5LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
total genus 51
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5lprA01
3C1KA 2FOEA 3GCTF 2HLCA 3A7XA 1C2KA 4HFPB 4AN7A 2PGQB 4YOIA 1C2JA 5EODA 3ZVFA 4ISOA 2FOAA 4NIYA 1GGDC 4K5ZA 1SVPA 1TGCA 4FVDA 3JZ1B 5HGGA 1UHBB 1EZUC 1V2VT 4RN6A 4DCDA 5DP8A 1NN6A 1AI8H 1TPOA 3BTFE 3IG6B 2H5CA 1O2VA 1TQ7B 1GMDG 2ZHWH 3MOCA 4WWYA 3P92A 3GYLB 1C9TA 1THSH 3PM3A 1HRTH 1MQ6A 1FJSA 5FCRA 1YCPM 1O31A 3VB4A 1LHCH 5DKMA 2J4IA 1BTZA 5GDSH 3SNAA 1FV9A 2OD3B 3P95A 3L3TA 1Z1JA 1C5XB 1A2CH 3UIRA 1OWHA 1NM6A 3MO9A 2BQ6B 2ZCLP 1VCPA 2OP9A 1PQ8A 1DOJA 1TGNA 1HB0B 2ZU4A 1OPHB 1C1MA 2QN5T 1DE7H 1K1IA 3MMGA 4AG2A 1GJCB 3M5MA 1Z71A 4LOYH 3TNTA 3IITA 2A31A 1IHSH 4X6OA 3HGNA 2BQWB 3URDA 1ZSLA 1TE0A 1O2OA 1EUFA 2V0BA 5EG4A 1QHRB 2FOCA 3SJOA 5EPNA 2KAIB 3BTDE 2OBQA 1GMHF 3GDVA 1W7XH 1P09A 1ZGIA 5BPEA 3UTUH 1GG6C 5GCHF 3AW0A 1Z8RA 3ATLA 1G3BA 2BDCA 2B9LA 1HAPH 3DFJA 1A46H 3SU4A 1EJNA 2ZPRA 2W7UA 1THRH 3ITIA 1HBTH 1AWFH 1SGNE 3ZZ9A 4BAQB 1GJDB 1T4UH 3TJOA 1TGSZ 4MPXA 1IQJA 3LGVA 2V3OH 1UVOA 1KXAA 2EI8A 3SGBE 3A82A 4ISNA 4TPIZ 3C27B 2H2ZA 5EQQA 3PLKA 3RXFA 3T62A 1QY6A 3LGWA 3M5NA 2IPHA 3BTHE 2PGBB 3NWUA 2PUXB 1HAXB 1HYLA 3HKIB 1UMAH 5F03A 5JBTA 3ATKA 3B9FH 1SGPE 1PQAA 4Q7ZA 1DSTA 1C5NH 1GBAA 2J94A 4BNRA 4K60A 1VGCC 1TPPA 5JDUB 1Z6JH 1GCDA 4K3JA 4ZKSU 1FIZA 1EOLA 1Y3VA 4YLUA 4B2BA 1Q3XA 1XVOA 2H5DA 1ETTH 4ZROA 6GCHF 1B0EA 1ZTJA 1QA0A 5JBBS 1IHTH 1T8LA 1A0JA 1L2EA 5F8TA 1PPBH 1AFEH 1C9PA 1EP6A 1ZLRA 1TBRH 4Y6DA 1TX7A 3PWCA 1YPHE 3M35A 4U2WA 2WYGA 3SI4H 2VIQA 4U32A 8GCHG 1JWTA 4ABAA 4WMFA 4YT7H 1FY4A 2WPIS 3A7ZA 5L30H 2ULLA 4ABJA 1GHZA 1V6DA 3H7TA 1O5FH 1IAUA 5GIBA 1BTXA 1HFDA 1MTSA 2OXSA 4TYDA 1IQMA 1QL7A 5F6MA 5C20A 2ZQ2A 4UONA 1GBBA 3UQVA 2ZHFH 4K8YA 2WINI 1VITG 1WAYB 4B71A 3UREA 2BY7X 3MO3A 2OUAA 2WYJA 1QR3E 3GY3A 2OTVA 2GCHF 2C3SA 1ELFA 1ABIH 1MAYA 4U01A 2ZDKA 2VIOA 2C8YB 3A85A 1AIXH 1ZMNA 4WVPE 2LPRA 1EATA 3RXVA 5GJ4B 2AERH 4A92A 1O0DH 5LPEA 1A61H 4NIVA 4VGCB 5AF9H 1GVZA 1MU8B 9ESTA 4GCHF 1BT7A 1AN1E 4BAMB 3HATH 1QJ6B 3E8LA 1YGCH 4LK4A 2P3TB 7ESTE 3O8CA 1HGTH 3G01A 2PV9B 5L6NH 1YPGH 4RKOB 2D2DA 2Y6TA 1LHEH 4MNXA 2F3CE 1BTYA 1L1JA 1GMDF 1THPB 4R8TB 1XUHA 4Y7AA 3QGNB 1AGJA 2XTTB 1V2RT 2G52A 2HNTE 1LHDH 1FY8E 1O3PB 4Q80A 1O2NA 2CGAA 2GZ9A 1LQDB 3KHVA 1PQ5A 3AASA 2CMYA 2ZCHP 2FESH 1RIWC 1K9OE 3STIA 1BTWA 3E6PH 1GMHG 2VIDA 3MTYA 4AGJA 4MDSA 1AZ8A 1XVMA 1CHOF 4GCHG 1C2IA 2NU0E 1EP5A 4ZHAA 1FQ3A 2XNIA 1KDQA 2BOHB 1RTFB 1C1SA 1ELBA 1HAIH 1L1GA 4PROA 5IYTA 2FMJA 3VEQB 4X6PA 1MD7A 1LVOA 2UUFB 1GHBF 3NPSA 2A4QA 1MKXK 3KN2A 2RA3A 3BTGE 3RU4T 3S9AA 1RXPA 4DIIH 2HPPH 2O8MA 3SNCA 1GDNA 3PTBA 1DWBH 2RDLA 5EOKA 1WUNH 1EB1H 1H1BA 3BG4C 1PPFE 4D9QA 1ETRH 1GI8B 1NTPA 2BDYA 1SL3A 2G5NA 4MPVA 1C4Y2 4ZKOU 2FS9A 2A5AA 1YC0A 3OU0A 1G36A 4ZH8A 2ZPQA 1QQ4A 2P59A 2C8XB 4D7FA 1C5YB 1UVUH 2ZA5A 1HAOH 3TNSA 1SOTA 4JZFH 1GI7B 4WXIA 3OYPA 1N1LA 1A0HB 1SGFG 4CH2B 3P8GA 4Y11E 3RMNH 2BX4A 1TGTA 1TNJA 1ZJKA 2FO9A 4BTIB 1C5ZB 1YP9A 1ZMJA 1NFXA 5C2ZA 2PTNA 2ZKSA 1Z6EA 5A0AE 2R3YA 1QL8A 2WPLS 3RXKA 1BITA 1DUAA 4NA8A 4X6NA 3E16B 3GCOA 4YOJA 2RG3A 2XCFA 4TWYA 1DWCH 4OS7A 3LJJA 4CHAC 5B6OA 1GHBG 1BMAA 2ZHQH 5E2PA 2CF8H 1DM4B 2ZFTA 1FLEE 2QXHA 1O3DA 3ZZBA 1ZZZA 4K2YA 3BN9A 2A32A 5FPTA 1N6YA 3UUZA 4CRDA 2BVRH 4NIWA 1BA8B 1TYNA 4XDEA 4DG4A 4AZ2B 4X2XA 1TX8A 1JRSA 1C1WH 1NFYA 2FEQH 1E35B 2Z6BD 2J92A 2JETB 2PR3A 2HPQH 1O2PA 1C1VH 3AW1A 1C5VA 1SLXB 4H42U 3GYMA 1GBLA 4NA7A 1OKXA 1GBFA 1UHBA 2XC5A 1L1NA 4J2YB 4ZAEA 2WPJS 1S6FA 1WOFA 1SG8B 2BDHA 3S9CA 1AWHB 1UVSH 2QGRA 1OWEA 2PUQH 4JK5A 2H9EH 4INLA 1TGBA 4JZDH 1JXPA 3Q76A 2FS8A 3H5CB 1C2FA 4OS5A 1SR5C 4DOQA 3I78A 5DO4H 3SUEA 1OWKA 1HAVB 4MPWA 1UTNA 1E36B 4XBBA 1NRSH 4HTCH 4X2WA 4CH8B 2A7JA 2D26C 2I6QA 1ZYOA 4FUEA 4AB8A 3JZ2B 2GCTC 2PSYA 3F68H 3RXIA 2FX4A 2TGDA 3TJUA 3LH3A 4LXBH 5T6DA 1TMUH 1EJMA 1QB1A 4YLQH 1K28D 3E3TA 2OC1A 1Y3XA 2FZZA 2CN0H 5DP3A 3V3MA 1UJ1A 1NFWA 2ANWA 1GJBB 8GCHF 1CGIE 1GMCF 4B1TA 3LJOA 1O5DH 3GCTG 1ANEA 1Y3WA 2JH6D 3BTQE 3MU1A 4I8HA 1WBGB 1ZHRA 2F9NA 1KIGH 1AB9C 1EPTC 4IMZA 4FUFA 4AFQA 3QN7A 4E7NA 5EW1H 1FPHH 1GBDA 4BAHB 3RXJA 2G8TA 4CR5A 1O5AB 4B2CA 1EJAA 3EAJA 2J2UA 1TABE 2ASUB 1MCVA 1GI5A 1WU1A 2WUBA 1AFQC 1T8MA 1TWXB 1D3QB 3KNXA 1BTUA 3SV7A 3E1XB 4U30A 1K1MA 2J34A 1LO6A 3GOVB 5K7RA 4DIHH 1XUGA 1NFUA 3QX5H 1UTMA 1ANCA 2PLXA 1WYKA 4DJZB 3R0FA 4MNYA 1MKXH 1FN8A 4IN2A 4O9VA 1BZXE 1PPHE 1A7SA 3GY4A 1QBOA 1ARBA 1W13U 4GVUA 3SZNA 3MHWU 1EZXC 3QZRA 2B0FA 4FU9A 1O36A 5F8ZA 3PMJA 1FONA 4KELA 1AUTC 1C5PA 1T7CA 2WPKS 1LHGH 3SQEE 1MTNB 2QYIA 1AFQB 2FX6A 3SV6A 1C5OH 2K1QA 2GTBA 4ZMAH 1F0RA 1C2DA 3K65B 1MTNC 4WH8A 1O2ZA 3HGPA 2ZWLH 4Y8YA 3RXQA 5HM9A 1OYTH 2A1DB 3TLOA 1BB0B 3TGJE 2B5TB 3EE0B 1GJ6A 3GY2A 1K1OA 4X2YA 4E06H 2ZU1A 1ZRBA 3RXDA 3KL6A 2SGPE 5DPAA 5LGOA 4FUBA 5E0JA 4CR9A 1PPZA 3PLBA 1NZQH 2PTCE 2VH6A 4NWKA 2OINA 4OS2A 4WF8A 2HNTF 2GKVE 2V6NA 5A2MH 4IGDA 5FX5A 5C1YA 5AVDA 2B8OH 3V12A 3RXOA 2Z3DA 1H4WA 2FTLE 2CJIA 4UFFH 1F7ZA 1F0SA 1SGFA 3RC4A 