5LQBH

Complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARWRGDGYYAYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-2
publication title Improved cancer immunotherapy by a CD25-mimobody conferring selectivity to human interleukin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH02
3KXFB 1AGFB 4ZAKD 3QB7C 5A2LH 3G5ZB 5AUMB 3Q1SH 1A7RL 3I75B 4IJ3B 2GT9B 4WEBL 3T0EC 1SBSL 2BFVL 1CL7H 2LU4A 5HHMB 2BDNH 4R7DB 5FECB 3TA3D 3QCVL 4LSSH 3UTPD 3WFHA 5DEGB 1FDLL 4U1IA 1MCWW 2FJHA 4ODUB 3T77A 2B0SL 4IIQA 4WW1B 4ZFGL 5HGAA 3RX8A 5J12B 3FAWA 1J0KA 4N0UA 4UU9A 5J9PB 1PZ5A 4WWKB 5IWLA 3GSXB 4P4RB 3W0WD 4FFWD 4QXTA 4HH9A 2AJVL 3L5JA 1EO5A 4KVCH 2VLKA 4ZPVB 5CGMA 4JFEA 3V8CA 3TBSA 4TSBL 1E0OB 4MDIB 1ERNA 3N1GC 1ZTXH 1YMHA 3C5ZB 4CKVX 1KTDA 4DCQA 5CP7B 1DUYA 2W0FB 5J6GB 5GJSH 2WK2A 1XIWA 4G9FD 2IJ0C 1HSBB 4KQ4L 2H2SC 4PJ5E 5A3ID 1S9XA 4D9RD 5KSBE 3WUZA 1RI8A 3OPZH 4PRIE 2HT4D 3ALPA 4ZUUA 4XPHH 5JOEA 4N0RA 5F97E 4RBPK 4YPJA 1UADC 2ZNWA 4QCIA 3LKPA 4JFHE 5TE6L 1GRWA 3VFWA 2I60H 3WFBH 5DJDB 3X3GL 3H0TB 1TDQA 4AEHH 3HHRB 2VISB 3JWDC 4NKOB 3ZKSD 2UWEF 3T0VA 5DUPH 2APXA 4UILL 1I8IA 2R0LL 5C0RH 4KRPD 2DQHH 3EJZC 2EECA 4ODWA 5CP3H 2OL3B 2R2BB 1WC7A 1NBVH 4M7LL 5DMIH 3TBVB 4PJBB 4K71B 3IT8D 4GRLA 3FOLB 3QQ3A 4FQ1H 3HC0B 4NM8H 4P57B 2ATPB 3FCTA 3JV5A 4PTTB 5D2LE 5I8EB 2FWOA 4NNXA 3U79A 3HG1D 4Y8DC 5EO9B 4ZD3H 1QBLH 4X5WB 3EO9L 5EZLA 2BVQB 3ZKXC 3LKQA 1A2YA 3IRPX 4L8SB 3PWVB 5DMYA 2Y4SA 4MA8L 1MREH 3WJLC 4QRRB 2D4DA 5ECJE 5F71A 4JO4H 1NGWB 3QDJE 5D1QA 1OTUC 4QWWD 4KKNA 1AD0A 2R2CA 3T3ME 5C2BH 2J8UA 2Y5TB 3E1F1 3V7AG 5IW1A 4GG8B 1Q94A 2PUQT 3F7QA 3HR5A 3IDGA 4MLIA 4RMUA 5EBMB 2APTA 1ZT1B 4NOBA 4OUOA 4I0PC 5J6HB 2GSGB 3H9YA 4QEGA 4ZXBC 1KBGL 1MIEL 2NY3C 3I6LE 3ARDB 3JTSB 4PRAB 1CBVH 1KCVL 2WIMA 3HAEG 3F58H 4Z7OE 3NFPA 2CK0L 4OFDA 4XC3L 4HULB 1T7XA 4X8JB 2CGRH 5BMFL 2RIKA 4OBRA 1KENL 2HJKB 3AAZA 3QUXD 4LAQL 4H1LA 1UJ3C 3V6OA 4Z0BH 2VQ1A 3QXAB 4YHYB 2JCCB 3WCYA 3CUPB 3MCLH 1IAOA 3OXSB 2ZOLA 1LO0H 3VFMA 4GW4A 1PVHA 5L7XL 2CPCA 1OARH 3N50A 4FFYH 1P6AB 4H20L 2PTTB 2NX5D 1TQBB 5JOFB 3MTRA 1SJHB 2AJZB 3BP5A 5ALBH 4K2UL 2Z9TA 4YLQT 3RVXD 1JP5A 4PJEE 4TRPL 3V7AE 4X6CE 4LEXH 3OJVC 3BUTA 3W9DA 3DV6A 1PX3A 2F53E 5ACZA 5KAQF 1MFDH 2MQCA 4UQ2A 2NZ9D 5F1IB 1XGPB 2DTSA 4XWOD 1LK3L 1MCWM 3WBDA 4AMKH 4JZOB 4NO0A 4NBXB 4NRZA 4CDGC 2EKSB 1MJ8L 1IEBB 4HUXA 1CYGA 2P46B 3LEVL 3MRGB 4OZIA 5JOPD 3S88L 4LHUG 1DBJH 2JIXA 4OCMC 2R2EB 3MV7B 3D39A 1ZT7A 5JNYB 4QHLB 5FV1L 4JFDD 5T1LB 5IMKB 1OTTD 3QDGE 2IG2L 3MNWA 3QXWA 1TVHA 4HWEH 4HHAA 1ZLSL 3PWUA 1N6UA 3HI5H 5CMAA 2XTJB 5JIPA 4LLDB 4IIQC 4M61A 2CIIB 4JFPB 5JXAL 2NY2B 2W0LA 1CI5A 4N1CA 4Y8AA 1NGPH 4Y2DD 1AQDA 3TCLB 3GI8L 2HJFB 2X41A 5E56A 5CEXA 1UVQA 5IWLC 4X7FC 1CFSB 4NYLB 3RGVD 3HE7B 1SM3L 1S7VA 4X4ZA 3TN0D 3VRIA 3WFEH 3NABH 1GGIH 1CIUA 3LEYH 4UDTA 2WBJD 5CINH 3WIFB 1RU9H 4X7SL 5D7LA 4HPOH 3DOSA 1W72B 2CDFA 2Z92B 4J3SA 3N9GL 1ZE3C 4K7PH 1RY7B 1R3LA 3MJ6A 3CDGB 1YDPB 4M1GH 3BDYL 2QHLA 3DYPA 3U6RA 4ZS6D 1Z0MA 2DQEH 3QIUB 2D31B 4NWTL 2YUWA 5AG9A 1OWRM 1MJ7H 6FABL 4XPFL 1S3KH 1S9VB 5BRZB 2PKDA 4AK1A 4AH2B 1G0YR 5KS9A 4H1LH 4JFYB 4KJPC 3Q0HA 2VJXA 3DROB 1EPFA 5CGTA 2G9HA 1XGYH 1AXTL 4Y4HA 3E3QE 4PJ8D 1IGYA 2CLZB 3LIZL 3MXWL 1H8NA 5CS7A 4GRLC 3MFFA 2D7TH 1B2WH 3QNXA 3VXUE 1RHHA 3P9WB 4ZSOB 3RBGA 4F7PA 1C5DA 3V7MA 1UXSA 4ZQKA 2YHGA 1CF8H 3SKMA 4B7LA 1NC4D 2EICA 1YEKH 2X6MA 5E95B 1MNUL 5CBAB 1JGLH 1AXSB 3VFPA 2R0ZH 5T3XL 3NMEA 2DIBA 2DWEB 2R1WA 5D5MF 4U2YA 3TA3A 3NBNA 2PCPB 4EDXB 1T0MA 4AQOA 3R8QA 1QUNA 4UT9H 5T1KB 5D1QC 3SKJL 4N1EA 3DX9B 2NY7L 4HFWB 3CSPA 4MJIE 4GQ9H 3STZB 1MWAA 3W0WA 4PRPE 4WO4D 4KJYA 3DX6A 1IGML 3MOBL 3F7VB 4GG6F 2EDEA 4OT1H 5I30H 1C12A 1IAIL 2OLDA 2HLFD 5FUOL 4G9FA 4APQB 3EUUA 1I8KB 1YQVL 5DZNA 5ESVA 3QIBB 3AVEA 1CDYA 4JN1L 5FOBA 3MRKB 1QBAA 4M7KH 3IF1B 1JHKH 2G5BA 3B9EA 3PNWA 3RY5A 4F37K 5AAMA 4L29A 4M7LT 3P9LB 3S8WA 5EA0L 2Q7YB 2WLYA 1CL7I 3LKOB 5IJKA 3N0PB 4MAYA 4IOIA 4G8EA 1OAXH 4WFGD 2IPUG 3K3QA 2APFA 3DVGB 3TM6A 1CT8A 2VXVL 3ULUD 2K9UA 5DJXA 3DHJA 2BNQD 1WFNA 2FHBA 5CILL 1U95A 3STBA 4NZDA 4J6RL 5DLMH 3TO2A 3ME0A 1MLCB 3LQZB 4R26H 1DLFH 1A1NA 4DAGH 2NPLX 2G5RA 3LQAH 4OKVB 3HG1A 5MENA 1S78C 3O2WH 4AM0A 2VLRE 3B5GA 1F58H 5IHUH 4ELMB 3GSQA 4HXAH 1G9NH 2Z4QA 5FHAH 3UAJD 4IDLA 2RGSA 1N6QH 1WGOA 5EOQH 3FHQA 5F7MC 5KANG 2GYSA 4LKXB 3BP7A 1CLOL 3K80A 3MLZH 1VFBB 5IIEA 2N7AA 1MCEA 2KPNA 2VXUH 3MUGA 4NC2B 3UO1L 4U1MA 1T1XB 3TJHC 1RZ7L 1QLFA 4OI7A 2X4RA 4FQCH 3C5SA 1P7QB 3QCVH 3B9AA 4OV5B 3UEZA 5JA8B 1FDLH 1RIUL 3T2OA 5D2LF 3PE9A 4PFEA 4ZFGH 2NY1C 1HHKA 4PR5B 4URTB 4YZFE 2BX5A 5HVHB 3L3IA 3QO0B 5FAAA 2AEWA 2VRAA 3BWAB 1HNFA 3MFGB 3QHFL 1GIGL 4ISVB 5DT1H 4ODVL 1IGTA 1MWAH 3TYFA 1TTUA 2Y6SD 1A7QH 3B9KB 3TV3H 3O4LD 2P5ED 3G6DH 1U91A 2CXKA 2X1WL 3IDJB 1UM4L 4S11A 4KHTL 5GGSB 3DX7A 2HFEA 3LY6A 1G9MH 3T3MF 1LO5B 2XIDA 4KI5E 2XWBA 2ICWJ 1WQVT 3T04D 5ICXA 4KQ4H 4OZHB 4YAQB 1QZ1A 2HP4A 5IJVA 4P2OD 4OCXL 1DBKL 1HEZB 4GW5B 1HHGA 1T7VA 4OM0L 3KYNA 2CDEB 3HZMB 3X3GH 5CKGA 3FRPG 5GISL 1U0QA 1MAMH 