5LQBH

Complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARWRGDGYYAYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-2
publication title Improved cancer immunotherapy by a CD25-mimobody conferring selectivity to human interleukin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH02
4UNTA 1ITBB 3WNNA 2VDKH 4LLYA 4N9OB 4Z95L 5K9KA 2BVPA 4NNYA 4W4OC 2CJUL 5D7JB 5L2KB 3T0ED 4WUUB 2EDBA 1HDMB 4HJJH 3SDDD 4GMSL 2R1YB 4YXHH 3JUZA 2OZ4L 3U7YL 4X6CE 1A6PA 4QXUL 2WSKA 1MOEA 2IH3A 3F7VA 4YHNB 4O2EA 3RWIB 2A6KA 1NBYA 2DQTL 4Z7WB 2J6EH 2IBZY 1Q1JH 1A1NA 1U8OA 2ARJA 5L2KD 5DO2C 1HKLH 2AV1B 2APFA 2XY1A 4OLVH 4WUUD 1A02N 3UZEA 4PRAA 1I8MA 1I75A 1X5XA 3O6KL 1RMFL 3P4NA 2Q7YA 2D0HA 3K8LA 4F15C 1ONQA 2JE8A 1FNHA 1HXYA 5EOCH 3BPLB 5F7YC 3UROR 4YEEA 5INCB 1IVLA 1XH3A 1IBGL 3JTSA 4ODWA 5F6IC 3NIFE 4NNPL 3VFMB 3GIZH 5IFHH 5T1DH 3RFZC 5EU3B 2OL3L 2EDXA 5IK3B 1OAYL 3BSZH 4H25A 4ORZC 1MF2H 1FPTL 4G6AC 1XCTB 2F74A 2ITDA 4M48L 4S1RH 4KV5F 3BW9A 3BP5B 5D7KD 4G80A 3MUGB 4P23B 2AJUL 3TCXA 3WFHB 3MV8D 2X1QA 3OKMA 1UJ3C 4DWHA 1J0ZA 3QUML 2BX5A 1FJ1A 2WMPA 5DMKB 1N5AA 2B0SL 1RJZA 5FDYA 1QRND 3ZT6A 4JN1L 1F45A 4X6DF 3VDCA 3MFGB 1XGPB 3IFPB 1N64H 4NZRH 2NX5A 4ZS7L 3QXWA 1F4YL 4P23D 3LKNA 1EGJA 1U6AL 3B43A 2QV2A 3QCVH 2GJZA 2AJYH 3PL6C 1IFHH 2P4AB 2VZ1A 2ZZUT 1FBIH 3LQAC 3SKOA 4LKXA 2I9LA 3LV3A 4PGDB 5F1OB 4KAQH 3VFTB 4H20H 5K59F 3OL2A 2WLYA 3G6DL 4QRPB 1JRHH 5IVZB 5DVMA 1KCRH 4U05A 3RY6A 4Q6IA 1ORSA 4WFED 4CMMB 1KPUB 1SYVA 2VR4A 1KJ2A 2JJTC 5DQDH 3JWOC 5DFVC 4JFXA 2B1HL 2MPAL 4ZD3H 4FA8A 2AJVH 5I8OH 3RVUD 1CE1L 1L6XA 4G8GD 2R2CA 1IE5A 3D48R 4QRPD 5C08A 4YDKL 4EOWH 