1NRPH 2D8WA 2P3UB 2GP9B 5LPFA 4YZUA 1IQLA 1W0ZU 3GISB 4JYTA 2P8OB 1SLVB 1FAXA 2Y7XA 3SJKA 2V3HH 4J1YA 4NSYA 3NK8A 3MH7A 2Y80A 1MBQA 3BTEE 2GZ8A 1O2GH 1UK4A 2W3KA 3NKKA 1AU8A 1GBIA 1Y59T 1V2TT 4ABEA 1XXDA 2Z9GA 2VVCA 5DP9A 3LT3A 3MWIU 1RTLA 2TPIZ 2XRCA 1DLEA 1YM0A 2GV7A 3EA9A 3OY5U 3RXUA 3MYWA 3GY5A 1OXGA 1JBUH 1UCYE 3RU4D 1C1PA 3SV8A 4CBNA 2BD8A 2HALA 4ABGA 1CA0B 3TU7H 2SNWA 3VFEA 1SGQE 1WSSH 1S6HA 1AD8H 1A3BH 2R2WU 3MNXA 4JCNA 1PPGE 2VNTA 4F4OC 1UO6A 4UFEH 1GVKB 3RXPA 1IQKA 1Y8TA 6LPRA 1O34A 1KTTB 3O8BA 2G5VA 6ESTA 1L4ZA 1KXFA 2BDGA 3F1SB 3SUGA 3UR9A 1XX9A 3UR6A 4CRAA 3RXEA 1UCYH 1A5HA 1G9IE 2FI4E 7LPRA 2ZC9H 3MU0A 4TY7A 1C1QA 1SC8U 2BY8X 2OBOA 1OWJA 4A1XA 2O8WA 1P2JA 3SUFA 4QT8C 3VB3A 5J4SA 9LPRA 1SGIB 5DP7A 3PLPA 2GX4A 1NO9H 4A1TA 1O3NA 3P70B 1QRZA 1N8OB 2FOBA 3KF2A 3ZZ7A 4DT7B 1MTWA 2AEIH 3HK6B 1MUEB 3PO1B 1NS3A 2ZU3A 4I7YH 1HLTH 1QTFA 3QO6A 5GCHG 5AFYH 5A8YA 2BVXH 1S83A 1UK2A 1GHXH 1DPOA 5FBEA 4CHAB 1YPMH 2XWAA 1A0LA 4AYVB 5A0BA 3M5LA 3SU0A 1BTPA 1HDTH 1O3KA 1ZPZA 1ESTA 4A5TS 3S0NA 1C5RA 3TVJB 3HPTB 5C3NA 2H9HA 4K1SA 1OSSA 4ABHA 1XMNB 2R0KA 1DWDH 3VXEH 1BJVA 1O3LA 3SOSA 4E7RG 2YNBA 4X1NU 1W10U 1CE5A 1HPGA 1CGHA 3GCHB 2A2XH 4E05H 3PMHB 1MQ5A 1UVTH 2I6SA 2NWNA 5EPYA 2GMTB 1KSNA 1QJ1B 1WTHD 1C1TA 2O8LA 4Q7YA 1W3CA 2XBXA 1GI4A 2UUYA 5DG6A 1UTKA 3SJIA 3UOPA 4A1VA 2J38A 4NIXA 1SHHB 1WV7H 2W5EA 4Y8ZA 3TH4H 4YO9A 2F9VA 3ZZAA 1ARCA 1QL9A 4Y71A 3RM0H 1FNIA 3BTWE 5F8XA 1NU7B 1W14U 4OS1A 1GMCG 2HGTH 4FUDA 4BTUB 1ELDE 2FXRA 1YBWA 1OP0A 4Y79A 4BXSA 1SGDE 4RKJB 2C93B 3HK3B 5E2OA 2NU4E 2OCVB 5G4BA 8KME2 1S5SA 3NCLA 3U9AH 4CBOA 4ZUHA 4WH6A 2QXIA 5TJXA 1E38B 3Q77A 1BUIA 3SU1A 1EOJA 4XFQA 4ZKRU 2Z3EA 1XXFA 4IN1A 4ABBA 2GV6A 4KTCA 2OC0A 3FAOA 3RC6A 1MKWH 2AMPA 5EQRA 1UTQA 1DY9A 3OSYA 5DK1A 3KEEA 1G32B 1BHXF 1ZTKA 5HXFA 1SGRE 3LH1A 1HJ8A 2AYWA 1MAXA 4FU8A 1V2PT 5CE1A 1O2YA 5C67A 3TK9A 5K0HA 2LNCA 4I8GA 1OX1A 2RA0A 1P2NA 4IMQA 4D7GA 2ANMH 1S84A 3MH4A 1GHVH 3ZVBA 1D4PB 3RMOH 4ABDA 4MLFB 3UPEA 2ILNA 5ETXA 3RP2A 1LTOA 3S69A 1ELAA 1VITF 3MU4A 2ODPA 2VVUA 2ZU5A 1ABJH 3SORA 1Y5AT 2ZFPH 1VITH 1QGFA 3FFGA 1O2WA 2H6MA 2P95A 3CS7A 1O3GA 1O3AA 3M7UA 1P04A 1Z7KA 5CHAB 1LVBA 4XOJA 1GL0E 2ANYA 4THNH 1WQVH 1TFXA 1FDPA 5EXLA 4ZHLU 1U6QA 1LCYA 1HAGE 1C1NA 1RJXB 1J15A 1HIAA 2ZDAH 4MPUA 4LZ4B 1K1NA 1PYTD 3L6PA 4X1RU 1O2TA 5IDKA 1PFXC 1DS2E 1C1OA 5H4IB 3SW2B 1LPKB 3U8TH 2G55A 2PKSC 4KTSA 1KDQB 2VGCB 4A6LA 3E90B 1C5MD 2XC4A 4NCYA 1SGEE 2EI7A 5DP4A 2BDAA 4MG3A 1O5BB 2Q6GA 2UWPA 3A7TA 2H9TH 4UFDH 1AUJA 1G37A 4Y7BA 3CS0A 2XC0A 1M9UA 1ID5H 2QAAA 1P2OA 3A89A 3EQ0H 2QXJA 3SNDA 1INCA 1ZGVA 1DUEA 2KAIA 1O2MA 4ZXXH 5PTPA 3F6UH 1EPTA 4FUHA 4X2VA 5ABWA 2THFB 4M7GA 2BXTH 1ZMLA 1O2JA 1HV7A 2BDIA 3STJA 3SGAE 1BMLA 1VJAU 1QB9A 3SGQE 3PV4A 1UCYK 1SLUB 1TAWA 1Y3UA 5DP5A 1UTLM 2Z9KA 3E0PB 2C8WB 2FODA 4HZHA 5JBAS 1P9UA 4D8NA 4CRFA 3D62A 2BY9X 2HNTC 5BRRE 1GI0A 1XM1A 1K1PA 1DXWA 3VB7A 4MTBA 4JMYA 2AS9A 3A7VA 3Q3XA 1QRWA 1RRKA 2BY5X 1SLWB 1O2XA 3L33A 7GCHG 5EXMA 4XE4A 1LKBA 3ZZ8A 3A80A 4UFGH 1JRTA 1A5IA 4K1EA 3BTME 4ZHMU 4X1PU 1P8VC 1EAIA 3RLYH 3BTKE 2A7CA 1SGYE 1BRBE 2G4TA 1DLKB 4AFZA 3P17H 1GJ5H 1ELEE 4I32A 1GVLA 3T27A 1O3MA 2ODQA 5EGMA 2G51A 2FYQA 3AVZA 1J17T 1TB6H 2ZZUH 1NRQH 1P9SA 2BVSH 2UUKB 1T31A 1BQYA 3LPRA 4NG9H 4ISIH 2BOKA 3M3VA 1GJ4H 2DE8A 2GCTB 3M5OA 5TCAA 1N6XA 1DT2A 2ZP0H 2JETC 3PMAB 1S85A 1DFPA 2QY0B 2SNVA 4HGCA 2VIPA 2C90B 3LKWA 2RCEA 1C4V2 3SU3A 1NT1A 2M5TA 4BAKB 2ZF0H 4FUIA 1IQFA 5A09A 1BDAA 2CF9H 4K69A 2GD4B 5GXPA 1O3IA 4AX9H 2AGGX 5DP6A 2P8OC 2D1JA 4KTUA 2IJOB 4I33A 2W26A 1NRRH 1CBWB 1HAZB 1QJ7B 3TH2H 1GBEA 2BLVA 1GHWH 2J9NA 3MFJA 2F9BH 1WTGH 3DHKH 3SU6A 1IQNA 2GCHG 3RXMA 5EW2H 4GSOA 1AVXA 1CGJE 4JYVH 3EA8A 1FY5A 4XSKU 1SGCA 3A81A 3RXBA 1GBMA 5AFZH 4BAOB 2FYRA 2C4FH 2TIOA 3SV9A 1O3FA 2W7SA 4INKA 3BIUH 2FLBH 1Y3YA 2QF0A 3NZIA 6CHAC 3S9BA 3DFLA 1YPJH 1YCPH 1GBCA 5JBCS 3RDZA 3FANA 1EZSC 1ORFA 1P2MA 1GBJA 2ALVA 1C2EA 1JMOH 1MZDA 2ZO3H 3TJVA 2P3FH 1TQ0B 1C2LA 2Z94A 2HRVA 2EC9H 3NXPA 1YPHC 3I77A 1V2WT 3RU4E 1T8OA 1LHFH 1W7GH 2BYAX 1W12U 5E8EH 1UVPA 1BMNH 1O2UA 3S7HB 1AE8H 1C5UA 1SFQB 1A1RA 1VCQA 3SBKA 2FTMA 4SGAE 3LDXH 1K21H 2BHGA 2FPZA 1TA6A 1TONA 1ESAA 5JB9S 4B74A 3A8BA 4UE7H 2BD7A 3A83A 1YF4A 2ZGJA 4DVAU 1O2SA 4ESTE 3AAVA 1O35A 3RXLA 2GDDA 2ZFQH 1FXYA 2BLQA 1CQQA 1LDTT 3RUOA 4ABIA 2A7HA 2BX3A 4IC6A 1C2HA 3N7OA 1O3OA 1FY1A 1DY8A 1D3DB 3ESTA 4AB9A 2O8UA 3ZVGA 4K1TA 2A5IA 4BTTB 3UNRA 1FN6A 2VIWA 3UNSA 1GG6B 4X8SH 1C4U2 3ZVDA 1H9IE 5HM2A 1P01A 4GUXA 1FZZA 3ENSB 1F5LA 4FUGA 4ISLA 2BM2A 1P0SH 1TBQH 1V2UT 4CRBA 2TBSA 4ZKNU 1FPCH 1UK3A 3Q00A 1BBRK 3LGTA 4O97A 1P02A 1MU6B 1GGDB 2V35A 2Z9LA 1OWDA 2XCNA 3ZYDA 1O5EH 1F5RA 1F2SE 1OS8A 1V3XA 1YPKH 3KQBA 3MH5A 1O2HA 1V2LT 3T28A 1D6WA 3KQCA 2W3IA 3ZVCA 2TRMA 3MO6A 1UTPA 3FP8E 1Z8GA 1TPAE 1SFIA 2R2MB 2XBVA 4NZLA 1TA2A 2OC7A 4FXGH 1C5QA 1DITH 1GCTB 3GY6A 5SGAE 1O2IA 3M7TA 3H7OA 2ZDVH 2CHAB 1GCTC 3SV2H 1D6RA 1BIOA 3DA9B 3NUMA 2R9PA 1PPCE 2BD9A 3W94A 1C2MA 3ZV9A 3UNQA 3BIVH 4NFFA 4WY3A 2OLGA 