3QNYA 2BK8A 1KJVB 2XQYG 4QOKE 1T6WA 3THML 2A74A 4E41E 3TF7C 2GJ6E 3SDYL 3QWOA 1ZVSB 2J7LA 2QEJA 2H1PL 5HYJA 2VDRL 3E8UL 4RMRA 4RA0C 3V8OA 4OD2A 2Q3AA 1YA5A 2ADIB 3B83A 4JHAL 1LWRA 5DJCA 4LCYA 5A16B 2EKJA 5F1OB 4UQ3B 4D8PA 1CE1L 4S1RL 1U41A 4J3UA 4P23B 5E08L 5I1LA 4PJCB 2OZ4A 4AENA 3EO9H 1YMMD 1MCOH 1U3HC 4YFLI 4MA8H 1BLNB 3REWA 4FQQB 3D69B 4NZUL 2LVCA 3VA6A 3VWJA 4ETQB 4OCLC 4ONGH 3TO4A 5C0JA 2PYFB 5GS2D 4CNIA 3RGVA 1BX2B 4KZEL 4MXVF 3TN0A 4XHJD 3ALXA 2ARJA 2WBJA 3EYOB 4U1GB 4AIOA 4BQ8A 1AXIB 3W39A 4XHQA 4LLVA 5DC4B 3SDXA 1S7UA 4NPYA 3SDCD 4JO1H 1KBGH 1MIEH 2AEPH 3JWNC 5E4EB 4JY6B 2H3NA 4F7TA 3V0WH 2G2RB 3OGOE 2CK0H 4XC3H 2EDBA 4NRYB 4ZS7L 3ARRA 5BMFH 1H0DB 4HUWB 2EYRB 4POYA 3D48R 3D3VD 5F96L 4CVUA 4LNRA 1A9BB 4LVOC 4NQDE 1YEIL 5IBLC 5IJKC 4MAYC 1M05A 4PRHB 3H3KA 3ARVA 4X6FA 2DAVA 5AYUH 4PJ8A 4MD4B 3VD3A 43CAB 1IE5A 4C59B 5L7XH 3QDME 4DUXA 2EYSA 4O02L 4EOWL 4H20H 1EZVY 1U8JB 3LH2H 1J86A 2R8SL 4K2UH 4S1QL 3VI3F 5I1DA 1NC4A 1IM9D 1ZVYA 4Y1AD 4H25B 4GLRH 4KK5C 1BPVA 4C4KO 2R9HD 4QXUL 3QNZB 4EBQL 1FYTB 4XGZA 5BCAA 3T0WA 1I8LC 3FT2A 1BAFL 2XXCB 2YUXA 4G8FB 5I2IB 4P49A 5EBWB 2WQ8A 3LEVH 3OR6B 5IMLB 4NKQB 2XN9B 4JPKL 3VXNB 1QG3A 4U6YB 1GPOH 4Z7QF 1U92A 3MRPA 5DXWA 2RCSL 1N5YL 1V7NH 4WTWA 3NPSB 2VUYA 5J56B 4UBDC 2W38A 1ZLSH 1TETL 2OR9L 3VD5A 4G6JH 4R4FH 5A2JH 3QCTL 2OZ4H 2XZZA 4YO0A 4JZNB 3SKOA 2A9NL 2GW5A 1KPRB 2V5RA 5DF0A 5DFWH 2X4TA 4ZOBA 3AC0A 2X2YA 3HZVB 4FFVD 1U8LB 1ETZA 3PQYD 3GI8H 4ZMAT 1CLZL 1IKFL 1QRND 1TPXB 3A6CL 4JRXD 3V4VL 3BPLC 4LPTA 4YK4B 1II4E 1W0YT 4D0CB 2Q7NA 3LN4A 1LDPL 3QG7L 1LO2L 1FSKC 4OZFB 1RVFL 4N90D 1FNEB 2XACC 3PJSB 1FG9C 1UKTA 4HBQA 3N9GH 4KTEH 4WTXA 1P4BL 3LB6D 2NXYC 2BNQA 1JF1A 5D1ZD 2P44B 1Q9WA 4QRPD 3HI6L 5D7JB 5EH1A 3NIGE 2QTEA 2Y06H 3INUL 4F7EA 4M6NL 1XR8A 1OT2A 4KJWD 4GSDL 5ALCH 2JF1A 4NWTH 3ZTJH 2Y07L 3SEPA 2OJZH 1K3IA 4N0UE 5DVLA 3OKDB 1ED3A 2R29L 2OX5A 4M7JL 3TZVB 3O6LL 2YPKB 5EZIH 4GOSA 4QXGL 2IMMA 4E0RB 4YEEA 5TQ2H 2P7TB 2NXZD 3T4YB 4JFEE 3MXWH 2XPGB 3K0WA 1NL0L 3ZYJA 3VG0L 1LEKA 3CK0H 2M2DA 3KPRE 1RIVH 1NGZB 3AREB 1MNUH 1J9CT 4X9BA 3ZDXE 4RIRA 4CADA 5KSAC 2DYPD 4M8QA 4XPBL 4C57C 3IETA 25C8L 2WBKA 2H45A 3VWJC 2AABH 5E1HB 4NM4L 3FZUD 4OAWB 3TO4C 3PHQA 4U3CA 3BPNB 1D5ZB 1T6VN 3IFLL 1NGYA 4OLYH 1BBJB 2GTZA 4R4ND 1RZGB 3NIDF 1FG2B 1TTFA 4OF5A 1ZGLP 5E0QA 3DGCR 3B4NA 2P5EA 5EN2B 4AT6A 2LE9A 1QLRA 4GW1B 4KUZH 5E8PB 1IGMH 3MOBH 1URLA 1HZHL 1W0VB 3DUHA 5HHVH 4L9LA 1RUMH 4X7TA 5JPMB 3MRCA 1Z5LA 5BS0E 4M7ZC 1C5CL 1IAIH 3B8SA 5IMMB 5CJOL 5FUOH 2WWMC 3EOYG 5F9DC 3E6FB 3I6KA 1XF2B 2EDYA 1A6TA 2NY5H 1BQHA 3P73B 4P3DB 5IHLB 4W6XB 4WTZG 2O5YL 5IFHH 5CD3A 1CG9B 1DANU 1UZ6E 4QY8B 1XGUB 3BW9A 5D72H 1JYXA 2OR7A 4R4BA 3L6FA 4R8WH 5C71A 1R3JB 1K2DB 3KXFD 2L0DA 2IBBA 2H6PB 4N0YL 4I18B 2J8UE 3EO0B 4XTRD 2QADC 5I71C 5IK3B 4XBGA 3G5VA 1VGEH 3RHWK 5EIQA 4LSTH 1J11A 3V6FA 4MNHB 2B2XL 1CLYL 2ITCA 1H5BC 1UACL 1XCQA 4M5ZL 5GRYA 1ZA3B 3CVHA 4GH7B 2DS4A 2R2HB 2D9QB 4KI5F 5M95B 4XNZC 3P4OB 5I17B 4PJDB 4WWKD 4HCRL 2EDJA 5EO1A 4JGJA 1OQXA 3X11A 5FA3A 4M93B 2IADA 1N3NA 2EDQA 1YMMA 5GGQH 1R24B 2DQCL 1RV6X 1DE4B 2P1YA 1T1ZB 5C08A 5J0BA 3BHBA 3U9UA 1G6VK 1INDL 5DK2A 3C5ZD 1JUFA 3CCHA 3MYJA 4DN3H 3KPTA 4HH8A 3S96B 1L9MA 4MB5A 5DD3L 3LS4H 3QG6B 3I9GH 4HMCA 3UO1H 2XA3A 3QQNA 2QSVA 3VXPA 1RZ7H 3B6SB 1MUJB 5CJ5A 4NOFA 3CDCA 2VDKL 4RFEA 4PGCA 2NY5C 2YUZA 3VJ6A 1B0GA 4YDIL 4D2NA 4KC3B 3CXHK 1Y6MR 4HUVA 1S9WA 1DSFL 4LP5A 4LRNL 5F1NB 5D6DA 4ODVH 4LHQB 4WFHE 2OI9C 3SO3C 4D9LL 3D3VA 5EO0B 5CWSB 5F89B 1HXYA 4OZIE 4WW2B 3WDHA 2ICWA 2ESVE 2OSLB 1I3RA 4LCWB 1QO3B 4H5SA 3PGDA 4UTAL 2YXMA 4KKBC 3D39E 4KHTH 4OFVA 4WI7A 3BPCA 1J7VR 5T3ZD 4TVSa 4JANB 1BD2B 3HUJE 4GXVL 1UXWB 2JJSA 1MHHA 1HNGA 1IT9H 2OMNA 3U30C 3SGKA 1JYNA 2VSCA 4QRRD 1DBKH 1ZHLA 4Y1AA 5IB1B 2VL5A 1YNTB 1YN7A 3QUMA 4XRCA 1XF3A 4OZ4B 2QQQA 5E5MB 4XNUH 2F9BT 2H8PA 4N0FB 3HS0B 5HHPB 3WN5A 1JTOA 2H9GB 3O81A 4XNMA 4ZYKB 3BRGC 4XCFL 5D7LE 5FGCE 1AGBA 5ESQA 2VDRH 1JPGB 2V6HA 1Z3GH 4RFOH 3K7UA 5GGVH 3CVHH 2Z93B 2AV7A 2A83B 5CBEB 3KYKL 3DBXA 4S1RH 3GSVA 5CSGA 5DHYA 4OFPA 1CXLA 4U1KA 1T3FA 2UVEA 2UVFA 2B39A 4XXDB 1UZ8A 3UTOA 4XBPA 4JFFA 3WS3A 1RURH 3FO9B 1LP9A 1FPTL 1P69B 4X83A 1JPTL 3U4EA 3QHTC 5IB3A 3SE3A 4PV8B 5GS3A 3IFOB 2Y36L 3PQYA 2ADGA 4JKMA 5KVGL 4WU5A 1QKZH 3ROOA 5C0EB 3VH8A 3FQNA 5HI5D 4K07A 1MHPL 5DD1L 4GLRI 3A0OA 3MA9L 4GKZA 1NAMA 1HQ4B 1H15B 3LRHA 1UB5B 3KPNA 1IAKB 1WCBB 3SHSA 5D1ZA 4OLVL 2EC9U 2E7LA 2Y7QA 4HUUB 4MQSB 4AEIL 4BUHA 3IJSA 2XZQL 3NFSL 4MX7B 4EI5B 3C09C 1NFDA 3GSRA 1S7XB 5D7KD 5SWQA 4Y4FC 1RJZB 3KLAB 3VW3H 1JGEA 4J4PD 3SKNA 4FXLA 5DUBB 4PRDA 1DQQA 3CFJB 3MV7D 1XH3B 3K2MC 4RMQA 3W0WE 3ZDZE 1CICB 5K59E 4RBPH 3BSZL 3S5LA 4LIQH 5T1LD 1X5AA 5I1AA 3GSWA 1AHWB 4YHML 2PR4L 2PTUA 4R90H 3ROLA 5EUKA 4LU5L 4O02H 3U0PB 1FZJA 2XTJD 3GMOB 4EOWH 3FOMA 2IBGA 2J88H 2O93L 1JFQL 2YD1A 3ZHDA 2NY2D 5F7KC 4WNQB 4G9FE 2AXHA 4F9PC 4S1QH 35C8L 1HQRB 3GSOB 4CN6A 4OCYH 2OQJB 4PJ5B 2H2PD 3CZFB 3RVUD 3QUMH 5KSBB 4MHHG 2EYTA 2E7BA 3GMMA 1XR9B 4EBQH 5ID0A 4NIKB 1T5XB 2DYPA 