA 2B0MA 5K4XA 3TH6A 1OK6A 3OVQA 3QSTA 5BNKA 5EBUA 3LCIA 5AFDA 2QDHA 5F4SA 1OFBA 1W1ZA 2Y61A 5HUPA 1SO3A 4UNLA 5D32A 4XZ9A 5DLCA 4NX0A 2BXVA 3Q37A 2ZA3A 2GVJA 3NQ7A 2R8WA 4M5PA 3G1FA 1OK4A 1W3NA 4CNPA 4GNJA 3ATYA 2PRLA 3L65A 4LS0A 4Z1BA 3WJSA 1QNVA 2QUVA 4DPPA 1KV8A 5HQEA 2Y6ZA 2QCLA 4K37A 4O0KA 4N4QA 1SO4A 3P82A 3NPXA 1A5AA 4BWLC 2RHGA 1VPXA 5EY5A 3CPRA 3BW4A 1TB3A 3C52A 4GFSA 1RQHA 4S2CA 1CX9A 2ZZ4A 3NQCA 1LOLA 3TXZA 4FHAA 3UZJA 1XBYA 4NQ1A 4FNTA 2PRHA 1Q6QA 2C16A 4JDYA 4O1CA 4GUGA 1VYRA 2V5LA 3EWWA 3NAVA 2I9EA 4MVAA 3PBVA 3O16A 3BVJA 1O60A 3N34A 3VE9A 5DCBA 3N73A 1XFBA 4BF9A 4HT3A 3T55A 1KBJA 1GVSA 1QPOA 1LOQA 1ZAIA 4JR5A 2NXHA 2H8ZA 1F73A 4JS3A 2HS8A 3CT7A 2J27A 3GXTA 3QYQA 2FPYA 5F2IA 4JTHA 3UY8A 2ZZ5A 1K02A 4KFNA 4XWUA 1QWGA 2A85A 1W5PA 3TAKA 1H7WA 3U8GA 2C0AA 4OE7A 3MBDA 4HIBA 3HB9A 3WFAA 5HNRA 1WOBA 4UMBA 3W2MA 4O52A 2JKEA 2YX0A 3GDTA 4NZJA 3LCHA 3W1QA 2QKFA 3EX6A 2GOUA 4DF0A 5IM51 4NVTA 3SR7A 3HBLA 1OX4B 4NXKA 5F2GA 1OYBA 3CIWA 4O4VA 1FWNA 2V82A 5K2ZA 1SO6A 4M6QA 1IXOA 4UTWC 5FEZA 2QDGA 4IXHA 4E0CA 1LBMA 2AGKA 2QF7A 3GNNA 4EVZA 3OVRA 4JY9A 5D09A 4MOZA 3W76A 1XBVA 3HMJG 1TO3A 1DKWA 1LYXA 4EOUA 5EMUA 5D30A 2VEKA 3QEZA 1BTMA 3NXFA 5K9DA 4GWEA 4GXMA 3QJAA 2C1HA 1JCNA 4YL2A 3G18A 1JCXA 1NEYA 4O12A 5C54A 3R5EA 4MUZA 3DFQA 3Q2DA 4TMBA 3UWWA 4UTHA 1ADOA 2YYTA 5A8GA 3STGA 3C4UA 3W1NA 3W7QA 2EF9A 1SZNA 2QCMA 3HG5A 3CB8A 3PC0A 3E02A 3SW6A 1JQVA 3P81A 3OA3A 4NUWA 2DORA 3TU9A 4EF8A 3TSBA 1D3GA 1ZHAA 2ZZ7A 3S6DA 1FWTA 4FXRA 5CZJA 1AL7A 3RLVA 4ZQOA 3TDFA 4BR1A 5LSMA 3C2OA 3PY2A 1PHQA 2QCCA 3W2KA 1JCYA 2WSRA 1KM1A 1YLVA 5D2YA 3R2GA 3F03K 4U28A 4HN4A 2W0UA 3TMQA 3W7NA 2A2IA 3ANYA 3W6YA 4HNVA 4RX0A 1WOAA 3GDRA 1IIGA 3TKFA 3P84A 1FY6A 1OF6A 5D2XA 4AHPA 3GDMA 2PURA 3MI6A 4UTTA 3TXVA 3G8EA 2E68A 2LLEA 1L2UA 3G1DA 4LUJA 3C0JA 3CM4A 1V5XA 1TV8A 3C8FA 3NPVA 2Q8LA 3ABQA 3O6YX 2XN2A 4CCDA 1YXYA 2ZTKA 3M9YA 1GVOA 4GUIA 4JTGA 3O06A 1QOQA 1TPH1 4TMCA 3DHFA 3B06A 1P0NA 4OQVA 4CNNA 2CLHA 3LGEA 3M5VA 1ICPA 4WQ6A 3HGSA 2VFGA 3EB2A 1OFOA 1UUMA 1DOSA 1YTDA 3VI2A 4Y9AA 1GYLA 2CLLA 2NWSA 4JTIA 2A1YA 3HGJA 2B7PA 3FYPA 3LRKA 2A7NA 1TMHA 3R8RA 3S1VA 4RXGA 3THAA 2Y63A 4WZHA 4ADSA 5TQLA 2CLKA 1F05A 2CLFA 2QCDB 1Z42A 2ISSA 2GJLA 3MP3A 2NX9A 1G4EA 2NXIA 2UV8G 1ME8A 3SJ3A 4WXYA 1KLYA 1ZY9A 4BI7A 3M5XA 3W7CA 4LV4A 3LCFA 3M16A 1LCOA 4N2YA 3FYOA 4PCFA 1KFBA 3OEXA 4LS2A 4AF0B 4PFMA 5FEPA 1LBFA 4RZ5A 3F1QA 3NQAA 3C2FA 4IUOA 3GAYA 3DKLA 3BPWA 3JR2A 1S3HA 1KLZA 1O5XA 1I2PA 2QCNA 2NX3A 3EXRA 4JX5A 4MJMA 1C9DA 4QM1A 3L5MA 4QNEA 1KFEA 5J5DA 3W87A 1VLIA 2EPHA 2TMDA 2Z0IA 2PCQA 1GG0A 4WOQA 3W7IA 1LOSA 1R2RA 5A5WA 4O1AA 4QNWA 4WY0F 4Z0JA 5DBTA 3TQVA 2IQTA 1VCGA 3TAOA 3TW6A 1FBAA 1NF7A 1SSDA 3GIYA 2Y70A 2DZVA 3B0VC 3FIGA 3D0CA 1MZHA 4UTUA 4YXGA 1FCBA 3G1VA 4JX6A 3BG3A 3DXIA 1TPFA 2GQ9A 5ABTA 4ZQMA 2E09A 1SUXA 3A22A 2JK2A 3E0IA 4LY8A 2CLMA 1R2SA 3ZWSA 1F6KA 2CZDA 1N7KA 1UBSA 1H62A 3WJXA 3NQ6A 1WA3A 1W3TA 2Z6IA 3CWNA 1W5OA 3H54A 1XDLA 3GXPA 1K8XA 5HUOA 3W1MA 1Q6LA 4GUFA 1OJXA 4RZ4A 3WK2A 2YPIA 1FCQA 1QPQA 3W3OA 4AH7A 3WK0A 5EA9A 4RJEA 1VYPX 1JRCA 2DZTA 3MW7A 4MY8A 3UNDA 3LX9A 4AAJA 2OMAA 3RK8A 4UFHA 4S1FA 2QJHA 1RD5A 1GG1A 2NX1A 1GEQA 2DZSA 3CC1A 3LOTA 5C55A 2V5BA 4JICA 4N9CA 4X2RA 3NQFA 3EWYA 4OT7A 2DU2A 4CQ8A 1H50A 4MJZA 4JTUA 1JQXA 2PRMA 4ZVJA 3A9IA 5F4WA 4BFAA 5L9FA 5LNUA 4A3UA 3KFTA 4IOTA 1YXDA 2A7PA 1FCUA 2NWRA 1O94A 3W1XA 3ELFA 1Z48A 3FKRA 4ICNA 5AC6A 3OHIA 1WBJA 1TPC1 5EYWA 1TCDA 3M1ZA 4M6PA 1PV8A 3O05A 2RFGA 5D04C 1XXXA 4MKNA 3PG9A 1WXJA 3KRZA 5AYYA 3NYZA 5CPLA 2YXGA 1G4SA 3KAOA 3TK7A 3LLDA 2QJIA 1AK5A 1EP2A 3LTYA 3UZ5A 2V81A 5BRBA 1ZJIA 2A7RA 4A22A 4Y90A 3LCXA 2ZZ2A 3N9SA 5G2IA 1HL2A 1UUOA 3I68A 2W79A 2CLEA 4IMCA 3G3DA 3QZEA 3IGUA 4FNRA 1YDVA 1SSGA 1SZGA 3H53A 1TTQA 2CW6A 5CPOA 5U7SA 1YTKA 4MLJA 4LT9A 1LRNA 2ZA2A 1FCVA 2E77A 1JCLA 2JKPA 2WPBA 3TW7A 2NUWA 1GVRA 2P10A 3LCGA 1TPDA 5G5IA 4Z1AA 1BWLA 4LUIA 1FX6A 4N9BA 1H61A 3IIPA 3GZ3A