1UA6H 3ARED 4F7CB 4LCYB 2YR3A 1IT9L 1DL7H 3G08B 1BFOA 3RGHA 4Y19E 5MERB 4GW5A 3F8UB 3M8OL 2EDFA 1PZ5A 3ZDYF 3KJ6L 4YHZH 3P73A 3KWWB 4YIQB 2R69H 5DC0A 3CLEH 3L5JA 4AL8L 1QFWL 1YMMB 1P1ZA 1WIOA 2R4SL 3CK0H 2IEPA 2PETA 3GNML 5MEOB 4FS0A 5C6TL 4OAWA 5E6IC 3QDME 3MNWA 3U4EA 2W9DL 4O02L 1G7LA 1GGBH 2WM0A 1BVLB 4F57H 3BE1H 1QZ1A 5I16B 2PYFB 3LEXB 1FC1A 2ZOKA 2R8SH 4KXZH 1RULL 1C08B 4K7PL 1YMMD 5F3BA 2VL5A 3V95A 3WIFA 1AR1C 3U9UA 4RAVB 5IMOB 4FHBD 3FO2A 3S97C 2EDJA 1G7JB 3TYGL 1UACH 3ARTA 3MV11 3CC5A 1T1YB 3MLTA 3TA3A 2M1KA 3U30C 4YQXH 1DBML 3IKCB 5EUOE 4WHCA 1ZVHA 1VGKA 3MLVH 4M7KL 4OZGF 1JF1A 1A3QA 4LCWA 5I6XB 4O4YH 1FIGL 2BHUA 5ETUA 1I9JH 3MGTB 4HPOH 2WZPD 3T1FA 1NCNA 2I24N 4XB7A 4JB9L 3LCYA 1FFPA 1G6RH 5HGHA 5C6PB 1WAAA 3SE4C 5ADOH 5GGVL 4KZDH 3K2MC 3L7FB 5FV2A 4N90E 3VU2A 1P9MC 4X80H 5FHBL 5IB1A 1CDCA 4NO3B 2YS4A 4JO3H 2F5AH 5BVPL 5EU5B 4P9HH 1FAKT 4X8JB 3MRJB 5TF0A 2YUXA 2PYEB 4WJ5B 4ZUVA 2WBJB 4QF1A 4OKVB 2EIZB 2QLVB 3SDAA 4JFPB 5HBBA 2C5DC 2GK0B 4I18B 2G5BB 5IBLC 3I84A 5E00A 1DEEA 3EHBC 3VXQB 3IETA 2YPKB 2Y6SC 2FNBA 4M61A 5TPWH 1KTDA 3DUSB 3K1KC 4EDWH 4JVPA 1F4XH 2PYED 4OCYL 1I9IH 2XIDA 3GMOA 1YPZE 2WBJD 4XMLL 1QKZL 1OF2B 4JRXA 1ZGLB 4YHLH 4R26H 4XVUC 2Z8WC 3C87A 3HMXH 3LY6A 4HQQL 4PUBH 1DBAH 3QHZL 2FX9H 1W8NA 1T04A 5I8CA 4HDIB 2GTZB 3JUYA 3E2HC 4FP8H 3WKMH 5C86A 4I5BB 3BUTA 1OAZL 3FB7A 4RA3A 4WEMB 1ZT1A 5FV1L 2VQTA 1JL8A 4HLZG 1MELA 5GQBA 4P9ML 4Z7UF 1NMBH 4QTHB 5BZWA 4JDZB 1TNMA 2BDNL 1KCVH 1FZMA 1N59A 4OFVA 3TO2A 3MA9H 4F9PC 2FR4A 1RIHH 4YBLB 2MMXA 4I9WE 3TH4T 4I4WA 4TPRL 3ZDXE 3MTRA 1RZIA 3Q1SL 5E70A 3QA3B 5B8CB 2NY0C 1ZHKB 3KJ4C 3UPRB 4QLRA 5FK9B 