3EOAA 1E6OL 1QRKA 4PP2B 2D3VA 3G5XB 1ZVHA 3HB3C 3V2AR 4KUCF 2GTWB 3MREA 4N5EC 4TUJA 5JW5B 4QRQA 2X9YA 4D3CH 3S4SA 5I66B 3VDBA 5JXEA 4I8DA 3VRJA 5KJRL 1A9EB 2EDTA 3ES6A 3MRFA 3QIUD 4YFLF 2RCSH 3VFUA 1AGDB 3K4AA 5GSVA 5IB5B 1KCUL 4NSKB 2OR9H 1DFBH 4IMLA 5MENE 5CD5D 4H88H 3FQWB 5D2LB 4LVNC 4XCNB 1LEGB 1INEH 4GBXB 3VD7A 4JG0L 5T5NG 2FR4B 1R5VB 4FXGB 2BY2A 2J3SA 3V4VH 1Y0LA 5LAXB 5FF6A 1PG7L 3PP4H 2E27L 5C0BE 3EHBC 1EAPA 4XP9L 3KXFA 1MEXH 3G5ZA 3QDJB 1JN6B 2ZJSH 4ELKB 3D87B 1CTNA 1RVFH 3TESA 3P11L 3G04B 1NAMH 4NN6B 2DBLL 5J4MA 1P4BH 1PYWA 1HIML 4XPGL 4LPWA 1D5XA 5FECA 2VKXA 4HK0B 3V5DB 3DV4B 3R06A 3HI6H 4ODUA 4U1JA 4WW1A 3G6AA 5T1KD 1JZ4A 4WGWB 4GSDH 2LV4A 3PWJB 1HCVA 5J9PA 2AP2A 4K8RD 3P4LA 3PGCA 3IXTB 3O6LH 4Q9BA 4J8RB 4V2CB 5LGJB 1IAII 1UCBL 4UNVA 2NY6C 2WIIA 3C5ZA 5DEFB 5F9JB 4L3CA 4X9FA 2BERA 1DQJA 4WI9A 2W0FA 5CP7A 2J8UF 3TT1L 2BCKA 1YEHH 4APQD 4UINL 2W9EL 3KPOB 3MLRL 3VG0H 3ETBF 1A02N 4OUUA 3QIBD 3ZL4L 1AE6L 5DJAB 5J11B 1GSMA 1VFUA 3KYAA 2UUDH 2AJ3A 3VGFA 5LQBL 3S34L 3H0TA 2DM4A 2VDOL 2VXSH 4G3YH 1T21B 2HKHH 4NKOA 4XP6L 1BOYA 1IAMA 3ZHLA 3V95A 4PJEB 2VDNH 1OAYH 4MCZA 4X6CB 3BZ4B 2I27N 1GH7A 5FK9B 3QXDB 3P2TA 1BFVL 2F53B 3CPLB 4G6AC 3GSNL 1PX4A 4PJBA 3RPIB 5HYJE 3MBEB 3MRJA 4L5FL 4LVHC 5E8EB 2XTLA 3WHE1 5JOPE 3HMXL 1HWGB 1VKXA 1JV5A 4MD5B 3J8F7 2P45B 4PTTA 2D03L 1S8DA 3LVEA 5CLWA 4LLUA 1MLBB 4DFIA 2C26A 1FO0L 1M6OB 5EO9A 5EU4B 1IQDA 1B4JH 4H0IA 4U1HB 4PJFA 4YBQC 3HNVL 3QDGB 3KJ4B 2AEQH 2ZG2A 4OGXL 5HD8C 4PLKD 1WVZA 1YEEL 4PY7A 3WEXB 4Y4KC 4XVTL 1NGWA 3X17A 2ICES 2OBGA 1YY9C 5E8OB 3QULB 4PS4L 1T0PB 3MPCA 3IAPA 4OSUL 1D9KB 1UG9A 2Y5TA 4YGVB 4IHOB 4BFIA 4NHUB 4N0YH 2JJTA 3HR6A 3GSUB 5MEOB 5CHNB 3AXLB 2FEEI 3BEWB 4GRWH 4KKAD 4JEGB 1ZMYA 2GSGA 1P7QD 5H94B 1T7ZA 4K3HA 3V0VA 1UACH 4OGAD 4PRAA 5MERB 4JZJB 5CEYB 2A6KB 3F8UB 3RWIB 2W60B 2FX9L 1FE8H 1A3RH 2HVJA 3L3OB 1T1YB 1XAUA 2I9LA 4TOYH 3GHEL 3Q3GB 5KG9B 3ZDYE 4YE4H 5H8DA 2ORBH 3GM0A 3QUZC 1OPGL 5GJTL 3V5HA 1J1XL 2JCCA 2DQCH 1T04B 1BEYL 2GY7B 5D2NA 2R0KL 5TF0A 1AP2B 1GHFL 2BVPA 5JXEC 1EHLL 1A4KB 5FHBL 1SJHA 2QQNL 1GGBH 2G60H 3BGFC 3VMOA 4R7NB 3M8OH 3NCYS 1AKJB 3VXUB 4O4YH 4KTDH 3CXHJ 5IBTH 2VIRB 3WYRA 4BH8B 3GHBH 1N5AB 1XF1A 2F5AL 3BN9D 5T3XE 2V7HA 3CFBA 3BRFA 2BSSA 3H6JA 4OCWL 1X5ZA 3D2UB 3TNNB 5F1IA 1ORSB 2WZPD 1FL3B 1SEQH 4U6HB 1VFOA 3VWKA 3GJFK 1DSFH 4X6BA 1A8JH 5KS9F 3MRGA 4J4PA 1F11A 3BE1H 4D9LH 1HINH 4Q9QL 1FFQA 5AAWA 3RVWD 3RBSA 1PSKL 3MV7A 2VAJA 3FB8A 5FA4A 4QHLA 3UMTA 4UTAH 4Y5VA 4OLZH 1KB5B 5J57B 3AS1A 4PRPB 1A47A 4P23D 5IG7A 5I1JL 1EX0A 4WY7H 3VDAA 4EDWL 1TZHA 4S1DD 4GXVH 5I1EL 2CIIA 4J3TA 1DVFA 1NDMB 1H3XA 3N1MC 5GS0L 3PDOB 4PGDB 3TCLA 4R97B 3NCMA 1WWCA 1O0VA 5A2KH 1CFSA 2FIRT 4YXLL 5L0QC 1CFTA 1MRFL 4PLJC 3LKRB 3WNPA 3VXSE 4AEEA 3IS0X 4UTBL 2B1HL 3UROR 2IH1A 1JPSL 1BVLA 3WIFA 3LRGA 3FO0H 5FO7B 1I8MB 4OQ1A 1ROWA 3S3JA 4DKEL 1IC1A 3V4PL 1KCKA 5DZLA 1YDPA 4QHKJ 2BNQE 3HNSL 4HWZA 2UY6A 5KN5A 3QIUA 2H26B 2D31A 1IC5H 1A7PL 1ZEAL 4WENB 4Z7NE 5DQJB 4U1NA 5C3LD 5SX4H 4GKSA 2B5IC 1ZWIA 4POZC 8FABB 2ICWI 4JFYA 2Q8BH 2CLVA 3BXNA 4M5YL 4FG6C 4PRHD 3HRZB 1YPZE 3MRIB 3QYCA 3X3FL 5HDBE 2K7PA 2LAAA 3ULVD 2Y36H 4OD3L 1ZS8B 2NLJA 4QNPE 1R3IL 4YXKL 2VLRB 1BM3H 4R3SA 2DLFH 4JLRB 4KFZC 4LCCB 1BQHG 1QFWH 4ZSOA 1IC4L 1MHPH 4FRWA 1A6ZB 5DD1H 4X99B 4Z5RB 1AXSA 5EC2B 4ENED 2DWEA 4UMGA 2VC2L 1FYTD 4P0DA 2PCPA 3FMGL 1WIPA 4AEIH 1G7HB 4X5LA 1PBYA 3NFSH 5ACMA 4J3XA 1MPAL 1J0YA 4KI1A 3DVIA 1NUDA 1I4FB 3DX9A 1MCHA 3BWUC 2YD8A 4ONFH 4F33B 2BY1A 1FNGB 4HFWA 1HHIB 3STZA 1WEJH 3C8KA 4O5LL 3FB7B 3WL9B 1G0XA 3IFPA 1MF2H 2XN9D 2JJTC 4PJXA 3EFDH 3LV3A 5FYLL 1ZHKB 2P5EE 3AY4A 5GGUB 4RGOH 1G6RL 2HT2D 2X70A 1NBQA 4KMQA 2PR4H 4L4VA 3ZTNH 4LU5H 2PO6C 1E6JH 5HGBB 1PLGL 4JE4B 2XFXB 4APQA 3NZ8A 3FB5B 4O51A 4J23A 1EFXB 3QIBA 1JE6A 4ZTOH 2NY0C 3MRKA 4V1DE 2FRGP 1MFCL 2EDWA 3KAAA 2Y9RT 3IAQA 2P8MB 5HDQH 3ZKND 3IU3A 1F13A 1GGCL 2XI9A 2ZSVB 2DL2A 3ULUL 5F21B 2FEDD 2Q7YA 4FXKB 2HRPH 5D2NC 3LKOA 4XBEL 5BQ7A 1TZIB 3QH3A 5HGDA 1MVFA 3IJYB 2BP3A 1SVZA 2F8XC 5C0DA 1NCBH 1RZKL 3IDNA 4QOKB 5ITBL 4J12A 4UOW1 4E41B 5D7JD 2GJ6B 3GO1L 2Y72A 1FNSH 2WNGA 2W07A 1KCRH 2FATH 3HMXA 2BXYA 3TIDB 3BDXA 1ND0B 3RUGF 5JHDE 5T5NF 1FO0A 3B3IA 2XG4A 5HHQA 5B38B 3P30H 3TZVD 2V17H 2DIJA 5FYJL 4MD0B 1WZMA 3VWKC 3BQUA 4KJQC 3MLVL 1UM5L 4KAQH 3QQ9C 4JG0H 3L9RB 5C08E 2RB8A 2A73A 1FQ9C 1Q0XL 3RGHA 2E27H 5I1IH 4JY4A 4QYOB 1G7QA 5MEPB 2MPAH 4LARL 4Y5VC 4OLWH 1DUZB 5IR1A 3ARED 4X6DB 5DRWA 2W1NA 3WLBB 4UOJA 2BSED 5CJ8A 5DRZB 5ENWA 2DBLH 2D7PA 1CDCA 5F1SA 1VA9A 1VCAA 1DVFC 3P40A 2XICA 1TNNA 5JPNA 1EGJA 4NKIH 2DMCA 1JBJA 4ZUSB 5DJ6A 3QO0A 3BWAA 1N8ZB 1SBBA 4K8RH 5DJZB 1OCWL 4HKJA 5CKAA 1SY6A 3D3VE 2CQVA 3ZKXB 2YBRA 3IDJA 3V6ZB 4YBHA 1R5IA 5F9WC 5GGSA 3PABB 1MHCA 4UIKL 4LIQE 4OIIL 5GZOD 1LO5A 4NQDB 3RHWF 3GNMH 5ERWA 1K5NB 3EJYD 5HHOA 4JPVL 2I07B 3C08L 4UINH 5EUOF 4NO2A 3MLRH 1MCBA 1QFUH 3BJLA 3ELAT 4OZHA 4YAQA 1BFTA 3QDMB 1KIPB 3SDXF 1HEZA 2CDEA 3HZMA 5CEZD 4R96B 3ARGC 4I0PB 3QEHB 1CDGA 5LQBH 4Y1AE 1IGFL 3VH8G 2VDOH 1KJVA 4JDZA 2NY3B 