5LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lprA01
1HAXB 2UUJB 3IG6B 1C2KA 1SLUB 3K6ZA 2UWLA 1J16A 5GIBA 2GZ9A 3QUMP 1BMMH 4CBOA 1O3LA 1BTYA 2ZHEH 4UFGH 5GJ4B 5FBIA 1ANBA 1KXFA 2OC1A 1SQTA 3W94A 4U01A 2A4RA 5T6FA 4I31A 2P94A 3SI3H 4UFEH 2WINI 5AVDA 3GY2A 5ABWA 1Z6JH 1QA0A 1T32A 1TWXB 3NZIA 4IBLH 1JWTA 1TQ7B 4H6TA 1L4DA 4B75A 3JZ2B 1YPMH 2PHBA 1HUTH 1GBJA 1SGFA 1PJPA 2A5KA 1SGPE 1FIZA 1TMBH 1GMDG 1UVTH 1TABE 1G3EA 2GD4B 5GCHF 3HKIB 1NU9A 2P3TB 1TGCA 5L30H 2CMYA 3RMLH 2C93B 3LGWA 4FUGA 4KGAA 3A82A 1WBGB 1GHWH 1QQUA 1L2EA 3NPSA 6GCHG 5B6OA 3BTEE 4NIXA 3MU0A 1D6RA 2B5TB 1J15A 2QYIA 1RTLA 2JETC 2ZQ2A 3OYPA 3U1JB 4DURA 2XC0A 1ELEE 2B8OH 1DFPA 1EASA 1Z8GA 1NRSH 5GCHG 1ZOMA 3E6PH 3UIRA 1ZPBA 4XE4A 2A4OA 2G8TA 4XBCA 1DITH 1LHEH 3SNDA 5DKMA 4U30A 1Y5UT 1O2GH 4WF8A 1O3OA 1LQDB 2A0QB 1UTJA 1TFXA 1C5OH 1YYY1 1L1JA 1YCPH 4K5ZA 1HAVA 1V2RT 1BBRH 2AGEX 2QA9E 1YPEH 3VFEA 3B9FH 1TIOA 1OWIA 4B2CA 3F9HA 3V3MA 3BTDE 1GJ4H 4IN1A 3V13A 4ZKSU 1Z6EA 3GY8A 1OX1A 3UWJH 3PMJA 2G55A 2XYAA 1WTHD 1EAWA 3MNCA 2CXVA 1H1BA 4FU7A 2F9BH 2HNTC 5L2ZH 1BTPA 1AVWA 1MTSA 1QRZA 1XM1A 5CHAC 1BUIA 1O5CB 1Q2WA 2PW8H 5EODA 4A6LA 3KGPA 3TK5A 1F92A 1NFUA 2BX3A 2Y7XA 4X8UH 1BT7A 1LDTT 2R3UA 1YBWA 4BTUB 1SGIB 4KTUA 5CHAB 1V2TT 2F9VA 1V2LT 4BXSA 5DP4A 4CRAA 1QBNA 4UFFH 2ODQA 3VEQB 1C5WB 1ZMNA 2WUBA 1KTSB 3M3VA 2GKVE 5FAHA 3FZDA 1B5GH 3R3GB 3MH4A 4BAHB 2PTCE 1SGQE 1BA8B 1ZRKA 1EB2A 1AUJA 2SGEE 2WUCA 5EXLA 2ANKH 3RXOA 1W10U 3S9AA 1MCTA 5EW1H 1O2QA 2H5CA 3OY6U 2AYWA 3BN9A 3V12A 3ZZ5A 3ZV9A 4KKDA 1VJ9U 3TK9A 2BY6X 3ZVDA 2BD2A 3PM3A 2VWOA 2BD4A 4CRFA 1EB1H 4LXBH 4NCYA 1OXGA 5A8YA 3ZZCA 2D8WA 1ELVA 1PPBH 2ALVA 3ATKA 2FXRA 1FZZA 3QWCH 1OYTH 4I8JA 1N6XA 2AERH 4X2XA 3A89A 4ZHAA 1O5BB 3P8FA 1HAHH 1DT2A 3IITA 1VCPA 2FOHA 1XVOA 1AB9C 4MLFB 3S7HB 3UNQA 3ENSB 3KQEA 4HZHA 1INCA 2O8TA 2P3FH 1C5SA 1IQMA 1CVWH 2G4UA 1A61H 4O3UA 1FONA 1N8OB 1C5YB 4K69A 4AB8A 1C2JA 3SV7A 3S9CA 3H5CB 1LHCH 3QX5H 4FUEA 1N6YA 2PGBB 2RG3A 1TGBA 1QTFA 4E7RG 4JZFH 1BJVA 4X2WA 3LJJA 3V0XA 4DGJA 5JBCS 1QJ1B 1DPOA 3CENA 4CR9A 1GBFA 3S69A 4D76A 1C5UA 3Q3XA 4OS4A 3FZZA 1RS0A 4H42U 4AFZA 1SLVB 1P02A 1TNLA 1W8BH 5C1UA 4YOJA 1L1GA 2C8YB 2WPJS 1IQHA 3A7ZA 1HJAB 1EX3A 5FPYA 1KTTB 1MTVA 1RTKA 3F9EA 1QBOA 4FUCA 1LCYA 2FOFA 2ULLA 3L33A 1KXCA 2GZ8A 5A09A 1W13U 1ARCA 1UTLM 4ZUHA 1ZR0A 1H9LB 1HRTH 1O3PB 2H1UA 1GI9B 1DICA 5BRRE 3A7TA 1NC6A 1OS8A 5IYTA 1SQAA 1ZSJA 5HGGA 3RU4T 1GJAB 1Z8JB 3FAOA 4IC6A 2FS8A 1GI4A 3A8CA 2ZF0H 1GJDB 3S9BA 3LGVA 1O33A 1D3TB 3O8DA 3SGAE 1OP2A 2AGGX 1V2VT 3PO1C 1SGCA 2BB4A 1ZTKA 3EGKH 3NUMA 1C5PA 2Y80A 3E0PB 1ESTA 4VGCC 2J9NA 1C5NH 1ABJH 4D9QA 4K8BA 2PKSB 1OP8A 1O35A 1HB0B 3T26A 2F9UA 4AFUA 1O3IA 3KCGH 1QFKH 3LOXA 4IMZA 3NWUA 1XUFA 2O9QA 1ETSH 1NY22 4YTAA 1O2KA 1GJ5H 2OD3B 1GBLA 2BVRH 4AOQA 1FAXA 3BEUA 3RXGA 5AFZH 3K9XB 3R0FA 3D65E 3MU4A 2AH4X 2ZU5A 1GI7B 2FI4E 4DVAU 1AFQC 4AB9A 1W3CA 1ZHMA 3TGIE 1PYTC 3O8BA 1ZYOA 1IQGA 2C3SA 1QL7A 1NFXA 2OUAA 4WMFA 1A7SA 2GGVB 3UR6A 1AFQB 2Z7FE 3SU6A 1NRRH 1K1OA 2SGQE 2DE8A 2F91A 1ANCA 1O39A 2XW9A 3ZZAA 4TY6A 1VITH 1O3MA 3ZZ8A 3I77A 1AGJA 1OWDA 1C1OA 1WQSA 3GDSA 5JB9S 2XWBI 3FP7E 1VCQA 1B0FA 2Z94A 3P8OA 3SNEA 4E7NA 4R8TB 1P9UA 3RXFA 1AE5A 2BXUH 2W7SA 4K1SA 1NT1A 1P11E 3SUDA 4ZXXH 2Z9JA 1OKXA 1SFQB 1BHXF 1DE7H 1QB9A 3LKWA 1D3PB 2ILNA 2SNWA 1O5GH 4YT6H 2J95A 3VB4A 2H9TH 1V2QT 1ZJKA 2NU2E 4RKJB 4X1NU 1SR5C 2FP7B 1C1VH 1O3CA 2I6QA 3M7TA 2A45B 4DCDA 1LKBA 1ORFA 1TA2A 2Y5HA 4I8GA 2P16A 4ABIA 1CBWC 3CS0A 1OWJA 3ATWA 2VIPA 2WPLS 1PPFE 1G3CA 1O2NA 2AMPA 4IC5A 3VXEH 1XX9A 2C4FH 2D1JA 3Q76A 1RIWC 1C5XB 1DS2E 1LKAA 1FJSA 1THSH 1UVSH 2BD9A 2BMGB 2G5VA 3GCHC 2FESH 1C5RA 1AHTH 2OXSA 1H4WA 1CT4E 3E91A 4WH8A 1X7AC 5I25A 4HGCA 1LVMA 1S85A 1YGCH 1DVAH 5SGAE 4R0IA 1DWEH 1PPCE 4NGAH 1LVOA 2BOHB 2QC2A 1QL9A 5EG4A 4K8YA 2ZDAH 4K60A 2ZQ1A 1ESBA 1CA0C 2BDAA 4ISIH 4X8SH 1F0SA 1KXEA 1DM4B 5PTPA 4ESTE 2AFQB 3UUZA 1Z8RA 1BMLA 3RP2A 4BXWA 1V2PT 1SQOA 2GDEH 1TYNA 1Z8IB 2ZGBH 1GBMA 3TJVA 2TBSA 1CA0B 5DP7A 4CH2B 5C67A 2ZGHA 1HV7A 2NU1E 5JYIA 2ZEBA 3PLPA 4Y8ZA 1FY4A 2TIOA 3HGNA 3RLYH 1S0RA 2R3YA 1UHBB 3ZVAA 1MU6B 1DLEA 2WPMS 2QN5T 4CHAC 1A0HB 4TWYA 1HFDA 1GI1A 4Y6DA 2OINA 1IQLA 1S83A 4ZHLU 1HXFH 3A85A 1NU7B 1E0FD 1EZQA 2XC4A 5HM9A 2HGTH 3S0NA 2BLWA 2R9PA 1JMOH 2P8OB 1BTXA 1VZQH 1EPTC 3Q00A 4FUJA 4DG4A 2R0LA 3MNSA 3CP7A 1AY6H 1C9PA 1GBBA 5J4QA 2ZZUH 3T27A 3MH7A 1HAZB 1SGRE 1S6HA 3GDUA 5L2YH 1C2IA 2Y6TA 4NFFA 1AKSB 3SU4A 1ZMJA 4MDSA 2OQ5A 1BZXE 1DSUA 4D7FA 2O8MA 3BIUH 3LONA 2FYQA 1OYQA 1Y3WA 1ZTJA 4RSPA 1GL0E 4HTCH 4X6OA 5EPNA 1H8IH 2BDCA 1P10A 1Y59T 4YO9A 3SHCH 2JH6D 1LVBA 1H9IE 5IDKA 2W3IA 1O2ZA 2FOCA 1BRUP 1C2DA 1TQ0B 1ELFA 1EZUC 2ZGXH 3C1KA 4NIYA 2VIVA 3ZVBA 1GBCA 4X2YA 2G52A 1Z1IA 3SV8A 3SV6A 2BLVA 1A5IA 2P93A 2VB0A 1SHYA 1KLTA 2G4TA 1XKBC 1TNGA 3M5NA 2TRMA 2ZI2H 4JZIA 4ZKOU 1SG8B 9LPRA 2XBWA 3TNTA 4BNRA 1LO6A 2H5DA 2ZDVH 2PKAB 3ZZ7A 3BTFE 4ZROA 5EPYA 4XOJA 3FFGA 1LVYA 3PMHB 2IN2A 2ZFTA 6GCHF 5H4IB 1YP9A 3A7VA 5FXLA 3MU8A 3I78A 1FPCH 1K1NA 