1W2KH 3A87A 2BZ6H 1HIAB 1AY6H 2NU1E 3RC5A 1FUJA 4FU7A 1CO7E 1O5GH 3B8JA 4DURA 5LH8A 1SBWA 1BOQA 1QA7A 3BF6H 1OYQA 1F0TA 1MD8A 1PYTC 3KQEA 4O3UA 2VWNA 1J14A 3A8AA 1K2I1 1EKBB 5T6GA 1ESBA 1EXFA 1BCUH 1HAYB 2AIQA 1E37B 5A8XA 1CSOE 3BTTE 3BSQA 2ZEBA 4Q7XA 1TRYA 3V7TA 1BRCE 3Q3YA 3W95A 3DT0H 1ANBA 2F91A 2BB4A 3VPKA 4IBLH 1MMJN 4Z0KA 3K6YA 1AVGH 3UWJH 5EXNA 2BQ7B 2BZAA 2C8ZB 4ISHH 4MNVA 3LGYA 3TPIZ 4WJG2 1EAXA 1YCPK 4TY6A 2HWLB 2WUCA 3V13A 2JH0D 2IOTA 1Y5UT 2QC2A 3RXAA 3VGCB 4DY7B 1EAUA 4FUJA 1GBTA 2VU8E 3ODFA 3PMBB 1SSXA 3A8CA 2GVFA 4WMDA 3ZZ3A 2WV5A 5L2YH 3I29A 3QDZB 7GCHF 1GI1A 2AMQA 1OP2A 2P93A 3PO1C 2QXGA 3LC5A 4H6SB 3SNBA 1TNHA 2STAE 1W8BH 3QK1A 3BEIB 2FIRH 1PQ7A 1UTJA 1T4VH 4Y0ZE 4AG1A 3KIDU 3D65E 1JIMA 1B5GH 2FDAA 4Y10E 2HVXA 1RTKA 1O38A 1QQUA 4YOGA 4ZXYH 2SFAA 3GCNA 5A8ZA 3AAUA 2DE9A 2VJ1A 3BG4B 1CT2E 3QZQA 1RIWB 1NESE 4DGJA 5C1UA 4B2AA 1GJ9B 1HAVA 1P06A 2OQ5A 5L2ZH 1D3PB 1P03A 1GPZA 1KTSB 1TMTH 2XBYA 4X8TH 3IWMA 3RXTA 1VR1H 2ZGHA 1GI9B 2WV4A 2XYAA 4X1SU 3QUMP 1IOEA 5FPSA 5FXLA 1CHOG 1BRAA 5HYOA 3PWBA 1V2MT 2Q1JA 1IQGA 4F49A 1B0FA 2ZDNA 3PYHA 1V2ST 1ZOMA 2ZGCA 5C5NA 3SI3H 3P8OA 2PSXA 1V2NT 3LGIA 3QGJA 2VIVA 3ZYEA 3SJ9A 3QWCH 3ZZ6A 3O8DA 1H8IH 4JK6A 3P6ZB 1S82A 2ZIQH 4H6TA 1V2OT 1SGTA 2JKHA 1C5TA 1CA0C 1NU9A 1RFNA 1TIOA 3ZZ4A 2YNAA 3MNSA 1AKSB 1J9CH 1C5WB 1V2KT 5EQSA 1QFKH 1TRMA 2TGPZ 1BTHH 1Y5BT 3A88A 1OP8A 3HKJB 5A0CA 1H9HE 2BXUH 3BEFB 3T2NA 2CXVA 1FY3A 5DGJA 1QNJA 4ASHA 3KGPA 2SGDE 3M36A 2BD5A 4MNWA 2AFQB 5FCKA 1WCZA 3ATIA 1ELVA 3VGCC 2Y7ZA 4OS6A 4K8BA 1A5GH 4D9RA 2FP7B 1MH0A 3QLPH 1Q31A 2P16A 1GJ7B 1P12E 3EGKH 4OS4A 1VCWA 1TPSA 3LGUA 2PKAB 3U98H 3UQOA 4UD9H 1K22H 2Q6FA 3F9EA 3MH6A 3SHCH 1EASA 1S81A 2BLWA 2NU3E 5GWZA 2Y82A 1RGQA 4FVBA 4BOHA 4CRGA 3FVFB 4IS5A 1T32A 2OC8A 3A86A 1O32A 2YOLA 4WXVA 3GCHC 5FBIA 1IQEA 1G30B 1KY9A 1GWAA 4RSPA 4GLYA 2A2QH 1FI8A 2BY6X 3P8NA 1GI3A 3LOXA 6GCHG 1KXCA 2GDEH 2EEKA 3CP7A 3M7QA 2A4OA 3Q3KA 4GPGA 1DXPA 2XWBI 1GDUA 3E0NB 1P2IA 3RMMH 1V2JT 3RXRA 2Z3CA 4X0WU 2DUCA 2XXLA 2FOFA 1G3EA 1TNGA 4INHA 1K1JA 1FMGA 1PJPA 1ZSKA 2PKSB 1T8NA 1JIRA 6CHAB 3QTVH 1KXEA 1SOZA 5JPMH 1O3BA 2QCYA 1GHYH 1O30A 3ZVAA 3T5FH 2O9QA 4CREA 2BD4A 1EX3A 2GZ7A 1MCTA 1IQHA 2FI3E 1YKTA 2CHAC 2P94A 5EU8A 5FAHA 3M61U 3U69H 1YLCA 1BHXB 1G3CA 5AHGH 1O2KA 4YESB 1XKBC 2BLOA 2WPHS 2A4RA 2FLRH 1AKSA 4OGYA 1GJAB 1V2QT 2ZTYA 2XBWA 3M3SA 1P2KA 4UDWH 1HUTH 2FOMB 4BANB 1RD3B 1P3EA 1LPZB 1HJAC 2Y5GA 5I25A 1C2GA 4UEHH 4X8UH 3EYDA 3GDSA 4YT6H 2ZDMA 4MQAA 1MKWK 3ZV8A 1GJ8B 2VH0A 2ZQ1A 3KCGH 3S7KB 2QIQA 3V0XA 2SGEE 3D23A 3MI4A 4Z6AH 1ZRKA 2QV1A 2WPMS 1E34B 1LPGB 3TIUA 1HCGA 2TGTA 1GL1A 3RXGA 1O3HA 5JYIA 1SMFE 1O2RA 1D3TB 1O3JA 2O8TA 2QA9E 1G2LA 1J16A 3GY8A 2PKAA 4NFEA 1XUFA 2AH4X 1TOMH 4JZIA 3O8RA 4VGCC 2QF3A 1GHAF 1P3CA 2Z7FE 1O37A 1G3DA 4X1QU 3TH3H 4NA9H 4Y8XA 3T25A 1ETSH 2AGEX 1GI2A 4KKDA 1NC6A 2FOHA 1ZHMA 3BG8A 1DDJA 5ESTE 5FX6A 1ZHPA 1TMBH 1AE5A 2ZGXH 1SPJA 1AHTH 4JZ1A 4GHQA 2A4GA 1LKAA 2IN2A 2SGFE 1ZPBA 4JZEH 1F92A 1SQOA 3VB6A 4NZQA 4Q2KA 1O3CA 3U1JB 3UWIA 3F9GA 1XUKA 2ESTE 1K1LA 1LVYA 3RM2H 4NGAH 4NSVA 3ZZCA 3TK5A 1SB1H 2GT7A 2VINA 2Y81A 2ANKH 1HXEH 3SO3A 1S0RA 1F5KU 4X6MA 4GHTA 2J95A 4KGAA 3GICB 1H9LB 1ANDA 2H1UA 3ODDA 1YPLH 4ABFA 3U8RH 1XUJA 2BTCE 3TJNA 1Q2WA 3TGIE 1GI6A 2ZCKP 1FIWA 2Y5HA 2VGCC 4AORA 1GBKA 2JH5D 4SGBE 1ELTA 1VGCB 2Q6DA 3ATWA 1KLIH 1VJ9U 3KQDA 4CRCA 1QB6A 3ELAH 1ACBE 3RMLH 1SQTA 1GHAG 2BD3A 4I8LA 2EI6A 2A5KA 2F9OA 3K9XB 1Z1IA 3EA7A 1CA8B 3BEUA 1JOUB 1LVMA 1BBRE 2TGAA 1MZAA 3FZZA 2F83A 1ELCA 1KLJH 1MBMA 3R3GB 3F9FA 1O2QA 4H4FA 3F9HA 4AFSA 1AZZA 5DJ7A 4XBCA 1O5CB 1O2LA 1UTOA 3PROA 1TRNA 3QTOH 2ZHEH 3A84A 3RXHA 1DVAH 1P2QA 2OQUA 4YM9A 3DD2H 1PPEE 3SN8A 1DX5M 3LU9B 5TCCA 3PTNA 3VXFH 2Z9JA 1ZPCA 3UOUA 2VVVA 3SQHE 1HNEE 1BJUA 4O03A 2UWOA 3RXSA 4GAWA 3ZZ5A 3SJ8A 2ALPA 3T26A 5CHAC 1P11E 1VZQH 1CHGA 5T6FA 1HJAB 1A3EH 1LMWB 2A45B 2ZFSA 1AMHA 1RS0A 1CT0E 1EQ9A 1TBZH 2SGAA 3TGKE 2ZU2A 3MU5A 1HJ9A 2A0QB 1YYY1 2VWOA 4BXWA 2GGVB 5CMXH 1QBNA 3DUXH 2CV3A 3A7YA 4I8KA 4NWLA 1C1UH 1N8OC 2ZDLA 4B75A 4KP0A 3ZVEA 1MTVA 2VWLA 1L4DA 1O39A 3RLWH 4XBDA 3D49H 4B73A 2ZTZA 3UY9A 1OWIA 3GDUA 1O3EA 2F9UA 1LQEA 3OTJE 3LIWA 5HMAA 5T3HA 4YTAA 1B7XB 1C1RA 1GBHA 1XUIA 1Z8IB 2BMGB 1NRNH 3ZZDA 1TNKA 2GT8A 3TITA 3A8DA 3GY7A 3SHAH 1W0YH 1C5SA 1XKAC 1AQ7A 2ZI2H 1SHYA 4WMEA 1DANH 3SU2A 2PHBA 2Y5FA 1O33A 2VWMA 4X8VH 1TNLA 4I8JA 1SI5H 8LPRA 1QCPA 1BMMH 4AFUA 1W11U 1F0UA 2ZFFH 3E91A 1AVWA 1G2MA 2BDBA 2GMTC 2NU2E 4DW2U 1WQSA 1QIXB 2UWLA 3FP7E 4TPYA 2Z9IA 4R0IA 5C5OA 1ELGA 1P57B 5J4QA 4AYYB 3TK6A 2STBE 2FM2A 1DSUA 4O3TA 2R3UA 1KYNA 2FI5E 2PFEA 3BV9B 1CVWH 3FZDA 2ZFRH 2ZHDA 2F9PA 1NROH 3M37A 3VB5A 4Y76A 4OGXA 1E0FD 2R0LA 1DWEH 1Z8JB 1TLDA 5ESBA 2PWXA 1EAWA 2VB0A 4HI3A 3U8OH 1S0QA 4MVNA 2AMDA 2ZPSA 1NPMA 1MTUA 2EA3A 1J8AA 3FP6E 1A4WH 1P10A 4TWWA 2ZNKH 2G4UA 1QRXA 1FAKH 3URCA 3UFAA 4FUCA 1OOKB 1AO5A 5FHTA 1YLDA 1TX6A 2FWWA 5JB8S 2AGIX 3PB1E 1X7AC 5FPYA 2ZTXA 5E0HA 2B7DH 3SU5A 3B23B 1YPEH 4AOQA 1DICA 1L0ZA 5C1XA 4LZ1H 2XW9A 4Y0YE 1C5LH 1ZSJA 1ZR0A 2ZGBH 1HXFH 1ZTLA 1TOCB 3OY6U 4IW4E 1HAHH 2G00A 3LONA 4D76A 2ODYB 2ZECA 2FOGA 1ZJDA 4AGKA 5I46H 2PW8H 4IC5A 1IQIA 3LC3A 3A7WA 3M3TA 1QBVH 4I31A 3U1IB 2AIPA 3SNEA 3OX7U 3K2UA 1KLTA 1NY22 1EB2A 3MU8A 4B76A 7KMEH 1GDQA 2ZG0H 1BRUP 1CBWC 2BD2A 1CT4E 3SUDA 3ATMA 5GPIB 2SGQE 3CENA 3K6ZA 3WY8A 3P8FA 1CU1A 1D9IA 8ESTE 2G81E 3RXCA 5E0GA 1EZQA 1P05A 1KXBA 1AB9B 1EPTB 2HOBA 1TNIA 1KXDA 4JYUH 1QURH 3MNCA 4A7IB 1BBRH 3EDXB 1SQAA 3T29A 5LPRA 3MNBA 1H8DH 2UUJB 1TALA