chains in the Genus database with same CATH superfamily
3MPGA 4FNPA 1MW2A 4G2DA 3Q67A 3RU6A 5G1YA 3A9BA 2J9YA 4R7OA 1K77A 5FF0A 1E6NA 3KW3A 1NARA 3E96A 1S2CA 4AZBA 1EJUC 1B0IA 3MP5A 2E5BA 4QQUA 1LWHA 2YW4A 3WK1A 1QR7A 5B7YA 3S0CA 5LIYX 4GJIA 2PDIA 1JCMP 4PODA 4R9OA 3NQDA 2YB1A 3L0GA 3UPMA 1UC5A 4GUHA 4S3GA 4ZOEA 1CECA 5E09A 3DFOA 1PKNA 2OYMA 1YHTA 4Z2IA 2Z24A 2A3EA 2X8RA 1JJKA 1UKTA 1LRTA 3UWQA 2IKGA 5I78A 1K70A 4TV5A 3PM6A 2ZOXA 2A3BA 1DJIA 3PAJA 4GVFA 1Q45A 1IEVA 3EWCA 3VYLA 1H0GA 4ZXOA 1BYAA 3SUTA 1TMQA 2MNRA 2VENA 3HQPA 3URNA 2DUAA 3SGZA 5CC6A 2EO7A 5I6SA 3HOJA 3M0IA 3M46A 3N2CA 4K36A 1FUYA 5DY2A 4B16A 4R7JA 3ME3A 1Q6FA 1FDJA 1DJQA 3UERA 3CV7A 4JTCA 1J11A 1M41A 3ZQ9A 3PPHA 3BL3A 1TVLA 3V1PA 3T9PA 3G77A 3W00A 4AX7A 1C91A 1YDYA 3W38A 1VENA 4D8ZA 2Z7KA 3CUIA 4BI6A 3BMXA 3PBWA 3OOQA 2J7BA 3TE9A 4E3TA 4HJWA 4L4PA 4H7ZA 1XD0A 3SY5A 3DEQA 3MC5A 4DWDA 4XO7A 4IP7A 4HZ8A 2V3GA 1Z7AA 3AIUA 3ABRA 1WKFA 4RXFA 1V93A 1R9YA 1CGVA 2FYMA 4JCLA 4BQ2A 3IEBA 3L68A 1OF8A 1VCVA 4CCEA 3UP8A 4Q4KA 3M41A 4PTMA 1LL4A 1R2TA 3GUWA 4HMDA 1JR1A 4O54A 3WNNA 4O18A 1E51A 1ISZA 1SJBA 1WQ5A 1U2YA 2WMKA 4CNOA 1W9UA 3CQHA 4KBXA 3SFKA 3E9AA 1EA0A 2ZDSA 2ZCGA 3W82A 4Y8FA 5HJYA 1J18A 1J6OA 2FHBA 1B31A 2Q3OA 4FALA 5JXQA 3T0DA 1EJVC 2WZMA 1KBLA 1Q7ZA 5M1TA 1S3TC 2ZUSA 1OM0A 1CXIA 4HSHA 4IP4A 3BGJA 1VQTA 1HNYA 1J0IA 3FEMA 2AKMA 3NZQA 2PWDA 4Y6GA 1JL8A 4Z2LA 2GDVA 3GHSA 1ZENA 4JYEA 6A3HA 4DXKA 1WKYA 2FKPA 3EPOA 4YTUA 2E1DA 2DFAA 2GSEA 1EHNA 1PCKA 2WV8A 5C2GA 2HMCA 1F3WA 3VM5A 3RF9A 1Z9AA 1ADDA 1KRCC 1OFDA 4HKPA 2GSJA 2XISA 2VX6A 3GZAA 1X6LA 2ZRWA 2QJNA 2YBUA 3JZEA 4F8XA 5IHSA 5MF5A 2AQWA 4GXPA 2HEJA 3WH9A 2I57A 3F2CA 3N9RA 5DMYA 2SFPA 3BW2A 2OOGA 2WAGA 3MUAA 4W93A 1W1YA 4CD5A 3RRXA 1P4CA 2F9RA 2IQ0A 3N25A 3DDMA 1H1NA 3KX6A 4D2JA 3N13A 4TV6A 3EWBX 3SIMA 1UWTA 3K30A 3W2JA 3GDLA 4EXAA 1YPFA 3VVGA 3E49A 1ZALA 1XP3A 1S2TA 1I75A 1OFAA 2OQLA 4Z1CA 1OYAA 4GLEA 2ZVRA 1EF3A 1PJ9A 3R7MA 3MBFA 3LGGA 2ZFAA 1W0MA 4UMAA 2EJ1A 3TTSA 2X1RA 1MWOA 1QVBA 4PTWA 4JYFA 5D2VA 3OBKA 1I45A 2X0YA 1ME9A 3I7QA 2I9UA 4NXSA 2V5KA 2ZZ1A 5LA1A 1E1FA 1NWTA 3LCLA 3VINA 1M1BA 4LWWA 1YMYA 5LGXA 4FXFA 2AMXA 4EIVA 3AAMA 3HO8A 1I2OA 1UWSA 2BZNA 1GOOA 1CGTA 2V9DA 1OC5A 1O5RA 2GGHA 1OGSA 1J2BA 3KL5A 5I3IA 3PJTA 2VGBA 2YL5A 4WJEA 3IIZA 4BS0A 4AD4A 2WO5A 2EG6A 2VRQA 1OX6A 2Z1KA 1K8YA 4IFRA 3WMCA 2H3DA 4HNOA 1OWQA 4ZOBA 4B5TA 1OINA 4M8UA 3OBAA 4JFUA 3BICA 1PTDA 3GFYA 5BMWA 4ZA0A 1AJ2A 2X0HA 4IXXA 2Y7DA 2WMHA 2D24A 2V63A 1SZFA 4XBSA 2WZIA 5A6SA 1TRIA 4FR1A 5A95A 3VOHA 3THUA 3U2CA 3P60A 5M17A 1VFFA 4E38A 3S46A 1CDGA 2XZ7A 3N4FA 1J96A 4W88A 3FK4A 4OGZA 1F4AA 2O9RA 3ITCA 1V6UA 2XH7A 3B05A 3FSUA 3D6NA 3W6MA 1JPIA 1ENUA 4O4WA 3P67A 5LNWA 3UY7A 3H2CA 3D3FA 3HJEA 2VC5A 3EWDA 3W28A 1ITXA 3BAKA 4DM2A 1E6SM 2ISDA 5KITA 5JBFA 3KL0A 4DWSB 4YVXA 3CHEA 3ATZA 3TC3A 1F3EA 1TPUA 3ZJ6A 3BLIA 3DECA 3LGDA 1HGYA 1BKSA 4JIRA 1Q5MA 1IEWA 3LD5A 4M1BA 4C1NA 1PX3A 1SW0A 4W7VA 2C6QA 3BC9A 5DY3A 4S3JA 3DKJA 3WEOA 3VMPA 3A3HA 3MUXA 4H7VA 1E0XA 4FB7A 4C5ZA 3QPEA 4HPNA 3T07A 3HQOA 3LHUA 1JDEA 3UT0A 4LQ1A 1BHGA 1YADA 2OT0A 4WXZA 3S47A 4XZHA 1AQ0A 3QBUA 4C5YA 2WZTA 4MZYA 2OCZA 3TSMA 1WP6A 3SECA 4B2DA 2BOFX 3DENA 4GPNA 4PRRA 3S5NA 2XIBA 5BYWA 3ABOA 3NDZA 1KWKA 1P5BA 2C13A 2DJLA 1NP2A 3M7WA 4B3ZA 2UY4A 4E4FA 3HV8A 3M5YA 1HKIA 3N14A 2PWGA 1P0EA 2XN0A 4A4AA 3OQ8A 3H7UA 3AU6A 4NRRA 4REQB 1J0YA 5XIAA 2YSWA 3NZPA 3VABA 3DH7A 2Y0FA 3MCNA 4RNHA 4D8AA 4WY0B 7TAAA 3LPFA 3GDBA 3IAPA 4G7EA 5DANA 3PUEA 4C90A 1YX1A 5TIMA 1ML1A 2CITA 1B3OA 1EBHA 1JUKA 3LUTA 3IACA 4DUXA 3S2NA 1RP9A 2PZNA 4GZJA 1BSIA 3PBMA 1JRBA 1A5UA 1B5TA 2WLZA 1IEQA 3EEGA 4ECLA 2DH3A 1AD4A 1IGSA 3L67A 4BEUA 