5BRZA 1EPFA 1HYSD 3CFEB 2L0DA 1PKQB 4JPKH 4M7JH 5C2BH 4Z0XB 4Z77A 1LP9A 5E56A 3IDIA 3GDBA 2YRPA 3LHPH 5JMRA 3V4PH 2J4WH 4OCWL 2XTJE 5DFTA 5F7HA 3H7LA 3MJ9H 3CLFH 5EZIH 1UWGH 4J4PC 3WNOA 1LDPL 5KJRH 4Y4FB 5FB8A 4X4ZA 2DLGA 1EGJL 2N7BA 1NCAL 1YEHH 5EH1A 1WJ3A 2NW2B 1U95A 2OR9L 4NJAH 2P49B 5F7DA 1YEJL 4WW2F 5IMKA 1A4JB 3IS1X 3DX8A 4J6RL 1ZT4A 5KVFH 2ZCKH 2DQDL 3S3JA 5CGYC 2OMNA 3AU1A 4Y4FD 4C56A 1HNFA 1J87A 4YO0B 1KJ2L 3IYLW 4KWUA 1UWXK 3SDXF 4X0KB 1K2DB 1OQXA 1JV5A 4MCZB 1XGQB 4NCC2 1ZOXA 3T77B 5JHLL 3NH7H 2BNQE 5C0IA 3WFBL 4XCYB 4Q9QL 4LHQB 1N5YH 4JRWA 3MNZA 4ZPVA 4XRCA 2V2TA 1OM3L 5I30L 1QVOA 1VADB 1LO4L 4EN3C 4H1LB 4YDVA 2P5EA 2CUIA 4D9LH 5IOPB 4Z5RA 3U4BH 1U92A 3BKML 3B3IA 1RU9H 3GSQB 2D4FA 4ZMAT 2HLFC 3MV9E 3DX7B 3OJDB 5ELIA 4NKIL 1WQVT 4LLDA 1X5AA 2DJSA 1KPRA 1ZHNA 4I0PB 4OCSH 1G7IA 3GMPB 1BD2E 5GGRY 2SEBB 2DQCH 1QSFD 4LHJB 2DM7A 2A73B 3IRZA 3VFVB 2G2RA 3OMZA 1RUQL 15C8L 1IEAA 4GRMB 3P11H 4HKZB 3JV6A 5IW6A 1AC6A 4WDIB 4CN4A 2HG5A 3D25B 3IJYB 1IAKA 4J1UB 4QRUB 5D93B 3BT2L 3O41A 2DWEA 4I0PD 3GM8A 1MIEL 3S3SA 3MGAA 3T08A 3ULVD 4L8BA 5A3ID 5LWYL 1JYNA 2YZ8A 3T0EA 1YNTB 5TQ2L 5IB4B 4I3RH 4Z7OE 3SDDA 3AXLA 3B2VH 2HKFH 1K3ZA 1KB5A 3I6GB 1FG9C 5L2JA 2PNDA 2WBWB 3B5GA 2EICA 1C7SA 4N8VA 2JCCE 1JNHB 5J06A 1T2JA 3VI3F 5DRXB 4BQ9A 3QFJB 3P4LA 3Q6FB 4RNRB 3ULUF 2X44D 4LCCA 4L3EE 4WUUA 2HT4D 2JJTA 2WP3T 3S5LA 2CMRL 4PS4L 3D85D 4GAYA 4BH7A 3S98A 4Y4HC 3BP4B 3VD4A 1KEML 2H2SD 3SPVA 1WVZA 1REIA 5JIIA 1Z9LA 2MHAB 2D9QB 4RMUA 4I2XA 3FAXA 5CD3B 3AMLA 4HWEL 5MENE 2NYYC 2D3VA 3ROOB 3VG9C 5E2TL 4C55A 4QRSB 3S37H 3PWUB 1AO7D 5ID1B 4KI5F 5J6GA 2EE9A 2IBGA 3MRMA 3G5YA 