1YCPK 3HK3B 1BBRK 4ABGA 3SJ8A 1TGNA 1O2MA 1XMNB 4JZDH 2FO9A 1C9TA 4QT8C 2ODPA 3SQHE 2TGPZ 1CGIE 1O36A 3MO6A 2OTVA 2GTBA 5JBAS 1YPJH 3TJUA 2V0BA 4WVPE 1PFXC 3GICB 1YF4A 1GMCF 1TRYA 2GX4A 3RXUA 2VH6A 3BTME 1GHYH 3ITIA 1L0ZA 2TPIZ 1C1SA 1PQ7A 3MHWU 1WUNH 2CHAC 1F0TA 2Z9KA 3SU2A 1A2CH 2ZFQH 1HAOH 1TONA 3LH3A 1C1NA 2FTLE 1ANDA 3RXHA 4X8TH 2VWLA 1C5TA 5HXFA 1GBHA 3M7UA 4FXGH 1UK4A 4Y79A 2CHAB 3M7QA 2BDHA 2RA3A 1GG6C 1GJ6A 4IGDA 1AZZA 3PTBA 2JETB 1HAGE 1JBUH 3A8AA 5EU8A 3RM2H 2P59A 1GMCG 3M5MA 1RJXB 5DP3A 4UDWH 2H9EH 3STIA 3T62A 1NZQH 2CN0H 2Q6DA 2ZHFH 2LPRA 2G81E 3RC6A 1KYNA 1O5FH 1MBMA 1A5HA 1KXAA 1A0JA 3A84A 4ISLA 1GPZA 4YOIA 2M5TA 1A1RA 2GDDA 4X6NA 1SGEE 5F8TA 4OS5A 3RXMA 1AZ8A 1ZPZA 2QV1A 3KQBA 4CR5A 1JRTA 4NA7A 1C1WH 1O34A 4GPGA 1GHBF 4Q2KA 3A87A 4ABFA 2BLQA 4GLYA 1GDUA 3UOUA 5DP9A 1RRKA 2J34A 4I8LA 3TH3H 2V35A 1TBRH 4IS5A 3RXQA 1GGDC 3URDA 1V2MT 4I33A 3I29A 4U2WA 3URCA 1NRPH 2C90B 2Z3DA 1TOMH 3DFLA 1O3NA 3TH2H 1GI5A 3MI4A 1UHBA 1WTGH 1HPGA 1QGFA 2XXLA 5EXMA 5BPEA 3T25A 2PR3A 1IQJA 4B73A 4NSVA 1QL8A 1WYKA 1GDNA 3OSYA 4PROA 4ZMAH 1A46H 4MVNA 5TCAA 1O3EA 1SLXB 2NU3E 1Q31A 1UVPA 4TPIZ 2GT7A 2GMTC 2ZTZA 3SNAA 2BY7X 2IPHA 3EQ0H 1WV7H 1ZSLA 1NRNH 1E36B 2EC9H 4GSOA 1GHBG 2Y5FA 3KF2A 1HGTH 1O3JA 1MTNC 1MU8B 5GDSH 2Q6GA 4F4OC 2J94A 3LIWA 1QURH 5A0AE 1E38B 1MZDA 5FBEA 1TBZH 1AE8H 4X0WU 1P2JA 1U6QA 1AQ7A 2Z3EA 1AKSA 1OWKA 4MG3A 4NWLA 1HCGA 1SLWB 1B0EA 3MFJA 4UD9H 1VITF 1GHAG 3F9FA 4ZH8A 3RDZA 1UTKA 2AMQA 1MH0A 2GCTC 3ATLA 3CS7A 2A5IA 2J2UA 3EA7A 4X1PU 2Q1JA 5C2ZA 2XNIA 4OGYA 1QJ6B 1Y3XA 1GVZA 1OOKB 2FI3E 2V6NA 7KMEH 3RUOA 1DWDH 5TJXA 1EJMA 2O8WA 3M35A 1V2OT 3GY3A 1XUJA 1KLIH 1SOZA 4TWWA 3RU4D 1O3KA 1GL1A 3SHAH 4BAOB 1C2FA 3VB6A 1KDQB 4B2BA 3SUFA 1DXWA 4Y7BA 1TNJA 1BTUA 4IN2A 2J4IA 1VITG 5LH8A 2VWMA 7LPRA 4A92A 4MPUA 2C8WB 2PKAA 2BDYA 3F68H 1AB9B 1O2SA 1A0LA 2XBXA 4O97A 3SI4H 3U8TH 2RDLA 3TIUA 4BAKB 4LZ4B 3BSQA 2VIQA 8LPRA 1ZPCA 1EOLA 5E2OA 3EE0B 1EZXC 1W11U 2A7CA 4B74A 7GCHF 1O2UA 2OC0A 1O32A 2FODA 3DA9B 2AIQA 5DP5A 1E37B 5EOKA 2Y7ZA 2A1DB 1CHGA 3SNCA 1LHDH 3MYWA 5TCCA 4NZLA 4D9RA 4FUIA 2DUCA 3SJ9A 1Q3XA 3SORA 4DY7B 1F7ZA 1O2PA 1THRH 2XCFA 1N1LA 5HM2A 1HAPH 2PWXA 4FUDA 1ZGIA 3KNXA 1HJ9A 1P2IA 2SGFE 3QK1A 4JYTA 2BQ6B 1C1RA 1ELGA 2ZO3H 4Y8YA 2AS9A 3HPTB 1AD8H 4K3JA 3V7TA 3SU1A 1C2GA 1G9IE 3TLOA 2ZG0H 3SV2H 4JZ1A 2W5EA 1V2NT 3RXEA 7GCHG 1FXYA 5T6GA 2AEIH 2QXHA 3ZYDA 1SSXA 3G01A 3B23B 2BD8A 1UTPA 4AG1A 2R2MB 3M36A 1Z1JA 1AWHB 3BEIB 3ESTA 1L4ZA 1TRMA 1TNIA 1GCTC 1TOCB 4J2YB 1QR3E 5C5OA 3ZYEA 2F9OA 1CT0E 5A0BA 2C8XB 2ASUB 3Q3YA 4WMEA 1PPEE 1LMWB 1SGNE 3BTKE 3RXVA 3SU3A 2Y81A 4INKA 3A83A 4UEHH 5FHTA 3ZZ3A 1UTMA 2Y82A 1KXDA 1MKXK 4NG9H 3RM0H 4NIWA 1W7GH 4A1TA 2Z9IA 2GZ7A 1EOJA 1W2KH 3BTHE 3LU9B 1ARBA 1GHZA 4M7GA 5F03A 1D3QB 1NTPA 2UWPA 1SVPA 2Z9LA 4ISOA 4X1RU 4D8NA 1Y5BT 4H6SB 3GY6A 3RLWH 1QB1A 1P0SH 1ZZZA 3PO1B 4X1SU 3ZZ9A 3LGYA 4D7GA 3D49H 2FYRA 3MO9A 1Y3UA 1ACBE 1NS3A 4OGXA 4ISHH 2GV7A 3RXBA 4VGCB 4AX9H 1T8MA 3KQCA 3RC5A 1V2UT 1A5GH 1LHGH 2ZIQH 1ZHPA 4DIHH 3RXRA 3SJKA 1UK2A 4B71A 1CHOF 3M37A 4IMQA 4X6PA 1TPPA 4AYVB 1C1MA 2SGDE 1P3CA 1GBEA 2ZECA 1TBQH 1C4Y2 1TALA 1SGDE 2F3CE 1TGSZ 2NU0E 4B2AA 3LGTA 3A7WA 1EXFA 2AGIX 2B7DH 4Z6AH 1QHRB 1UK3A 1BTHH 2YNAA 3N7OA 1SPJA 2ZDNA 1MKWK 3LJOA 4Q7YA 1T8NA 2UWOA 3PMBB 3ZV8A 1TGTA 1AFEH 4WWYA 4NA8A 3RC4A 1TX8A 1SMFE 1G36A 5E0GA 1QRXA 3GY4A 1BMNH 3PV4A 5EGMA 1P12E 3TNSA 5EQSA 1CHOG 2Z6BD 3JZ1B 6CHAC 3ELAH 3QTVH 3A81A 1S5SA 1O38A 1MMJN 2ZCHP 4CRBA 1GDQA 2RA0A 3H7OA 3QGJA 3S7KB 4NZQA 1DUEA 1FMGA 1SGYE 4Y0ZE 2BD3A 1FN6A 5HYOA 1PPZA 2XCNA 3AVZA 3VB5A 1PYTD 4KELA 1JIRA 4MPWA 3QDZB 1FPHH 1C1UH 1P01A 1Z7KA 5G4BA 1ELAA 2QAAA 1JXPA 1TMTH 3IWMA 3UQOA 1GVKB 2ZP0H 1S82A 1KIGH 1PQAA 1DX5M 2ZKSA 3C27B 4NIVA 1O5AB 2OC8A 1EAXA 2I6SA 2TGDA 3B8JA 1GI6A 4I7YH 1KDQA 3F1SB 5JDUB 5E8EH 1YM0A 3HATH 5L6NH 3UPEA 1BTWA 4NA9H 3AAUA 2VVVA 1O37A 1CBWB 2BY9X 2JH5D 4OS6A 5C3NA 1O3BA 1V2JT 3MTYA 3QTOH 4CRCA 1OWHA 1TAWA 2F9PA 2XC5A 1BRAA 4O9VA 4Q7ZA 1RIWB 3SZNA 1P03A 2VU8E 3TH4H 1BOQA 1ETTH 2PGQB 1GVLA 1TNHA 2STBE 3GCHB 4CRDA 2Z9GA 2ZGJA 3LPRA 3KIDU 1NFYA 3WY8A 1P2NA 1TMUH 1C2LA 1YPGH 2JKHA 4BTTB 4OS2A 4THNH 1TNKA 3A8BA 2VGCC 1EAUA 1FIWA 4ISNA 1FUJA 2BY8X 1C1QA 1Z71A 2BDIA 3VXFH 2TGTA 3A7XA 3TGJE 3BEFB 1ZMLA 2QXJA 1QRWA 2STAE 2D26C 3RMMH 2ZHQH 1SHHB 1MAXA 2ANWA 1J8AA 1IOEA 1FN8A 2B9LA 2ZC9H 1OPHB 1EKBB 2ZTYA 2ZTXA 1S81A 1UVOA 4TYDA 1YPKH 5EXNA 5E0JA 5E2PA 2ZU3A 1O2WA 4Y11E 5DJ7A 4FUFA 4MPXA 1C5LH 1P2KA 2OCVB 1GI2A 3GY5A 1P3EA 4JYUH 1P2MA 4CHAB 3SUEA 2ZGCA 2FOAA 2PUQH 1UVUH 4Y7AA 2VIOA 1IHSH 4K2YA 1P06A 2Q6FA 2XBYA 4KP0A 3RXAA 3ATIA 3A80A 2VH0A 4ABBA 1JOUB 4NSYA 2F83A 4ZKRU 1EPTB 3BTQE 3M3SA 3BG4C 3LH1A 1HAIH 2QCYA 2ZU2A 3LGIA 2THFB 4BAQB 1GI3A 3LDXH 2QF0A 3UNSA 3SV9A 2EI6A 1J17T 1B7XB 1EJNA 4KTSA 1DSTA 1O2LA 1IHTH 1GJCB 1TA6A 3AAVA 3T5FH 3NK8A 5I46H 2BHGA 3SOSA 4AG2A 2PSYA 3AW1A 2A2XH 1A4WH 1IQIA 3ATMA 3RXPA 3M5OA 4UE7H 1O5DH 2V3HH 3MMGA 5A2MH 2HLCA 1Y5AT 1BRCE 1FV9A 4ZXYH 2FLBH 3SU0A 1G37A 