2Y1VA 4XP6H 2YKLL 2A6DB 1DP0A 2CXGA 4ZAKC 1ACYL 3EFFA 4JN2A 1ZVSA 1GZPA 1DBAH 1ORQA 3GSNH 4UV4H 3F5WB 2DN7A 3TGXA 1UJ3B 1OF2A 1A3LL 2ADIA 3HMXH 5CZKA 1U9KA 4RAVA 4UQ3A 1UJTA 4P23A 1BJ1H 1FO0H 4LDEB 2DKMA 2ZKHL 3KDMB 4PJCA 1QNZH 3H9SD 3S5LG 3HNVH 3FB6B 4JFFE 4OGXH 1LP9E 3IVKB 1YEEH 4NGHL 1JPST 1BGXH 4FQQA 3KVQA 3D69A 4Z77B 2PYFA 4ODTL 3PQYE 1S5HB 3P4MA 1NBZA 3IDXH 3PDGA 1M7DB 4IMKA 1MJUL 3UTTE 1FRGL 4P4KA 5D7IF 5DC0A 3VFSB 4PG9B 5EU7C 3T08A 4RISH 1VENA 5DRNB 3V52L 3PF2A 2N56A 1P53A 3DRQA 4QRSA 3ZE2F 2DQFB 4N68A 3OX8B 2AS5M 3RVVD 4ZOEA 3C6SA 5E8DH 4YIQB 3IKCA 4HUNB 1EGJH 2G2RA 4WUKH 5DGRA 3KLHC 4JHBA 2YRLA 3DNKA 4NRYA 4YNYA 1NFDE 3UC0H 4HUWA 2JB6A 4F2MB 2BHYA 3WFHB 2OK0L 4U1IB 1H8SA 3T77B 3L1OL 4IIQB 4KKLC 2YC1A 5CFHA 1SY6H 1OPGH 5GJTH 2HTKC 4LCWD 1QFPA 4LRIA 5HGAB 4F58H 5DVMA 3RZCC 4N0UB 5CZXD 1I3UA 1CGUA 1X7QA 2R0WL 3WUWA 4DN4L 4DVBB 1PZ5B 4MD4A 43CAA 5ACLA 2FYYA 1HOCB 3C2AH 3U1SL 4ESKA 5EOCL 1BD2D 4Q0XH 5F1KC 1EHLH 4K9EL 4HH9B 5FHBH 5J8OA 2DM3A 1BIIA 2X4OB 3ZKMC 4JFEB 3WKMH 4QRUA 2NR6D 3ULUF 4H25A 1KTDB 4DCQB 5K93A 5IW6B 3KPRB 3HNTL 4S10A 3B2UD 4ZUTA 1S9XB 3LDBC 4Y19E 3BQUC 3NN8B 1EO7A 4OCWH 3DX8A 4ZUUB 2DLEA 3BJ91 4HX1A 4D0DB 1VPOH 1KG0B 3EYUL 2AJXL 3RQ3A 1V3MA 3P9MA 4HGWA 3TT3H 2A0LC 4X80H 4QCIB 4R2GC 3MV11 3VFWB 2HT3D 5D4QA 4NQXA 3MRQA 3OR6A 3AS3A 4WJ5B 4OB5L 5MHSE 4UNUA 5DMGC 5SX4I 4QNPF 4G5ZL 1MIML 2VMFA 3BP4B 1M7IA 5I1JH 4KDWA 4OLXL 4GRLB 4AY0A 5JW3H 4UT6L 4EDWH 3ISWA 1D3CA 3F65A 2VZ1A 3S9DB 1BFOA 3CD4A 1UM6L 1I9IH 5B22A 3JV4A 5BS0B 5ESAB 4I48A 2ZPKH 4ZOAA 5FGRA 5DK0A 4I9WD 4YXLH 1MRFH 3LKQB 5E00A 3UCRA 1A2YB 2B1HH 2NMSA 1JPSH 3W11C 3H2WA 3KGRA 4JGMA 4HDIA 4BZ2H 1KXQE 3PJSA 2DOCA 5D1QB 1KUMA 4DKEH 1EAJA 3MUHL 4GRWE 5BVPH 4LDLB 3V4PH 2J8UB 3MJGX 5IW1B 2YSSB 1Q94B 5D7JA 3HR5B 3VRLE 1IL1A 4EI5D 3WXVH 1MFEH 3UTSA 2AGJH 1UEYA 2VKWA 4S0TD 3L3HB 3WIIH 5CSZA 3NCCB 4YX2H 2IAMA 3SOBH 1KEMH 3MRHB 2QQKL 2DRUA 1XCTA 4XPAL 1J10A 4UIMA 1KCLA 4M5YH 1CICD 3CXDL 4E0RA 3F7RA 2P7TA 1A7NH 1XEDA 1Z9SA 3AAZB 3ZE0F 4OD3H 4H1LB 2A6IB 3FTGA 2R15A 1CD9B 2FX8H 2DD8L 1IC4H 4QLRA 4P2YA 3VFMB 3OF6A 4GW4B 1G7PB 5IM7A 3V5KA 4PJ5D 3QWRD 4XC1H 1UQSA 3DUUA 5DURB 1CD1A 4XXCA 3EYFA 4HK3N 3FMGH 3RVTD 2ICCA 2Z8VC 3DSFL 1RJLB 1UKSA 1V7MH 3BP5B 5GS0C 3D9AH 1FIGH 1T7WA 4LBEA 4OAWA 4I3SH 3H8NA 4OBSA 3GI9L 3W9DB 3DV6B 1BBJA 4CBPA 1U8PB 4RMTA 4IMKC 4O5LH 4P5MA 5ACZB 1KLUA 4P4KC 4UQ2B 3S37X 3RZWA 3LSOA 3LEXA 4PJBE 5E2WL 4NO0B 5TGBA 4JB9L 4NRZB 4Z7VF 2NW3A 5JIIA 1P1ZB 1NMAL 5GS1A 3HZKA 1FLRH 4OZIB 5DD0H 3WFCL 2YS4A 2ESVB 4N8PA 2JIXB 1PLGH 3QP3A 3D39B 1N7ML 4PJFE 3REVA 2O5ZH 3VXTA 2W91A 5GHWH 1FV1B 3UJTL 5IFJA 4GBXD 1UB6A 4HHAB 1MFCH 3HUJB 1LNUA 3P73A 3BYTA 3PWUB 4P3DA 1JNLL 5CMAB 3QFJD 3VGAC 1XGUA 1GGCH 4P9HH 1QOKA 1K2DA 4LRIC 3S7GA 3QDJD 5FKAA 3RRQA 2CKBA 1AQDB 5CEXB 1V3JA 2NY1B 1UVQB 3O0RL 2EDHA 4JKPL 3UXFA 5LGHH 4MNHA 3VRIB 5ITBH 2Z35A 5EIIA 2CUIA 2IC2A 4DTGL 3BIAX 1EUUA 1RHFA 4NQEE 1VESA 4L1DA 1KN4L 3DO3A 5D7LB 2P48B 5FGCB 3EYVA 3I6LD 3P4OA 5I17A 3SCMA 1R3LB 3HI1A 3H9SA 3BO8A 4F7MA 2P5WA 4TSCH 3F6IA 5AZ2H 3VFGL 2A38A 3MJ9A 3T2NH 4MQXD 4FOMA 1DE4A 1AFVL 4WI5A 3GMPB 2FJFA 2JE8A 3MRRA 1B6UA 1TIUA 4OFYD 3MCKB 4RMWA 3KPPA 5D2NE 1N4XH 3S96A 2Q20A 4U3XA 5DYOA 4HZAA 1N2RA 3QG6A 2GK0A 3CZJA 4S2SA 4BUGA 1MFAL 2EH8L 3BN3B 2Q76A 2XG5A 1LILA 3R0MA 4U49A 5HYEA 1W8OA 1CDBA 4PJAA 3QNXB 1EO8L 3OG4B 4RNRA 1RHHB 2K3TA 1C5DB 1JWUA 4HBCL 1UXSB 3SKMB 4DJMA 1WF5A 4XNYH 5T33L 4YHZL 3VFPB 2P43B 3G9VA 2R1WB 2F53D 5F7UA 1FC1A 1HE7A 3WFZA 1LP9F 5EO0A 3BZEA 3MBED 1OCWH 1RK0A 5T3ZL 2OSLA 1J12A 2QQLL 1U3HB 3GIZL 1RZKC 1MWAB 1JRHH 5LWYL 3W0WB 3GUTA 5CCKH 4KJYB 3QDGD 3DX6B 2P24A 3AGVA 1FZMB 1QVOB 2I9TA 4D94A 1G1YA 1CU4L 4JFOA 2IAMC 5IB1A 1I3VA 1YNTA 4JHWL 3MXVH 4Z18A 3NA9H 4G9FB 5T1MA 1TVBA 1D9KD 2C4XA 1NFDF 5FOBB 2OP4L 2CKBH 2QSQA 4N0FA 5HHPA 1FL5A 1YNKH 3NA4A 4NO5A 2H9GA 3PNWB 1C08B 4NP4L 1J87A 4ZYKA 5F70A 1NCUA 3DXAB 4L29B 2YK1L 3MV9A 3QEUA 5IB4B 4W81A 1JPGA 3GMNA 1A3LH 2IQ9L 4LVOB 4MAYB 4IOIB 4G8EB 2Z93A 2A83A 4JREC 1CT8B 2E9WA 2XWJA 4KK9D 4ZOCA 3OJMB 4XXCC 4XXDA 1U95B 2ZKHH 3U0TA 3TO2B 3DGGB 3AS2A 1UYWL 3SDAA 3JUZA 1AJ7H 5B3JF 3MJ9H 4QHUA 1T20A 4J1UB 4HIHA 5IQ7L 5MENB 4BSWB 1DEEA 2YWYA 1DLHA 4K23H 1WTGT 1OD7A 4AM0B 3FT3A 1MJUH 1LO3L 5JDJA 5I1KH 4A6YL 5GS1C 4LSVH 4ZSOE 4O58H 1ITCA 4PP1D 1TCMA 1IQWH 2V9QA 4U0RC 1ZK9A 1AKJD 5C0BB 3KS0J 4L9DA 1HQ4A 3PUCA 1H15A 3VFTB 1RMFL 3SDDD 2CK2A 5IIEB 2AK1L 3T65A 3MUGB 1JZ5A 3D2UD 5GRJL 4HEME 4YDLC 3RJDA 3MRLA 4O2EA 4WRLA 1QLFB 5DQDH 5DC9B 5I73C 1GC1L 2X4RB 3L7EB 5C7XL 2DQTL 3C5SB 4K3DH 4NT6A 5HY9B 3TVMA 2QV2A 3CFJA 3O2VL 1KPVA 4Z6AT 3L3IB 4PJXE 1AHWA 2R0WH 5C0AE 4DN4H 4PRPD 3S36L 3LRSA 5EU7E 3TYFB 4L4VE 3U1SH 3BPLB 4MMZC 2D0GA 3S6CA 3GMOA 4BK4A 1U91B 3QJFA 1EXUA 1WISA 3CVIH 3IFNL 2FGWL 4WGVB 1NMBH 1ZLWH 3TLRA 1FSKB 4HS6B 4JPWH 4NWUL 2F19H 1ZA6A 2HFEB 2ZUTA 3GSOA 3SCMC 4CVZB 3OAUH 2XWBB 2OQJA 1F3DJ 3C5JA 5KTEH 2H32A 3TBYA 3I2CH 1YJDL 2EIEA 2NXYB 3HNTH 1W72L 4YHKH 3LS5H 3MOQA 3SBWA 3P3YA 1NCCH 3G5XA 3EYUH 5C0IA 3V79C 5GRXG 