4NSKB 5KVMC 1QR1A 3MLSH 5CJQH 4OGYL 3D3VB 3OHXA 4PRPE 4HZLB 4K8RC 5C0GB 3C5SA 3WD5H 2OX5A 1RZFL 2WQRA 4J8RA 3WSQL 3TBYB 3MV8A 4P2RE 2X05A 5JA9A 1EAPB 4PJEA 3R0NA 5IK3A 4FZEL 3DSNA 1M7DA 3VW3H 3BH8B 1QRNA 3IAGC 3D3VD 4ZTPL 1BFVL 1XCTA 2W0KA 5EU7C 4M6MH 1SBSL 4YZFF 4Y1AE 1OWWA 4DKFL 2CKBA 2F8VA 4P2QB 1OB1A 4HG4K 4HJ0D 3C2AH 5T1LB 4P23A 4YWGH 1JYXA 4Z0BH 5MEQA 1VGEL 1G7MB 2A77L 4YHPB 2V5MA 3FRUB 3FQTA 3DOSA 4KV5E 4R7DB 3WFCH 4U1LB 2QQLH 1YYLL 4JHBA 1ZTXL 4K3JL 4POUB 3U48A 2XI9A 2AK4B 4L5FL 3BWAA 2I60L 3KDMB 4M1GH 2GHWB 3VA6A 4XHQA 4F8TA 5T1LD 3SE8H 3FO9A 1A6VL 1F8TH 4X6DE 4R2GD 4ODSL 3RIAF 5HJ3B 3OG6B 5KAQG 2VKXA 3IB4A 4KKLD 1X3DA 1H0DA 4XX1E 3F7YB 5I17B 4PGDA 2APXA 4DFIA 4OV6F 3SE4A 5ISZE 4G8GA 2WP3O 3ZSTA 2PXYC 4FQHB 2AK4D 1H8SA 4KQ3L 1K4CB 3KXFA 5D7LE 1Q72H 4U33A 5GPRA 4BH8B 4TULL 4BKLB 4WI4A 3NBNA 4QRPA 1G9EA 4PRHE 1YZZA 2OI9B 4HH9B 4G6ML 1DN0B 2AKRB 3VXPB 3AREA 5KN5B 4DQOH 4YXKL 1GZQB 2QADB 1PVHA 4MXWH 5K59E 3F65A 1ZLUH 3AAZB 3H42L 4PRNB 4P49A 5TH2B 3WNMA 4RZCB 4NQEE 1NGXB 1ZAGA 1BX2B 1HCVA 2E9WA 4LLWA 4DTGH 3O2WL 4G9FE 4JFFB 1I3GL 2RFXB 3QXTA 2KZWA 3TT1H 2DICA 3CU1A 4K2UH 3CFDB 1U8KB 2VDLH 4HMDA 1BAFH 1S7QB 3S35X 2QADD 1FV1B 1IGFH 2IADA 4HPYH 2A9NL 3GGWB 2ORBL 4WTXA 3VGDA 3L3OB 1KELL 1JPTH 1S5HB 3QIUC 4JFFD 3S36L 2FGWL 2ZCHH 4ETQB 1DE4B 5FKAA 5F96L 1QUNA 4F7PB 4WCYH 1NDGB 1YMMA 2E7HA 2CDGB 3OGOE 4ALAH 2CLZA 1Z3GH 3F12A 2DD8L 3ZDYE 3UBXG 4N5UA 1J7VR 3BX7C 1CZ8H 1BVLA 1ND0A 2ZSVB 5DHVA 1PG7H 2IPTL 3LEXA 4NOFA 1LO2H 2O5ZH 1QSEE 4F7EB 3OTTA 3UXFA 4H26B 2AV7B 2EDLA 3LB6C 4D9QE 2X6MA 4LHUA 5F8QC 1T0NA 4ELMB 5D96C 5IG7A 1VFMA 4F9PA 4DZBB 1BQUA 1T1YA 