4WJG2 3GDVA 3STJA 1ELBA 2IJOB 1MUEB 3RXSA 1O2HA 4A1XA 2ZA5A 2XRCA 1MCVA 1RGQA 3A88A 3PWBA 4DJZB 3UFAA 2GT8A 1O3FA 1WQVH 2QGRA 2ZWLH 1WCZA 1VGCC 1QIXB 3KHVA 4SGBE 2HPQH 1BTZA 2WV5A 3FP8E 1LPGB 3MOCA 2ZFPH 1C4V2 4A7IB 1AWFH 1CO7E 2FTMA 3T29A 1BBRE 4XBDA 1NRQH 4Y0YE 2H9HA 3PROA 1BITA 1AO5A 1FAKH 3PMAB 1VJAU 3E1XB 1PPGE 1S0QA 2UUFB 1W14U 1GHVH 1YCPM 1L1NA 1C5QA 1EQ9A 3OTJE 1EUFA 1EZSC 3DFJA 2FOEA 1GCDA 2NWNA 3NXPA 3EAJA 5FPSA 1GJ8B 4CBNA 1P8VC 1C1TA 2BDBA 3DHKH 1O2YA 3PB1E 1C2MA 2G51A 2QXGA 4GCHF 3U8OH 4MNYA 1QCPA 1WSSH 1UCYH 3E0NB 5C1XA 1HNEE 2DE9A 3ZVCA 1K22H 3U98H 1BIOA 1MD8A 1Y8TA 1GJ9B 4LOYH 3SJIA 2ZFSA 4MQAA 2FDAA 1RD3B 2K1QA 3GYMA 1F5KU 5A8ZA 4AFSA 2VJ1A 2PLXA 4BOHA 2FWWA 4GHQA 4LZ1H 1O5EH 2FZZA 2VVUA 1HBTH 3K2UA 3SQEE 3PLBA 1HJ8A 5DK1A 4E05H 1AMHA 4AN7A 1BCUH 3K6YA 4GCHG 1TX6A 1GG6B 2WYJA 4AGJA 3UWIA 1AU8A 4LK4A 2ALPA 4Y10E 4NWKA 3QLPH 5T6DA 1V6DA 1G3BA 1T4UH 1C2HA 1CU1A 1UO6A 2FX4A 4X1QU 2A31A 2FS9A 2GVFA 3U9AH 5GXPA 5EW2H 1SB1H 1MD7A 1C5MD 1KXBA 2OQUA 3M3TA 3SU5A 1C4U2 1MTUA 3P17H 3U1IB 3TITA 2IOTA 5AFYH 1V2WT 2CGAA 2J38A 2FLRH 1FY3A 4JZEH 4X8VH 3ZVFA 1CGHA 3SUGA 2ZDMA 1NPMA 1O0DH 1DLKB 1E35B 1FY1A 1O2XA 1D4PB 1ANEA 4MNXA 5K7RA 1J14A 1CSOE 3A86A 3DD2H 3EYDA 3TU7H 2BVSH 3MU1A 1TRNA 3TK6A 1GHXH 2ZNKH 3U8RH 1IQNA 1UTNA 1ZHRA 1GHAF 5EQQA 1DANH 1GGDB 3EA8A 2ZCKP 4DT7B 3O8CA 1OWEA 5LPFA 2OBQA 1D3DB 3ZVEA 3ZVGA 4ABHA 1F0UA 2HNTF 3LC5A 1WOFA 1P2OA 3T28A 2SGPE 5FX5A 1P05A 2H2ZA 1GBIA 3DUXH 5F8XA 2V3OH 4AYYB 2PV9B 2FI5E 1XKAC 1ZTLA 1KY9A 2ZHDA 2CV3A 4ZHMU 3GOVB 1W0YH 4CRGA 1V2KT 3AW0A 2GMTB 1O2RA 1HYLA 4AZ2B 4Q7XA 2GP9B 5E0HA 3D23A 1GBAA 1EPTA 1MTNB 1HIAB 2BD7A 3D62A 4MTBA 2KAIB 1YPHC 1EP6A 3BTTE 1AVXA 3KL6A 3ODDA 3LGUA 3GISB 2OLGA 1J9CH 2Y5GA 5LPRA 1O3GA 1IQFA 2O8UA 1FI8A 1RTFB 2ODYB 4ABEA 1GI0A 5LGOA 2GCTB 1O30A 2WPIS 3TJNA 3E8LA 3E3TA 3GCTF 5FCRA 3GYLB 4TPYA 1F5RA 3A8DA 4GHTA 1DDJA 2B0FA 3K65B 1T7CA 1FDPA 2XBVA 1BRBE 2GV6A 4ABAA 1P2QA 9ESTA 4FVDA 1QQ4A 1WAYB 2BD5A 2QF3A 5CE1A 1T4VH 4AORA 4ABDA 5J4SA 3ZZ6A 2HVXA 1MTWA 2ZHWH 2PFEA 1GI8B 3GCOA 1UMAH 2WPHS 1O2IA 1N8OC 1T8OA 4I32A 3VB7A 2FX6A 5A0CA 4ASHA 2A32A 1VR1H 4GAWA 4O03A 2VWNA 3UR9A 3GCTG 4U32A 1RFNA 3RMNH 3E90B 2GCHF 2BLOA 2C8ZB 1KSNA 3E16B 3U69H 3T2NA 2VINA 4WH6A 4JMYA 3VGCC 5C5NA 3F6UH 4UONA 1LPKB 4H4FA 2G00A 1TE0A 3VGCB 4FUHA 6LPRA 1HAYB 3MNBA 3MU5A 1W7XH 2EI8A 4WXVA 2YNBA 3PTNA 2W3KA 2HALA 2CF9H 2XTTB 2HNTE 1T31A 3P8GA 5LPEA 4RKOB 5JBBS 1FY8E 1XVMA 3QGNB 1TPOA 4J1YA 1QJ7B 3BV9B 1HJAC 2HRVA 3SN8A 4MPVA 1ELDE 2GCHG 4TY7A 2A4GA 2YOLA 2F9NA 1ID5H 2WYGA 3EA9A 4INLA 1O3DA 1EAIA 3L6PA 1C5VA 1G3DA 4K1EA 2FPZA 3UTUH 1CA8B 5JBTA 3RXDA 1LQEA 4Y76A 4FU8A 2J92A 1O2JA 2VNTA 1VCWA 2ZPRA 1K2I1 1YPHE 2BVXH 4KTCA 2BDGA 1GCTB 1K1PA 2VVCA 2BXTH 2A7HA 1G2MA 3RXTA 3TVJB 3SBKA 1E34B 2HPPH 1GBDA 1SI5H 3BIVH 3RU4E 1GJ7B 1GJBB 1RXPA 1GBTA 4JK6A 2P3UB 3GCNA 1NFWA 7ESTE 4INHA 5T3HA 1AI8H 1K1JA 1TPSA 1AN1E 2SGAA 1TB6H 4HFPB 4MNVA 4DW2U 5FCKA 1DXPA 1LTOA 5F8ZA 3ODFA 3NCLA 1K1LA 1QA7A 4YM9A 2PKSC 1PQ5A 2HWLB 2ZPQA 1CGJE 1SGTA 4YT7H 2ZCLP 1GMHF 3TGKE 1ELTA 1YPLH 3BF6H 4O3TA 1F5LA 1XUKA 4GVUA 3SO3A 2BTCE 5K0HA 4YLUA 1ETRH 4UFDH 5ESTE 1P57B 4RN6A 1V2ST 3MWIU 4DOQA 4YESB 1A3EH 1JRSA 2QIQA 3UQVA 5C20A 1XXDA 1SC8U 4Q80A 5CMXH 2RCEA 3UY9A 4HI3A 4A1VA 5ESBA 2FIRH 2QXIA 2ZFRH 1V3XA 4F49A 2FM2A 1MAYA 2FMJA 1D9IA 1K1IA 2Z3CA 2OBOA 2BQ7B 3KN2A 1G30B 1JIMA 5FPTA 3HGPA 5AF9H 3O8RA 1MBQA 2OP9A 1HXEH 1M9UA 2BYAX 5JB8S 1GBKA 1K1MA 1K9OE 1GMHG 4Y8XA 3SGQE 4NFEA 1MZAA 1CQQA 1ELCA 1XUIA 1CT2E 3L3TA 4JCNA 2BX4A 1HIAA 4BAMB 1DY8A 2KAIA 3MH5A 1TPAE 6CHAB 3MNXA 2BZAA 4AGKA 2PUXB 4BTIB 1ZLRA 1QNJA 3PLKA 3MH6A 2P95A 2FOMB 1DY9A 1SL3A 4I8KA 1LHFH 4CH8B 4JYVH 5HMAA 1MKXH 3ZZDA 1SFIA 1O3AA 1BHXB 4XSKU 3BTGE 1XUGA 5DPAA 3BTWE 3SJOA 2VIDA 3RXIA 3P8NA 4X2VA 1MQ6A 1Y3YA 4WY3A 1A3BH 3UNRA 2HOBA 3UREA 2O8LA 1SBWA 4GUXA 3NKKA 4Z0KA 3ZZ4A 1K21H 2CJIA 2QY0B 1O2TA 2SNVA 3OU0A 4YLQH 2WV4A 5A8XA 3SGBE 3VPKA 1TLDA 2BY5X 1AUTC 3RXKA 1ZJDA 4XBBA 1IQKA 2A7JA 4AFQA 2ZDLA 3AASA 4Y71A 2CF8H 2TGAA 2FOBA 5ETXA 3P70B 4YOGA 4ZAEA 1ZGVA 4XFQA 1FLEE 5DP8A 5EQRA 2W26A 1NO9H 2VIWA 2ANMH 3PWCA 3KQDA 1DUAA 5FX6A 1O2OA 3Q77A 1YLDA 8ESTE 3VB3A 4FU9A 3QN7A 1AVGH 2H6MA 1BMAA 4WXIA 2BM2A 1F0RA 1SOTA 2ZDKA 1YC0A 2UUKB 1MKWH 1S6FA 3RMOH 1H8DH 5GWZA 5DO4H 1BQYA 1O31A 1SGFG 1HLTH 1BJUA 2A5AA 2R2WU 1ABIH 1DWBH 4IW4E 4FVBA 3UOPA 3RXCA 2LNCA 1FNIA 1HAVB 1LPZB 1BDAA 1EP5A 2VGCB 1QBVH 1UTQA 4JK5A 1ESAA 1D6WA 1ZSKA 4OS1A 5F6MA 4B76A 8GCHF 3P6ZB 8KME2 3PYHA 3H7TA 4DIIH 1TX7A 2AIPA 1UJ1A 5DP6A 3OY5U 1NM6A 3A7YA 4K1TA 2SFAA 1T8LA 3SNBA 3KEEA 4YZUA 3TJOA 3F9GA 3LC3A 1GWAA 1C5ZB 1AIXH 3MO3A 3LT3A 4A5TS 1QY6A 2AMDA 2ESTE 1XUHA 2EA3A 1FY5A 3M61U 3OX7U 5DGJA 5GPIB 1H9HE 3ZZBA 1WU1A 1HDTH 1PPHE 1O3HA 1DWCH 1O2VA 3W95A 2ZU1A 1XXFA 1F2SE 5DG6A 4X6MA 2WPKS 1CE5A 2P8OC 2ZFFH 1NESE 2NU4E 4ABJA 2ZPSA 1YLCA 2UUYA 4I8HA 8GCHG 3SW2B 4MNWA 1S84A 1Y3VA 4OS7A 1W0ZU 1MQ5A 2W7UA 1THPB 3P92A 3M5LA 1UCYE 3BG4B 1QB6A 4FUBA 3FVFB 1UCYK 1C1PA 1OP0A 2EI7A 1NROH 4BANB 3QZQA 1YKTA 3DT0H 3HK6B 4E06H 4SGAE 2BZ6H 3Q3KA 2FEQH 3QZRA 1EJAA 2BQWB 2PTNA 2JH0D 2A2QH 2D2DA 3RXLA 1IAUA 2A4QA 1NN6A 1G2LA 2BOKA 4ZKNU 3GY7A 1P9SA 3EDXB 5AHGH 1PQ8A 2OC7A 3FP6E 2G5NA 3FANA 1EATA 3P95A 2EEKA 1IQEA 6ESTA 2XWAA 4XDEA 3RXJA 1K28D 4CREA 2FOGA 1G32B 3BG8A 3QO6A 1KLJH 3HKJB 1DOJA 2ANYA 1UTOA 2R0KA 3TPIZ 1BB0B 1P09A 2ZU4A 1OSSA 4WMDA 1C2EA 4B1TA 1VGCB 5JPMH 1P04A 1W12U 1ZRBA 5C1YA 1GMDF 1FQ3A 2PSXA