chains in the Genus database with same CATH superfamily
3C1KA 2FOEA 3GCTF 2HLCA 3A7XA 4TT3D 1C2KA 4HFPB 4AN7A 2PGQB 4YOIA 1C2JA 5EODA 3ZVFA 4ISOA 2FOAA 4NIYA 1GGDC 4K5ZA 1SVPA 1TGCA 4FVDA 3JZ1B 5HGGA 1UHBB 1EZUC 1V2VT 4RN6A 4DCDA 2V7QD 5DP8A 1NN6A 1AI8H 1TPOA 3BTFE 3IG6B 2H5CA 1O2VA 3PRDA 1TQ7B 1GMDG 2ZHWH 3MOCA 4WWYA 3P92A 3GYLB 1C9TA 2KM0A 1THSH 3PM3A 1HRTH 1MQ6A 1FJSA 5FCRA 1YCPM 4TSFD 1O31A 3VB4A 1LHCH 5DKMA 2J4IA 1BTZA 5GDSH 3SNAA 1FV9A 2OD3B 3P95A 5KECA 3L3TA 1Z1JA 1C5XB 1A2CH 3UIRA 1OWHA 1NM6A 3MO9A 2BQ6B 2ZCLP 1VCPA 2OP9A 1PQ8A 4ACAA 1DOJA 2IJD1 1TGNA 1HB0B 2ZU4A 1OPHB 1C1MA 2QN5T 1DE7H 1K1IA 3MMGA 4AG2A 1GJCB 3M5MA 1Z71A 4LOYH 3TNTA 3IITA 2A31A 1IHSH 4X6OA 3HGNA 2BQWB 3URDA 1ZSLA 1TE0A 1O2OA 1EUFA 2V0BA 5EG4A 1QHRB 2FOCA 3SJOA 5EPNA 2KAIB 3BTDE 5C94A 2K8IA 2OBQA 1GMHF 3GDVA 1W7XH 1P09A 1ZGIA 5BPEA 3UTUH 1GG6C 5GCHF 3AW0A 1Z8RA 3ATLA 1G3BA 2BDCA 1MABB 2B9LA 1HAPH 3DFJA 1A46H 3SU4A 1EJNA 2ZPRA 2W7UA 1THRH 3ITIA 1HBTH 1AWFH 1SGNE 3ZZ9A 4BAQB 1GJDB 1T4UH 3TJOA 3ZIAD 1TGSZ 4MPXA 1IQJA 3LGVA 2V3OH 1UVOA 1KXAA 2EI8A 1E1QD 3SGBE 3A82A 4ISNA 2PP6A 4TPIZ 3C27B 2H2ZA 5EQQA 3PLKA 3RXFA 3T62A 1QY6A 3LGWA 3M5NA 2IPHA 3BTHE 4ZCNA 2PGBB 3NWUA 2PUXB 1HAXB 1HYLA 3HKIB 1UMAH 5F03A 5JBTA 3ATKA 3B9FH 1SGPE 1PQAA 4Q7ZA 1DSTA 1C5NH 1GBAA 2J94A 3WW7A 2W6JD 4BNRA 4K60A 1VGCC 1TPPA 5JDUB 1Z6JH 1GCDA 4K3JA 4ZKSU 1FIZA 1EOLA 1Y3VA 4YLUA 4B2BA 1Q3XA 1XVOA 2H5DA 1ETTH 4ZROA 6GCHF 1B0EA 1ZTJA 1QA0A 5JBBS 1IHTH 1T8LA 1A0JA 1L2EA 5F8TA 1PPBH 1AFEH 1C9PA 1EP6A 1ZLRA 2YMSC 1TBRH 4Y6DA 1TX7A 3PWCA 2JJ2D 1YPHE 3M35A 4U2WA 2WYGA 3SI4H 2VIQA 4U32A 8GCHG 1JWTA 4ABAA 4WMFA 4YT7H 1FY4A 2WPIS 3A7ZA 1KMHB 5L30H 2ULLA 4ABJA 1GHZA 1V6DA 2QE7D 3H7TA 1O5FH 1IAUA 5GIBA 1BTXA 1HFDA 1MTSA 2OXSA 4TYDA 1IQMA 1QL7A 5F6MA 5C20A 2ZQ2A 4UONA 1GBBA 5FL7D 3UQVA 2ZHFH 4K8YA 2WINI 1VITG 1WAYB 4B71A 3UREA 2BY7X 3MO3A 2OUAA 2WYJA 1QR3E 3GY3A 2OTVA 2GCHF 2C3SA 1ELFA 1ABIH 1MAYA 4U01A 2ZDKA 2VIOA 2C8YB 3A85A 1AIXH 1ZMNA 4WVPE 2LPRA 1EATA 3RXVA 5GJ4B 3DSOA 2AERH 4A92A 1O0DH 5LPEA 1A61H 5CDFE 4NIVA 4VGCB 5AF9H 1GVZA 1MU8B 1COWD 5EJZA 9ESTA 4GCHF 1BT7A 1AN1E 4BAMB 3HATH 1QJ6B 3E8LA 1YGCH 4LK4A 2P3TB 2LP6A 7ESTE 3O8CA 1HGTH 3G01A 2PV9B 5L6NH 1YPGH 4RKOB 2D2DA 2Y6TA 2KCPA 1LHEH 4MNXA 2F3CE 1BTYA 1L1JA 1GMDF 1THPB 4R8TB 1XUHA 4Y7AA 3QGNB 1AGJA 2XTTB 1V2RT 2G52A 2HNTE 1LHDH 1FY8E 3N7EA 1O3PB 4Q80A 1O2NA 2J5UA 2CGAA 2GZ9A 1LQDB 3KHVA 1PQ5A 3AASA 2CMYA 2ZCHP 2FESH 1RIWC 1K9OE 3STIA 1BTWA 3E6PH 1GMHG 2VIDA 3MTYA 4AGJA 4MDSA 1AZ8A 1XVMA 2CK3D 1CHOF 4GCHG 1C2IA 2NU0E 1EP5A 4ZHAA 4B6EA 1FQ3A 1KDQA 2XNIA 2BOHB 1RTFB 1C1SA 1ELBA 1HAIH 1L1GA 4PROA 5IYTA 2FMJA 3VEQB 3F3BA 1MD7A 4X6PA 1LVOA 2UUFB 1GHBF 3NPSA 2A4QA 1MKXK 3KN2A 3F0PA 2RA3A 3BTGE 3RU4T 3S9AA 1RXPA 4DIIH 1NBME 2HPPH 2O8MA 3SNCA 1GDNA 3PTBA 1DWBH 2RDLA 5EOKA 1WUNH 1EB1H 1H1BA 3BG4C 1PPFE 4D9QA 1ETRH 1GI8B 1NTPA 2BDYA 1SL3A 2G5NA 4MPVA 1C4Y2 4ZKOU 2FS9A 2A5AA 1YC0A 3OU0A 1G36A 4ZH8A 2ZPQA 4OM9A 1QQ4A 2P59A 2C8XB 5CHBA 4D7FA 1C5YB 1UVUH 2ZA5A 1HAOH 3TNSA 1SOTA 3KQ5A 4JZFH 1GI7B 4WXIA 3OYPA 1N1LA 1A0HB 1SGFG 4CH2B 3P8GA 4Y11E 3RMNH 2BX4A 1TGTA 1TNJA 1ZJKA 2FO9A 4BTIB 1C5ZB 1YP9A 1OHHD 1ZMJA 1NFXA 5C2ZA 2PTNA 2ZKSA 1Z6EA 5A0AE 2R3YA 1QL8A 2WPLS 3RXKA 1BITA 1DUAA 4NA8A 4X6NA 3E16B 3GCOA 4YOJA 2RG3A 2XCFA 4TWYA 1DWCH 4OS7A 3LJJA 4CHAC 5B6OA 1GHBG 1BMAA 2ZHQH 5E2PA 2CF8H 1DM4B 2ZFTA 1FLEE 2QXHA 1O3DA 3ZZBA 1ZZZA 4K2YA 3BN9A 2A32A 5FPTA 1N6YA 3UUZA 4CRDA 2BVRH 4NIWA 1BA8B 1TYNA 4XDEA 4DG4A 4AZ2B 4X2XA 1TX8A 3OTPA 1JRSA 1C1WH 1NFYA 2FEQH 1E35B 2Z6BD 2J92A 2JETB 2PR3A 2HPQH 1O2PA 1C1VH 3AW1A 1C5VA 1SLXB 4H42U 3GYMA 1GBLA 4NA7A 1OKXA 1GBFA 1UHBA 2XC5A 1L1NA 2KR7A 4J2YB 4ZAEA 2WPJS 3CNRA 1S6FA 1WOFA 1SG8B 2BDHA 3EE7A 3S9CA 1AWHB 1UVSH 2QGRA 1OWEA 2PUQH 4JK5A 2H9EH 4INLA 1TGBA 4JZDH 1JXPA 3Q76A 2FS8A 3H5CB 1C2FA 4OS5A 1SR5C 4DOQA 3I78A 5DO4H 3SUEA 1OWKA 1HAVB 4MPWA 1UTNA 1E36B 4XBBA 1NRSH 4HTCH 4X2WA 4CH8B 2A7JA 2D26C 2I6QA 1ZYOA 4FUEA 4AB8A 3JZ2B 2GCTC 2PSYA 3F68H 3RXIA 2HLDD 2FX4A 1W0JD 2TGDA 3TJUA 3LH3A 4LXBH 5T6DA 1TMUH 1EJMA 1QB1A 2RDEA 4YLQH 1K28D 3E3TA 4HG6A 2OC1A 1Y3XA 2FZZA 2CN0H 5DP3A 3V3MA 1UJ1A 1NFWA 2ANWA 1GJBB 8GCHF 1CGIE 1GMCF 4B1TA 3LJOA 1O5DH 3GCTG 1ANEA 1Y3WA 2JH6D 3BTQE 3MU1A 4I8HA 1WBGB 1ZHRA 2F9NA 1KIGH 1AB9C 1EPTC 4IMZA 4FUFA 4AFQA 3QN7A 4E7NA 5EW1H 1FPHH 1GBDA 4BAHB 1K0HA 3RXJA 2G8TA 4CR5A 1O5AB 4B2CA 1EFRD 1EJAA 3EAJA 2EY4C 2J2UA 1TABE 2ASUB 1MCVA 1GI5A 1WU1A 2WUBA 1AFQC 1T8MA 1TWXB 3PV2A 1D3QB 3KNXA 1BTUA 3SV7A 