4HUWB 1J8KA 2VWEC 1U8MA 1I4FA 3QJHB 1ZLWK 1WIPA 3A67L 3H9SB 5F21B 1JBJA 2Z4QB 5E8PA 3PUCA 1F6AB 5BXFB 2LTQC 5FF6A 3HMWL 4RFNC 5ADPL 4WFFD 4LBEB 1L0QA 2VIRA 5C0NC 3RNKA 3MGTA 3MLXL 3ZT7A 2PW2B 4QNPF 4K55A 3PGFH 4XPTL 1NJ9B 4MZ2A 4OZGE 5C0EB 1T3FB 4YNYA 3CPLA 1NAKL 1FDLL 1P6AB 5F1IA 3HE6B 4YE4L 2ESVE 3DMMD 1CN4A 1XGUB 2IQ9L 3BQUB 1EV2E 4OM0H 5EO1B 1KENL 4NO3A 3DVIA 3N50A 5GRZA 5GSVB 3QWRD 2APBA 1E6OH 5EU5A 2E7BA 5A2LH 3LQAL 3RU8L 4ERSL 1KB5L 4IS6B 4KTEH 5C09A 5FO8A 1Y0LB 1JGUH 1QLFB 2PR4H 5DD3H 3NIDF 2GT9B 3ESVF 4ZDHB 4ODVH 3HE6D 3MRPB 4P4KC 1WBXB 1ZE3C 2GK0A 3BQUD 2G5BA 5D5MB 3TJEH 2CDFA 2X10A 3QEQA 1HSAB 3JWOL 5GRYA 2YPKA 1DUYA 2DB8A 3B2UD 4J3UA 2ZUWA 5JMOC 1JGEB 4Y2DB 4XNXH 3QCUL 2D7MA 3PWLB 1FL3B 4ODUA 1MCOH 5DUBA 3P4MB 4LCUB 2BSTA 3LMJH 3DURA 3P9LB 4G7VL 4U6VH 3U82B 1I85C 1ZGLA 2F9BT 2G9HB 1OLZA 1OAKL 4EN3A 5C0BE 2JJUA 4LGSB 1N0XL 3KPPB 3WIHH 1UEMA 4X9IA 4HDIA 1KJMB 3M07A 3UTTE 2DWDA 2IG2L 1QACA 2D7NA 3GHEH 4Y2DD 4WW1B 3VXNB 3KPRA 1X5YA 4FQLH 4HCRH 5AG8A 5FYJU 4QXTB 5D7IF 4HF5H 1OAQH 1D5ZB 5HI3D 5SV3A 5HXMA 4X99A 4JLRB 3DI3B 3V4UL 4KTDH 4HH8A 4YR6B 1MRCH 1GXEA 1CFNB 3IJHB 3QJFB 1MJJA 3DTXB 4OSUH 4QWWC 3K8KA 4NWTH 2ERJB 4Z8FL 1BIIB 3SJVA 4Z7UE 1I3VA 1MJ8L 2CKBL 1ZHKA 1JUFA 3BN9D 1AIFA 1PKQA 3K4DA 1KCLA 2ATKB 4Z0XA 1QEWA 3ECBB 3UJTL 4PJ7F 3MRHB 2VSCA 4JFQA 4U7MA 4KPHL 4FQ2H 3SQOH 4XMKL 5IBUG 1FVEA 1A5FL 4UILH 3TIDA 1FSKB 3Q48A 3L3GA 3I85A 2E5EA 1G9NL 4YXLL 4MA7H 5HY9B 2BC4A 4MD0B 3ABZA 1KTRL 4QOKE 4Y4HA 3MBXL 3MV7B 4PJFB 4JM2F 4GJTB 4R4BA 5F88B 1NGWB 3FQRB 2XN9A 3FL7A 3RWEB 3OAZH 4ZXBB 5LQBL 3WXVH 2DOCA 5IM7B 5GS2H 3THML 2J8UB 2NXZC 1UYWH 1OP5K 