chains in the Genus database with same CATH superfamily
1HAXB 2UUJB 3IG6B 1YY3A 1C2KA 1SLUB 3K6ZA 2UWLA 1J16A 5GIBA 1NBMD 2GZ9A 2J98A 3QUMP 1BMMH 4CBOA 1O3LA 1BTYA 2ZHEH 4UFGH 5GJ4B 5FBIA 1ANBA 1KXFA 2OC1A 1SQTA 3W94A 4U01A 3EE7A 2A4RA 5T6FA 4I31A 2P94A 3SI3H 4UFEH 2WINI 5AVDA 3GY2A 5ABWA 1Z6JH 1QA0A 1T32A 1TWXB 3NZIA 4IBLH 5DSFA 1JWTA 1TQ7B 4H6TA 1L4DA 4B75A 3JZ2B 1YPMH 2PHBA 1HUTH 1GBJA 1SGFA 1PJPA 2A5KA 1SGPE 1FIZA 1TMBH 1GMDG 1UVTH 1TABE 1G3EA 2GD4B 2F4LA 3HKIB 5GCHF 1NU9A 2P3TB 1TGCA 5L30H 2CMYA 3RMLH 2C93B 3LGWA 4FUGA 4KGAA 3A82A 1WBGB 1GHWH 1QQUA 1L2EA 3NPSA 4ACBA 5B6OA 6GCHG 3BTEE 4NIXA 3MU0A 1D6RA 2B5TB 1J15A 2QYIA 1RTLA 2JETC 2ZQ2A 3OYPA 3U1JB 4DURA 2XC0A 1ELEE 2B8OH 1DFPA 1EASA 1Z8GA 1NRSH 5GCHG 1ZOMA 3E6PH 3UIRA 1SQRA 1ZPBA 4XE4A 2A4OA 2G8TA 4XBCA 1DITH 1LHEH 3SNDA 5DKMA 4U30A 1Y5UT 1O2GH 4WF8A 1O3OA 1LQDB 2A0QB 1UTJA 1TFXA 1C5OH 1YYY1 1L1JA 1YCPH 4K5ZA 1HAVA 1V2RT 1BBRH 2AGEX 2QA9E 1YPEH 3VFEA 3B9FH 1TIOA 1OWIA 4B2CA 3F9HA 3V3MA 3BTDE 1GJ4H 4IN1A 3V13A 4ZKSU 2HLDD 1Z6EA 3GY8A 1OX1A 3UWJH 3PMJA 2G55A 2XYAA 1WTHD 1EAWA 3MNCA 2CXVA 1H1BA 4FU7A 2F9BH 2HNTC 5L2ZH 1BTPA 1AVWA 1MTSA 1BMFD 1QRZA 1XM1A 2M2AA 1BUIA 1O5CB 1Q2WA 2PW8H 5CHAC 5EODA 4A6LA 3KGPA 3TK5A 1F92A 1COWD 1NFUA 2BX3A 2Y7XA 4X8UH 1BT7A 3OE7D 1LDTT 2R3UA 1YBWA 4BTUB 1SGIB 4KTUA 5CHAB 1V2TT 2F9VA 1V2LT 4BXSA 5DP4A 4CRAA 1QBNA 4F55A 4UFFH 2ODQA 3VEQB 1C5WB 2HVYB 1ZMNA 4P02A 2WUBA 1KTSB 3M3VA 2GKVE 5FAHA 3FZDA 1B5GH 3R3GB 3MH4A 4BAHB 2PTCE 1SGQE 1BA8B 1ZRKA 1EB2A 1AUJA 2SGEE 2WUCA 5EXLA 2ANKH 3RXOA 1W10U 3S9AA 1MCTA 5EW1H 1O2QA 2H5CA 3OY6U 2AYWA 3BN9A 3V12A 3ZZ5A 5C0TA 3ZV9A 3F3BA 4KKDA 1VJ9U 3TK9A 2BY6X 3ZVDA 2BD2A 3PM3A 3AK5A 2VWOA 2BD4A 4CRFA 1EB1H 4LXBH 4NCYA 1OXGA 5A8YA 3ZZCA 2D8WA 1ELVA 1PPBH 2ALVA 3ATKA 2FXRA 3KYFA 1FZZA 3QWCH 1OYTH 4I8JA 1N6XA 2AERH 4X2XA 3A89A 4ZHAA 1O5BB 3P8FA 1HAHH 1DT2A 3IITA 1VCPA 2FOHA 1XVOA 1AB9C 4MLFB 3S7HB 3UNQA 3ENSB 3KQEA 2V7QD 1INCA 1C5SA 1IQMA 1CVWH 2G4UA 2O8TA 2P3FH 1A61H 4HZHA 4O3UA 1FONA 2QF4A 1N8OB 1C5YB 4K69A 2OK5A 4AB8A 1C2JA 3SV7A 3S9CA 3H5CB 1LHCH 3QX5H 4FUEA 1N6YA 2PGBB 2RG3A 1TGBA 1QTFA 4E7RG 4JZFH 1BJVA 4X2WA 3LJJA 3V0XA 4DGJA 5JBCS 1QJ1B 1DPOA 3CENA 4CR9A 1GBFA 3S69A 4D76A 1WXRA 1C5UA 3Q3XA 4RI0A 4OS4A 3FZZA 1E1QD 2YMSB 1RS0A 4H42U 4AFZA 1SLVB 1P02A 1TNLA 1W8BH 2RDEA 5C1UA 4YOJA 1L1GA 3N7DA 3WWFA 2C8YB 2WPJS 1IQHA 3A7ZA 4XRNA 2CK3D 3MQKC 1HJAB 1EX3A 5FPYA 1KTTB 1MTVA 2KX4A 1RTKA 3F9EA 1QBOA 4FUCA 1LCYA 2FOFA 2ULLA 3L33A 1KXCA 2GZ8A 5A09A 1W13U 1ARCA 1UTLM 4ZUHA 1ZR0A 1H9LB 1HRTH 4DT4A 1O3PB 2H1UA 1GI9B 2YMSD 1DICA 5BRRE 3A7TA 1NC6A 1OS8A 5IYTA 1SQAA 1ZSJA 5HGGA 3RU4T 1GJAB 1Z8JB 3FAOA 4IC6A 2FS8A 1GI4A 3A8CA 2ZF0H 1GJDB 3S9BA 3LGVA 1O33A 3PV2A 1D3TB 3O8DA 2W6JD 3SGAE 1OP2A 2AGGX 1V2VT 3PO1C 1SGCA 2BB4A 1ZTKA 3EGKH 3NUMA 1C5PA 5HKKD 2Y80A 3GS9A 3E0PB 2K8IA 1ESTA 4VGCC 2J9NA 1C5NH 1ABJH 4D9QA 4K8BA 4Q63A 2PKSB 1OP8A 1O35A 1HB0B 3T26A 2F9UA 4AFUA 1O3IA 3KCGH 1QFKH 3LOXA 4IMZA 3NWUA 1XUFA 2O9QA 1ETSH 1UW7A 1NY22 4YTAA 1O2KA 1GJ5H 2OD3B 1GBLA 2BVRH 4AOQA 1FAXA 3BEUA 3RXGA 5AFZH 3K9XB 3R0FA 3D65E 1KMHB 3MU4A 2AH4X 1SKYE 2ZU5A 1GI7B 2FI4E 4DVAU 1AFQC 4AB9A 1W3CA 1ZHMA 3TGIE 1PYTC 3O8BA 1ZYOA 1IQGA 2C3SA 1QL7A 1NFXA 2OUAA 4WMFA 1A7SA 2GGVB 3UR6A 1AFQB 2Z7FE 3SU6A 1NRRH 1K1OA 2SGQE 2DE8A 2F91A 1ANCA 1O39A 2XW9A 3ZZAA 4TY6A 1VITH 1O3MA 3ZZ8A 3I77A 1AGJA 1OWDA 1C1OA 1WQSA 3GDSA 5JB9S 2XWBI 3FP7E 1VCQA 1B0FA 2Z94A 3P8OA 3SNEA 4E7NA 4R8TB 1P9UA 3RXFA 1AE5A 2BXUH 2W7SA 4K1SA 1NT1A 1P11E 3SUDA 4ZXXH 2Z9JA 1OKXA 1SFQB 1BHXF 1DE7H 2L74A 1QB9A 3LKWA 1D3PB 2ILNA 2SNWA 1O5GH 4YT6H 2J95A 3VB4A 2H9TH 1V2QT 1ZJKA 2NU2E 4RKJB 4X1NU 1SR5C 2FP7B 1C1VH 1O3CA 2I6QA 3M7TA 2A45B 4DCDA 1LKBA 1ORFA 1TA2A 2Y5HA 4I8GA 2P16A 2JIZD 4ABIA 1CBWC 3CS0A 1OWJA 3ATWA 2VIPA 2WPLS 3WWBA 1PPFE 1G3CA 1O2NA 2AMPA 4IC5A 3VXEH 1XX9A 2C4FH 2D1JA 3Q76A 1RIWC 1C5XB 1DS2E 1LKAA 1FJSA 1THSH 1UVSH 2BD9A 2BMGB 2G5VA 3GCHC 2FESH 1C5RA 1AHTH 2OXSA 1YWUA 1H4WA 1CT4E 3E91A 4WH8A 1X7AC 5I25A 2QF5A 4HGCA 1LVMA 1S85A 1YGCH 5T1VA 1DVAH 5SGAE 4R0IA 1DWEH 1PPCE 4NGAH 1LVOA 2BOHB 2QC2A 1QL9A 5EG4A 3OEHD 4K8YA 2ZDAH 4K60A 2ZQ1A 1ESBA 1CA0C 2BDAA 4ISIH 4X8SH 1F0SA 1KXEA 1DM4B 5PTPA 4ESTE 2AFQB 3UUZA 1Z8RA 1BMLA 3RP2A 4BXWA 1V2PT 1SQOA 2GDEH 1TYNA 1Z8IB 2ZGBH 1GBMA 3N7EA 3TJVA 2TBSA 1CA0B 5DP7A 4CH2B 5C67A 2ZGHA 1HV7A 2NU1E 5JYIA 2ZEBA 3PLPA 4Y8ZA 1FY4A 2TIOA 3HGNA 3RLYH 1S0RA 2R3YA 1UHBB 3ZVAA 1MU6B 1DLEA 2WPMS 2QN5T 4CHAC 1A0HB 4TWYA 1HFDA 1GI1A 4Y6DA 2OINA 1IQLA 1S83A 4ZHLU 1HXFH 3A85A 1NU7B 1E0FD 