1HHGB 2GTWA 1KJ2A 3KYNB 3PL6D 5JW5A 4PV9B 3D18A 1FGNH 3QNYB 2EXYC 5DRXA 1E4XL 1L7IL 2CRMA 5D8JL 3CNKA 4JRYE 3QWOB 4G5ZH 3Q48A 4Q6IA 1EMTL 3O6FA 4LQFH 4YHIA 5HYJB 4NSKA 4HFUH 12E8H 4XMKH 4UT6H 4XI5D 4MA1C 4M8VA 4LCYB 2R56L 2F5BH 4GBXA 1VDGA 2FR4A 5I1LB 2VLLA 4FXGA 3QFJA 4HUKB 2AI0H 2VLRD 2FH6A 4OCSL 5KSAB 2XKSA 2HKFL 3H3BC 3QDJA 3REWB 4ELKA 4G8IA 4KZDL 3OKKA 4UT7L 3VWJB 3TO4B 3G04A 5C0JB 5DVKA 1YEJL 4CNIB 5EB9A 4PJBF 1X5JA 4FNLL 4K9EC 3D25A 2IAND 2ARJB 2MCPH 3OKMB 5TPWL 3W39B 3ZSSA 4LLVB 4JO2L 1CK0L 5FM5M 1OM3H 1S7UB 3PWJA 3EBAA 3R1GL 5DJ8A 4LHJB 4C56B 4M7ZB 3IXTA 2DJUA 2DLHA 4LNVA 4F7TB 1IGIH 1NGQL 1I9JH 3RKDC 4GAFB 4J8RA 4FFZL 4HF5H 4ERSL 5C0FA 2OR8A 3C6LC 4LNRB 4M6MH 4N0CD 3UYOD 4OI9A 1A7OH 3AROA 3S35H 3KPOA 1FFNB 2BC4A 2NY4C 4H0GA 5DA0B 3O8XC 2ZZUT 3C60A 5HHOE 1KJ3H 2DD8H 5DJAA 5I71B 4PJ8B 3T0ED 3V0AC 5TE4H 2VZTA 2H32H 4MGXA 4MLSA 2HFGH 4UAOC 5MI0C 5F9OL 3SDAC 4AIXA 1X5HA 4YWGH 1H5BB 3DSFH 32C2A 1T03L 4QHKI 4PJEA 5I1DB 3MNZB 3D1MC 2VH5L 1UWGH 1NC2A 1KJ2H 2HVKB 3P0YH 4XNZB 3RU8L 5TF1L 5L8LB 3VI4E 2F53A 2WM0A 4ZG1A 1YUHB 4XGZB 4L8CB 3RPIA 1GL4B 2J5LC 4HQQH 3FT2B 4XAKE 2JCCF 4L8BA 3LHPL 4PG2C 4J2XA 4MD5A 3O3UN 4JB9H 5L9DL 3L7FA 1HSAA 3P0VH 1OAKH 4AJ0A 5IVZA 3BKYH 1AQKL 4U1HA 4U6XA 2H2SD 3FQTA 1U92B 1AO7E 1N7MH 3IDUA 3DVNB 3MRPB 3UZVB 5DJ2A 3WEXA 3ORJA 3SE4C 3L3GA 4F57H 1JNLH 3TVMC 2X05A 1O5DT 4LSRH 3QULA 4GRMA 1QSVA 3LPFA 3GKWL 4KY1L 2P42B 2OXGA 4OIAA 3SKOB 1OGAA 4PJ7E 4YGVA 4IHOA 4LKCB 1PY4A 3WFDH 2DTMH 1V3KA 4RMSA 1ETZB 5CHNA 3AXLA 3BEWA 4IRZL 1MRDL 2XA8L 2X40A 4EIZC 3EJZD 3VXSB 5FM4A 3P77A 4WV1A 5GGRY 1A6VL 3LN4B 3FN0L 2OI9B 3SO3B 3HMWL 3OHXA 3QRGH 2CLRB 5MERA 4JZJA 3HC4L 5GPRA 2A6KA 3CC5A 5FGSA 5GQBA 3MZTA 2YN5A 1I9RL 2R4RL 4HJJH 4MMXC 2ARWA 2BNQB 2J4WL 4NN7C 3TYGH 3Q3GA 5F7HA 3SBWC 5KG9A 4KROC 1Q9WB 5E9DA 3WO4C 1XF4A 4F7EB 3WE6B 3U30B 4HC1L 2P8LA 4RX4A 4PB0L 5D71L 1JRHI 3BKCL 3MLUL 4PY8J 1FBIL 6CGTA 2BVTA 4TTGA 3S37H 3UP1A 5CUSL 1OTUD 2ZUWA 1ED3B 3SPVB 5DDHA 1YPZB 1A4KA 5DO2C 4Q6IC 3DI2B 4A6YA 2LAGB 1RD6A 1A6UH 1I1AC 1AKJA 2GFBB 1L0QA 1MQKL 4I0PD 5IVXB 1CXIA 2D7QA 3SDDA 4ZXBD 3GK8L 2NY3D 4OZFG 5DFVC 3BUYA 3UDWC 1ORSA 1FL3A 4FZEH 4YHZH 2DKSA 1J0IA 2HYMA 4LSPL 1LE5A 5CJXC 4RIRB 3UJIL 4M8QB 1E4KA 3IETB 3CDYA 4M1DH 1T5WA 4LGRB 1G7MA 1NUGA 2DICA 2M26A 4OQTL 2QQLH 1SJEB 2DDQL 3BZFA 4EVNA 1KB5A 2GTZB 1Q72H 5F6HJ 1KYOK 1OGTA 2P5EB 4AT6B 3L5IA 3ZYOA 1QLRB 3ARWA 1BOGA 1P6FA 5F8QC 1OAZL 3SO5A 4K55A 3L3JA 3IAGC 1IKNA 4HAGA 4X7TB 2FCBA 3PDOA 5T5FH 5J7CC 3RIFK 1GCFA 4JHWH 2OXHA 1EVTC 4HJGB 3VXQA 2MNUA 4V1DB 2BZDA 1A6TB 5TQ0H 2VWEC 3C2SA 4NCC1 1BQHB 3C09B 5C07A 1RUQL 5FO7A 4PJIB 2EO9A 5CD3B 3PL6A 4Y4FB 4FZ8H 3BW9B 4NP4H 4Y16C 2KZWA 3L6FB 4IBLT 4U31A 2M8XA 1NCNA 3C60C 2HAZA 3S3SA 1FZKB 2ZG3A 4JKWA 3H42L 3G5VB 4I77H 1YQ2A 5DQJA 3V6FB 1BZ9B 3B5HA 3UTSE 4NCC2 1L9NA 1MCRA 2JJUA 2ZCLH 4LMQI 4DGVH 2DBJA 2EZ0C 1XCQB 3I3DA 5FCUH 3OKNA 5IF0B 1NCAH 1UYWH 4OM1L 1EK3A 2NYYC 3QI9C 3RTQC 1QSEA 3HE6A 3UYRL 3MRIA 5IHZB 3QISA 1MCSA 5JHDB 1F4WL 2AJUH 3WXWL 5EO1B 3X11B 1ZS8A 5FA3B 5IQ7H 2J12B 1B9ZA 2NQCA 1CFNA 1Q9OB 4H8WH 3W5MA 1T2XA 2A9ML 4HKBA 4LCCA 4XP1L 4XVUC 1DDHA 2ICEB 5FUCC 1QPXA 4A6YH 5J3HC 4JFED 5C08B 3U9UB 1L0XA 3R0NA 5DK2B 4N8VA 5EC2A 3CCHB 3MYJB 4KMTL 4JM2C 4NQSA 3KPRD 1RMFH 1OAQL 4XX1E 2JJWA 1FCGA 3PP3K 2IANA 1FH5L 4D9QE 1G7HA 4F8QA 3VXPB 5L88L 1T89A 3A6OA 1GC1H 1F45A 3U36A 2DQTH 3BMVA 1VADB 5HJ3A 3T8XB 1HHIA 5IQ9A 3VMNA 1KC5L 4KQ3L 4RFEB 1IILE 2NTSP 1MJJA 4KJPD 3VJ6B 3ARDC 3MACH 4ELMF 3EDKA 1S9WB 4HUVB 1SMOA 3CU7A 1KLGB 3OWEA 3UYPA 5C1MB 5GRVK 1KB5H 1P2CA 5AWNL 3E6HA 3D3VB 4NNPH 5JHLL 4GRLD 1HXYB 1T1WA 3SE8L 2ICWB 1I3RB 2FGWH 4H5SB 5DHVA 1FORH 4JKLA 5BS0D 1YNLH 2FD6L 4PJGA 1A0QH 3BPCB 3VFVA 3T0EA 3LD8C 5SWZE 1YEFH 2P8MA 1KELH 4M4RA 4RGNC 3T2QA 3U9PH 4G9DA 2CJUL 3JUYA 1YJDH 1S7TB 5FUZL 1MHHB 1WZLA 2PXYA 1PD6A 3W2DL 2VR5A 1CFBA 3FJTA 1MCFA 2E3VA 2EH7H 3OKLA 4Y1AB 1GGYA 1N64H 5D1QD 5EORH 1TZIA 2VL5B 3SQOL 1YN7B 3QUMB 1KXTB 1XF3B 4XRCB 1ZLUK 3JV0A 4C58B 4H8WC 1JL8A 2AXGA 4RFNC 2CRYA 5F7EL 2X9WA 1D5IH 1YYMH 1EMTH 1ND0A 3UPAA 5ESQB 2OMBA 3TNMA 1QBML 1EVUA 2YEZB 5HSFA 4OZHF 5B38A 5KW9H 2X4UA 4NC1C 1KN2H 2VXQH 4MD0A 2AV7B 3H9SE 5F6IC 2P5WE 1GC1C 3GSVB 4IDJL 4LLYA 4U1KB 2DI8A 4P2CG 4Y0GA 1E4KC 1UZ8B 3I6GA 4XBPB 4JFFB 3WS3B 4WDIB 3FAXA 4RRPA 2C1OB 4FQJL 3KS0H 3IS1X 4XAWL 3X14A 5MEPA 2EE3A 3QEQA 3U4BH 3U4EB 2CMRL 4ALAH 5T1DL 4YHNB 4X6DA 3PQYB 4UT7H 5JQ6H 2HN7A 4CJ0A 2R1YA 4WU5B 2Q8AL 3CSGA 5DRZA 3UTTB 1I1RA 5DURD 3RA7L 2VR9A 2W92A 4N9GA 3ROOB 3HE7C 3GBLA 4PJAE 1XF5A 5LG1A 3FQNB 4LVHB 2QSTA 4HGKC 5TPWH 2OTUA 4GKZB 4DK6A 4ZUSA 1CK0H 4P3CH 3RWCA 4AG4L 3QUYC 1N8ZA 4PJCF 1P9MA 1YJDC 3KPNB 1F6AA 2Y7QB 2Z31A 1S78D 4OGYH 2YA0A 3IJSB 1LMKA 4MNGA 5HDLA 3JWOL 4NO0D 4LMQE 3U7YL 4Z7WA 5E2TH 5CJQL 4BFEA 5SWQB 5F3BB 1FAIL 3CSYB 3EOTL 3SKNB 4FFZH 1OAUL 4ERSH 3QHZL 2ESVD 5CSBA 3U0WL 1Q9LA 2JIXD 2MQ3A 1J5OL 3RWEB 4PRDB 1F3DH 1DQQB 2VZSA 5K33A 3D39D 2OCFD 3OB0K 5DHVH 1CIDA 1S7RA 3O41A 3GSWB 2FO4A 1KIPA 4HLZH 3H9ZA 5EUKB 4QHMB 2NXZB 2IALA 