4QIUA 3W75A 2VURA 3ABZA 1EYWA 1SZRA 5G1TA 2YYUA 1X1OA 4IPIA 1BXNA 1LP6A 1W5QA 1R6WA 1T8XA 2XVLA 4R5EA 1JYWA 3WMLA 2A3AA 4JKKA 3RILA 2R1KA 3GXDA 4NF7A 1UC4A 1MYRA 2G3JA 5KETA 2X41A 5E0FA 1FKXA 1BF2A 1JXJA 3CLMA 1XIFA 3GIQA 2E8ZA 4NX5A 1QASA 4QRNA 5DN1A 3HPZA 4DUVA 2EJAA 4L1GA 4UQCA 4K8GA 2NQ9A 1XV8A 3PF3A 1T99A 3P62A 3S1UA 3WUEA 2I16A 4MNMA 3O2LA 3VPLA 5K9XA 4AMAA 3L2LA 3H2MA 4JHOA 2QAPA 6ENLA 4OBSA 1XS2A 3THCA 1PL9A 4N9EA 3S5YA 3KUMA 1M7JA 1F7BA 3HPSA 3F4WA 1VP5A 4PMYA 3GNOA 5A69A 5D9MA 1UIOA 3HJZA 3P5YA 1HO1A 3ZR4A 2WNNA 4FNUA 1V7AA 1X38A 5FA5A 4W85A 3OZPA 2Y1HA 4NRSA 2OFJA 4X2PA 1T40A 4HNLA 4U33A 5D9NA 1KCLA 4C6JA 4YWSA 2VC9A 3PUDA 1EDTA 1S5WA 1GVIA 3DFYA 1GOQA 3U5UA 5DX7A 5C71A 1A4MA 5B80A 1JDFA 4ZL1A 3NQMA 1BD0A 4E3VA 4ACYA 4E2OA 3ZT6A 3CEUA 4NZ3A 5FAJA 2UBPC 2HROA 4PUEA 4E8GA 5JUVA 4O0QA 3T7VA 4Q32A 3MHFA 4J40A 3GRIA 2FQIA 3KDNA 2OYKA 2PDLA 1H41A 4C1KA 1K7FA 3GHTA 2WCGA 1PDYA 3WQCA 2DJXA 1ECQA 4X3ZA 1LLZA 2GVLA 4B4HA 1J5TA 3G6LA 2NQHA 4XK2A 3PANA 3L4YA 3G24A 3FJLA 2BLEA 4A6GA 2WBGA 2ISVA 1XC6A 3NXLA 2WHKA 1B30A 1DV7A 3OVPA 2F6XA 3UYCA 4JCMA 1WV2A 4NJGA 1PTAA 4K38A 3JW7A 2PWHA 2DSWA 1BSLA 3TC7A 4WLCA 2BHYA 4IMEA 1N8FA 4J9JA 1CLXA 2JGYA 5ABGA 4GC3A 4LW7A 4S3KA 2DW6A 3UJ2A 5AYIA 1B4KA 4C1LA 2GJNA 4FSAA 4C6OA 1P6WA 3UVAA 1O6IA 4I7VA 1I8JA 2Z00A 4QG8A 4GE8A 2IPJA 4FEZA 1TTPA 2QF8A 5E6ZA 5HBFA 5KMYA 3QFEA 3KVJA 3HFTA 1GYMA 3BGGA 1B54A 4GYPC 3II1A 4N7QA 4BQ4A 3NJ3A 4Q3MA 1CTNA 3VIMA 5E1QA 4IG2B 3VOFA 1ICQA 3W7KA 4LUTB 2VZUA 4DBUA 2VC6A 2PDMA 3LHZA 1B3XA 3R1ZA 3MHUA 3DYPA 2QCHA 4DIAA 3GH7A 4JN6A 5DQPA 1E4NA 1OIMA 1O4UA 4LVBA 5EMMA 4LF2A 1UZ1A 2OSYA 3NL2A 5I79A 1KXTA 3NA8A 2OSWA 2J24A 3W85A 3MP4A 4GI8A 5AHIA 4LBRA 3GTIA 3K46A 1DWIM 4Q8NA 3BG9A 2CLIA 3OIHA 1W9PA 2V6AA 2ZRYA 3QW3A 4DEFA 1G67A 2CWNA 3O1NA 3T2QA 3L7RA 4UTMA 2PDCA 2EPNA 5F7UA 3EMQA 3R94A 1QFEA 1IGWA 1P0KA 3DFSA 3SQSA 1HTIA 2X1SA 2Z27A 4D1IA 4OIFA 4KWUA 3EXSA 3HF3A 4IM4A 3CZJA 3LBCA 3EA2A 4Q4PA 4JKMA 3WD4A 4RE3A 4JTSA 1OFRA 1DVJA 2ZBTA 2QCFA 2NVCA 4HTYA 4WGXA 1A4LA 1XLBA 3BV4A 3ZFHA 1RPXA 4NJHA 5CC7A 3IUIA 3B9DA 3V5OA 1W91A 2GUYA 3Q65A 3H8AA 5CLTA 2NVAA 3OGRA 1MW0A 3CBWA 5G2HA 3SUUA 3EYPA 1CXKA 3EX2A 1SR9A 3W9ZA 1QW9A 3KOXA 3ICJA 3ZR6A 2D73A 5CG7A 3KBWA 3WK3A 3UWEA 4QXIA 1LORA 1M7PA 3MCOA 3WLIA 1V7YA 2PCEA 2V30A 1ISYA 1ITCA 4GY1A 1TTIA 4ENLA 3NUKA 4PA8A 3GX9A 1S5TA 7PTDA 1IXNA 3SDOA 4GNKB 1OGBA 5LHEA 4AZ5A 4O28A 4NL1A 3U4FA 1SFTA 3UCQA 1VEPA 4GI9A 3EKGA 4MUPA 3CASA 3RM8A 1I9CB 1XIHA 2QMKA 2WZEA 1JF6A 2IQDA 1YE4A 2J7FA 3QM3A 3SN1A 4IGHA 2Z26A 3VM7A 1L6SA 1GOIA 4POCA 2X42A 2WKGA 3WLQA 3STPA 3MYPA 4UFKA 3W29A 4QTGA 2ALDA 3VE7A 1GTEA 4C6MA 4C7GA 2PA6A 5KTLA 2PI6A 4W5ZA 2NT0A 4YN5A 3SCUA 1GWJA 2QJGA 3UBPC 1FQ0A 4ZOCA 2OTDA 1R47A 4FNSA 2VRJA 4NZFA 4O8RA 1R5YA 2IPFA 2CZEA 1E70M 1GCYA 5I3JA 5JIPA 1TKKA 4UFMA 4AIUA 5FI8A 4ADTA 1JEZA 2VFDA 2CETA 3BWWA 1UMYA 3B0YA 2CXGA 4YYFA 3FHQA 1PZ0A 2X05A 3ZO9A 3FXGA 1TUFA 2VYOA 4INFA 1DE5A 5HANA 1QW8A 1W9DM 2MANA 3WMSA 3GKFA 5H8UA 2XH2A 4MPQA 1GOWA 2VTFA 3NSXA 4QAIA 5BOOA 2YZ5A 1R7OA 3IGSA 2ZYFA 3RG6A 2ZUNA 2VEGA 3BLKA 3BG5A 1OG0A 3VIKA 6XIMA 1ONWA 1W31A 1XIIA 1QPNA 4R85A 2AL1A 2BFGA 3N1AA 5E6YA 5HJLA 4NZ1A 1FDYA 2AAMA 4RDYA 3C3UA 3DFHA 1JD9A 3VKJA 1YDOA 4KWVA 2QUMA 3SY8A 4IPNB 2WVSA 2DZAA 5HMFA 4JAWA 2ZXBA 2CFFA 1S5MA 3APYA 1ZJAA 2Q8ZA 1OYCA 3NVDA 4JD4A 3RCMA 4HU3A 4AISA 3T0CA 4AHQA 3C8NA 5I24A 3F4CA 2P53A 4QFUA 1J4EA 3IJQA 1JIBA 3PBYA 5CPNA 1Z89A 3I3DA 1RUSA 4QSHA 3DU0A 2RDTA 4P7QA 5LNVA 1S1PA 1OX5A 3EKZA 1MUMA 3HMCA 3L0NA 1JXKA 1AZ2A 2GVGA 2WQPA 2D22A 3OLIA 4LU0A 4YTRA 2EGZA 1EO7A 2GFTA 5EL1A 3P0WA 1G0CA 2I14A 1MRAA 3AWOA 1V6XA 4A2SA 2BVTA 1LQAA 5GJMA 2J7CA 2QV5A 1DHKA 1XJBA 1AMKA 2CU0A 3G8RA 2X16A 3BAJA 4Z08A 3AALA 3LV5A 2WSKA 3EX3A 4IX2A 5FOOA 4AB4A 4AEOA 5H1WA 4EPEC 4PMRA 