1EZQA 2XC4A 5HM9A 2HGTH 3S0NA 2BLWA 2R9PA 1JMOH 2XOKD 2P8OB 1BTXA 1MABB 1VZQH 1EPTC 3Q00A 4FUJA 4DG4A 2R0LA 3MNSA 3CP7A 1S6LA 1AY6H 1C9PA 1GBBA 5J4QA 2ZZUH 3T27A 3MH7A 1HAZB 1SGRE 1S6HA 3GDUA 5L2YH 1C2IA 2Y6TA 4NFFA 1AKSB 3SU4A 1ZMJA 4MDSA 2OQ5A 5EIYA 1BZXE 1DSUA 4D7FA 1FX0B 2O8MA 3BIUH 3LONA 2FYQA 1OYQA 2QE7D 1Y3WA 1ZTJA 4RSPA 1GL0E 4HTCH 4X6OA 5EPNA 1H8IH 2BDCA 1P10A 1Y59T 4YO9A 3SHCH 2JH6D 1LVBA 1H9IE 5IDKA 2W3IA 1O2ZA 2FOCA 1BRUP 1C2DA 1TQ0B 1ELFA 1EZUC 2ZGXH 3C1KA 4NIYA 2VIVA 3ZVBA 1GBCA 4X2YA 2G52A 1Z1IA 3SV8A 3SV6A 2BLVA 1A5IA 2P93A 2VB0A 1SHYA 4B6EA 1KLTA 2G4TA 1XKBC 1TNGA 3M5NA 2TRMA 2ZI2H 4JZIA 4ZKOU 1SG8B 9LPRA 2XBWA 3TNTA 4BNRA 1LO6A 2H5DA 2ZDVH 2PKAB 3ZZ7A 3BTFE 4ZROA 5EPYA 4XOJA 3FFGA 1LVYA 3KYGA 3PMHB 2IN2A 2ZFTA 6GCHF 5H4IB 1YP9A 3A7VA 5FXLA 3MU8A 3I78A 1FPCH 5C94A 1K1NA 1YCPK 3HK3B 2KCOA 1BBRK 4ABGA 3SJ8A 1TGNA 1O2MA 1XMNB 4JZDH 2FO9A 1C9TA 4QT8C 2ODPA 3SQHE 2TGPZ 1CGIE 1O36A 3MO6A 2OTVA 2GTBA 5JBAS 1YPJH 3TJUA 2V0BA 4WVPE 1PFXC 3GICB 1YF4A 1GMCF 1TRYA 2GX4A 3RXUA 2VH6A 3BTME 1GHYH 3ITIA 1L0ZA 2TPIZ 1C1SA 1PQ7A 3MHWU 1WUNH 2CHAC 1F0TA 2Z9KA 3SU2A 1A2CH 2ZFQH 1HAOH 1TONA 3LH3A 1C1NA 2FTLE 1ANDA 2XNDD 3RXHA 4X8TH 2VWLA 1C5TA 5HXFA 1GBHA 3M7UA 4FXGH 1UK4A 4Y79A 2CHAB 3VG8A 3M7QA 2BDHA 2RA3A 1GG6C 1GJ6A 4IGDA 1AZZA 3PTBA 2JETB 1HAGE 1JBUH 3A8AA 5EU8A 3RM2H 2P59A 1GMCG 2IJD1 3M5MA 1RJXB 5DP3A 4UDWH 2H9EH 3STIA 3T62A 1NZQH 2CN0H 2Q6DA 2ZHFH 2LPRA 2G81E 3PRDA 3RC6A 1KYNA 1O5FH 1MBMA 1A5HA 1KXAA 1A0JA 3A84A 4ISLA 1GPZA 4YOIA 4ACAA 2M5TA 1A1RA 2GDDA 4X6NA 1SGEE 5F8TA 4OS5A 3RXMA 4FETA 1AZ8A 1ZPZA 2QV1A 3KQBA 1NBME 4CR5A 1JRTA 4NA7A 1C1WH 1O34A 4GPGA 1GHBF 4Q2KA 3A87A 4ABFA 2BLQA 4GLYA 1GDUA 3UOUA 5DP9A 1RRKA 2J34A 4I8LA 3TH3H 5EJ1A 2V35A 1TBRH 4IS5A 3RXQA 1GGDC 3URDA 1V2MT 4I33A 3I29A 4U2WA 3URCA 1NRPH 2C90B 2Z3DA 1TOMH 3DFLA 1O3NA 3TH2H 1GI5A 3MI4A 1UHBA 1WTGH 1HPGA 1QGFA 2XXLA 4M9FA 5EXMA 5BPEA 2PR3A 1IQJA 4B73A 4NSVA 1QL8A 1WYKA 1GDNA 3OSYA 4PROA 4ZMAH 1A46H 4MVNA 5TCAA 1O3EA 1SLXB 2NU3E 1EFRD 1Q31A 1UVPA 4TPIZ 2GT7A 2GMTC 2ZTZA 3SNAA 2BY7X 2IPHA 3EQ0H 1WV7H 1ZSLA 1NRNH 1E36B 2EC9H 4GSOA 1GHBG 2Y5FA 3KF2A 1HGTH 1O3JA 1MTNC 1MU8B 5GDSH 2Q6GA 4F4OC 2J94A 3LIWA 1QURH 5A0AE 1E38B 1MZDA 5FBEA 1TBZH 1AE8H 3OEED 4X0WU 1P2JA 1U6QA 2JJ1D 1AQ7A 2Z3EA 1AKSA 1OWKA 4MG3A 4NWLA 1HCGA 1SLWB 1B0EA 3MFJA 4UD9H 1VITF 1GHAG 3F9FA 4ZH8A 3RDZA 1UTKA 2AMQA 1MH0A 2GCTC 3ATLA 3CS7A 2A5IA 2J2UA 3EA7A 4X1PU 2Q1JA 5C2ZA 2WV9A 2XNIA 4OGYA 1QJ6B 1Y3XA 1GVZA 1OOKB 2FI3E 2V6NA 7KMEH 3RUOA 1DWDH 5TJXA 1EJMA 2O8WA 3M35A 1V2OT 3GY3A 1XUJA 1KLIH 1SOZA 4TWWA 3RU4D 1O3KA 1GL1A 3SHAH 4BAOB 1C2FA 2KFWA 3VB6A 1KDQB 4B2BA 3SUFA 1DXWA 4Y7BA 3FN8A 1TNJA 1BTUA 1H8ED 1K0HA 4IN2A 2J4IA 1VITG 5LH8A 2VWMA 7LPRA 4A92A 4MPUA 2C8WB 2PKAA 3F2FA 2BDYA 3F68H 1AB9B 1O2SA 1A0LA 2XBXA 4O97A 3SI4H 3U8TH 2RDLA 3TIUA 4BAKB 4LZ4B 3BSQA 2VIQA 8LPRA 1ZPCA 5KGOA 1EOLA 5E2OA 3EE0B 1EZXC 1W11U 2A7CA 4B74A 7GCHF 1O2UA 2OC0A 1O32A 2FODA 3DA9B 2AIQA 5DP5A 1E37B 5EOKA 2Y7ZA 3OAAD 2A1DB 1CHGA 3SNCA 1LHDH 3MYWA 5TCCA 4NZLA 4D9RA 4FUIA 2DUCA 3SJ9A 1Q3XA 3SORA 4DY7B 1F7ZA 1O2PA 1THRH 2XCFA 1N1LA 5HM2A 1HAPH 2PWXA 2LP6A 5C0UA 4FUDA 2KR7A 1ZGIA 3KNXA 1HJ9A 1P2IA 2SGFE 3QK1A 4JYTA 2BQ6B 1C1RA 1ELGA 2ZO3H 4Y8YA 2AS9A 3HPTB 1AD8H 4K3JA 3V7TA 3SU1A 1C2GA 1G9IE 3TLOA 2ZG0H 3SV2H 4JZ1A 2W5EA 1V2NT 3RXEA 7GCHG 1FXYA 5T6GA 2AEIH 2QXHA 3ZYDA 1SSXA 3G01A 3B23B 2BD8A 1UTPA 4AG1A 2R2MB 4RT1A 3M36A 1Z1JA 1AWHB 3BEIB 3ESTA 1L4ZA 1TRMA 1TNIA 1GCTC 1TOCB 4J2YB 1QR3E 2PP6A 5C5OA 3ZYEA 2F9OA 1CT0E 5A0BA 2C8XB 2ASUB 3Q3YA 4YXWD 4WMEA 1PPEE 1LMWB 1SGNE 3BTKE 3RXVA 3SU3A 2Y81A 4INKA 3A83A 4UEHH 5FHTA 3ZZ3A 1UTMA 2Y82A 1KXDA 1MKXK 4NG9H 3RM0H 4NIWA 1W7GH 4A1TA 2Z9IA 2GZ7A 1EOJA 1W2KH 3BTHE 3LU9B 1ARBA 1GHZA 4M7GA 5F03A 1D3QB 1NTPA 2UWPA 1SVPA 2Z9LA 4ISOA 4X1RU 4D8NA 1Y5BT 4H6SB 3GY6A 3RLWH 1QB1A 1P0SH 1ZZZA 3PO1B 4X1SU 3ZZ9A 3LGYA 4D7GA 3D49H 2FYRA 3MO9A 1Y3UA 1ACBE 1NS3A 4OGXA 4ISHH 2GV7A 3RXBA 4VGCB 4AX9H 1T8MA 3KQCA 4OM9A 3RC5A 1V2UT 1A5GH 1LHGH 2ZIQH 1ZHPA 4DIHH 3RXRA 3SJKA 1E79D 1UK2A 4B71A 1CHOF 3M37A 4IMQA 4X6PA 1TPPA 4AYVB 1C1MA 2SGDE 1P3CA 1GBEA 2ZECA 3FKSD 1TBQH 1C4Y2 1TALA 1SGDE 2F3CE 1TGSZ 2NU0E 4B2AA 3LGTA 3A7WA 1EXFA 2AGIX 2B7DH 4Z6AH 1QHRB 1UK3A 1BTHH 2YNAA 3N7OA 1SPJA 2ZDNA 1MKWK 3LJOA 2GJGA 4Q7YA 1T8NA 2UWOA 3PMBB 3ZV8A 1TGTA 1AFEH 4WWYA 4NA8A 3RC4A 1TX8A 1SMFE 1G36A 5E0GA 5KEDA 1QRXA 3GY4A 1BMNH 3PV4A 5EGMA 1P12E 3TNSA 5EQSA 1CHOG 2Z6BD 3JZ1B 6CHAC 3ELAH 3QTVH 3A81A 1S5SA 2KM0A 1O38A 1MMJN 2ZCHP 4CRBA 1GDQA 2RA0A 3H7OA 3QGJA 3S7KB 4NZQA 1DUEA 1FMGA 1SGYE 4Y0ZE 2BD3A 1FN6A 5HYOA 1PPZA 2XCNA 3AVZA 3VB5A 1PYTD 4KELA 4RT0A 1JIRA 4MPWA 4ASUD 3QDZB 1FPHH 1C1UH 1P01A 1Z7KA 5G4BA 1ELAA 2QAAA 1JXPA 1TMTH 3IWMA 3UQOA 1GVKB 2ZP0H 1S82A 1KIGH 1PQAA 1DX5M 2ZKSA 3C27B 4NIVA 1O5AB 4P00A 2OC8A 1EAXA 2I6SA 2TGDA 3B8JA 1GI6A 4I7YH 1KDQA 3F1SB 3ZIAD 3T25A 5JDUB 5E8EH 1YM0A 4TSFD 3HATH 5L6NH 3UPEA 1BTWA 5EJLA 4NA9H 3AAUA 2VVVA 1O37A 1CBWB 2BY9X 2JH5D 4OS6A 5C3NA 