4JO3H 2WAHA 3TJHD 3OAYK 3H7LA 3AMKA 1FZJB 4I0PA 3FOMB 4XWGH 5F9OH 1XT5A 4ZXBA 1X6LA 3KHOA 3HE6C 5B4MC 4ZTPH 4DGIL 1IGCH 2NY1D 2VH5H 7CGTA 5LGKA 3TJEL 3SE9H 4XVSL 3RU8H 5TF1H 4G6ML 4Y19B 2EYTB 5FOJA 2UZYB 4X98B 2DYPB 3F5WA 3QUZB 1TZGL 2V2XB 3MV9E 4PTUA 4XCCL 5C8JA 1FLTX 1HILB 4KHXH 5D7LD 4OQTA 4TUJB 43C9A 3ULVF 5L9DH 3WNLA 1I7UA 3S4SB 5JR1L 3WMSA 1AQKH 3ES6B 4YUEL 2BVOB 3FB6A 3MRFB 3MV01 1T89C 3VFUB 5DWUH 1CXFA 5GSVB 1ZANH 3RKPA 3OR7B 3OG6B 1S9YB 3TPKA 5IOPA 4QGTA 4Z77A 1DBBH 1S5HA 4BFGA 3O6MH 2GJZB 1AIFA 4G8GA 1ADQL 4JGUA 3VFSA 2KQMA 4PG9A 5FGBA 1D6VL 5E6IA 1NKOA 1U6AL 1MRDH 3FN3A 1JWMA 1QD0A 1U3JA 5FF6B 2IF7A 3LKNA 2VDLL 2AJSL 1BF8A 1A6VH 2QBWA 1EAPB 2F54E 3NIFF 2VLJE 2VZVA 4YIQA 3KPSD 3WJJC 3GZKA 5DR5L 4GRWB 1CFQB 1I7TB 4MYWB 4O9HL 5C09A 3LZFH 1I9RH 4RGMC 1PYWB 4MB3A 1D5XB 1RZIB 2J4WH 2PXYC 2VDML 4WCYL 4F2MA 3R06B 4U1JB 3G6AB 3ARBA 2J8HA 3GIVB 3MA7B 1U3HD 2IPUK 4PB0H 5D71H 3ESVF 3BKCH 3MLUH 3O45A 4Z95L 4DVBA 3OJ2C 1HOCA 4KV5E 5CUSH 3PGCB 4B0MM 4HKXB 5L0QB 4YHOL 2EEBA 3HZYA 5AEAA 4FQ2H 1FAKT 2X4OA 1OW0C 1MCKA 2VXTL 4M6OH 4NDMB 5I8OL 2A1WL 2WIIB 4L3CB 5IW6A 1B0RA 1DQJB 4OD1H 2BCKB 2CR3A 5J13C 3KPRA 1CE6B 4GKOA 3NN8A 4OUUB 5GIRB 3C9NB 3IRZA 4TPRL 3PIQA 4D0DA 1KG0A 4UDUA 1P7HL 5IGXL 2AJ3B 1LGVA 1RZFL 2DQDL 5EC1B 5C0CE 3DXAD 3WHE0 1LQSR 2WSKA 3UJIH 2B5IB 1UA6H 4MNQE 4WEUD 4WJ5A 4MCZB 1Q0YH 5IBLD 4MAYD 1KYOJ 5IKCB 2CKNA 3H3PL 4YQXH 3QCUH 5JO5B 1A1MA 4OQTH 4YDKL 5IBUB 2Z8SA 3BP4A 1G1CA 5DUMH 3FFCD 3MRJB 2ZOKB 1VKXB 1JV5B 3B9KC 2BRQA 5BS0A 2I5YL 1WWBX 5D7SL 2FECL 5ESAA 2WP3O 1S8DB 4LLUB 1P9MC 1NCWL 1XMWA 4MJ6B 4OF0A 4Z7UA 1P7KA 3I02A 5JW4M 4KK5D 5MEND 2B7DT 3I84A 1IQDB 2Z31C 4PJFB 1KEGL 2EDXA 2IBZX 3QFJE 4OGZA 4P9MH 5ADPL 2HFFA 2UZIL 4PY7B 3G5YA 4IRSA 1RUQH 2FNBA 5HVFB 1TLKA 5C0BD 4JDVB 3QXVA 1L7TL 2J6EL 4EN3A 4XB8A 4TNWF 2NW2A 4BFIB 2YSSA 1H3TA 3GBNL 1SHMA 2A77L 1OQOA 5I15H 5IESL 5JW4Q 2QL1A 3NTCL 3H42H 5K9JL 1AR1C 2V5YA 4UBDD 3L3HA 2XQYK 3UJJL 3V0VB 1SEBA 4NQEB 2X4QA 4CJ1A 4HXBL 5IVOA 1JVKA 3MRHA 1E4JA 2DMKA 4OM1H 4U7KA 3CFCL 4LPCA 3IGAA 1EEYA 2BNRB 1NLDL 2NY0B 3K2UL 1TJIL 2HVJB 2VWEE 3WXWH 2I9LB 4QXWA 1G84A 1C5BH 1G7JA 2A6IA 2ILLA 3QPXL 2FZ3A 2EXWC 4GT7A 3V5HB 4XP1H 5F9AC 5D2NB 2XXMB 3VXRA 1CGXA 4GJTB 1G7PA 2YUVA 2BVPB 2CO6B 2NXYD 5GRUL 1RUKL 1OAQH 4LVEA 1RJLA 3F7PC 1XGRB 5GZNC 4TUKL 3IU4L 5L88H 4PJDF 2F74A 1YC7A 2YWZA 3LKSB 4YHLL 1T83C 1IFHH 1VGKB 3VXMA 3A6BL 3OAZK 1KXVC 2V7HB 1U8PA 2R23B 3CFBB 4GS7B 1KC5H 1IGJB 2BSSB 4WU7A 1HYSC 4E42B 5FGBC 3CAFA 1MH5A 5E6IC 5I0DA 3VWKB 2FIKA 4X6BB 1F97A 5GXBB 1P1ZA 3PV7A 5HYJD 1MAKA 5KVEH 4FQPA 5FUCE 1BBDH 1F11B 1DL7L 2ESVA 5HI3C 4Q74A 4PBVC 4ZFOL 3IDMA 4I3RH 3FB8B 5FA4B 4HSQA 3L3KA 4KK6C 3ZHKA 2R4SL 3QBTB 3VGDA 4Y5VB 1FV1A 1BQLH 4GQPH 4HT1L 5D96C 5IG7B 3HUJA 1ZGLB 1CFVL 2EIDA 2O61B 1TZHB 1DVFB 3ARBC 4P46C 4YH6A 4KPHH 5KSAD 4U1LB 1HCFX 2IGFL 1OGAE 4TULL 5E2JA 3VWJD 3MLYL 4G6KH 3UTZA 3TO4D 4Z0XB 3OZ9L 4AQ1B 4K7PY 1CFTB 1EHAA 1EBAA 4WW2F 3ARPA 1CLCA 3RNKA 4WI6A 2IH1B 1BVLB 1TNMA 1GZQB 4HMEA 2XY1A 2WMPA 5F7EH 3DMMC 1E28A 4W4OA 4PLOB 1YECH 3B9DA 3MLSL 5F9WB 4OTXH 4C56D 4YFEA 1UWEL 4I2XA 1QBMH 2JLLA 1J1OL 3IYLW 3WDJA 1CVRA 4W6WB 4HWZB 2WWMD 4KKCC 1OL0A 4RGNE 1DQMH 5E9DE 4BZ1L 5KN5B 1K8IA 4U6TA 1NUNB 3PWPA 4U1NB 3GMPA 4GKSB 4IDJH 2ZCKL 1GXEA 1MCJA 1PQZA 1ZWIB 3MCKA 4XNQB 3ARGB 2CLVB 1VEPA 1RZJL 3BXNB 3OKOA 3KYOA 1BHGA 4HD9A 1MCPL 2O5XH 5KVDL 2QADD 4LPYA 2NLJB 3CLEL 1CD0A 4R3SB 2XQBL 4YXHL 2FB4H 2DM2A 3PXJA 4M48H 3DIFB 1RPQA 4Q97A 3NAAL 1HKLH 5GRVL 4S1SH 3KPSA 4F7CA 5ANME 3D85A 5E24E 4F3FA 5T3XD 4NC1E 3BKML 1X9QA 3EYQC 4XNXL 3RNQB 4IS6A 5CZVH 1FL6A 4JJ5A 2VN7A 3QDHA 3U48A 4IRSC 2V5TA 2ITDA 1U3HA 1RUAH 2GCYA 5E2VL 4F8TA 1FAIH 4H0HB 4EN3C 3C8KB 3B2VL 3IFPB 1Q9KA 4LOUC 1J5OH 4PJXB 5F7LB 3LV3B 5C0AB 1XFPA 1WV7T 2X70B 3BD4A 4RWHA 1FZMA 4L4VB 2Q6WB 5BZDB 1QVOA 4Y2OA 2VLMD 1HH6A 1OLLA 3PGFL 2YMXH 3WNNA 5HI4C 3NZ8B 4O51B 3MLXH 1T2JA 1WT5C 2WUBL 4N8VG 5TDOA 4DGIH 4M43L 5GSRA 4UOW0 2W0PA 2VB5A 2A2QT 4CMMB 3VXSD 5C07E 3IU3B 1QYGH 4G6MH 1C08A 5BO1L 1MRCH 3DXAA 2W59A 1FFRA 3ARSA 7FABL 4JFQB 3EDEA 5IB4A 4HWBL 4MJ5A 4LCUA 1TZGH 5D5MA 1Q38A 4XCCH 5BQ7B 3LMJH 3QH3B 5HGDB 4KKBD 5EZOH 1KOAA 4NJ9H 4KK8C 1NFKA 5C0DB 3IDNB 3GSNB 4Q6YA 3L5XH 2XV6B 5JR1H 4JRYB 3FFCA 5B8CA 2X9XA 3RJQB 3DGGA 5L6YH 4TNVF 4XZUA 2PW1B 4MAUL 1QSEE 4J1UA 1FO0B 5KSBF 3B3IB 5HHQB 2P49B 4K3EL 4BSWA 4BKLA 3EZ8A 1FVCA 4JM4L 3LDBB 3JWOC 3BQUB 4HLZG 1M7XA 1I8LA 2ZCHH 3HFML 4NKMB 1D6VH 4TQEH 4HJ0C 2A73B 5C0BA 4R2GB 1CGVA 1LDSA 1F42A 2VDLH 2AJSH 3I50H 2HA1A 3VFTA 4JY4B 2J6EA 1G7QB 3TWCL 4CW1A 2IFFL 2C7UA 5FYKL 5IR1B 1B88A 1A7RH 2IANE 1UKQA 5DRWB 4WEBH 1SBSH 2BFVH 4I18C 5A2FA 1I85C 2C5DC 1RAMA 5ENWB 3L7EA 3LN9A 2WUCL 5HY9A 3RIFF 5EBLA 1GGTA 4HMDA 2B0SH 5JPNB 3OXRA 1LD9A 3MOAL 1E27A 5DJ6B 5KSVB 4R0LA 1JTPA 1ZXQA 5B38G 4LASL 1QFWM 4HKJB 4YHOH 2XNAB 4MXQC 1FNLA 2YBRB 3EYSL 2AJVH 4W4OC 1R5IB 1OB1A 4HS6A 1MHCB 4TSBH 4KVNL 4PJGE 4RRPG 4CVZA 1N0XL 5ERWB 4YJZL 1RULL 1L6XA 5HHOB 3T0EE 3VGGA 1F3JA 1NKRA 1RIHL 4KRLB 4NO2B 3IB4A 5LCVL 4V1DD 