4PMDA 3N2MA 2XU2A 2P8BA 2WJFA 2VQUA 3WX7A 4XSLA 2NQ5A 2J7EA 1PDZA 3SCVA 1KXQA 4HZ6A 1AQMA 3F4VA 1Q65A 2XZ9A 1FWIC 3VC5A 4O1EA 1OG6A 2ACRA 3RNDA 4IPLA 5E5CA 1W1TA 2R82A 4IX0A 3SM0A 3ARXA 3PNZA 4YPJA 5I3GA 4IMAA 4MMWA 1VJIA 1QO5A 5BWAA 3M47A 3ZXWA 1HKJA 3S2MA 2JEQA 3FYYA 4MNJA 1PIIA 3IIOA 5A2AA 4HB7A 5DMMA 4L7ZA 1W56A 3NNTA 1QMLA 4MY9A 1CBGA 5K4XA 1OK6A 5GQBA 1RA5A 2EBNA 3COTA 1IZKA 2VGIA 2Y8UA 4DJED 4ZE5A 4H8HA 4UNLA 2BVYA 2GYIA 4RL3A 2GJRA 4NX0A 1SGJA 2GVJA 1O1HA 3VAVA 2R8WA 3C0LA 2A3LA 1GHSA 3G1FA 1OK4A 3ATYA 3AXKA 1QNVA 4PSPA 3FVMA 3IRSA 3MZ2A 4O0KA 1EJRC 3P82A 3LS9A 1A5AA 1OCJA 1TZZA 3P93A 1VPXA 3FX4A 3PNUA 2HWGA 2Y5SA 3C52A 4GFSA 4S2CA 2ZZ4A 2EPMX 5FL1A 3RM4A 5PTDA 1XBYA 1UWUA 1Q6QA 2C16A 4JDYA 3AS1A 4GUGA 3NAVA 2V5JA 1RCOB 3K8KA 2OEMA 3WFZA 1XFBA 1HKMA 4UTFA 1IQ8A 1GVSA 1LOQA 2YCLB 4IGMA 2BASA 4DNHA 2H8ZA 3ANVA 3ARTA 1E9YB 4NAEA 3M0KA 4IQDA 4JN7A 1NWUA 1RHCA 4YJ5A 2FPYA 2ZZ5A 4XWUA 1W5PA 7REQB 1U1HA 2WPGA 1K6WA 3BGAA 1J12A 2QVNA 3MU7A 4P8VA 4D1JA 3HB9A 3WFAA 1J0HA 4S23A 4H6QA 1TMLA 2PZ0A 2XIIA 4P8XA 4FS9A 4J3UA 4NXKA 4AFYA 2INEA 4PMUA 3CGTA 4C7DA 1V02A 3OJGA 1TR1A 4DZAA 5K2ZA 1SO6A 4ZOAA 1OQFA 4LFYA 2QDGA 3MKVA 1I1XA 1LBMA 2AGKA 3GW0A 1QNPA 3OVRA 5D09A 3W76A 1XBVA 4X9YA 1LYXA 4F40A 4EOUA 5D30A 2VEKA 4H1ZA 4U2YA 4U3AA 3QEZA 4JNYA 4S3EA 2POTA 2VQTA 5K9DA 4GXMA 5BOEA 3G18A 1WZLA 4XAGA 2OOFA 1XD1A 3H21A 3Q2DA 4LNCA 1VEMA 3PHAA 2OO0A 3UWWA 1ADOA 3G1RA 3ARWA 4R27A 1QATA 3QHMA 3W1NA 3LEPA 1PXGA 3MKKA 4QAWA 1S2AA 3E02A 4W84A 3FJ4A 3W02A 3KM8A 2DORA 2ZWZA 1ZHAA 2VUNA 3S6DA 4FXRA 5CZJA 1QNOA 3RLVA 4BR1A 4NIRA 1E40A 2WSRA 3GC4A 2D3NA 2AAAA 4U28A 5ABFB 3VUPA 2BOGX 3TMQA 2VX4A 3ID7A 3DC8A 1F3XA 2ALRA 4CNUA 4LB4A 2PDXA 1RLDA 5HPCA 4FOKA 1EC7A 1IIGA 3TW9A 2OELA 4DUOA 2DT0A 3R58A 1ISWA 3OLDA 3GG7A 3IJ9A 4JPGA 4OJYA 4V2XA 3FA3A 3VOIA 1UD8A 4LH8A 3W6LA 2DW7A 1KCZA 5FKYA 2GK1A 2ZTKA 3T0TA 1JYNA 4MB5A 4GUIA 1TPH1 3BSMA 5IHRA 4CNNA 2HISA 1ICPA 3WNPA 5CSUA 3RX2A 1MNSA 5LXXA 4IG2A 1X6NA 2CLLA 1XPGA 1VKFA 4HNCA 3TYBA 4JTIA 2OQHA 2PSNA 3PPGA 4E4PA 5C7HA 2C8NA 2A7NA 1VIWA 5MKGB 4RXGA 1LLOA 3FSTA 3BOLA 5CBJA 1FWAC 2G37A 2ISSA 1G4EA 2NXIA 1RD6A 1KLYA 5RUBA 3M5XA 1JDCA 3PJWA 3MSRA 3UEQA 4DZIA 1V03A 4J3TA 1XGDA 4PCFA 1LBFA 4RZ5A 3TA9A 3W27A 1JF5A 2BMBA 3WLOA 1KLZA 1I2PA 2PMQA 4JX5A 4QM1A 1GGOA 3L5MA 4C6KA 1ZJBA 4U5KA 3SCWA 2I5GA 2ESCA 2TMDA 5I03A 5A8OA 3WQ6A 3T08A 1VPQA 4QNWA 4WY0F 2IQTA 1VCGA 3IPWA 4W8AA 6TAAA 2F6KA 3EEZA 1CPUA 3SJNA 3I3BA 2OPJA 2PDGA 3B0VC 3D0CA 1MZHA 4UTUA 2R1LA 2VCAA 3CAKA 3G1VA 4QS5A 4FLSA 4WDXA 1KRMA 1TPFA 4Q8QA 1WDQA 2GQ9A 2V5CA 2J75A 3ITXA 1CWYA 4S3DA 3ZWSA 4PB5A 1N7KA 2BGQA 2VZOA 4J2MA 1H62A 2CESA 1VFTA 3WD3A 3CWNA 3AC0A 5AC4A 1XDLA 5HUOA 1XYCA 1Q6LA 3AIVA 4IF2A 2QPSA 4QJ3B 2XGBA 3WK0A 5EA9A 5CSYA 2BG5A 1JRCA 2DZTA 2ZXDA 5A6MA 3WNLA 4GK8A 3WCZA 1J10A 1WXYA 1VFSA 3O0KA 2VP8A 3VNMA 2NX1A 1GEQA 3CC1A 2PB1A 3OTRA 4LEQA 2V5BA 4JICA 1Q7MA 4N9CA 3NQFA 2DT1A 2E3ZA 4RDWA 4MJZA 5EMYA 4BFAA 5L9FA 4ATWA 4A3UA 1K4HA 1ONXA 4PB3A 4ICNA 1B3WA 3OHIA 1WBJA 4GX8A 1G5AA 4M6PA 2G50A 4PUWA 4F2UA 2RFGA 5JIWA 1XXXA 3PG9A 1XYLA 1KGXA 2O4MA 5M5DA 2XSBA 1REQB 1I0BA 1A5KC 2V81A 2JALA 3LCXA 1S38A 1W9XA 5G2IA 3WG6A 3I68A 1V0MA 2FZMA 2W79A 3CS2A 3EB4A 4ZTYA 1OD0A 4LYPA 1OCBA 3G3DA 3GTHA 2WHLA 2FJUB 1LJYA 4WSKA 1SZGA 4Y7EA 1TTQA 1YQ2A 4MLJA 4LT9A 1LRNA 4IIGA 1N82A 2WPBA 1XYAA 2JEPA 1TPDA 5FSEC 5I0DA 4ZCWA 3LNMA 4AZIA 1RJQA 1FX6A 5T9CE 3W81A 3MUIA 3H2AA 4Q8PA 3VGGA 4Z2HA 1QI2A 3APGA 2ODOA 1WKEA 1MEHA 4MYXA 3UZYA 4FX8A 5AYXA 5F2MA 3CUHA 3NO5A 1A47A 2FLIA 1XH0A 2ABAA 1EWDA 4JX4A 4PCTA 2CLOA 1LTDA 3WUGA 3W1PA 1HO4A 1JAEA 4PR4A 4FA3A 3GK0A 4JIQA 4H6EA 2FGZA 1E73M 1IHIA 1EB3A 4AHOA 2DUZA 1PS9A 3TONA 3NSMA 3TV8A 3CMFA 1UR2A 2CNCA 1QJWA 3I4EA 4I9AA 3UR2A 3C86A 2NLIA 4NJIA 2FB3A 4JDBA 4F0HA 3GXNA 1H63A 2BHZA 