1O3BA 1V2JT 3MTYA 3QTOH 4CRCA 1OWHA 1TAWA 2F9PA 2XC5A 1BRAA 4O9VA 4Q7ZA 1RIWB 3F2HA 3SZNA 1P03A 2VU8E 3TH4H 1BOQA 1ETTH 2PGQB 1GVLA 1TNHA 2STBE 3GCHB 4CRDA 2Z9GA 2ZGJA 3LPRA 3KIDU 1NFYA 3WY8A 1P2NA 1TMUH 1C2LA 1YPGH 2JKHA 4BTTB 4OS2A 4THNH 1TNKA 3A8BA 2VGCC 1WDIA 1EAUA 1FIWA 4ISNA 1FUJA 2BY8X 1C1QA 1Z71A 2BDIA 5F53A 3VXFH 2TGTA 3A7XA 3TGJE 3BEFB 1ZMLA 2QXJA 1QRWA 2STAE 2VBCA 2D26C 3RMMH 2ZHQH 1SHHB 1MAXA 2ANWA 1J8AA 1IOEA 1FN8A 2B9LA 2ZC9H 1OPHB 1EKBB 2ZTYA 2ZTXA 2KCPA 1S81A 1UVOA 4TYDA 1YPKH 5EXNA 5E0JA 5E2PA 4TT3D 2ZU3A 1O2WA 4Y11E 5DJ7A 4FUFA 4MPXA 1C5LH 1P2KA 2OCVB 1GI2A 3GY5A 1P3EA 4JYUH 1P2MA 4CHAB 3SUEA 2ZGCA 2FOAA 2PUQH 2KCAA 1UVUH 4Y7AA 2VIOA 1IHSH 4K2YA 1P06A 2Q6FA 2XBYA 4KP0A 3RXAA 3ATIA 3A80A 2EQNA 2VH0A 4ABBA 1JOUB 4NSYA 2F83A 4ZKRU 1EPTB 3BTQE 3M3SA 3BG4C 3LH1A 1HAIH 2QCYA 2ZU2A 3LGIA 2THFB 3UB0A 4BAQB 1GI3A 3LDXH 2QF0A 3UNSA 3SV9A 5CHBA 2EI6A 1J17T 1B7XB 1EJNA 4KTSA 1DSTA 1O2LA 1IHTH 1GJCB 1TA6A 3AAVA 3T5FH 3NK8A 5I46H 2BHGA 3SOSA 4AG2A 2PSYA 3AW1A 3F0PA 2A2XH 1A4WH 1IQIA 3ATMA 3RXPA 3M5OA 4UE7H 1O5DH 2V3HH 3MMGA 5A2MH 2HLCA 1Y5AT 1BRCE 1FV9A 4ZXYH 2FLBH 3SU0A 1G37A 4WJG2 3GDVA 3SZEA 3STJA 1ELBA 2IJOB 1MUEB 3RXSA 1O2HA 5HIYA 4A1XA 2ZA5A 2XRCA 1MCVA 1RGQA 3A88A 3PWBA 4DJZB 3UFAA 5GNDA 2GT8A 2K0QA 1O3FA 1WQVH 2QGRA 2ZWLH 1WCZA 1VGCC 1QIXB 3KHVA 4SGBE 2HPQH 1BTZA 4I86A 2WV5A 3FP8E 1LPGB 2WSSD 3MOCA 2ZFPH 1C4V2 4A7IB 1AWFH 1CO7E 2FTMA 3T29A 1BBRE 4XBDA 1NRQH 4Y0YE 2H9HA 3PROA 1BITA 1AO5A 3NRLA 1FAKH 3PMAB 1VJAU 3E1XB 3DSGA 1PPGE 1S0QA 2UUFB 1W14U 1GHVH 1YCPM 1L1NA 1C5QA 4B6FA 2KZ4A 1EQ9A 3OTJE 1EUFA 1EZSC 3KQ5A 3DFJA 2FOEA 1GCDA 2NWNA 3NXPA 3EAJA 5FPSA 1GJ8B 4CBNA 1P8VC 1C1TA 2BDBA 3DHKH 1O2YA 3PB1E 1C2MA 2G51A 2QXGA 4GCHF 3U8OH 4MNYA 1QCPA 1WSSH 1UCYH 3E0NB 5C1XA 1HNEE 2DE9A 3ZVCA 1K22H 2EY4C 3U98H 1BIOA 1MD8A 1Y8TA 5CDFE 1GJ9B 4LOYH 3SJIA 2ZFSA 4MQAA 2FDAA 1RD3B 2K1QA 3GYMA 1F5KU 5A8ZA 4AFSA 2VJ1A 2PLXA 4BOHA 2FWWA 4GHQA 4LZ1H 1O5EH 2FZZA 2VVUA 1HBTH 3K2UA 3SQEE 3PLBA 1HJ8A 5DK1A 4E05H 1AMHA 4AN7A 1BCUH 3K6YA 4GCHG 1TX6A 1GG6B 2WYJA 4AGJA 3UWIA 1AU8A 4LK4A 2ALPA 4Y10E 4NWKA 3QLPH 5T6DA 1V6DA 1G3BA 1T4UH 1C2HA 1CU1A 1UO6A 2FX4A 4X1QU 2A31A 2FS9A 2GVFA 3U9AH 5GXPA 5EW2H 1SB1H 1MD7A 1C5MD 1KXBA 2OQUA 3M3TA 3SU5A 1C4U2 1MTUA 3P17H 2W6ID 3U1IB 3TITA 2IOTA 5AFYH 1V2WT 2CGAA 2J38A 2FLRH 1FY3A 2J97A 2V3MA 4JZEH 4X8VH 4AC9A 3ZVFA 5B6LA 1CGHA 3SUGA 3WW7A 2ZDMA 1NPMA 1O0DH 1DLKB 1E35B 1FY1A 2WHXA 1O2XA 1D4PB 1ANEA 4MNXA 5K7RA 1J14A 1CSOE 3A86A 3DD2H 3EYDA 3TU7H 1W0JD 2BVSH 3MU1A 1TRNA 3TK6A 1GHXH 2ZNKH 3U8RH 1IQNA 1UTNA 1ZHRA 1GHAF 5EQQA 1DANH 1GGDB 3EA8A 2ZCKP 4DT7B 3O8CA 1OWEA 5LPFA 2OBQA 1D3DB 3ZVEA 3ZVGA 4ABHA 1F0UA 2HNTF 3LC5A 3DSOA 1WOFA 1P2OA 3T28A 2SGPE 5FX5A 1P05A 1E1RD 2H2ZA 1GBIA 3DUXH 5F8XA 2V3OH 4AYYB 2PV9B 2FI5E 1XKAC 1ZTLA 1KY9A 2ZHDA 2CV3A 4ZHMU 3GOVB 1W0YH 4CRGA 3W1EA 1V2KT 3AW0A 2GMTB 1O2RA 1HYLA 4AZ2B 4Q7XA 2GP9B 5E0HA 3D23A 1GBAA 1EPTA 2WZQA 1MTNB 1HIAB 2BD7A 3D62A 4MTBA 2KAIB 1YPHC 1EP6A 4F48B 3BTTE 1AVXA 2L6OA 1YLNA 3KL6A 3ODDA 3LGUA 3GISB 2OLGA 1J9CH 2Y5GA 5LPRA 1O3GA 5EJZA 1IQFA 2O8UA 1FI8A 1RTFB 2ODYB 4ABEA 1GI0A 3UAIC 5IK2D 5LGOA 3OFND 2GCTB 1O30A 2WPIS 3F2GA 3E8LA 3TJNA 3E3TA 3GCTF 5FCRA 3GYLB 4TPYA 1F5RA 3A8DA 4GHTA 1DDJA 2B0FA 3K65B 1T7CA 2AHME 1FDPA 2XBVA 1BRBE 2GV6A 4ABAA 1P2QA 9ESTA 4FVDA 1QQ4A 1WAYB 2BD5A 2QF3A 5CE1A 1T4VH 4AORA 4ABDA 5J4SA 3ZZ6A 5C17A 2HVXA 1MTWA 2ZHWH 2PFEA 1GI8B 3GCOA 1UMAH 2WPHS 1O2IA 1N8OC 1T8OA 4I32A 3VB7A 2FX6A 5A0CA 4ASHA 2JJ2D 2A32A 1VR1H 4GAWA 4O03A 2VWNA 1H8HD 3UR9A 2J5UA 3GCTG 4U32A 1RFNA 3RMNH 3E90B 2GCHF 2BLOA 2C8ZB 1KSNA 3E16B 1VKYA 3U69H 3T2NA 2VINA 4WH6A 4JMYA 3VGCC 5C5NA 3F6UH 3DSPA 4UONA 1LPKB 4H4FA 2G00A 1TE0A 3VGCB 4FUHA 6LPRA 1HAYB 2YMSC 3MNBA 3MU5A 1W7XH 2EI8A 4WXVA 2YNBA 3PTNA 2W3KA 2HALA 5DN6D 2CF9H 2XTTB 2HNTE 1T31A 3P8GA 5LPEA 4RKOB 5JBBS 1FY8E 1XVMA 3QGNB 1TPOA 4J1YA 1QJ7B 3BV9B 1HJAC 2HRVA 4Q4LA 3SN8A 2LELA 4MPVA 1ELDE 2GCHG 4TY7A 2A4GA 2YOLA 2F9NA 1ID5H 2WYGA 3EA9A 4INLA 1O3DA 1EAIA 3L6PA 1C5VA 1G3DA 4K1EA 2FPZA 3PV5A 3UTUH 3OTPA 1CA8B 5JBTA 3F0OA 3RXDA 1LQEA 4Y76A 4FU8A 2J92A 1O2JA 2VNTA 1VCWA 2ZPRA 5KECA 4HG6A 1K2I1 1YPHE 2BVXH 4KTCA 2BDGA 1GCTB 1K1PA 2VVCA 2BXTH 2A7HA 1G2MA 3RXTA 3TVJB 3SBKA 1E34B 2HPPH 1GBDA 1OHHD 1SI5H 3BIVH 3RU4E 1GJ7B 1GJBB 1RXPA 1GBTA 4JK6A 2P3UB 3GCNA 1NFWA 7ESTE 4INHA 5T3HA 1AI8H 1K1JA 1TPSA 1AN1E 2SGAA 1TB6H 4HFPB 4MNVA 4DW2U 5FCKA 1DXPA 1LTOA 5F8ZA 3ODFA 3NCLA 1K1LA 1QA7A 4YM9A 2RFKC 2PKSC 1PQ5A 2HWLB 2ZPQA 1CGJE 1SGTA 4YT7H 2ZCLP 1GMHF 3TGKE 1ELTA 1YPLH 3BF6H 3N99A 4O3TA 1F5LA 1XUKA 2KCYA 4GVUA 3SO3A 2BTCE 5K0HA 4YLUA 1ETRH 4UFDH 5ESTE 1P57B 4RN6A 1V2ST 2IPQX 3MWIU 4XD7D 4DOQA 4YESB 1A3EH 1JRSA 2QIQA 3UQVA 5C20A 1XXDA 1SC8U 4Q80A 5CMXH 2RCEA 3UY9A 4HI3A 4A1VA 5ESBA 2FIRH 2QXIA 2ZFRH 1V3XA 4F49A 2FM2A 1MAYA 2FMJA 1D9IA 1K1IA 2Z3CA 2OBOA 1W0KD 2BQ7B 3KN2A 1G30B 1JIMA 5FPTA 3HGPA 5AF9H 3O8RA 1MBQA 2OP9A 1HXEH 1M9UA 2BYAX 5JB8S 1GBKA 1K1MA 1K9OE 1GMHG 4Y8XA 3FO8D 