3E1XB 4U30A 1K1MA 2J34A 1LO6A 3GOVB 5K7RA 5HIYA 1XUGA 4DIHH 1NFUA 3QX5H 1UTMA 1ANCA 2PLXA 1WYKA 4DJZB 3R0FA 4MNYA 1MKXH 1FN8A 2IPQX 4IN2A 4O9VA 1BZXE 1PPHE 1A7SA 3GY4A 1QBOA 1ARBA 5HIZA 1W13U 4GVUA 3SZNA 3MHWU 1EZXC 3QZRA 2B0FA 4FU9A 1O36A 5F8ZA 3PMJA 1FONA 4KELA 1AUTC 1C5PA 1T7CA 2WPKS 1LHGH 3SQEE 1MTNB 5DSFA 2QYIA 1AFQB 2FX6A 3SV6A 1C5OH 2K1QA 2GTBA 4ZMAH 1F0RA 1C2DA 3K65B 1MTNC 4WH8A 1O2ZA 3HGPA 2ZWLH 4Y8YA 3RXQA 2OK5A 5HM9A 1OYTH 2A1DB 3TLOA 1BB0B 3TGJE 2B5TB 3EE0B 1GJ6A 3GY2A 1K1OA 4X2YA 4E06H 2ZU1A 1ZRBA 3RXDA 3KL6A 2SGPE 5DPAA 5LGOA 4FUBA 5E0JA 4CR9A 1PPZA 3PLBA 1NZQH 2PTCE 2VH6A 4NWKA 2OINA 4OS2A 4WF8A 1H8HD 2HNTF 4XRNA 2GKVE 2V6NA 5A2MH 4IGDA 5FX5A 5C1YA 5AVDA 2B8OH 3V12A 3RXOA 2Z3DA 1H4WA 2FTLE 2CJIA 4UFFH 1F7ZA 1F0SA 1SGFA 3RC4A 1NRPH 2D8WA 2P3UB 2GP9B 5LPFA 4YZUA 1IQLA 1W0ZU 3GISB 4JYTA 2P8OB 1SLVB 2F4LA 1FAXA 2Y7XA 3SJKA 2V3HH 4J1YA 4NSYA 3N99A 3NK8A 3MH7A 2Y80A 1MBQA 3BTEE 4AC9A 2GZ8A 1O2GH 1UK4A 2W3KA 1S6LA 3NKKA 1AU8A 1GBIA 1Y59T 1V2TT 4ABEA 1XXDA 2Z9GA 2VVCA 5DP9A 3LT3A 3MWIU 2WV9A 1RTLA 2TPIZ 2XRCA 1DLEA 1YM0A 2GV7A 3EA9A 3OY5U 3RXUA 3MYWA 3GY5A 1OXGA 1JBUH 1UCYE 3RU4D 1C1PA 3SV8A 4CBNA 2BD8A 2HALA 4ABGA 1CA0B 3TU7H 2SNWA 3VFEA 1SGQE 3FOAA 3VG8A 5IK2D 3N7DA 1WSSH 1S6HA 1AD8H 1A3BH 2R2WU 3MNXA 4JCNA 1PPGE 2VNTA 4F4OC 1UO6A 4UFEH 1GVKB 3RXPA 1IQKA 1Y8TA 6LPRA 1O34A 1KTTB 3O8BA 2G5VA 6ESTA 1L4ZA 1KXFA 2BDGA 3F1SB 3SUGA 3UR9A 1XX9A 3UR6A 4CRAA 3RXEA 1UCYH 1A5HA 1G9IE 2FI4E 5C0TA 7LPRA 2ZC9H 3MU0A 4TY7A 1C1QA 1SC8U 2BY8X 2OBOA 1OWJA 4A1XA 2O8WA 1P2JA 3SUFA 4QT8C 3VB3A 5J4SA 9LPRA 1SGIB 5DP7A 3PLPA 2GX4A 1NO9H 4A1TA 1O3NA 3P70B 1QRZA 1N8OB 2FOBA 3KF2A 3ZZ7A 4DT7B 1MTWA 2AEIH 3HK6B 1MUEB 3PO1B 1NS3A 2ZU3A 2L6OA 4I7YH 1HLTH 1QTFA 3QO6A 5GCHG 3F2HA 5AFYH 5A8YA 2BVXH 1S83A 1UK2A 1GHXH 1DPOA 5FBEA 4CHAB 1YPMH 2XWAA 1A0LA 4AYVB 5A0BA 3M5LA 3SU0A 3AK5A 1BTPA 1HDTH 1O3KA 4P02A 1ZPZA 1ESTA 4A5TS 3S0NA 1C5RA 3TVJB 3HPTB 5C3NA 2H9HA 4K1SA 1OSSA 4ABHA 1XMNB 2R0KA 1DWDH 3VXEH 1BJVA 1O3LA 3SOSA 4E7RG 2YNBA 4X1NU 1W10U 1CE5A 1HPGA 1CGHA 3GCHB 2A2XH 4E05H 3PMHB 5GNDA 1MQ5A 1UVTH 2I6SA 2NWNA 5EPYA 2J97A 2GMTB 1KSNA 1QJ1B 1WTHD 1C1TA 2O8LA 2GJGA 4Q7YA 1W3CA 2XBXA 1GI4A 2UUYA 5DG6A 1UTKA 3SJIA 3UOPA 4A1VA 2J38A 4NIXA 1SHHB 1WV7H 2W5EA 2K0QA 4Y8ZA 3TH4H 4YO9A 2F9VA 3ZZAA 1ARCA 3FN8A 1QL9A 4Y71A 3RM0H 1FNIA 3BTWE 5F8XA 1NU7B 1W14U 4OS1A 1GMCG 2HGTH 4FUDA 4BTUB 2WSSD 1ELDE 2FXRA 1YBWA 1OP0A 4Y79A 4BXSA 1SGDE 4RKJB 2C93B 3HK3B 5E2OA 2NU4E 2OCVB 5G4BA 8KME2 1S5SA 3NCLA 3U9AH 4CBOA 4ZUHA 4WH6A 2QXIA 5TJXA 1WDIA 1E38B 3Q77A 1BUIA 3H09A 3SU1A 1EOJA 4XFQA 4ZKRU 2Z3EA 1XXFA 4IN1A 4ABBA 2GV6A 4KTCA 2OC0A 3FAOA 2YMSD 3RC6A 1MKWH 2AMPA 2J98B 5EQRA 1UTQA 1DY9A 3OSYA 5DK1A 3DSGA 3KEEA 1G32B 1BHXF 1ZTKA 5HXFA 1SGRE 3LH1A 1HJ8A 2AYWA 4FOUC 1MAXA 4FU8A 1V2PT 5CE1A 1O2YA 5C67A 3TK9A 5K0HA 2LNCA 4I8GA 1OX1A 2RA0A 1P2NA 4IMQA 4D7GA 2ANMH 1S84A 3MH4A 1GHVH 3ZVBA 1D4PB 3RMOH 4ABDA 4MLFB 3UPEA 2ILNA 5ETXA 3RP2A 1LTOA 3S69A 1ELAA 1VITF 3MU4A 2ODPA 2VVUA 2ZU5A 1ABJH 3OE7D 1WXRA 3SORA 1Y5AT 2ZFPH 1VITH 1QGFA 3FFGA 1O2WA 2H6MA 2P95A 3CS7A 2J98A 1O3GA 1O3AA 2F43B 3M7UA 1P04A 1Z7KA 5CHAB 1LVBA 4XOJA 1GL0E 2ANYA 4THNH 1WQVH 1TFXA 1FDPA 3SYJA 5EXLA 4ZHLU 1U6QA 1LCYA 1HAGE 1C1NA 1RJXB 1J15A 1HIAA 2ZDAH 4MPUA 4LZ4B 1K1NA 1PYTD 3L6PA 1W0KD 4X1RU 1O2TA 5IDKA 1PFXC 1DS2E 1C1OA 5H4IB 3SW2B 1LPKB 3U8TH 2G55A 2PKSC 4KTSA 1KDQB 2YMSB 2VGCB 4A6LA 3E90B 1C5MD 2XC4A 4NCYA 1SGEE 2EI7A 5DP4A 2BDAA 4MG3A 1O5BB 2Q6GA 2UWPA 3A7TA 2H9TH 4UFDH 1AUJA 1G37A 4Y7BA 3CS0A 2XC0A 1M9UA 1ID5H 2QAAA 1P2OA 3A89A 3EQ0H 2QXJA 3SNDA 4Z1MD 1INCA 1ZGVA 1DUEA 2KAIA 1O2MA 5EIYA 4ZXXH 5PTPA 3F6UH 1EPTA 4FUHA 4X2VA 5ABWA 2THFB 4M7GA 2BXTH 1ZMLA 1O2JA 1HV7A 2BDIA 3STJA 3SGAE 1BMLA 1VJAU 1QB9A 3SGQE 3PV4A 1UCYK 1SLUB 1TAWA 1Y3UA 5DP5A 1UTLM 2Z9KA 3E0PB 2C8WB 2FODA 4HZHA 5JBAS 1P9UA 4D8NA 4CRFA 3D62A 5T1VA 2BY9X 2HNTC 5BRRE 1GI0A 3FKSD 1XM1A 1K1PA 1DXWA 3KYFA 3VB7A 4MTBA 4JMYA 2AS9A 3A7VA 3Q3XA 1QRWA 1RRKA 2BY5X 1SLWB 4B6FA 1O2XA 3L33A 7GCHG 5EXMA 3WWFA 4XE4A 1LKBA 3ZZ8A 3A80A 4UFGH 1JRTA 1A5IA 4K1EA 3BTME 4ZHMU 4X1PU 1P8VC 1EAIA 3RLYH 3BTKE 2A7CA 1SGYE 1BRBE 2G4TA 1DLKB 4AFZA 3P17H 1GJ5H 1ELEE 4I32A 1GVLA 3T27A 1O3MA 2ODQA 2XOKD 5EGMA 2G51A 2FYQA 3AVZA 1J17T 1TB6H 2ZZUH 1NRQH 1P9SA 2BVSH 2UUKB 1T31A 1BQYA 3LPRA 4NG9H 4ISIH 2BOKA 3M3VA 1GJ4H 2DE8A 2GCTB 3M5OA 5TCAA 1N6XA 1DT2A 2ZP0H 2JETC 3PMAB 1S85A 1DFPA 2QY0B 2SNVA 4HGCA 2VIPA 2C90B 3LKWA 2RCEA 1C4V2 3SU3A 1NT1A 2M5TA 4BAKB 2ZF0H 4FUIA 1IQFA 5A09A 1BDAA 2CF9H 4K69A 2GD4B 5GXPA 1O3IA 4AX9H 2AGGX 5DP6A 2P8OC 2D1JA 4KTUA 2IJOB 4M9FA 4I33A 2W26A 1NRRH 1CBWB 1HAZB 1QJ7B 3TH2H 1GBEA 2BLVA 1E1RD 1GHWH 2J9NA 3MFJA 2F9BH 1WTGH 3DHKH 3OAAD 3SU6A 1IQNA 2GCHG 3RXMA 5EW2H 4GSOA 1AVXA 1CGJE 4JYVH 3EA8A 1FY5A 4XSKU 1SGCA 3A81A 3RXBA 1GBMA 5AFZH 4BAOB 2FYRA 2C4FH 2TIOA 4Q63A 3SV9A 1O3FA 2W7SA 4INKA 3BIUH 2FLBH 1Y3YA 2QF0A 3NZIA 6CHAC 3S9BA 3DFLA 1YPJH 1YCPH 1GBCA 2JDID 5JBCS 3RDZA 3FANA 1EZSC 1ORFA 1P2MA 4F55A 1GBJA 2ALVA 