1L6YA 4EPKA 3M0HA 1CXHA 3T05A 3THDA 4B2DD 3V0UA 4O10A 1AFSA 2RDWA 4PH6A 2PGRA 3WH6A 3QPYA 4MWAE 1NDYA 5AECA 5IBXA 3MI2A 5CSSA 4XAYA 3LENA 1XBXA 4BF5A 3CL6A 1G7UA 3DYOA 2VR4A 3L12A 4GJJA 1FWFC 4HNNA 4G1KA 5JH1A 4NI3A 1KFCA 3N2XA 3LTSA 4KWOA 4JHMA 5A94A 1KR1A 4O16A 1AJ0A 3NQBA 4AWUA 4DQWA 4RKAA 5U4NA 4JQ4A 1WXZA 4XQ6A 5AYZA 4MGGA 3O6AA 3N2BA 4XVDA 1THFD 3C5QA 5HAOA 1TTJA 4D6CA 2Y8KA 4HNUA 1IE7C 3LI0A 2FTWA 5LGZA 4O15A 3AO0A 1W3KA 1WAWA 4PE8A 4XUGA 4C6BA 1S2VA 1LF1A 4J28A 4AZ7A 4RV8A 1HX0A 3QPZA 1U1UA 3T0AA 2X7VA 1MXSA 5TF0A 4NNBA 1KW1A 1RH9A 1C90A 5HWNA 2V8ZA 5H2ZA 8TIMA 1UD3A 4RV3A 4UQEA 3QGAC 4UCGA 2OZTA 5FF7A 4XAZA 5CCZA 3TJXA 5ABHA 1NP0A 2PGEA 1RP8A 3SCRA 1DTNA 4BF7A 3QN3A 3UESA 4OHQA 3GNPA 3F2DA 3LERA 1ZZMA 5DBUA 4YU1A 2BV9A 2QCGA 1DWAM 4CQAA 4ORMA 2X7WA 4J5NA 4FLRA 1UJQA 4KIRA 1PAMA 1AZ1A 2YDQA 1H7XA 1E4IA 2JF7A 4B5NA 3ZLHA 4US6A 1N2VA 3QV6A 3VZZA 4DPQA 3S2LA 1JCJA 5CGQA 1GQKA 2PTYA 1AW2A 3GVVA 3U57A 5KSWA 1IT0A 4Z0SA 4AIOA 1MEWA 1XRSA 1HP4A 4G9PA 1UIPA 2I1OA 4IIHA 5DEZA 3BJSA 3C2EA 5I07A 4CN6A 4NJJA 5DRCA 4FOUA 1PYFA 5C9ZA 4JTRA 2FZBA 3CAVA 4Y8EA 2WVUA 4UQ9A 1XCWA 1RPKA 1EP3A 3MZNA 1ZFJA 1GEHA 5DRIA 4WKFA 3ZVHB 1KKRA 1V6VA 2GLKA 2Z29A 1O5KA 3SRDA 1GQNA 1H1ZA 2XWDA 7REQA 1TIWA 3TYEA 4IL0A 3CQ0A 2H8XA 1J79A 3AYVA 1TWSA 3H4WA 4ML4A 3GB6A 2ZICA 2XVGA 3SCPA 1RVGA 1SVDA 4DLFA 3DAQA 1JAKA 3F2BA 2XFFA 1ZAJA 4G5DA 1NDZA 4KEUA 3N6QA 3QSRA 4O13A 4CUCA 1RV8A 4H9UA 3V7PA 3ES7A 2PDNA 4M0XA 4NJKA 2W66A 4D6HA 4BJHA 4LYQA 3AMGA 3U3HA 2Z2AA 4K7VA 4P7RA 3S1XA 3AXHA 4GKLA 2OWWA 4GZIA 3C2VA 5FF2A 3GO2A 3S4TA 1Q2RA 1DTUA 2F6UA 3R89A 1ITUA 4LVDA 4Z1DA 1F6YA 4UMCA 3GBDA 2YCJA 4AZGA 4UTIA 2OEKA 4MDOA 3PG8A 5GPRA 3WJZA 4HA1A 4DBEA 3B9NA 4C7FA 4HHPA 3TZFA 3WQ4A 1XINA 1PZ3A 3E12A 3QMTA 4C91A 2X40A 3RX3A 4K68A 3UWYA 7ODCA 3N04A 1I0DA 2UY3A 2ZC1A 3VKKA 3WQPA 3ZS4A 3E2SA 3OBEA 4GGBA 5D33A 2VX7A 5IRPA 2P5NA 1B4EA 3FY1A 5E70A 2EAWA 2IS7A 2DSKA 3NZ1A 3KVLA 1FFRA 2FTPA 5H91A 5ABFA 1AH0A 3N2TA 3LMYA 2B7QA 3HQNA 3WNMA 1MQQA 3FDKA 2QCEA 1A5LC 2WWCA 3CHVA 4L1XA 3KCJA 4CD8A 4ZQCA 3OLEA 5LXEA 3V18A 5A8PA 5HA7A 1R9ZA 4QROA 1UHVA 3VGHA 5BXSA 3GR4A 4JBRA 4GCAA 2F8QA 3KBMA 2ZX9A 5FJIA 3VD7A 1CGUA 2JF6A 1H7OA 3VD9A 3QV9A 3IANA 3SI9A 1M9HA 1UCWA 3M0JA 2P1FA 4KGJA 5G4HC 1JPKA 5D05A 1LBLA 3EWZA 4I9MA 2WSPA 3U48A 1PO9A 3G1AA 1M5WA 1IR2A 1Q6EA 2G96A 5FJJA 3R11A 2X30A 1NTHA 1OVDA 1W2PA 3AHXA 1PIFA 3Q4DA 5TD4A 4LNYA 2PODA 5MKGA 1I4NA 4PTVA 3SFWA 3QGKC 2TYSA 4IJCA 4MAZA 1RBOB 3LLXA 3TN6A 4Q4OA 3B9EA 4F9DA 1NM9A 1ZLPA 1D2KA 4M19A 1VGAA 3UG4A 3W7LA 1P48A 4E2DA 1OFQA 4TTGA 4ZMGA 4QLJA 2JGQA 3WQDA 4JGDA 5AC8A 3IVUA 3F5JA 3BO9A 4DXXA 4XD3A 3E1F1 1W3IA 1Q3NA 3FAWA 2VJXA 4RR4A 3AI0A 4AVOA 4UTJA 1KWGA 1WNOA 1Z41A 3KOWA 1IWAA 1TV5A 3UD6A 4UQAA 3IARA 4F0LA 3AYTA 2PAJA 2VEPA 1W9BM 3A5VA 1SW3A 2OJPA 4F0MA 2ONEA 3BLFA 3W53A 3KBNA 3K4WA 5LHFA 2RGLA 2VMFA 3H26A 3DG3A 1YE6A 4ZBCA 2NT1A 4EXQA 3C56A 4A3RA 1EPXA 1C7SA 1XBZA 3ZWTA 1QI4A 3FS2A 1VJZA 3N6JA 2XIMA 4LJ3A 1GOMA 3MS8A 4A2RA 1FA2A 1WPCA 4HHHA 3KP1A 4PRTA 1FWGC 1HUVA 2J77A 2OU4A 2CXEA 4DNMA 4P61A 2ZUMA 3G0UA 3QHOA 1OFPA 4ZO8A 1F76A 2YDAA 3NURA 2GDQA 3P8JA 1WE5A 2V68A 3RJXA 1TJPA 1UUQA 2YKKA 5F1VA 2A5HA 4KCUA 3EGJA 4Y2WA 2B81A 2FHCA 3QKZA 4PL2A 3PB0A 3OA5A 3V36A 4A8LA 3W1LA 5T9BG 1XDMA 3VGFA 1UA7A 1K8CA 3N18A 3KTCA 3CHFA 4A35A 3HG3A 3KRUA 4XV0A 4WDUA 3AXMA 3MYOA 3MV11 4JNZA 3BLEA 1X7FA 3NM1A 4GY0A 3L5AA 2ZA1A 3WLSA 1TR9A 5K9CA 4QISA 4NT0A 3UETA 4LY4A 1RK5A 2VFHA 4FIRA 1AW1A 3MSYA 1REQA 5CJMA 3C6CA 1F9CA 1G94A 4EWND 1CB7B 1L6FA 4RZBA 3CAWA 1ZL1A 3TNOA 5KEZA 3VILA 4QLKA 3GW3A 3OIXA 1OZMA 5GJPA 1M53A 2W6RA 3GG8A 2OODA 1V0KA 4B9ZA 5AVNA 2J9ZA 5D03A 1EX5A 1IF2A 3R12A 1PX4A 4HPJA 3IJLA 2MUCA 3SBFA 3TTEA 4FR6A 4QP0A 1PKYA 1HP5A 3QR3A 4WHBA 2PC4A 3JZUA 2FGBA 2PWEA 1FWRA 3EX4A 1EC8A 