4NFEA 1MZAA 3SGQE 1CQQA 1ELCA 1XUIA 1CT2E 3L3TA 4JCNA 2BX4A 1HIAA 2J98B 2WPDD 4BAMB 1DY8A 2KAIA 3MH5A 1TPAE 6CHAB 3MNXA 2BZAA 4AGKA 2PUXB 4BTIB 1ZLRA 1QNJA 3PLKA 3MH6A 2P95A 2FOMB 1DY9A 1SL3A 4I8KA 1LHFH 4CH8B 4JYVH 5HMAA 1MKXH 3ZZDA 1SFIA 1O3AA 1BHXB 4XSKU 3BTGE 1XUGA 5DPAA 3BTWE 3H09A 3SJOA 2VIDA 3RXIA 3P8NA 4X2VA 1MQ6A 1Y3YA 4WY3A 1A3BH 3UNRA 3U28C 2HOBA 3UREA 2O8LA 1SBWA 4GUXA 3NKKA 4Z0KA 3ZZ4A 1K21H 2CJIA 2QY0B 1O2TA 2SNVA 3OU0A 4YLQH 2WV4A 5A8XA 3SGBE 3SYJA 3VPKA 1TLDA 2BY5X 1AUTC 3RXKA 1ZJDA 4XBBA 1IQKA 2A7JA 4AFQA 2ZDLA 3AASA 4Y71A 2CF8H 2TGAA 2FOBA 5ETXA 3P70B 4YOGA 4ZAEA 1ZGVA 4XFQA 1FLEE 5DP8A 5EQRA 2W26A 1NO9H 2VIWA 2ANMH 3PWCA 3KQDA 1DUAA 5FX6A 1O2OA 3Q77A 1YLDA 8ESTE 3VB3A 4FU9A 3QN7A 1AVGH 2H6MA 1BMAA 4WXIA 2BM2A 4ZCNA 1F0RA 1SOTA 2ZDKA 1YC0A 2UUKB 1MKWH 1S6FA 3RMOH 1H8DH 5GWZA 5DO4H 1BQYA 3FOAA 1O31A 1SGFG 1HLTH 1BJUA 2A5AA 2R2WU 1ABIH 1DWBH 1QZ8A 4IW4E 4FVBA 3UOPA 3RXCA 2LNCA 1FNIA 1HAVB 1LPZB 1BDAA 1EP5A 2VGCB 1QBVH 1UTQA 4JK5A 1ESAA 1D6WA 1ZSKA 4OS1A 5F6MA 4B76A 8GCHF 3P6ZB 8KME2 3PYHA 2JDID 5FL7D 3H7TA 4DIIH 1TX7A 2AIPA 1UJ1A 5DP6A 3OY5U 1NM6A 3A7YA 4K1TA 5HIZA 2SFAA 1T8LA 3SNBA 3KEEA 4YZUA 3TJOA 3F9GA 3LC3A 1GWAA 1C5ZB 1AIXH 3MO3A 3LT3A 4A5TS 1QY6A 2AMDA 2ESTE 1XUHA 2EA3A 1FY5A 3M61U 3OX7U 5DGJA 5GPIB 1H9HE 3ZZBA 1WU1A 1HDTH 1PPHE 1O3HA 1DWCH 1O2VA 3W95A 2ZU1A 1XXFA 1F2SE 3PRBA 5DG6A 4X6MA 2WPKS 1CE5A 2P8OC 2ZFFH 1NESE 2NU4E 4ABJA 2ZPSA 1YLCA 2F43B 2UUYA 4I8HA 8GCHG 3SW2B 3CNRA 4Z1MD 4MNWA 1S84A 1Y3VA 4OS7A 1W0ZU 1MQ5A 2W7UA 1THPB 3P92A 3M5LA 3DCLA 1UCYE 3BG4B 1QB6A 4FUBA 3FVFB 1UCYK 1C1PA 1OP0A 2EI7A 1NROH 4BANB 3QZQA 1YKTA 3DT0H 3HK6B 4E06H 4SGAE 2BZ6H 3Q3KA 2FEQH 3QZRA 1EJAA 2BQWB 2PTNA 2JH0D 2A2QH 2D2DA 3RXLA 1IAUA 2A4QA 4FOUC 1NN6A 1G2LA 2BOKA 4ZKNU 3GY7A 1P9SA 3EDXB 5AHGH 1PQ8A 2OC7A 3FP6E 2G5NA 3FANA 1EATA 3P95A 2EEKA 1IQEA 6ESTA 2XWAA 4XDEA 3RXJA 1K28D 4CREA 2FOGA 1G32B 3BG8A 3QO6A 1KLJH 3HKJB 1DOJA 2ANYA 1UTOA 2R0KA 3TPIZ 1BB0B 1P09A 2ZU4A 1OSSA 4WMDA 1C2EA 4B1TA 1VGCB 5JPMH 1P04A 1W12U 1ZRBA 5C1YA 1GMDF 1FQ3A 2PSXA
chains in the Genus database with same CATH topology
1HAXB 2UUJB 3IG6B 1C2KA 1SLUB 3K6ZA 2UWLA 1J16A 5GIBA 2GZ9A 3QUMP 1BMMH 4CBOA 1O3LA 1BTYA 2ZHEH 4UFGH 5GJ4B 5FBIA 1ANBA 1KXFA 2OC1A 1SQTA 3W94A 4U01A 2A4RA 5T6FA 4I31A 2P94A 3SI3H 4UFEH 2WINI 5AVDA 3GY2A 5ABWA 1Z6JH 1QA0A 1T32A 1TWXB 3NZIA 4IBLH 1JWTA 1TQ7B 4H6TA 1L4DA 4B75A 3JZ2B 1YPMH 2PHBA 1HUTH 1GBJA 1SGFA 1PJPA 2A5KA 1SGPE 1FIZA 1TMBH 1GMDG 1UVTH 1TABE 1G3EA 2GD4B 5GCHF 3HKIB 1NU9A 2P3TB 1TGCA 5L30H 2CMYA 3RMLH 2C93B 3LGWA 4FUGA 4KGAA 3A82A 1WBGB 1GHWH 1QQUA 1L2EA 3NPSA 6GCHG 5B6OA 3BTEE 4NIXA 3MU0A 1D6RA 2B5TB 1J15A 2QYIA 1RTLA 2JETC 2ZQ2A 3OYPA 3U1JB 4DURA 2XC0A 1ELEE 2B8OH 1DFPA 1EASA 1Z8GA 1NRSH 5GCHG 1ZOMA 3E6PH 3UIRA 1ZPBA 4XE4A 2A4OA 2G8TA 4XBCA 1DITH 1LHEH 3SNDA 5DKMA 4U30A 1Y5UT 1O2GH 4WF8A 1O3OA 1LQDB 2A0QB 1UTJA 1TFXA 1C5OH 1YYY1 1L1JA 1YCPH 4K5ZA 1HAVA 1V2RT 1BBRH 2AGEX 2QA9E 1YPEH 3VFEA 3B9FH 1TIOA 1OWIA 4B2CA 3F9HA 3V3MA 3BTDE 1GJ4H 4IN1A 3V13A 4ZKSU 1Z6EA 3GY8A 1OX1A 3UWJH 3PMJA 2G55A 2XYAA 1WTHD 1EAWA 3MNCA 2CXVA 1H1BA 4FU7A 2F9BH 2HNTC 5L2ZH 1BTPA 1AVWA 1MTSA 1QRZA 1XM1A 5CHAC 1BUIA 1O5CB 1Q2WA 2PW8H 5EODA 4A6LA 3KGPA 3TK5A 1F92A 1NFUA 2BX3A 2Y7XA 4X8UH 1BT7A 1LDTT 2R3UA 1YBWA 4BTUB 1SGIB 4KTUA 5CHAB 1V2TT 2F9VA 1V2LT 4BXSA 5DP4A 4CRAA 1QBNA 4UFFH 2ODQA 3VEQB 1C5WB 1ZMNA 2WUBA 1KTSB 3M3VA 2GKVE 5FAHA 3FZDA 1B5GH 3R3GB 3MH4A 4BAHB 2PTCE 1SGQE 1BA8B 1ZRKA 1EB2A 1AUJA 2SGEE 2WUCA 5EXLA 2ANKH 3RXOA 1W10U 3S9AA 1MCTA 5EW1H 1O2QA 2H5CA 3OY6U 2AYWA 3BN9A 3V12A 3ZZ5A 3ZV9A 4KKDA 1VJ9U 3TK9A 2BY6X 3ZVDA 2BD2A 3PM3A 2VWOA 2BD4A 4CRFA 1EB1H 4LXBH 4NCYA 1OXGA 5A8YA 3ZZCA 2D8WA 1ELVA 1PPBH 2ALVA 3ATKA 2FXRA 1FZZA 3QWCH 1OYTH 4I8JA 1N6XA 2AERH 4X2XA 3A89A 4ZHAA 1O5BB 3P8FA 1HAHH 1DT2A 3IITA 1VCPA 2FOHA 1XVOA 1AB9C 4MLFB 3S7HB 3UNQA 3ENSB 3KQEA 4HZHA 1INCA 2O8TA 2P3FH 1C5SA 1IQMA 1CVWH 2G4UA 1A61H 4O3UA 1FONA 1N8OB 1C5YB 4K69A 4AB8A 1C2JA 3SV7A 3S9CA 3H5CB 1LHCH 3QX5H 4FUEA 1N6YA 2PGBB 2RG3A 1TGBA 1QTFA 4E7RG 4JZFH 1BJVA 4X2WA 3LJJA 3V0XA 4DGJA 5JBCS 1QJ1B 1DPOA 3CENA 4CR9A 1GBFA 3S69A 4D76A 1C5UA 3Q3XA 4OS4A 3FZZA 1RS0A 4H42U 4AFZA 1SLVB 1P02A 1TNLA 1W8BH 5C1UA 4YOJA 1L1GA 2C8YB 2WPJS 1IQHA 3A7ZA 1HJAB 1EX3A 5FPYA 1KTTB 1MTVA 1RTKA 3F9EA 1QBOA 4FUCA 1LCYA 2FOFA 2ULLA 3L33A 1KXCA 2GZ8A 5A09A 1W13U 1ARCA 1UTLM 4ZUHA 1ZR0A 1H9LB 1HRTH 1O3PB 2H1UA 1GI9B 1DICA 5BRRE 3A7TA 1NC6A 1OS8A 5IYTA 1SQAA 1ZSJA 5HGGA 3RU4T 1GJAB 1Z8JB 3FAOA 4IC6A 2FS8A 1GI4A 3A8CA 2ZF0H 1GJDB 3S9BA 3LGVA 1O33A 1D3TB 3O8DA 3SGAE 1OP2A 2AGGX 1V2VT 3PO1C 1SGCA 2BB4A 1ZTKA 3EGKH 3NUMA 1C5PA 2Y80A 3E0PB 1ESTA 4VGCC 2J9NA 1C5NH 1ABJH 4D9QA 4K8BA 2PKSB 1OP8A 1O35A 1HB0B 3T26A 2F9UA 4AFUA 1O3IA 3KCGH 1QFKH 3LOXA 4IMZA 3NWUA 1XUFA 2O9QA 1ETSH 1NY22 4YTAA 1O2KA 1GJ5H 2OD3B 1GBLA 2BVRH 4AOQA 1FAXA 3BEUA 3RXGA 5AFZH 3K9XB 3R0FA 3D65E 3MU4A 2AH4X 2ZU5A 1GI7B 2FI4E 4DVAU 1AFQC 4AB9A 1W3CA 1ZHMA 3TGIE 1PYTC 3O8BA 1ZYOA 