4X9GA 4CVXB 2FBJL 3L95A 4ODSL 5IGXH 3W9EB 5LBSL 2DQDH 4PV9A 4Y4FD 5TE6H 5DMJB 1ITBB 4JDZB 4Z7OF 4L3EA 1WAAE 3RY6A 4UILH 3MODL 1CWVA 2R0LH 3CH8A 3H3PH 3EFFB 4NKDA 4JN2B 3B5TA 1GZPB 2F58L 4PY8I 1EV2E 1ORQB 3GB7A 4NHCL 2DM7A 4M7LH 1WFOA 1WICA 4IRJC 1OF2B 1JZ3A 3ARFA 5JW4R 4RAVB 5ITFB 5JHDD 2I5YH 5D7SH 2JJVA 2BJML 1FN4A 5F7DA 1NCWH 1A6AB 1JHTA 1JF6A 4CN1A 1AO7B 3DYOA 2KZ1B 1KEGH 4PJEF 1FZOB 2ATKA 3VG9C 5KSAA 4X6CF 2UZIH 5C08D 3QEQE 2I26N 3HB3D 4E9LA 3STLA 4O00A 4N5ED 3VU2A 4X6DE 4PJ7B 3P4MB 1NBZB 1L7TH 1Y6NR 1ZT4B 2J6EH 1SMAA 4NZRL 3GBNH 4P4KB 5GGRA 4JPIB 3O2DL 1DQTA 3OKMA 1NJ9B 3NTCH 4K3GA 2C3HA 4W4NA 3DRQB 4QRSB 2IFGA 4C56A 3FT4A 3UJJH 2JB5L 1ZOXA 3C6SB 3IKCB 1KCVH 1G0DA 3CFCH 4NJAL 4MNGE 4YNYB 2XKNB 5KOMC 3K2UH 2UY7A 1DN2A 4Z7WE 1TJIH 1KENH 5I6XC 1KULA 2JB6B 4LAQH 4DGYL 3VGAB 4M00A 2YC1B 3UPRA 2KBGA 1FFNA 4C83A 3EHBD 4DQOL 1F5WA 5SX5K 3WNOA 5BVJA 1X7QB 3G9AB 1A4JB 3WUWB 4DVRL 2FYYB 4U7SA 5B8CC 4B41A 2RBLA 3B8YA 1RUKH 3ZLQC 1A6WL 4GKNA 4FTVE 1NEUA 1H5BA 1BIIB 4G7VL 2P4AB 2HTLC 3MNZA 4QRUB 5E7FA 4TUKH 3SGJC 5EU6E 4XMPL 4TRPH 2HVKA 5I18L 4YHLH 4ONOA 4BH7A 3MSPA 4ZUTB 1EHXA 1YUHA 3NACL 4ZNEA 4L8CA 4P59L 4MVBC 4HIJA 3DX8B 4HX1B 4ZPTA 1LK3H 2PYEB 4M4PA 3P9MB 4HGWB 3WIHL 1MJ8H 2GY5A 4OF6A 5AZEL 4NQXB 3MRQB 2NY6D 1KJMA 4UZGA 1KNOB 3S88H 4MJ4A 2EDKA 3IXAB 4NQCD 3U7WL 1ZLVH 3DVNA 1KCSL 2R4SH 1G6RB 2IG2H 3TH4T 1M7IB 1WBXB 1CFVH 1UFUA 4JFFD 3TFKC 5I1HL 2N7BA 4N1HB 1BFOB 5JXAH 4M03A 5H35A 4LKCA 2IGFH 3JV4B 5MEQA 1BJ8A 4R0LC 2Z91A 4I48B 4G8GE 3GEWB 3Q1SL 3C87A 3VXSA 5DK0B 1UT9A 1SM3H 4G6AD 1CL7L 3UTTD 1X5FA 5E00B 5FB8A 2BDNL 3VFNA 4HWBA 4LSSL 2HMIC 2CLRA 2E9JA 4HDIB 4X7SH 4JFZL 5L2JA 5EPMB 5C09E 2DI7A 5DJYA 2RFXA 1UWEH 3WNKA 4I1NB 1U93A 4K7FB 4YBQD 2EEAA 4X5XA 1IL1B 3BDYH 3WE6A 1IC7L 5C3TA 5HD8D 1RUPL 5D1XA 3UTSB 2WP3T 1S5IL 2BSRA 6FABH 4KVCL 4XPFH 4Y4KD 5CSZB 1K85A 1YY9D 2IAMB 3VMPA 2F8VA 1ZTXL 3SPVA 3RY6C 4XMLL 1XCTB 1YPZA 1RZJH 1H9VA 2ZUSA 3BOVA 4UIMB 2R39A 3MJ8B 1ZHNA 3VD9A 1AXTH 1MVUB 4GMTL 1RFDL 3G6JE 3LIZH 4XPHL 5E2UL 3FTGB 2GFBA 5IVXA 3ARFC 2I60L 3LQMA 3NAAH 3MGTA 3ILQC 4AEHL 2ERJC 2X09A 1RQ5A 5IM7B 3V5KB 4Y5YC 1CDJA 5T3XH 5C0RL 4Y19D 1JNNL 2DQHL 1UQSB 3DUUB 1CD1B 3PG2A 4PGZA 1GOGA 3EYFB 3MV8E 3QUZD 1OP3H 2AXJA 5FM5O 5J1SC 3UPCA 4NQVB 4FQ1L 4LBEB 1SJEA 1FFOA 3SKJH 5JLZB 5E2VH 3CX5K 2NY7H 5MHSD 4JG1L 4P5MB 1KLUB 3B2VH 5JXED 4TVPL 3LSOB 3LEXB 1OP5H 4ZD3L 1QBLL 3ZSTA 5C6PB 5HPOA 3M17A 5TGBB 3TPUA 2ED7A 2NW3B 5GS1B 3HZKB 3QO1A 2MQ0A 4H1LG 3PWNA 4U0RB 1MREL 3IDIA 4Z7UE 4JO4L 5FDWB 3PGFH 4I3GA 4HJGA 2EDDA 2HLAA 1MCIA 1YQVH 4GAYB 4V1DA 2C3GA 3REVB 3VXTB 4X7EC 5SWZB 5C2BL 4JN1H 5IFJB 4YDLB 1WK0A 1UB6B 4MXWL 1LNUB 3HPLA 4PJIA 4LLAA 2D7MA 4HWNA 5J11C 5I73B 3QEGL 1F4AA 1R0AL 4Y4FA 1RZJC 4Y5XA 3NH7L 3WHXA 5C0NC 1X44A 4P2QD 4YZFF 7FABH 4HWBH 5BXFB 5EA0H 5FKAB 2CKBB 4QKXB 1FZKA 1OTSC 2PETA 1PKQE 1CBVL 3F58L 1BZ9A 2VXVH 1KLFA 4DEPC 2CGRL 2Z35B 5EIIB 3O3BA 3PV6B 5CILH 4CMHC 1EFQA 3CJJA 4J6RH 5IF0A 3RIAK 4WHTA 3EYVB 2E6QA 4Z0BL 2UV3A 5JHDA 4F9PA 5IHZA 1S7QA 4EIGB 1AH1A 5EOTA 1D6EB 3MCLL 1DN0A 3SCMB 5F8RC 3CLFL 3HI1B 1LO0L 3HRPA 3H9SB 3BO8B 4F7MB 2P5WB 4PLJD 1CGWA 1Q9OA 1OARL 2ICEA 5TH2B 5E70A 1VFMA 2FJFB 3MRRB 3OKYA 4PPTA 4X7DC 1KV3A 4NFDA 5ALBL 3JVGA 3KPPB 1IBGL 3UBXA 3VXRE 3M1BA 2VYRE 5IB2B 5HGGS 4LEXL 1CLOH 5DYOB 1KTLA 1N2RB 3OL2A 1GJIA 3O2DA 2GK0B 2IFFH 4S2SB 2EE9A 5C0GB 1MFDL 1TMCB 2Q76B 3RI5F 3M45A 1CN4A 3RDTA 4AMKL 4PJAB 4DZBB 4RNRB 3FO2A 1VADA 3FN9A 3T8XA 2WUCH 4HKZA 4POZD 1JWUB 3VXME 2D0HA 1ZAGA 3NFNA 1RIUH 2IMNA 5B3NA 1MAJA 4MA1B 4LLMB 3WLWC 1BJMA 2D9CA 4FG6D 3MOAH 1UWXH 1KLGA 1JWSA 1U3ZA 4J3VA 3QHFH 1GIGH 1NH6A 3BGMA 3ZYZA 3BZEB 2GEEA 3PWLA 4I0KA 1TCRA 1RK0B 3HI5L 1T80A 3EYSH 1UM4H 4X6DF 4Q9RL 2NTFA 2AW2A 4ZO6A 1N0XH 1RULH 3GUTB 2F8OA 4U33A 3BI9X 3BISA 1RIHH 1JF5A 1S7TA 5TDPA 1K3ZA 5LCVH 2EIZB 1WUNT 2W9DL 5D1XC 4FMKA 2P24B 5HGHB 4Q7DA 4OCXH 3WFEL 3U7AA 1GGIL 2I9TB 3IJHB 3LEYL 2D4FA 4JFOB 4OKDA 5F3HB 2X89D 4OM0H 1DTUA 4OZGB 1RU9L 5LBSH 4RZCA 5E6YA 5GISH 5T1MB 1TVBB 1D7FA 4I5BA 3GMRB 3MRDA 4K7PL 4PUBL 5GGVY 1YEGL 4H26A 4RWYL 4Z7WF 3THMH 3SY0B 1CDHA 1FL5B 3KYMB 4M1GL 3ILPA 3WIHA 4TN9A 3SDYH 4NO5B 5DS8A 1LO4L 4EI6B 2IEPA 2H1PH 3S3PA 4NHCH 3E8UH 2PO6D 3ULSA 3MV9B 3DPBA 1MJ7L 3C6LB 1X5XA 3QEUB 4NQED 2YEZA 1S3KL 3TP4A 3GMNB 5IHBA 4NQCA 3T0AA 4I2XE 1CDIA 2NY4B 4JHAH 4JQVA 1YY8A 3O8XB 1EH9A 3E2HC 2BNRD 1CE1H 2NY0D 2XWJB 3PWPE 3VDCA 3PHOA 5L2KA 5E08H 5H37H 3U0TB 1P4LA 3NVQA 2MSPA 2OS7A 3QSKB 4AL8L 1PZUB 4UAOB 4WDIA 5MI0B 4NBZB 2C1OA 3SDAB 5CGYC 2D7TL 4QHUB 2AV1A 3FRPA 1T20B 4O2CA 4YHNA 4NZUH 4HIHB 5HHXL 3GRWL 1CF8L 1DEEB 2DF3A 1JGLL 1WWAX 3LN5A 4R97C 2Q86A 2BXZA 5ICZA 1DLHB 3UTTA 4KZEH 4E5XA 2R0ZL 4ORGA 4R6UA 3FT3B 2J5LB 1N59A 3NGBB 3O2DH 3FQXA 1RZ8A 2XKUA 3DURA 4EUPB 1IZJA 3KPSE 4YR6B 2C3VA 1EHNA 2F54B 4J3OC 2VLJB 1PEWA 1F6FB 3T65B 3TH2T 3RL2B 1VSCA 4GQ9L 1QSFA 5C9JA 3MRLB 4O2EB 3VWKD 1AGCB 4KJQD 4U0QB 4ZS7H 5F3BA 1LK2B 3QQ9D 4AIZA 3CMOL 3CSYA 4Y4KA 4Y5XC 4NT6B 4PREA 3TVMB 3ZT5A 2R1XB 4HWUA 5F96H 4OT1L 3H9HA 5I30L 