1EPVA 4FIQA 3GLCA 2VVNA 2G5WA 6PTDA 1M65A 2CWXA 2PWVA 1RR2A 3ITGA 1ECEA 4L6HA 1OC6A 3ZR5A 3A4JA 1YYAA 3U7VA 3QXBA 1S5NA 3IAQA 3PZGA 1JDDA 3LHYA 3JS3A 5GNZA 3LPGA 4Q8MA 4IMFA 1R3VA 2Z1BA 3TR2A 4DZHA 2PDYA 1C8VA 3OGSA 3PBUA 4XBJA 3CWOX 3ZJ7A 4ACZA 2CBIA 3S5ZA 5JBDA 5BMXA 3QQ0A 4F0KA 3W86A 1H1YA 2HE8A 3P3BA 2FFIA 2Z6JA 3LLFA 3PULA 3EPMA 2YA2A 3MJYA 2PTDA 4RZ6A 1BPLB 5I3HA 4B4FA 3AYRA 2GDUA 4OV4A 4RNJA 3TFCA 3G1YA 3DIPA 5K4ZA 2YCIX 4RW3A 1BXBA 3RO6A 4V27A 5I3KA 1S1RA 2IXUA 4G6CA 1V0NA 1VLWA 1WUEA 2ZX5A 2J47A 4XX6A 2Y62A 4S2BA 2C1GA 5JMUA 2EXOA 4PEKA 3MB9A 1QI3A 1UW9A 3EOLA 3LI1A 1EWEA 4JQ2A 3V75A 4B3LA 3VGBA 4QX4A 1NOWA 2DUXA 3K1DA 1X98A 4C6NA 3N3MA 3WN6A 3UJEA 2EKGA 2QEZA 4M82A 3KLLA 1E6QM 4C6PA 1LM1A 1OFEA 3M6DA 4MKSA 3GM8A 2W63A 5LNSA 4XISA 4QSFA 2G0WA 3H22A 2FFCA 3KHDA 1PE1A 2AOSA 4I5RA 3TTOA 1P1XA 3SUWA 3WLMA 1V79A 1VBRA 2VFEA 3G3MA 4PL1A 4E2BA 4O17A 4N9DA 4U31A 3QR0A 3E2RA 5D37A 3UR5A 3OU8A 4XTIA 4XZLX 5HNTA 1EXPA 2E6FA 4IZGA 4QDMA 3BCDA 4NASA 2POZA 1XDJA 1Q63A 5AOUA 2Z2BA 4CCCA 5E0KA 2J88A 3TSDA 1KXVA 4Q6JA 3VTRA 1AW5A 3LRMA 3VNDA 5H8MA 3FJ6A 3VIOA 3S1GA 3C3NA 4JN8A 4AWTA 3GTNA 1CEOA 2XWEA 5BWFA 4PULA 4P7LA 4N02A 4H00A 3DFPA 4PMXA 4YCOA 4TUFA 3GG0A 5IDIA 3WD2A 2VNCA 3W2NA 2NV2A 2H90A 4XZWA 4H9TA 4WSHA 1LL7A 2OT1A 5HINA 3KHJA 3THQA 1DQWA 1W5NA 1FTXA 4BA0A 3BV7A 1MNZA 2PWUA 1EEXA 5CXPA 3O0FA 2GWNA 3CZLA 1XSIA 1J0KA 3B3DA 1TQXA 1FHVA 4GD0A 3VNYA 2FDMA 3A21A 1VF8A 3W2UA 3HGRA 1VYSX 4NNCA 4Z2JA 5CLWA 1H7NA 1U5JA 2UY2A 1EOKA 1G4TA 3W4RA 3CZ8A 3UA3A 4KKXA 4Q4SA 1XGEA 4UNIA 1ZS2A 3FFSA 2YLAA 3CH0A 4H3DA 3NEVA 3W07A 2Y88A 5LA0A 1XC4A 1XYMA 3H4GA 2A21A 3RPMA 1BWKA 1YDNA 1EO5A 2REQB 1HG3A 4Y9NA 2WVTA 2YL9A 4K39A 1K7EA 2G4JA 1KM4A 3OQEA 5MHBA 2G95A 1ZUAX 3RJYA 3MMUA 4B5VA 2P0OA 2Y8VA 4UFJA 4L4LA 2VDIA 3WBWA 4NHVA 2VL4A 1OIFA 4LCRA 4OBTA 3TYUA 3SB0A 3W23A 5I2UA 4UTKA 3W83A 4J27A 1DXIA 2PU0A 3BAWA 1W9VA 3WENA 1DIEA 2UY5A 1XUUA 3ARYA 2PP0A 1CIUA 1XIDA 1VRDA 2NQJA 1JUBA 2HXTA 2C18A 3KS6A 1XLHA 3GYEA 1MSSA 5DMNA 1JGMA 2ZUWA 7CGTA 5E0CA 3W24A 1KM6A 3PZVA 2CBVA 4PMZA 4IUGA 3E3HA 3H2FA 2R6OA 2QUTA 1EJ7L 4GC4A 1FOBA 4DN1A 2QV4A 2J8TA 3PK7A 1NSJA 3PPCA 3RGTA 3WLKX 4W8LA 1J5SA 1XYZA 3QMSA 3SCOA 4PMQA 5REQB 3DC0A 4ICCX 1FWSA 4EANA 1RXOB 2E67A 2XPKA 3ARRA 3USBA 1ME7A 2OLHA 4QLLA 4AIEA 1GONA 5I5RA 1O66A 3DZ1A 3ENLA 4Z42C 2JFEX 1F8IA 3JRKA 4F79A 3W7EA 4XIAA 1A5OC 3VIIA 1ZJHA 1XUZA 1PCWA 5IFPA 3VGEA 1IEXA 3ZZ1A 1R38A 4LYKA 4DRSA 4LUYA 4DBDA 4EF9A 1T6MA 6ALDA 3B8TA 4S3BA 4D72A 1V3KA 2UZ9A 3RLUA 2OWXA 3GG1A 4ZQRA 1ZTVA 1DEDA 4OUIA 1V51A 1W3HA 4RW5A 2WNZA 3CU2A 1LRQA 2YFNA 1W5MA 3Q58A 4HSOA 4YTSA 1WZKA 4LVGA 3IUHA 5D2TA 4IL2A 1XIMA 1GZJA 2ASHA 5T8GA 2CHRA 3BE7A 3VOJA 1C9WA 3STCA 3ISIX 2OGJA 3TUUA 1IWPA 3F5KA 3S1WA 2W27A 2X1TA 1P1MA 1O12A 4ZO7A 2B31A 3RO8A 4WKHA 3R0KA 2RGMA 2ZZ3A 1J93A 3CV6A 4H6KA 2Q6ZA 1XLLA 3VDCA 4WX2A 1AVAA 1GQIA 2PDHA 1HL8A 5KZEA 2Q3RA 2F38A 1XIEA 2E6YA 3TYZA 2YXXA 1K7XA 4KESA 1EUNA 4MM1A 1SFLA 2DV0A 2INZA 2BVWA 1R8LA 4W87A 1EFZA 3E5PA 3WH7A 3LMZA 3H6OA 4AD0A 4AVNA 1QHPA 5A6TC 1PVNA 4ONVA 3PR2A 4LVFA 3ONBA 4AUBA 3WYZA 1UA3A 2XIJA 3GDKA 3DERA 4JEJA 4GIAA 4LC8A 3WQWA 4PUJA 5GVJA 3MTWA 1QK0A 4IP5A 3SRHA 4JXCA 1XYBA 2HJPA 1BTCA 2PD9A 4QE1A 2E4TA 4H8UA 2PFHA 3MSGA 4LBUA 2NUYA 1EXBA 3LN3A 4D6IA 2XVPA 1U1JA 4W4QA 2D2OA 3BW3A 3PWAA 1HF6A 2CZ5A 3NQGA 1WAUA 4IGSA 3QSTA 3EOUA 3LCIA 1A0DA 4BCEA 3WELA 2W92A 5DT7A 2ZVIA 5F4SA 1XCXA 1WUFA 1OFBA 1HQTA 5HUPA 2G4FA 1IZJA 5D32A 2BXVA 2GZXA 4QHRA 3NQ7A 2QZRA 4M5PA 1E1CB 2NLYA 2DQWA 3AQUA 4X63A 4GNJA 3L65A 3NDYA 4B90A 4Z1BA 4R7WA 1O1ZA 4K37A 4N4QA 4DM1A 4L1WA 2G8ZA 4BWLC 1NFPA 2FZ8A 3PAOA 5EY5A 3N4EA 5D9PA 4J3ZA 1RQHA 4HPGA 4DO7A 2W5FA 2OO6A 2DSZA 1LOLA 1LUCB 3TXZA 3P0XA 4QE4A 4FHAA 4NQ1A 1TWDA 4XD6A 2V5LA 2WHMA 1D7KA 3PBVA 2DVUA 3V1HA 3N34A 