1IQGA 2C3SA 1QL7A 1NFXA 2OUAA 4WMFA 1A7SA 2GGVB 3UR6A 1AFQB 2Z7FE 3SU6A 1NRRH 1K1OA 2SGQE 2DE8A 2F91A 1ANCA 1O39A 2XW9A 3ZZAA 4TY6A 1VITH 1O3MA 3ZZ8A 3I77A 1AGJA 1OWDA 1C1OA 1WQSA 3GDSA 5JB9S 2XWBI 3FP7E 1VCQA 1B0FA 2Z94A 3P8OA 3SNEA 4E7NA 4R8TB 1P9UA 3RXFA 1AE5A 2BXUH 2W7SA 4K1SA 1NT1A 1P11E 3SUDA 4ZXXH 2Z9JA 1OKXA 1SFQB 1BHXF 1DE7H 1QB9A 3LKWA 1D3PB 2ILNA 2SNWA 1O5GH 4YT6H 2J95A 3VB4A 2H9TH 1V2QT 1ZJKA 2NU2E 4RKJB 4X1NU 1SR5C 2FP7B 1C1VH 1O3CA 2I6QA 3M7TA 2A45B 4DCDA 1LKBA 1ORFA 1TA2A 2Y5HA 4I8GA 2P16A 4ABIA 1CBWC 3CS0A 1OWJA 3ATWA 2VIPA 2WPLS 1PPFE 1G3CA 1O2NA 2AMPA 4IC5A 3VXEH 1XX9A 2C4FH 2D1JA 3Q76A 1RIWC 1C5XB 1DS2E 1LKAA 1FJSA 1THSH 1UVSH 2BD9A 2BMGB 2G5VA 3GCHC 2FESH 1C5RA 1AHTH 2OXSA 1H4WA 1CT4E 3E91A 4WH8A 1X7AC 5I25A 4HGCA 1LVMA 1S85A 1YGCH 1DVAH 5SGAE 4R0IA 1DWEH 1PPCE 4NGAH 1LVOA 2BOHB 2QC2A 1QL9A 5EG4A 4K8YA 2ZDAH 4K60A 2ZQ1A 1ESBA 1CA0C 2BDAA 4ISIH 4X8SH 1F0SA 1KXEA 1DM4B 5PTPA 4ESTE 2AFQB 3UUZA 1Z8RA 1BMLA 3RP2A 4BXWA 1V2PT 1SQOA 2GDEH 1TYNA 1Z8IB 2ZGBH 1GBMA 3TJVA 2TBSA 1CA0B 5DP7A 4CH2B 5C67A 2ZGHA 1HV7A 2NU1E 5JYIA 2ZEBA 3PLPA 4Y8ZA 1FY4A 2TIOA 3HGNA 3RLYH 1S0RA 2R3YA 1UHBB 3ZVAA 1MU6B 1DLEA 2WPMS 2QN5T 4CHAC 1A0HB 4TWYA 1HFDA 1GI1A 4Y6DA 2OINA 1IQLA 1S83A 4ZHLU 1HXFH 3A85A 1NU7B 1E0FD 1EZQA 2XC4A 5HM9A 2HGTH 3S0NA 2BLWA 2R9PA 1JMOH 2P8OB 1BTXA 1VZQH 1EPTC 3Q00A 4FUJA 4DG4A 2R0LA 3MNSA 3CP7A 1AY6H 1C9PA 1GBBA 5J4QA 2ZZUH 3T27A 3MH7A 1HAZB 1SGRE 1S6HA 3GDUA 5L2YH 1C2IA 2Y6TA 4NFFA 1AKSB 3SU4A 1ZMJA 4MDSA 2OQ5A 1BZXE 1DSUA 4D7FA 2O8MA 3BIUH 3LONA 2FYQA 1OYQA 1Y3WA 1ZTJA 4RSPA 1GL0E 4HTCH 4X6OA 5EPNA 1H8IH 2BDCA 1P10A 1Y59T 4YO9A 3SHCH 2JH6D 1LVBA 1H9IE 5IDKA 2W3IA 1O2ZA 2FOCA 1BRUP 1C2DA 1TQ0B 1ELFA 1EZUC 2ZGXH 3C1KA 4NIYA 2VIVA 3ZVBA 1GBCA 4X2YA 2G52A 1Z1IA 3SV8A 3SV6A 2BLVA 1A5IA 2P93A 2VB0A 1SHYA 1KLTA 2G4TA 1XKBC 1TNGA 3M5NA 2TRMA 2ZI2H 4JZIA 4ZKOU 1SG8B 9LPRA 2XBWA 3TNTA 4BNRA 1LO6A 2H5DA 2ZDVH 2PKAB 3ZZ7A 3BTFE 4ZROA 5EPYA 4XOJA 3FFGA 1LVYA 3PMHB 2IN2A 2ZFTA 6GCHF 5H4IB 1YP9A 3A7VA 5FXLA 3MU8A 3I78A 1FPCH 1K1NA 1YCPK 3HK3B 1BBRK 4ABGA 3SJ8A 1TGNA 1O2MA 1XMNB 4JZDH 2FO9A 1C9TA 4QT8C 2ODPA 3SQHE 2TGPZ 1CGIE 1O36A 3MO6A 2OTVA 2GTBA 5JBAS 1YPJH 3TJUA 2V0BA 4WVPE 1PFXC 3GICB 1YF4A 1GMCF 1TRYA 2GX4A 3RXUA 2VH6A 3BTME 1GHYH 3ITIA 1L0ZA 2TPIZ 1C1SA 1PQ7A 3MHWU 1WUNH 2CHAC 1F0TA 2Z9KA 3SU2A 1A2CH 2ZFQH 1HAOH 1TONA 3LH3A 1C1NA 2FTLE 1ANDA 3RXHA 4X8TH 2VWLA 1C5TA 5HXFA 1GBHA 3M7UA 4FXGH 1UK4A 4Y79A 2CHAB 3M7QA 2BDHA 2RA3A 1GG6C 1GJ6A 4IGDA 1AZZA 3PTBA 2JETB 1HAGE 1JBUH 3A8AA 5EU8A 3RM2H 2P59A 1GMCG 3M5MA 1RJXB 5DP3A 4UDWH 2H9EH 3STIA 3T62A 1NZQH 2CN0H 2Q6DA 2ZHFH 2LPRA 2G81E 3RC6A 1KYNA 1O5FH 1MBMA 1A5HA 1KXAA 1A0JA 3A84A 4ISLA 1GPZA 4YOIA 2M5TA 1A1RA 2GDDA 4X6NA 1SGEE 5F8TA 4OS5A 3RXMA 1AZ8A 1ZPZA 2QV1A 3KQBA 4CR5A 1JRTA 4NA7A 1C1WH 1O34A 4GPGA 1GHBF 4Q2KA 3A87A 4ABFA 2BLQA 4GLYA 1GDUA 3UOUA 5DP9A 1RRKA 2J34A 4I8LA 3TH3H 2V35A 1TBRH 4IS5A 3RXQA 1GGDC 3URDA 1V2MT 4I33A 3I29A 4U2WA 3URCA 1NRPH 2C90B 2Z3DA 1TOMH 3DFLA 1O3NA 3TH2H 1GI5A 3MI4A 1UHBA 1WTGH 1HPGA 1QGFA 2XXLA 5EXMA 5BPEA 3T25A 2PR3A 1IQJA 4B73A 4NSVA 1QL8A 1WYKA 1GDNA 3OSYA 4PROA 4ZMAH 1A46H 4MVNA 5TCAA 1O3EA 1SLXB 2NU3E 1Q31A 1UVPA 4TPIZ 2GT7A 2GMTC 2ZTZA 3SNAA 2BY7X 2IPHA 3EQ0H 1WV7H 1ZSLA 1NRNH 1E36B 2EC9H 4GSOA 1GHBG 2Y5FA 3KF2A 1HGTH 1O3JA 1MTNC 1MU8B 5GDSH 2Q6GA 4F4OC 2J94A 3LIWA 1QURH 5A0AE 1E38B 1MZDA 5FBEA 1TBZH 1AE8H 4X0WU 1P2JA 1U6QA 1AQ7A 2Z3EA 1AKSA 1OWKA 4MG3A 4NWLA 1HCGA 1SLWB 1B0EA 3MFJA 4UD9H 1VITF 1GHAG 3F9FA 4ZH8A 3RDZA 1UTKA 2AMQA 1MH0A 2GCTC 3ATLA 3CS7A 2A5IA 2J2UA 3EA7A 4X1PU 2Q1JA 5C2ZA 2XNIA 4OGYA 1QJ6B 1Y3XA 1GVZA 1OOKB 2FI3E 2V6NA 7KMEH 3RUOA 1DWDH 5TJXA 1EJMA 2O8WA 3M35A 1V2OT 3GY3A 1XUJA 1KLIH 1SOZA 4TWWA 3RU4D 1O3KA 1GL1A 3SHAH 4BAOB 1C2FA 3VB6A 1KDQB 4B2BA 3SUFA 1DXWA 4Y7BA 1TNJA 1BTUA 4IN2A 2J4IA 1VITG 5LH8A 2VWMA 7LPRA 4A92A 4MPUA 2C8WB 2PKAA 2BDYA 3F68H 1AB9B 1O2SA 1A0LA 2XBXA 4O97A 3SI4H 3U8TH 2RDLA 3TIUA 4BAKB 4LZ4B 3BSQA 2VIQA 8LPRA 1ZPCA 1EOLA 5E2OA 3EE0B 1EZXC 1W11U 2A7CA 4B74A 7GCHF 1O2UA 2OC0A 1O32A 2FODA 3DA9B 2AIQA 5DP5A 1E37B 5EOKA 2Y7ZA 2A1DB 1CHGA 3SNCA 1LHDH 3MYWA 5TCCA 4NZLA 4D9RA 4FUIA 2DUCA 3SJ9A 1Q3XA 3SORA 4DY7B 1F7ZA 1O2PA 1THRH 2XCFA 1N1LA 5HM2A 1HAPH 2PWXA 4FUDA 1ZGIA 3KNXA 1HJ9A 1P2IA 2SGFE 3QK1A 4JYTA 2BQ6B 1C1RA 1ELGA 2ZO3H 4Y8YA 2AS9A 3HPTB 1AD8H 4K3JA 3V7TA 3SU1A 1C2GA 1G9IE 3TLOA 2ZG0H 3SV2H 4JZ1A 2W5EA 1V2NT 3RXEA 7GCHG 1FXYA 5T6GA 2AEIH 2QXHA 3ZYDA 1SSXA 3G01A 3B23B 2BD8A 1UTPA 4AG1A 2R2MB 3M36A 1Z1JA 1AWHB 3BEIB 3ESTA 1L4ZA 1TRMA 1TNIA 1GCTC 1TOCB 4J2YB 1QR3E 5C5OA 3ZYEA 2F9OA 1CT0E 5A0BA 2C8XB 2ASUB 3Q3YA 4WMEA 1PPEE 1LMWB 1SGNE 3BTKE 3RXVA 3SU3A 2Y81A 4INKA 3A83A 4UEHH 5FHTA 3ZZ3A 1UTMA 2Y82A 1KXDA 1MKXK 4NG9H 3RM0H 4NIWA 1W7GH 4A1TA 2Z9IA 2GZ7A 1EOJA 1W2KH 3BTHE 3LU9B 1ARBA 1GHZA 4M7GA 5F03A 1D3QB 1NTPA 2UWPA 1SVPA 2Z9LA 4ISOA 4X1RU 4D8NA 1Y5BT 4H6SB 3GY6A 3RLWH 1QB1A 1P0SH 1ZZZA 3PO1B 4X1SU 3ZZ9A 3LGYA 4D7GA 3D49H 2FYRA 3MO9A 1Y3UA 1ACBE