1C2EA 1JMOH 1MZDA 2ZO3H 3TJVA 2P3FH 4ASUD 1TQ0B 1C2LA 2Z94A 2HRVA 2EC9H 3NXPA 1YPHC 3I77A 1V2WT 3RU4E 1T8OA 1LHFH 1W7GH 2BYAX 1W12U 5E8EH 1UVPA 1BMNH 1O2UA 3S7HB 1AE8H 1C5UA 1SFQB 1A1RA 1VCQA 3SBKA 2FTMA 4SGAE 3LDXH 1K21H 2BHGA 2FPZA 1TA6A 1TONA 1ESAA 5JB9S 4B74A 3A8BA 4UE7H 2BD7A 3A83A 1YF4A 2ZGJA 4DVAU 1O2SA 4ESTE 3AAVA 1O35A 3RXLA 2GDDA 2ZFQH 1FXYA 2BLQA 1CQQA 1LDTT 4RT1A 3RUOA 5KGOA 4ABIA 2A7HA 2BX3A 3W1EA 4IC6A 1C2HA 3N7OA 1O3OA 2LELA 1FY1A 1DY8A 1D3DB 2W6ID 3ESTA 3FO8D 4AB9A 2O8UA 1UW7A 3ZVGA 4K1TA 2A5IA 4BTTB 3UNRA 1FN6A 2VIWA 3UNSA 1GG6B 4RT0A 4X8SH 1C4U2 3ZVDA 1H9IE 5HM2A 1P01A 1YWUA 4GUXA 1FZZA 3ENSB 1F5LA 4FUGA 4ISLA 2BM2A 1P0SH 1TBQH 1V2UT 4CRBA 2TBSA 4ZKNU 1FPCH 1UK3A 3Q00A 1BBRK 3LGTA 2XNDD 4O97A 1P02A 1MU6B 1GGDB 2V35A 2Z9LA 1OWDA 2XCNA 3ZYDA 1O5EH 1F5RA 2WHXA 1F2SE 1OS8A 1V3XA 1YPKH 3KQBA 3MH5A 1NBMD 3F0OA 1O2HA 1V2LT 3T28A 1D6WA 3KQCA 2W3IA 3ZVCA 2TRMA 3MO6A 1UTPA 3FP8E 1Z8GA 1TPAE 1SFIA 3F2FA 2R2MB 2XBVA 4NZLA 1TA2A 2OC7A 4FXGH 1C5QA 1DITH 1GCTB 3GY6A 5SGAE 1O2IA 3M7TA 3H7OA 2ZDVH 2CHAB 1GCTC 3SV2H 1D6RA 1BIOA 3DA9B 3NUMA 2R9PA 1PPCE 2BD9A 3W94A 1C2MA 3ZV9A 3UNQA 3BIVH 4NFFA 4WY3A 2OLGA 1W2KH 3A87A 2BZ6H 1HIAB 1AY6H 2NU1E 3RC5A 1FUJA 4FU7A 1CO7E 1O5GH 3B8JA 4DURA 5LH8A 1SBWA 1BOQA 1QA7A 3BF6H 1OYQA 1F0TA 1MD8A 1PYTC 3KQEA 4O3UA 2VWNA 1J14A 3A8AA 1K2I1 1EKBB 5T6GA 1ESBA 1EXFA 1BCUH 1HAYB 2EQNA 2AIQA 3PRBA 1E37B 5A8XA 1CSOE 3BTTE 3BSQA 2ZEBA 4Q7XA 1TRYA 3V7TA 1BRCE 3Q3YA 3W95A 3DT0H 1ANBA 2F91A 2BB4A 3VPKA 2WZQA 5DN6D 4IBLH 1MMJN 4Z0KA 3K6YA 1AVGH 3UWJH 5EXNA 2BQ7B 2BZAA 2C8ZB 4ISHH 4MNVA 3LGYA 3TPIZ 4WJG2 1EAXA 1YCPK 3WWBA 4TY6A 2HWLB 2WUCA 3V13A 2JH0D 2IOTA 2WPDD 1Y5UT 2QC2A 3RXAA 3VGCB 4DY7B 1EAUA 4FUJA 2AHME 1GBTA 2VU8E 3ODFA 3PMBB 1SSXA 3A8CA 2GVFA 4WMDA 3ZZ3A 2WV5A 5L2YH 3OEHD 3I29A 3QDZB 7GCHF 1GI1A 2AMQA 1OP2A 2P93A 3PO1C 2QXGA 3LC5A 4H6SB 3SNBA 1TNHA 2STAE 1W8BH 3QK1A 3BEIB 2FIRH 1PQ7A 1UTJA 1T4VH 4Y0ZE 4AG1A 3KIDU 3D65E 1JIMA 1B5GH 2FDAA 4Y10E 2HVXA 1RTKA 1O38A 1QQUA 4YOGA 4ZXYH 2SFAA 3GCNA 2KFWA 5A8ZA 3AAUA 2DE9A 2VJ1A 3BG4B 1CT2E 3QZQA 1RIWB 1NESE 4DGJA 5C1UA 4B2AA 1GJ9B 1HAVA 1P06A 2OQ5A 5L2ZH 1D3PB 1P03A 1GPZA 1KTSB 1TMTH 2XBYA 4X8TH 3IWMA 3RXTA 1VR1H 2ZGHA 4P00A 1GI9B 2WV4A 2XYAA 4X1SU 3QUMP 1IOEA 5FPSA 5FXLA 1CHOG 1BRAA 5HYOA 3PWBA 2HVYB 1V2MT 2Q1JA 1IQGA 4F49A 1B0FA 2ZDNA 3PYHA 1V2ST 1ZOMA 2ZGCA 5C5NA 3SI3H 4FETA 3P8OA 5B6LA 2PSXA 1V2NT 3LGIA 3QGJA 2VIVA 3ZYEA 3SJ9A 3QWCH 3ZZ6A 3O8DA 1H8IH 4JK6A 3P6ZB 1S82A 2ZIQH 4H6TA 1V2OT 1SGTA 2JKHA 1C5TA 1CA0C 1NU9A 1RFNA 1TIOA 3ZZ4A 2YNAA 3MNSA 1AKSB 1J9CH 1C5WB 1V2KT 1FX0B 5EQSA 1QFKH 1TRMA 1YLNA 2TGPZ 1BTHH 1Y5BT 3A88A 1OP8A 3HKJB 5A0CA 1H9HE 2BXUH 3BEFB 3T2NA 2CXVA 3MQKC 1FY3A 5DGJA 1QNJA 4ASHA 5HKKD 3KGPA 2SGDE 3M36A 2BD5A 4MNWA 2AFQB 5FCKA 1WCZA 3ATIA 1ELVA 3VGCC 3F2GA 2Y7ZA 4OS6A 4K8BA 1A5GH 4D9RA 2FP7B 1MH0A 3QLPH 1Q31A 3UAIC 2P16A 1GJ7B 5C0UA 1P12E 3EGKH 4OS4A 2VBCA 1VCWA 1TPSA 3LGUA 2PKAB 2KCYA 3U98H 3UQOA 3DSPA 4UD9H 1K22H 2Q6FA 3F9EA 3MH6A 3SHCH 1EASA 1S81A 2BLWA 4YXWD 2NU3E 5GWZA 2V3MA 2Y82A 1RGQA 4FVBA 4BOHA 4CRGA 3FVFB 2JJ1D 4IS5A 1T32A 2OC8A 3A86A 1O32A 2YOLA 4WXVA 3GCHC 5FBIA 1IQEA 1G30B 1KY9A 1GWAA 5EJLA 4RSPA 4GLYA 2A2QH 1FI8A 2BY6X 3P8NA 1GI3A 3LOXA 6GCHG 1KXCA 2GDEH 2EEKA 3CP7A 3M7QA 2A4OA 3Q3KA 4GPGA 1DXPA 2XWBI 1GDUA 3E0NB 1P2IA 3RMMH 1SKYE 1V2JT 3RXRA 2Z3CA 4X0WU 2DUCA 2XXLA 2FOFA 1G3EA 1TNGA 4INHA 1K1JA 1FMGA 1PJPA 1ZSKA 2PKSB 1T8NA 1JIRA 6CHAB 3QTVH 1KXEA 1SOZA 5JPMH 1O3BA 2QCYA 1GHYH 1O30A 3ZVAA 3T5FH 2O9QA 4CREA 2BD4A 1EX3A 2KCOA 2GZ7A 4Q4LA 1MCTA 1IQHA 2FI3E 1YKTA 2CHAC 2P94A 3NRLA 5EU8A 5FAHA 3M61U 3U69H 1YLCA 1BHXB 1G3CA 5AHGH 1O2KA 4YESB 1XKBC 2BLOA 2WPHS 2A4RA 2FLRH 1AKSA 4OGYA 1GJAB 1V2QT 2ZTYA 2XBWA 3M3SA 1P2KA 4UDWH 1HUTH 2FOMB 4BANB 1RD3B 1YY3A 1P3EA 1LPZB 1HJAC 2Y5GA 5I25A 1C2GA 4UEHH 4X8UH 3EYDA 3GDSA 4YT6H 3SZEA 2ZDMA 4MQAA 1MKWK 3ZV8A 1GJ8B 2KCAA 2VH0A 2ZQ1A 3KCGH 3S7KB 2QIQA 3V0XA 2SGEE 3D23A 3MI4A 4Z6AH 1ZRKA 5F53A 2QV1A 2WPMS 1E34B 1LPGB 3TIUA 1HCGA 2TGTA 1GL1A 3RXGA 1O3HA 1QZ8A 5JYIA 1SMFE 1O2RA 1D3TB 1O3JA 2O8TA 3DCLA 2QA9E 1G2LA 1J16A 3GY8A 2PKAA 4NFEA 1XUFA 2AH4X 1TOMH 4JZIA 3O8RA 4VGCC 2QF3A 1GHAF 1P3CA 2Z7FE 1O37A 1G3DA 4X1QU 3TH3H 4NA9H 4Y8XA 3T25A 1ETSH 2AGEX 1GI2A 4KKDA 1NC6A 2FOHA 1ZHMA 3BG8A 3OEED 1DDJA 5ESTE 5FX6A 1ZHPA 1TMBH 1AE5A 2ZGXH 1SPJA 1AHTH 4JZ1A 4GHQA 2A4GA 1LKAA 2IN2A 2SGFE 1ZPBA 4JZEH 1F92A 1SQOA 3VB6A 4NZQA 4Q2KA 1O3CA 3U1JB 3UWIA 3F9GA 1XUKA 3KYGA 1BMFD 2ESTE 1K1LA 1E79D 1LVYA 3RM2H 4NGAH 4NSVA 3ZZCA 3TK5A 1SQRA 1SB1H 2GT7A 2VINA 2Y81A 2ANKH 1HXEH 3SO3A 1S0RA 1F5KU 4X6MA 4GHTA 2J95A 4DT4A 4KGAA 3GICB 1H9LB 1ANDA 2H1UA 3ODDA 1YPLH 4ABFA 3U8RH 1XUJA 2BTCE 3TJNA 1Q2WA 3PV5A 3TGIE 1GI6A 2ZCKP 1FIWA 2Y5HA 2VGCC 4AORA 1GBKA 2JH5D 4SGBE 1ELTA 1VGCB 2Q6DA 3ATWA 1KLIH 1VJ9U 3KQDA 4CRCA 3UB0A 1QB6A 3ELAH 1ACBE 3RMLH 1SQTA 1GHAG 2BD3A 4I8LA 2EI6A 3U28C 2A5KA 4F48B 2F9OA 3K9XB 1Z1IA 3EA7A 1CA8B 3BEUA 1JOUB 1LVMA 2L74A 1BBRE 3OFND 4RI0A 2TGAA 1MZAA 3FZZA 