4BKNA 2E9LA 3M0VA 5DCBA 1EGVA 2KX9A 3RMEA 5FJPA 1Z69A 1US2A 4L5ZA 1KBJA 3GU9A 1QPOA 3L4UA 2Q8XA 2NXHA 3D47A 3OHMB 2J27A 4P7OA 1K02A 4KFNA 1QWGA 2QLYA 3U8GA 1P6BA 5FIPA 3MBDA 1JZ7A 2QVHA 5HNRA 4JIIX 2VR5A 3G5EA 2JKEA 4DJDA 3EDDA 3LCHA 3W1QA 2QKFA 3KEHA 3EX6A 2GOUA 3UCCA 2WCSA 2E1WA 3N17A 3BOFA 3I6TA 1IXOA 3BCJA 4UTWC 3TWAA 5FEZA 4QCFA 2X1IA 2QF7A 4Y9MA 3A13A 4EVZA 2BODX 3M0YA 2DSUA 3RLHA 2DQXA 1TO3A 2JIWA 4ZEPA 4M24A 1BTMA 4GWEA 6CGTA 1EQCA 2C1HA 4YL2A 2NW0A 4O12A 5C54A 1DIDA 3DFQA 4HU8A 5XIMA 3EA3A 5DFAA 1DQUA 4UTHA 8XIAA 5A8GA 3C4UA 2HNEA 3W7QA 3QLLA 2EF9A 3LNPA 5I00A 2PS2A 2QCMA 1C8QA 2C7FA 4X61A 3CB8A 4FP1A 4MB1A 1WDRA 3PC0A 1WCGA 3SW6A 1KBKA 1JFXA 4XO6A 1XG3A 2ZZ7A 3PN8A 1FWTA 4OVXA 4ZQOA 4PB4A 1DJYA 2GGGA 1JCYA 5D8ZA 1DWHM 1KCXA 4MG4A 1JGIA 1MQRA 3GHRA 3R2GA 2OYLA 1V3MA 3VX0A 3KWXA 3ARQA 4HN4A 3B97A 1W1A1 1NELA 2OVLA 4HNVA 5FAGA 4ZB2A 5A6BA 2INFA 2PLKA 2DVTA 2QYGA 3BANA 4GCXA 1KBBA 1XLMA 3SCTA 2J78A 3QFWA 5D2XA 4IGNA 1NQ6A 4LX4A 1R3YA 4UTTA 1UH3A 5I3DA 2AGTA 2E68A 2J8GA 1UQYA 1Y5VA 2G3IA 1BLIA 1VFLA 4GYFA 3A4AA 4ERAA 2XFRA 3CLWA 3T1GA 3ZIZA 4DLMA 1E43A 1JYVA 1G1YA 1GVOA 1QI5A 3O06A 3B06A 1P0NA 1FHDA 3LGEA 1DWJM 3HGSA 4WQ6A 1OFOA 3LY0A 1YTDA 3VI2A 3ARPA 2R1NA 2QMJA 3HGJA 4ZXLA 3UA4A 4L64A 3K4AA 3A47A 2B7PA 3FYPA 2Q09A 3LRKA 4Y9PA 4IQJA 3VK5A 3S9ZA 3S1VA 4XZIA 3WMBA 2Y63A 3RR1A 2CERA 3I4KA 3BQ5A 4WZHA 1F05A 1YBQB 3ANUA 3MP3A 4AZCA 2A3HA 1YNPA 2FTYA 2UV8G 3SJ3A 2O56A 4WXYA 3BUVA 4BI7A 3OZOA 3RU8X 3IJ8A 3W7CA 3LCFA 2Y5JA 4PN2A 4N2YA 5A8NA 3FYOA 2WVVB 1KFBA 3OEXA 4AF0B 4PFMA 5FEPA 5C7VA 3NQAA 1UZ4A 3C2FA 4EACA 1UKPA 3DKLA 3JR2A 1JPHA 3IJDA 1PTGA 3T42A 2UWFA 3PP7A 1E72M 4S3AA 1H4PA 4OBRA 1BQCA 4HHMA 3OP2A 4MAVA 2NX3A 4MJMA 1QNRA 4QNEA 3W87A 2CEQA 1R9XA 1Q4WA 2EPHA 6XIAA 2WWDA 4MKVA 1U5VA 3CH9A 4GZEA 3H2EA 1F3TA 3ONCA 4O1AA 1JZ4A 5C9WA 3DN5A 4M51A 3RHGA 3TAOA 3CB3A 1FBAA 1SSDA 4H9XA 3GIYA 3RAOA 2Y70A 3UXKA 2RDXA 1RALA 1YNYA 4JX6A 4ATDA 4RNFA 3WLHA 3KL3A 2Z25A 2HVMA 2CZDA 1HKWA 4E6MA 1FHLA 2GSHA 4M29A 1WA3A 3SEPA 2Z6IA 4D6DA 5CPSA 3GXPA 1NU5A 3W1MA 2C71A 2WC3A 1E3XA 1P7TB 2Y4SA 4RZ4A 3UNTA 3WK2A 2YPIA 1I1WA 1LG2A 1OT1A 4XAPA 2XHYA 4DJDC 3S83A 3FN9A 3LX9A 2DPEA 2OMAA 3RK8A 4NP7A 1EQPA 2HV5A 2QJHA 2WC4A 1Q2SA 1KFWA 1CXEA 3CUXA 3UZWA 5BRQA 2DZSA 1XF0A 2REQA 1BVWA 3H24A 3ZYZA 4ZO9A 3V5FA 4HU4A 1K9EA 3BJFA 2DU2A 4CQ8A 4I6KA 1JQXA 2FZDA 2PRMA 3RPTA 2W61A 3EPNA 3MT1A 4F2TA 2CCRA 1HJWA 3CTTA 3OPSA 4CEXC 4DAIA 1Z48A 3FKRA 4TX8A 4GYPA 3BH4A 5AC6A 1TPC1 4GQRA 2PUZA 4Q4RA 1HIZA 2RAGA 5FACA 1TCDA 3M1ZA 4CU8A 3POCA 1FWCC 5D04C 2W3ZA 2PDFA 1I60A 3NYZA 5CPLA 2E7FA 3TK7A 4AXNA 1QBAA 2J13A 2QIWA 1EDGA 1PZ1A 1EP2A 1KCKA 2PD5A 4WKAA 1GW1A 5A6JA 3LTYA 3UZ5A 5BRBA 4F2BA 2DVXA 4A22A 4Y90A 2HPIA 4QDWA 4I9JA 3D5HA 1HL2A 3NO3A 4V33A 2CLEA 4DVOA 1KB3A 3GC2A 1WDSA 4FNRA 2P76A 3H53A 5JH2A 3ABXA 2CW6A 5CPOA 2E9BA 4KETA 3Q45A 1FCVA 2JKPA 1JCLA 2P10A 2WM1A 5REQA 3VZXA 3VDHA 4N9BA 1H61A 5B7ZA 3CL8A 4Q7BA 1DP0A 2D0FA 1S39A 4BHYA 3SADA 3FHAA 1UG6A 4MFDA 4LRSA 2VVSA 3O3RA 4QEEA 1QPRA 4UTTC 4UQBA 2PC8A 4H01A 2FPVA 3MQTA 1ITQA 4MHBA 1FWEC 3FEQA 3TYCA 2BXZA 3MMWA 1AUSL 4UC5A 1RQEA 1YEYA 4B5UA 3S5OA 3AS2A 1OB0A 1NAL1 4HMNA 1JZ6A 5BRPA 1BRLB 2Q02A 3UR8A 3QZAA 2F7FA 2IMRA 4NAEB 4S39A 1EGZA 4FX7A 1KM2A 4TVUA 4F66A 2H6RA 2FMOA 4QG9A 4ROQA 1TZ7A 3MVTA 1CT5A 1VH7A 5HR7A 4KIEA 3MWAA 3DG6A 4RPQA 1TZ9A 3MHGA 5LIWX 2O9TA 2YXOA 3P8IA 2R91A 4FAMA 1J0ZA 1Q4NX 4MWAA 1D8CA 2F2KA 2PDPA 3MCMA 4AG0A 3UXDA 3GXMA 4AVFA 3LXAA 4IT1A 2CC0A 3W7RA 5BCAA 3VIFA 1V08A 4I90A 1UR4A 2TRSA 3O8AA 3G1SA 2BY0A 4EK7A 4XKYB 2YCKX 1E0TA 4H9ZA 4JIHA 4FXJA 3VDAA 2VFIA 1HN1A 1U83A 1XQLA 2OZ8A 4X60A 4E5TA 1UD2A 3K1GA 1KNWA 1GVYA 2C19A 4LCSA 2HPMA 5FESA 1HXJA 2W62A 3PJUA 2D20A 1H49A 4J7RA 1AD1A 2I5QA 4FX6M 3CYVA 3TN4A 1XM3A 5AKQA 1J2WA 2W9MA 1RCXB 3W2LA 