3RWEA 1YEIH 3KPQB 3N1PC 1PG7X 1KPVB 4ONHA 1A7BA 2OTWA 1F2QA 3ZO0A 3LRSB 4QHMA 3QPQC 2IQAA 3VE0B 4NCDA 4P2RA 3QJFB 1EXUB 1DVFD 5D93C 2BSTA 1OSPL 2R8SH 4N5UA 1ZA6B 4FABL 3QIWA 1DEDA 3LAFA 5IEHA 5TE7L 3FHAA 2KDGA 3C5JB 2H32B 3NIGF 3TBYB 3VXOB 5DTFA 3KHQA 4Y19A 1N26A 1OAXL 1HXMA 4P48A 4QXUH 4X98A 4NN7B 4YPGA 3DXAE 4P59H 3QUZA 3WO4B 1BAFH 2V2XA 3CH1A 5C0IB 3BGAA 1HILA 5DLML 5FO9A 5C0CB 1KJ2B 1Z2KA 3JVGC 5D5ME 3WIHH 5C2UB 3HPJA 3D18B 1DLFL 4MNQB 3VCLA 4WI4A 4DAGL 5DRXB 1S7SA 3LQAL 5F7NC 1KIQA 4JPKH 2BVOA 3FFCE 4PJ9C 3CMGA 4UB0L 3DHMA 4Q6IB 1N5YH 2DQIL 2VNCA 3RDTC 3O2WL 3O6FB 3OR7A 1SJVA 2CDGA 4YHIB 1F58L 1HH9A 1TETH 1S9YA 1R6VA 4HXAL 1IJ9A 2CRIA 3ARGD 1G9NL 5FHAL 3L5WA 3QCTH 1A5FL 5I1HH 5I9QC 1J0HA 2A9NH 2GJZA 5EOQL 5B39B 3ZDXF 4GG6E 4TTDC 2Z8WC 3NPZB 3MLZL 3TC9A 5M94B 2VXUL 2VLLB 3KLDA 1CLZH 1IKFH 3A6CH 3QFJB 4KI5C 3DETC 3BPOC 4DKAA 5FFLA 1LDPH 4P2QA 3QG7H 1U8QB 4FQCL 1LO2H 4ODXA 4U7MA 4G8IB 4ZO8A 1L6ZA 3OKKB 4JFZH 1CFQA 1I7TA 1U42A 1MQ8A 4HAFA 5SWSA 1FVDA 1I9EA 3EO1B 3WSQL 1RZIA 3D25B 5DT1L 4W68A 1MWAL 1JGUL 3INUH 1U8NA 4M6NH 1A7QL 1IC7H 3GIVA 3MA7A 3TV3L 1RUPH 2AVGA 3G6DL 4Z7UF 1I1FA 2Y07H 1S5IH 5DJ8B 5D6CB 4HCRA 1G9ML 5FO8B 2R29H 4HKXA 4P5TA 4M7JH 5EWIL 4GAJL 4XMLH 1D5MA 2IPKB 5E03A 4QXGH 5C0AD 2CR6A 3N85L 1UZ6F 4L4VD 3OAZH 4GMTH 4NDMA 1Y18B 5D70L 1RFDH 5EFIA 3R4DA 5C0FB 3Q5OA 4GFTB 5E2UH 4ACPA 1NL0H 4Y16B 3MR9B 4JQVC 2BC4B 1CE6A 3C60B 1MAML 5GIRA 2FX7L 5AD0A 3C9NA 2MCG1 1K4DA 3ARUA 2UYLA 1JHLL 3MBXL 3DUSA 5FYJU 3KLHD 4JHZA 5EC1A 3TIEA 1JNNH 1NEZB 3CX5J 4UI2A 32C2B 4XPBH 3NCJL 4KKLD 4L3EE 25C8H 3O3DA 5IKCA 2HTKD 5JO5A 1NC2B 4NM4H 3QI9B 3RTQB 3RZCD 2GJJA 3O9WC 4A2MA 3IFLH 4JG1H 1HHHA 4XCYA 4JRYD 4TVPH 2ZOKA 5FIEA 4L8BB 5HHNA 3RWHB 3ZTJG 1WLHA 3ZT6A 3BP6A 2COQA 1HZHH 3ZKMD 1MCOL 3L7FB 1HSAB 4NO3A 2VN4A 4MJ6A 4YDJB 1EZVX 2YPLA 3Q5TA 5IVZB 1ES0A 1C5CH 1NBYA 4JM2B 4U6XB 5CJOH 3FQTB 4ONGL 1KPUA 4MS8C 3UZEA 3BQUD 5DJ2B 2QKIA 3W5NA 5JZ7C 1QR1A 4MXWH 5DJ0A 4C4KT 3L3GB 2X89A 1AGEB 2A0LD 2O5YH 1I1YB 3KWWB 3QEGH 4GRMB 4JDVA 4R2GD 4F15C 5J1AA 1R0AH 2V2TA 5F7WC 1NMCC 1OGAB 3NH7H 3OKEA 4JO1L 5I76B 2AEPL 1U58A 5DMGD 4M1CC 4O2FB 3KJ6L 4B53A 5EDXA 5I74C 4OZIF 4LLWA 2AK4A 3P77B 4WV1B 3V0WL 4GUPA 2PO6A 4L8DA 2B2XH 1CLYH 4NQEA 5IEKB 3OHXB 3SQBA 4M5ZH 4C56E 2WWKO 3QIWC 3AB0B 4FQIL 4DUVA 3CC5B 3HUJF 2BNRA 4Z9KB 3LD8B 2X1PA 4HCRH 5DGQA 3CLFH 4RGNB 5AYUL 5E9DB 4TUOA 4Z78A 1XF4B 2YD5A 1T22A 2P8LB 5IW3A 4WTZA 1K8DB 3LH2L 1P5VA 3W11D 5INDB 2BOCB 1PKOA 2V9RA 1INDH 3GRWA 1IBGH 1FGVL 1CGYA 5HHOD 4X0KA 5DDHB 1MHEB 4KGJA 3DTXA 3DO7B 4POUB 5DD3H 3BIBX 3FKUS 3CU1A 4RFNB 4A6YB 4RSVA 3BH8B 1XGRA 1VEOA 2E8YA 4OJFL 1D5BA 3LKSA 5EIVA 1VGKA 4MXVE 3GMLA 5TDNA 1Q1JL 3SDDB 1KT2A 3BUYB 2R23A 2VDKH 1IGJA 5ANMB 4E42A 2UUDK 2YA2A 4KGLA 3IDYC 4ZNEE 2LTQC 4YDIH 5F6IB 2W9LA 4LRNH 1GPOL 3V6BR 1LE5B 2V7NA 5E8NA 1UC6A 1V7NL 4XAKD 2PN5A 2ZG1A 2X4SA 2XWTB 4Q2ZB 5DI8A 3A67L 1T5WB 4G6JL 1G7MB 5E5RB 4R4FL 5EU3B 2OZ4L 3D0LB 4WHYH 4Q9RH 3BZFB 4WUUD 4EVNB 1ZGLA 4BFBD 1JJUA 5K9KA 1OGTB 1AO7D 2O61A 2VLME 5I8KL 1BOGB 2YD2A 4U1LA 1HI6A 2W9DH 3L3JB 2DQJL 4JAMA 5GS0D 2O26U 3UBXI 5CLTA 5HXMA 1GAFL 4FQXA 3QUYB 4P5TC 4NUJA 1K4CA 4Z0XA 3JV6A 3VXQB 4KTEL 1XIWC 3VI3E 4P4KD 4PUBH 1GZQA 1YEGH 3Q6GL 4RWYH 3BIKA 5C07B 1V3LA 2Y06L 3PL6B 1LE9B 1LO4H 4XCFH 5ALCL 5K59F 3ZDZF 1ZSDA 2OJZL 2Z8RA 1J8HA 3N06B 5EZIL 3KYKH 3RX7A 1J05B 5E1AA 3RPKA 3GMQA 5TQ2L 4XNQA 3OGCA 1J88A 4NNYB 3ARGA 1EJ6A 3OKNB 4AL8H 4Z7QE 5AG8A 2J8OA 1FPTH 5ISZD 4KWUA 1JPTH 1U3YA 1QSEB 3HE6B 5KANI 2AAVA 3P0GB 2VL4A 2PW2A 3CK0L 4NN5C 3EGSA 4L4TB 3SGDH 4ZAKA 3U2SA 5IV2B 4I13B 5HHXH 1RIVL 3GRWH 5KVGH 1JPFA 1CFNB 4HKBB 5IVXE 1DDHB 2GAZA 3DIFA 3MA9H 2WINA 4MQ7A 5FYKE 1WSST 1WBYB 4N8VB 1ZHBA 4NQSB 2AABL 4RA3A 3RNQA 2L7UA 3LCYA 3MO1A 4MSWA 4OLYL 2IANB 4OLVH 2C9AA 3TBTA 3O3AB 2XZQH 2PYED 2E8ZA 4U3HA 2NCMA 4JFXA 4KUZL 3U36B 3CMOH 5HJ3B 5HHVL 5IQ9B 5E6ZA 1RUML 2Z0BA 1MJJB 4QRTA 3NCYP 1B4RA 4XPTL 5DVNA 1PFCA 5FYLD 5IFAL 3BSZH 5C0AA 5H37G 4YHMH 2Q6WA 5BZDA 1WFUA 1P2CB 4XVJL 2NY5L 3E6HB 4JRWA 4LCIL 4HGMA 1T1WB 5IFHL 1ZKAA 1JFQH 4PRBA 5DHVB 3V6OC 5D72L 3BESR 1OSPH 4PJGB 4IOFC 4R8WL 4FABH 35C8H 2YRZA 3UBXG 3VFVB 3T0EB 5TE7H 3WD5L 3OQ3B 4G9DB 4CMMA 2VERN 4PJIE 4RGMB 1VGEL 2PXYB 4LSTL 1T66C 4JFQA 3RWFA 1E6OH 1KTRL 4MZ3A 2FLBT 3OKLB 5DQ9A 3RZCA 2NZIA 3GSNA 4KTYA 2AXGB 4F80A 4PD4K 4JRYA 3F7YB 5KJRH 4X6EA 5L8JB 3UTSD 2PW1A 4UB0H 4XH2A 1J18A 1IEAB 2DQIH 5I75C 5GGQL 1KCUH 3NIDE 2X4PB 3L3DB 3QUKA 3TNMB 2IAMD 3EAKA 5F88A 5DMKA 5J13B 1I3GL 1A5FH 2X4UB 4LSQL 5FYJD 4DN3L 1MFNA 5E99L 3JXAA 4NKMA 4LLYB 3LS4L 3I9GL 3I6GB 3AS0A 3SKUD 2ZP0T 4XCEA 1PG7H 1CZ8L 3X14B 3CGTA 2FEEL 3QEQB 4XP9H 2C4FT 4Z76B 5JORB 1PEZA 3W81A 3OF6D 2LU3A 2HN7B 4PRNB 3P11H 3UX9B 1F6LL 2R1YB 3G08B 1HIMH 4XPGH 4RAHA 3WSQH 4D9QD 4N9GB 1XF5B 1X3DA 2AXFB 3CFDB 4L1HA 5SX5H 3QUXA 1S7WA 1JGUH 2ZUQC 1TXKA 2OTUB 3ECBB 2KH2B 4FQXC 3RWCB 5KSVA 3GGWA 4DOHE 1B6DA 3EIFA 1F6AB 2DMBA 3K8KA 2AERT 1CQYA 2IH3A 3VGBA 4JY5L 2Z31B 5EWIH 4GAJH 3RUGA 1AD9B 1T4KA 2XNAA 3AU1A 4MNGB 4P3WA 4Z7WB 3N85H