2AXGB 2EIBA 3EOBA 2IALA 3FHAA 1H3WM 4D3CH 4LF3B 4MCZA 4HFUH 4TVPD 1XGQA 5EORL 4C54A 2YN3A 3T77A 1QFUL 2EE6A 4KVNL 2RCSH 3Q5TA 1QSFA 4K3GA 4NM4L 3SDXE 3HAEH 4ZXBD 4PLJD 1TVDA 4H1LA 4XNYL 4BA8A 1KN2H 3C8DA 4XVSL 1A6ZB 4ZSOE 1XR9B 4AG4H 4Z7VB 3GSQA 4K94H 4S1DC 1TENA 3GSNB 1BF2A 3RVVD 2R1WA 1PGRB 1KPVB 1SY6H 1FC2D 3X12A 2EE2A 5HHVL 1CQKA 3N06B 1DEDA 2AK1H 3ZKXC 3KYKL 3H3KA 4Z95H 4HK0A 1DBKL 1MHPL 2FX8L 3VFVA 1QBLL 2CJUH 3BH9B 1XGRA 2NY3B 1C5DA 1JPSL 4PTTA 4HKZA 3NABL 4XWOC 4B7LA 1Q9KA 1WITA 4MJIB 1T5WA 2OZ4H 4KK9D 4KU1A 3ILQD 3U7YH 4QRRA 3C6SB 1V5JA 4ZUWA 4QXUH 3MRQB 4MNQB 1ZT7A 2DQTH 1W72B 5ECJE 3D85A 1PQZB 5F1NB 2ZKHL 2DQEL 2NY3D 1CR9L 4ZPTB 2WW8A 5IJVA 3I6GA 1HE7A 5IQ9B 4LLUA 4MJID 2PXYA 4BZYA 1CD9B 3O6KH 1RMFH 4NQTA 3FQXA 3VRLF 4MNQD 2VQUA 1AO7A 4YHIB 3V8OA 3S4SB 1IBGH 4NNPH 4H5SA 2KBGA 4XI5D 2A83A 5I74B 3FOLA 1NFIB 4NDMB 2OL3H 4Y5YC 3TN0B 1OAYH 4M9OA 3BP4A 3VI3E 3KVQA 4APQB 4Z6AT 5IMMA 2EO9A 3OXRB 3QXVA 2ZUVA 3ULUE 1FPTH 4UDTA 2MKWA 2X70A 3QEHA 4M48H 1RHFA 1J0JA 2DTML 2C3WA 1MHCB 3MRCA 3WO4B 2DKUA 4DW2L 3Q2CA 4MGXA 4C83B 1TCMA 2AJUH 5E9DB 2HN7A 1NBZA 2Z35A 4NSKA 4V1DE 4AT6A 5CEZE 5K33A 3D3VA 1F3JB 4HZLA 3QUMH 3TN0D 2F53E 5L0QB 4XVJL 1IGCL 2B0SH 4APQD 1EO7A 5IHLB 3QIUA 4JN1H 2H1PL 4HAFA 4JZJB 4KI5E 5IHZA 2LU3A 3GSWB 4R7NB 5BQ7A 3G5ZB 1KLGB 4ZS7H 1JTOA 1QBML 4IOIA 2Y07L 1F4YH 3UTPD 1S7UA 5E9DD 4RFEA 1U6AH 2XWBA 1S7TA 3RGVD 3BWUC 4WI3A 4JCMA 3HTLX 1BZ7A 3VCLA 5E7BA 1KLUB 5HGDB 1N6UA 5F89B 2C3HA 4P5TB 2ATPA 1BQHB 3SGDH 4EZMA 4XNUH 5JO5B 3CSBA 3G6DH 4LDLB 3E3QC 4BQ8A 1G7MA 4YHPA 1Z9SA 2B5IB 4UQ2A 3T2QA 5DI8B 3MROB 3FRUA 4R7DA 3ET9F 1HH6B 4YZFE 1WV7T 