4HYWA 1OCNA 2GGIA 2J79A 2HVOA 4LYRA 4B15A 3QY6A 3WUFA 2Y24A 3EB3A 1LQ0A 3M43A 3LQLA 3GBEA 1W1B1 1XR2A 1EF2A 4O1DA 1VBJA 3KE0A 3EXTA 4OECA 3LSBA 1WKDA 4Q8WA 1DL3A 1ONEA 5BOFA 1JZ5A 4CQDA 3U2OA 1KGUA 3OYZA 3TEVA 1UKQA 4MNKA 1JG9A 5CAKA 3MKCA 3NFUA 3WIJA 4NY2A 3ECQA 4HOZA 3AZRA 1HGWA 1TUXA 1FXPA 2GJPA 2XSAA 3NOEA 4KF1A 4CKQA 1I6NA 3VNZA 2WJZA 1DQXA 3IS4A 1DJZA 3DUGA 2YB4A 1SJAA 3I7SA 2R1MA 3OGVA 1QU4A 3S6TA 2P3ZA 3DYMA 1V02E 3UR7A 3N3TA 4DX3A 1XLKA 2A3CA 2BGSA 3VKAA 1KQYA 2GK1B 3LPPA 1E1CA 1P43A 1KO0A 4TU1A 4RK8A 3QV8A 4GBUA 4TVCA 5J8LA 3KLKA 1HFBA 4PUKA 3AHVA 4JYDA 4L4MA 1LLWA 1SFJA 4B92A 3QC3A 3SCSA 1OY0A 2YW3A 3CHDA 2DDXA 3A4WA 4QQ3A 1LUCA 3M64A 3HG4A 4JY8A 1W54A 1B90A 1GKQA 1A3XA 2J6XA 2B7OA 1VHNA 5HNNA 1EEPA 3VZYA 3WJWA 3NL3A 2AMGA 1CZ1A 4JTFA 3PUOA 2XJ7A 3VFLA 4CVWA 3TLLA 3B40A 4TQTA 1JI1A 2QGYA 1E9IA 5CZTA 4ALDA 3LQGA 1WDWA 5TAOA 1BWVA 1DJNA 4JTLA 4UR7A 2XDFA 3URQA 4PUDA 4XZNX 3N4AA 1SQ7A 1DJGA 3L2IA 3KOFA 1E0WA 4AY7A 3P7YA 2QHAA 3A23A 2P50A 3NL6A 3DFNA 5EU9A 5FSDC 3EBVA 1QUMA 2Z1SA 3C2RA 2DH2A 2TODA 3MUZ1 3VNKA 4LCQA 2ISFA 5G4WA 1DIOA 3UXIA 3GAKA 1NDWA 1VC4A 5AHLA 4AC7C 1GPFA 4C6FA 3FLUA 4IIFA 3WBXA 2BY1A 1CENA 3RFAA 9XIAA 3KVKA 1G7VA 1H0IA 5FJRA 4HMEA 1AL8A 3M0XA 4EX4A 1RJRA 3VNIA 1KFJA 3LK6A 2XH4A 3HM7A 2VKZG 4TX6A 8A3HA 3E6EA 1HJVA 2YFOA 1CYGA 4MWAC 4JIPA 5M2FX 3I10A 4ZFMA 1L8PA 4AQLA 1SFSA 4I3GA 3W1TA 2RDUA 4LANA 4GHRA 3RR4A 1TCMA 1ODUA 3GUGA 1HVXA 2GUBA 1A5BA 1JUEA 3FDGA 5LNRA 5HXMA 2TSYA 1CCWB 4JIEA 2W4XA 3TLQA 3L2MA 2OR2A 2WB5A 5C9RA 4XIMA 3W1AA 2GVEA 3GXFA 3NO1A 4QR6A 2X09A 3W26A 3RX4A 5KZMA 1Z32X 3LHWA 5C2XA 3ZM8A 1ZGDA 1ISVA 1TX2A 1UWIA 1FXQA 4GI6A 4ZQNA 1MDRA 5AYBA 4N6EA 3C0SA 4DB7A 4YLWA 1L6GA 3WDIA 3KTSA 2BGNE 4AXKA 3NGFA 1JNEA 4XB3A 1TV7A 1FH9A 4FLOA 4KS0A 2BB0A 4F0RA 3P5ZA 1BAGA 5FEXA 3H55A 4UQDA 4GYJA 3VC6A 2DT3A 4CCZA 1O95A 3PB2A 1UD6A 3DI0A 1E6XM 1TIMA 1ODZA 1ALDA 4M6VA 3WF0A 4QE5A 1B9BA 3GY1A 2HXUA 2O4QA 3NVTA 4LPCA 1KA9F 1TQJA 1XIJA 5BU9A 4H8VA 2PE4A 4J1OA 3QY7A 2E25A 4HD5A 1YPIA 5C8BB 1YBQA 2HVNA 4JTQA 2J62A 4EXBA 1MZRA 4ZR8A 4TO8A 1U30A 3WDJA 3TA6A 2WVVA 1QW7A 3I6RA 4AF0A 4DF2A 2OX1A 1B57A 3N29A 1VB9A 1Q7QA 3BAYA 4H9VA 2BBFA 3NGJA 2OKTA 3AIRA 4GY7A 2A6NA 1OD8A 4ZQPA 1MO0A 3WEZA 1IR1A 2OLSA 5HATA 3DGBA 3FJNA 3J7HA 3PUGA 3WLRA 4JTJA 3W1UA 5FL0A 4K8HA 5A8QA 4GH1A 4YCPA 2C3ZA 3IVSA 1K9FA 3EKLA 3SGUA 2ZUUA 2O0TA 4B9YA 4HHLA 1FH7A 1OBAA 3IWPA 3DGRA 4D6GA 1US3A 2OLAA 4HCLA 3G22A 3XISA 2QR6A 4C6LA 1QDSA 2VZVA 2VZSA 4DF1A 1KC7A 4WGHA 1BVNP 3L21A 3BMWA 1F6PA 1W1VA 4G1NA 1GT8A 1P7TA 2PTZA 4GKTA 2JE8A 3G0SA 1B3ZA 2AQVA 3TTYA 1VEOA 4PTDA 3IGHX 3I6EA 4LUSB 1XPYA 1GJWA 2E28A 4LAOA 1B9ZA 3H23A 4P7NA 7ENLA 1JZ3A 2BWGA 5I3FA 1B2YA 4GUJA 3CV2A 4AW7A 4AEFA 4K2SA 2PBOA 4HK7A 3SQMA 1W8GA 5AHFA 3WH5A 5A6LA 1UKOA 3VGDA 2OB3A 3ZOAA 2ZRUA 4H7CA 1W1PA 5FJTA 3AMCA 2ABBA 4Q8TA 3W25A 4JFWA 4L6DA 4KFOA 1GTHA 4NYYA 1XL9A 1EIBA 3T8LA 1SZEA 1TRDA 4DYKA 1UQZA 3WO8A 1ZBWA 3W01A 1JCTA 3CMJA 3URBA 2QULA 2P3EA 4BQ5A 4URIA 3WEMA 4MF4A 5CKSA 1A0EA 3DI1A 1H5VA 4OWGA 3PTMA 5CH9A 4OU1A 4A8NA 5F4XA 1VAHA 4QDPA 4PC8A 4JFVA 2Y2WA 2JBMA 4RCXA 3LTPA 1SO5A 1GZGA 2D23A 2ZTJA 4WSJA 3VKBA 7A3HA 1GHRA 9RUBA 1ELSA 1TV3A 4WOZA 5LZLA 1OADA 2WQDA 3VIHA 5FEWA 3HN3A 1QOPA 2GJXB 3IGXA 1UPPA 4MYAA 3AICA 4N0RA 2IUZA 4U2ZA 2B4GA 1J6PA 4CQBA 4FOJA 3CIXA 2ZIDA 3UG5A 3UPBA 2ANUA 1TV2A 1XFCA 5TNVA 2FB2A 2OX4A 3WQ5A 4C6QA 1I2NA 4ZZ9A 3TJ4A 3LM3A 1O5QA 3GVWA 1TPWA 1H51A 1MUCA 1LG1A 4OZOA 3S5SA 3AJ7A 4L80A 4R33A 2I56A 5I09A 1SYTA 2WMJA 3CZKA 4W89A 1M01A 1BRLA 4MFEA 1UB3A 2O7QA 4JQAA 1TJ0A 3OG2A 1J01A 3WLPA 1FWHC 3SO7A 3Q94A 4IQLA 1DJXA 3WY1A 3RRAA 3PZIA 3S9IA 4DUWA 4KRTA 4P8WA 4HMCA 3NM3A 2CBJA 4AMCA 2FPTA 1EOMA 2DSVA 2VOMA 4DJEC 1UBPC 3W7GA 2I17A 3B0XA 2NZLA 4RNIA 2HTMA 1IXQA 1QAPA 1X8CA 4W7UA 2VEMA 4XKYA