2F83A 1ELCA 1KLJH 5C17A 1MBMA 3R3GB 3F9FA 1O2QA 4H4FA 3F9HA 4AFSA 1AZZA 5DJ7A 2KX4A 4XBCA 1O5CB 1O2LA 1UTOA 3PROA 2M2AA 1TRNA 3QTOH 2ZHEH 3A84A 3RXHA 1DVAH 1P2QA 2OQUA 4YM9A 3DD2H 1PPEE 3SN8A 1DX5M 3LU9B 5TCCA 3PTNA 3VXFH 2Z9JA 1ZPCA 4I86A 3UOUA 2VVVA 3SQHE 1HNEE 1BJUA 4O03A 2QF4A 2UWOA 3RXSA 4GAWA 3ZZ5A 3SJ8A 2ALPA 3T26A 5CHAC 1P11E 2KZ4A 1VZQH 1CHGA 5T6FA 1HJAB 1A3EH 1LMWB 2A45B 2ZFSA 1AMHA 1RS0A 1CT0E 1EQ9A 1TBZH 2SGAA 3TGKE 1H8ED 2ZU2A 3MU5A 1HJ9A 5KEDA 2A0QB 1YYY1 2VWOA 4BXWA 2GGVB 5CMXH 1QBNA 3DUXH 2CV3A 3A7YA 4I8KA 4NWLA 1C1UH 1N8OC 2ZDLA 4B75A 2QF5A 4KP0A 3ZVEA 1MTVA 2VWLA 1L4DA 1O39A 3RLWH 4XBDA 3D49H 4B73A 2ZTZA 3UY9A 1OWIA 3GDUA 1O3EA 2F9UA 1LQEA 3OTJE 3LIWA 5HMAA 5T3HA 3GS9A 4YTAA 1B7XB 1C1RA 1GBHA 1XUIA 1Z8IB 2BMGB 1NRNH 3ZZDA 1TNKA 2GT8A 3TITA 3A8DA 3GY7A 3SHAH 1W0YH 1C5SA 2JIZD 1XKAC 1AQ7A 2ZI2H 1SHYA 1VKYA 4WMEA 1DANH 3SU2A 2PHBA 2Y5FA 1O33A 2VWMA 4X8VH 1TNLA 4I8JA 1SI5H 8LPRA 1QCPA 1BMMH 4AFUA 1W11U 1F0UA 2ZFFH 3E91A 1AVWA 1G2MA 2BDBA 2GMTC 2NU2E 4DW2U 1WQSA 1QIXB 2UWLA 3FP7E 4TPYA 2Z9IA 4R0IA 5C5OA 1ELGA 1P57B 5J4QA 4AYYB 3TK6A 2STBE 2FM2A 1DSUA 4O3TA 2R3UA 1KYNA 2FI5E 2PFEA 3BV9B 1CVWH 3FZDA 2ZFRH 2ZHDA 2F9PA 1NROH 3M37A 3VB5A 4Y76A 4OGXA 1E0FD 2R0LA 1DWEH 1Z8JB 1TLDA 5ESBA 2PWXA 1EAWA 2VB0A 4HI3A 3U8OH 1S0QA 4MVNA 2AMDA 2ZPSA 1NPMA 1MTUA 2EA3A 1J8AA 3FP6E 1A4WH 1P10A 4TWWA 2ZNKH 2G4UA 1QRXA 1FAKH 3URCA 3UFAA 4FUCA 1OOKB 1AO5A 5FHTA 1YLDA 1TX6A 2FWWA 5JB8S 2AGIX 3PB1E 1X7AC 5FPYA 2ZTXA 5E0HA 2B7DH 3SU5A 3B23B 1YPEH 4AOQA 1DICA 1L0ZA 5C1XA 4LZ1H 2XW9A 4Y0YE 2RFKC 1C5LH 1ZSJA 1ZR0A 2ZGBH 1HXFH 1ZTLA 1TOCB 3OY6U 4IW4E 1HAHH 2G00A 3LONA 4D76A 2ODYB 2ZECA 2FOGA 5EJ1A 1ZJDA 4AGKA 5I46H 2PW8H 4IC5A 1IQIA 3LC3A 3A7WA 3M3TA 1QBVH 4I31A 3U1IB 2AIPA 3SNEA 3OX7U 3K2UA 1KLTA 1NY22 1EB2A 3MU8A 4B76A 7KMEH 1GDQA 2ZG0H 1BRUP 1CBWC 2BD2A 1CT4E 3SUDA 3ATMA 5GPIB 4ACBA 2SGQE 4XD7D 3CENA 3K6ZA 3WY8A 3P8FA 1CU1A 1D9IA 8ESTE 2G81E 3RXCA 5E0GA 1EZQA 1P05A 1KXBA 1AB9B 1EPTB 2HOBA 1TNIA 1KXDA 4JYUH 1QURH 3MNCA 4A7IB 1BBRH 3EDXB 1SQAA 3T29A 5LPRA 3MNBA 1H8DH 2UUJB 1TALA
chains in the Genus database with same CATH topology
3C1KA 2FOEA 3GCTF 2HLCA 3A7XA 1C2KA 4HFPB 4AN7A 2PGQB 4YOIA 1C2JA 5EODA 3ZVFA 4ISOA 2FOAA 4NIYA 1GGDC 4K5ZA 1SVPA 1TGCA 4FVDA 3JZ1B 5HGGA 1UHBB 1EZUC 1V2VT 4RN6A 4DCDA 5DP8A 1NN6A 1AI8H 1TPOA 3BTFE 3IG6B 2H5CA 1O2VA 1TQ7B 1GMDG 2ZHWH 3MOCA 4WWYA 3P92A 3GYLB 1C9TA 1THSH 3PM3A 1HRTH 1MQ6A 1FJSA 5FCRA 1YCPM 1O31A 3VB4A 1LHCH 5DKMA 2J4IA 1BTZA 5GDSH 3SNAA 1FV9A 2OD3B 3P95A 3L3TA 1Z1JA 1C5XB 1A2CH 3UIRA 1OWHA 1NM6A 3MO9A 2BQ6B 2ZCLP 1VCPA 2OP9A 1PQ8A 1DOJA 1TGNA 1HB0B 2ZU4A 1OPHB 1C1MA 2QN5T 1DE7H 1K1IA 3MMGA 4AG2A 1GJCB 3M5MA 1Z71A 4LOYH 3TNTA 3IITA 2A31A 1IHSH 4X6OA 3HGNA 2BQWB 3URDA 1ZSLA 1TE0A 1O2OA 1EUFA 2V0BA 5EG4A 1QHRB 2FOCA 3SJOA 5EPNA 2KAIB 3BTDE 2OBQA 1GMHF 3GDVA 1W7XH 1P09A 1ZGIA 5BPEA 3UTUH 1GG6C 5GCHF 3AW0A 1Z8RA 3ATLA 1G3BA 2BDCA 2B9LA 1HAPH 3DFJA 1A46H 3SU4A 1EJNA 2ZPRA 2W7UA 1THRH 3ITIA 1HBTH 1AWFH 1SGNE 3ZZ9A 4BAQB 1GJDB 1T4UH 3TJOA 1TGSZ 4MPXA 1IQJA 3LGVA 2V3OH 1UVOA 1KXAA 2EI8A 3SGBE 3A82A 4ISNA 4TPIZ 3C27B 2H2ZA 5EQQA 3PLKA 3RXFA 3T62A 1QY6A 3LGWA 3M5NA 2IPHA 3BTHE 2PGBB 3NWUA 2PUXB 1HAXB 1HYLA 3HKIB 1UMAH 5F03A 5JBTA 3ATKA 3B9FH 1SGPE 1PQAA 4Q7ZA 1DSTA 1C5NH 1GBAA 2J94A 4BNRA 4K60A 1VGCC 1TPPA 5JDUB 1Z6JH 1GCDA 4K3JA 4ZKSU 1FIZA 1EOLA 1Y3VA 4YLUA 4B2BA 1Q3XA 1XVOA 2H5DA 1ETTH 4ZROA 6GCHF 1B0EA 1ZTJA 1QA0A 5JBBS 1IHTH 1T8LA 1A0JA 1L2EA 5F8TA 1PPBH 1AFEH 1C9PA 1EP6A 1ZLRA 1TBRH 4Y6DA 1TX7A 3PWCA 1YPHE 3M35A 4U2WA 2WYGA 3SI4H 2VIQA 4U32A 8GCHG 1JWTA 4ABAA 4WMFA 4YT7H 1FY4A 2WPIS 3A7ZA 5L30H 2ULLA 4ABJA 1GHZA 1V6DA 3H7TA 1O5FH 1IAUA 5GIBA 1BTXA 1HFDA 1MTSA 2OXSA 4TYDA 1IQMA 1QL7A 5F6MA 5C20A 2ZQ2A 4UONA 1GBBA 3UQVA 2ZHFH 4K8YA 2WINI 1VITG 1WAYB 4B71A 3UREA 2BY7X 3MO3A 2OUAA 2WYJA 1QR3E 3GY3A 2OTVA 2GCHF 2C3SA 1ELFA 1ABIH 1MAYA 4U01A 2ZDKA 2VIOA 2C8YB 3A85A 1AIXH 1ZMNA 4WVPE 2LPRA 1EATA 3RXVA 5GJ4B 2AERH 4A92A 1O0DH 5LPEA 1A61H 4NIVA 4VGCB 5AF9H 1GVZA 1MU8B 9ESTA 4GCHF 1BT7A 1AN1E 4BAMB 3HATH 1QJ6B 3E8LA 1YGCH 4LK4A 2P3TB 7ESTE 3O8CA 1HGTH 3G01A 2PV9B 5L6NH 1YPGH 4RKOB 2D2DA 2Y6TA 1LHEH 4MNXA 2F3CE 1BTYA 1L1JA 1GMDF 1THPB 4R8TB 1XUHA 4Y7AA 3QGNB 1AGJA 2XTTB 1V2RT 2G52A 2HNTE 1LHDH 1FY8E 1O3PB 4Q80A 1O2NA 2CGAA 2GZ9A 1LQDB 3KHVA 1PQ5A 3AASA 2CMYA 2ZCHP 2FESH 1RIWC 1K9OE 3STIA 1BTWA 3E6PH 1GMHG 2VIDA 3MTYA 4AGJA 4MDSA 1AZ8A 1XVMA 1CHOF 4GCHG 1C2IA 2NU0E 1EP5A 4ZHAA 1FQ3A 2XNIA 1KDQA 2BOHB 1RTFB 1C1SA 1ELBA 1HAIH 1L1GA 4PROA 5IYTA 2FMJA 3VEQB 4X6PA 1MD7A 1LVOA 2UUFB 1GHBF 3NPSA 2A4QA 1MKXK 3KN2A 2RA3A 3BTGE 3RU4T 3S9AA 1RXPA 4DIIH 2HPPH 2O8MA 3SNCA 1GDNA 3PTBA 1DWBH 2RDLA 5EOKA 1WUNH 1EB1H 1H1BA 3BG4C 1PPFE 4D9QA 1ETRH 1GI8B 1NTPA 2BDYA 1SL3A 2G5NA 4MPVA 1C4Y2 4ZKOU 2FS9A 2A5AA 1YC0A 3OU0A 1G36A 4ZH8A 2ZPQA 1QQ4A 2P59A 2C8XB 4D7FA 1C5YB 1UVUH 2ZA5A 1HAOH 3TNSA 1SOTA 4JZFH 1GI7B 4WXIA 3OYPA 1N1LA 1A0HB 1SGFG 4CH2B 3P8GA 4Y11E 3RMNH 2BX4A 1TGTA 1TNJA 1ZJKA 2FO9A 4BTIB 