4OF0A 1MCCA 1T7XA 1K4DB 2B1HH 2X4TB 3QQNA 2MPAH 5HHNA 1SMOA 4U1MB 4P5TD 1CE1H 5K93A 1BJ8A 4LMQE 1YEDA 2DDQL 3HKFA 5GS3A 5I1DB 3FB8A 5EUKA 1I8KA 4YDKH 4KJQD 4HHAA 1QBAA 3O9WB 4XPHL 2C4FU 4BELD 5D72L 3RDTC 1IT9H 2ITCB 3G6AA 4B50A 2YK1L 2QR0A 4OJFL 1JZ4A 5CIPB 1K4CA 4BKLA 1KCSL 3KJ6H 1A64A 1DN0A 4X4YB 1BQLL 2P45B 4AL8H 1PYWA 1J5OL 1QFWH 2R4SH 3DGGA 4HIEA 4RZCA 1JZ2A 3GNMH 3HPLA 5C6TH 1JHKL 5E8DL 4JFFA 2AQ1A 2W9DH 4O02H 5JXAL 1KBGL 4P4KA 3MLYL 1AHWB 2DBJA 4JVUA 1ED3B 3R1GH 5ENWB 3DVFA 4OFKA 1RULH 4K7PH 4L8SB 2HH0L 4LAQL 4YAQB 1HIML 3QWOB 3RGVC 3RWDB 1L9MA 4QXGL 3DX9B 4ORGA 2JK5A 3VDBA 3TYGH 2VLKA 2W0LA 3KYNA 4OV5B 1SVZA 3B9AA 2EECA 2GITB 4M6NL 1DBMH 1DE4A 4Y5VC 4F7PA 5T3ZD 1MCWW 4M7KH 3WJLC 3BPCB 1ES0A 1FIGH 1QNZL 1U8QA 1M6OA 1WAAF 4ZUTA 5HHMB 4Y19B 1K85A 1IM3A 3GKZA 2BMKB 1CT8B 5GGRA 3FT3A 1I1YB 1KF9B 2BVQA 2V5SA 4K8RL 1UM6L 4JB9H 1ZK9A 3ZKNC 4MX7A 1W0YT 2ZSVA 3ARZA 2VUYA 3HI1B 4LSSL 5GGVH 1KT2B 2F8XC 1BZ9B 1I1CA 3RVWC 2E8ZA 4LNRA 5T1MA 1EHXA 1BWWA 3NOIA 4PYHA 4U1HB 3Q6GL 1AGCB 1TZIB 3I50L 1NGZB 5HHMD 1JWUB 2PN5A 1OD7A 4NZUL 1T83C 4Z78A 4XTRD 3MUZ1 4NHCL 4DZBA 3NN8B 1BFSA 1X5LA 1IAIM 4CNIB 3BJ91 4PRBA 3IRPX 3DMMA 1QLEL 2F58L 3GSRB 2Z4QA 1X4YA 3QUYC 1F6AA 1ZHBB 3U7WL 2AAVA 1KJVA 2B39A 3O8XD 3QWRA 1NL0H 3VGFA 1CBVL 2EYTA 3ZHLA 4KKBC 1XFPA 4HEPG 1GYAA 4Q9BA 4HSQA 1VSCA 1T3FA 3L9RA 1DVFC 4UAOC 4DFHA 5FYKD 4ISVA 4OCYH 5GS1C 2FBJL 4XMLH 1QKZH 2CRYA 1T22A 2YBRB 3IDJA 1UKTA 1GZPB 1I3RA 5EO1A 3LRSA 2OTUA 4QNPE 4CADA 4U49A 5HYJE 3D87B 5T5FL 1A1MA 3NCMA 5FOBA 2Q3AA 1TFHA 1JWMA 4HQQH 4IS6A 4XBPA 3QHZH 2OP4L 3DX6B 5JOFB 5FYLD 3MXWL 4AENB 1NCWL 1CXLA 1OAZH 3LKSB 