1C5ZB 1YP9A 1ZMJA 1NFXA 5C2ZA 2PTNA 2ZKSA 1Z6EA 5A0AE 2R3YA 1QL8A 2WPLS 3RXKA 1BITA 1DUAA 4NA8A 4X6NA 3E16B 3GCOA 4YOJA 2RG3A 2XCFA 4TWYA 1DWCH 4OS7A 3LJJA 4CHAC 5B6OA 1GHBG 1BMAA 2ZHQH 5E2PA 2CF8H 1DM4B 2ZFTA 1FLEE 2QXHA 1O3DA 3ZZBA 1ZZZA 4K2YA 3BN9A 2A32A 5FPTA 1N6YA 3UUZA 4CRDA 2BVRH 4NIWA 1BA8B 1TYNA 4XDEA 4DG4A 4AZ2B 4X2XA 1TX8A 1JRSA 1C1WH 1NFYA 2FEQH 1E35B 2Z6BD 2J92A 2JETB 2PR3A 2HPQH 1O2PA 1C1VH 3AW1A 1C5VA 1SLXB 4H42U 3GYMA 1GBLA 4NA7A 1OKXA 1GBFA 1UHBA 2XC5A 1L1NA 4J2YB 4ZAEA 2WPJS 1S6FA 1WOFA 1SG8B 2BDHA 3S9CA 1AWHB 1UVSH 2QGRA 1OWEA 2PUQH 4JK5A 2H9EH 4INLA 1TGBA 4JZDH 1JXPA 3Q76A 2FS8A 3H5CB 1C2FA 4OS5A 1SR5C 4DOQA 3I78A 5DO4H 3SUEA 1OWKA 1HAVB 4MPWA 1UTNA 1E36B 4XBBA 1NRSH 4HTCH 4X2WA 4CH8B 2A7JA 2D26C 2I6QA 1ZYOA 4FUEA 4AB8A 3JZ2B 2GCTC 2PSYA 3F68H 3RXIA 2FX4A 2TGDA 3TJUA 3LH3A 4LXBH 5T6DA 1TMUH 1EJMA 1QB1A 4YLQH 1K28D 3E3TA 2OC1A 1Y3XA 2FZZA 2CN0H 5DP3A 3V3MA 1UJ1A 1NFWA 2ANWA 1GJBB 8GCHF 1CGIE 1GMCF 4B1TA 3LJOA 1O5DH 3GCTG 1ANEA 1Y3WA 2JH6D 3BTQE 3MU1A 4I8HA 1WBGB 1ZHRA 2F9NA 1KIGH 1AB9C 1EPTC 4IMZA 4FUFA 4AFQA 3QN7A 4E7NA 5EW1H 1FPHH 1GBDA 4BAHB 3RXJA 2G8TA 4CR5A 1O5AB 4B2CA 1EJAA 3EAJA 2J2UA 1TABE 2ASUB 1MCVA 1GI5A 1WU1A 2WUBA 1AFQC 1T8MA 1TWXB 1D3QB 3KNXA 1BTUA 3SV7A 3E1XB 4U30A 1K1MA 2J34A 1LO6A 3GOVB 5K7RA 4DIHH 1XUGA 1NFUA 3QX5H 1UTMA 1ANCA 2PLXA 1WYKA 4DJZB 3R0FA 4MNYA 1MKXH 1FN8A 4IN2A 4O9VA 1BZXE 1PPHE 1A7SA 3GY4A 1QBOA 1ARBA 1W13U 4GVUA 3SZNA 3MHWU 1EZXC 3QZRA 2B0FA 4FU9A 1O36A 5F8ZA 3PMJA 1FONA 4KELA 1AUTC 1C5PA 1T7CA 2WPKS 1LHGH 3SQEE 1MTNB 2QYIA 1AFQB 2FX6A 3SV6A 1C5OH 2K1QA 2GTBA 4ZMAH 1F0RA 1C2DA 3K65B 1MTNC 4WH8A 1O2ZA 3HGPA 2ZWLH 4Y8YA 3RXQA 5HM9A 1OYTH 2A1DB 3TLOA 1BB0B 3TGJE 2B5TB 3EE0B 1GJ6A 3GY2A 1K1OA 4X2YA 4E06H 2ZU1A 1ZRBA 3RXDA 3KL6A 2SGPE 5DPAA 5LGOA 4FUBA 5E0JA 4CR9A 1PPZA 3PLBA 1NZQH 2PTCE 2VH6A 4NWKA 2OINA 4OS2A 4WF8A 2HNTF 2GKVE 2V6NA 5A2MH 4IGDA 5FX5A 5C1YA 5AVDA 2B8OH 3V12A 3RXOA 2Z3DA 1H4WA 2FTLE 2CJIA 4UFFH 1F7ZA 1F0SA 1SGFA 3RC4A 1NRPH 2D8WA 2P3UB 2GP9B 5LPFA 4YZUA 1IQLA 1W0ZU 3GISB 4JYTA 2P8OB 1SLVB 1FAXA 2Y7XA 3SJKA 2V3HH 4J1YA 4NSYA 3NK8A 3MH7A 2Y80A 1MBQA 3BTEE 2GZ8A 1O2GH 1UK4A 2W3KA 3NKKA 1AU8A 1GBIA 1Y59T 1V2TT 4ABEA 1XXDA 2Z9GA 2VVCA 5DP9A 3LT3A 3MWIU 1RTLA 2TPIZ 2XRCA 1DLEA 1YM0A 2GV7A 3EA9A 3OY5U 3RXUA 3MYWA 3GY5A 1OXGA 1JBUH 1UCYE 3RU4D 1C1PA 3SV8A 4CBNA 2BD8A 2HALA 4ABGA 1CA0B 3TU7H 2SNWA 3VFEA 1SGQE 1WSSH 1S6HA 1AD8H 1A3BH 2R2WU 3MNXA 4JCNA 1PPGE 2VNTA 4F4OC 1UO6A 4UFEH 1GVKB 3RXPA 1IQKA 1Y8TA 6LPRA 1O34A 1KTTB 3O8BA 2G5VA 6ESTA 1L4ZA 1KXFA 2BDGA 3F1SB 3SUGA 3UR9A 1XX9A 3UR6A 4CRAA 3RXEA 1UCYH 1A5HA 1G9IE 2FI4E 7LPRA 2ZC9H 3MU0A 4TY7A 1C1QA 1SC8U 2BY8X 2OBOA 1OWJA 4A1XA 2O8WA 1P2JA 3SUFA 4QT8C 3VB3A 5J4SA 9LPRA 1SGIB 5DP7A 3PLPA 2GX4A 1NO9H 4A1TA 1O3NA 3P70B 1QRZA 1N8OB 2FOBA 3KF2A 3ZZ7A 4DT7B 1MTWA 2AEIH 3HK6B 1MUEB 3PO1B 1NS3A 2ZU3A 4I7YH 1HLTH 1QTFA 3QO6A 5GCHG 5AFYH 5A8YA 2BVXH 1S83A 1UK2A 1GHXH 1DPOA 5FBEA 4CHAB 1YPMH 2XWAA 1A0LA 4AYVB 5A0BA 3M5LA 3SU0A 1BTPA 1HDTH 1O3KA 1ZPZA 1ESTA 4A5TS 3S0NA 1C5RA 3TVJB 3HPTB 5C3NA 2H9HA 4K1SA 1OSSA 4ABHA 1XMNB 2R0KA 1DWDH 3VXEH 1BJVA 1O3LA 3SOSA 4E7RG 2YNBA 4X1NU 1W10U 1CE5A 1HPGA 1CGHA 3GCHB 2A2XH 4E05H 3PMHB 1MQ5A 1UVTH 2I6SA 2NWNA 5EPYA 2GMTB 1KSNA 1QJ1B 1WTHD 1C1TA 2O8LA 4Q7YA 1W3CA 2XBXA 1GI4A 2UUYA 5DG6A 1UTKA 3SJIA 3UOPA 4A1VA 2J38A 4NIXA 1SHHB 1WV7H 2W5EA 4Y8ZA 3TH4H 4YO9A 2F9VA 3ZZAA 1ARCA 1QL9A 4Y71A 3RM0H 1FNIA 3BTWE 5F8XA 1NU7B 1W14U 4OS1A 1GMCG 2HGTH 4FUDA 4BTUB 1ELDE 2FXRA 1YBWA 1OP0A 4Y79A 4BXSA 1SGDE 4RKJB 2C93B 3HK3B 5E2OA 2NU4E 2OCVB 5G4BA 8KME2 1S5SA 3NCLA 3U9AH 4CBOA 4ZUHA 4WH6A 2QXIA 5TJXA 1E38B 3Q77A 1BUIA 3SU1A 1EOJA 4XFQA 4ZKRU 2Z3EA 1XXFA 4IN1A 4ABBA 2GV6A 4KTCA 2OC0A 3FAOA 3RC6A 1MKWH 2AMPA 5EQRA 1UTQA 1DY9A 3OSYA 5DK1A 3KEEA 1G32B 1BHXF 1ZTKA 5HXFA 1SGRE 3LH1A 1HJ8A 2AYWA 1MAXA 4FU8A 1V2PT 5CE1A 1O2YA 5C67A 3TK9A 5K0HA 2LNCA 4I8GA 1OX1A 2RA0A 1P2NA 4IMQA 4D7GA 2ANMH 1S84A 3MH4A 1GHVH 3ZVBA 1D4PB 3RMOH 4ABDA 4MLFB 3UPEA 2ILNA 5ETXA 3RP2A 1LTOA 3S69A 1ELAA 1VITF 3MU4A 2ODPA 2VVUA 2ZU5A 1ABJH 3SORA 1Y5AT 2ZFPH 1VITH 1QGFA 3FFGA 1O2WA 2H6MA 2P95A 3CS7A 1O3GA 1O3AA 3M7UA 1P04A 1Z7KA 5CHAB 1LVBA 4XOJA 1GL0E 2ANYA 4THNH 1WQVH 1TFXA 1FDPA 5EXLA 4ZHLU 1U6QA 1LCYA 1HAGE 1C1NA 1RJXB 1J15A 1HIAA 2ZDAH 4MPUA 4LZ4B 1K1NA 1PYTD 3L6PA 4X1RU 1O2TA 5IDKA 1PFXC 1DS2E 1C1OA 5H4IB 3SW2B 1LPKB 3U8TH 2G55A 2PKSC 4KTSA 1KDQB 2VGCB 4A6LA 3E90B 1C5MD 2XC4A 4NCYA 1SGEE 2EI7A 5DP4A 2BDAA 4MG3A 1O5BB 2Q6GA 2UWPA 3A7TA 2H9TH 4UFDH 1AUJA 1G37A 4Y7BA 3CS0A 2XC0A 1M9UA 1ID5H 2QAAA 1P2OA 3A89A 3EQ0H 2QXJA 3SNDA 1INCA 1ZGVA 1DUEA 2KAIA 1O2MA 4ZXXH 5PTPA 3F6UH 1EPTA 4FUHA 4X2VA 5ABWA 2THFB 4M7GA 2BXTH 1ZMLA 1O2JA 1HV7A 2BDIA 3STJA 3SGAE 1BMLA 1VJAU 1QB9A 3SGQE 3PV4A 1UCYK 1SLUB 1TAWA 1Y3UA 5DP5A 1UTLM 2Z9KA 3E0PB 2C8WB 2FODA 4HZHA 5JBAS 1P9UA 4D8NA 4CRFA 3D62A 2BY9X 2HNTC 5BRRE 1GI0A 1XM1A 1K1PA 1DXWA 3VB7A 4MTBA 4JMYA 2AS9A 3A7VA 3Q3XA 1QRWA 1RRKA 2BY5X 1SLWB 1O2XA 3L33A 7GCHG 5EXMA