1RPQA 1WBXA 3ZLQC 1AFVL 4J3OC 3FZUD 4P9MH 3QR2A 3AY4C 5E8NB 3RWGB 4F58L 2BHYA 2BDNH 2DL2A 3NIDE 2EDDA 4AM0B 2G5RA 4W6XB 1RIVL 4ZO9A 5FDWB 4QHNB 3P9LA 4TPRH 1YY8B 5D7JC 5IJKC 3Q1SH 1KUMA 1A7RL 1M71A 5E4IA 1LP9F 3ZE0F 1B88A 3KPMB 4L9LA 2DS4A 5ITFB 1UWXH 2BSED 3KPPA 1TDQA 1OLLA 5IBTL 4WW1A 5LGKA 4XC3L 4JREB 4BFGA 2BFVL 2HT3C 3V7AG 1Y18A 4F7TA 2Z92A 1WWAX 4OCWH 5F7FA 5EU6E 4XP5H 5EOTB 3R8BB 1FVCB 1JZ7A 5DJAA 5B21A 5EFIA 1LDPH 5DS8B 4PGZA 1J8HA 4YR6A 1QA9B 1E27A 3ARGD 1EGJH 3W9EB 3LEVL 5AWNL 1NCAH 4YK4B 1I8IB 3C8HA 4D0BB 1X4ZA 1WWWX 2LFGA 3V0VB 1BIIA 5D7IE 1U8LA 2OR9H 4PPTA 1YEJH 4X9FA 2VXUL 3RKDC 1UM4L 1MCEA 4CN1A 4AIZA 2FJFB 4J6RH 4FNLL 3T04D 2DQDH 1N8ZB 1SJXA 1ORQA 1FZKB 2Q7NA 3O3BB 1CL7L 1XIWC 2PTTA 5JW3L 1KJ2H 4JN2B 4OI8A 3ECBA 5E2VL 4YLQT 3MRHA 3QDGB 4L3AA 2WANA 3GI8L 3QIBD 3JWDC 1EHLL 1DQML 3VD7A 5C6WH 5JHLH 3WFBH 1IC5L 4Q9QH 5TDNB 1FN4A 2Z91A 3RZCC 1BVZA 1U8IB 4OBRA 1OM3H 4BM7A 5I30H 4PJ7E 3TBVB 1LO4H 2DYPB 2R1XB 1ACYL 3EOTL 1JTTA 2JJWA 4KJWC 5HY9A 8FABB 1RUKL 4FZ8L 5SX5H 1EX0A 4I9WD 4M7ZC 3DETC 2XTJB 3BKMH 3W9DB 3QDGD 1A3RL 3FQNB 1B6DA 3K74B 5F88A 5DQJB 4NKIH 1KEGL 3PHOA 2YEZB 4YDLB 1NEZB 3PV6A 3L7EA 5CD5C 1SJVA 2A1WH 2AXGA 1J1PL 2DYPD 5SWZD 5EO0B 1IGIL 3EO0B 1MCSA 3FT4A 1OSPL 4X98B 1RUQH 1EFXA 4HD9A 15C8H 3LRGA 2Z93B 2HMID 5SX4I 4HKXB 4FFWD 4DZ8B 5I1IL 1IC1A 3RL1A 5IGXL 4S2SB 4M93C 3BT2H 3FN0L 1MIEH 5C0AB 4ZFZA 1NGQL 4LLAA 3HB3D 3VGHA 5LWYH 1A6ZA 1J12A 5TQ2H 5IQ7L 3F5WB 2BNQB 3GSNA 4CKVX 3CVHA 3RIFF 4ODBD 2PCPA 2XG5A 4P0DA 3BYYA 4UINL 2LQRA 4XWGL 4BSVA 1CF8L 1GSMA 4F33B 5JPNB 5C0AD 3BMVA 3BH9A 5JZ7D 3MXVL 3MA7A 2FD6L 3MV9B 2CMRH 4PS4H 1LO0L 3GBLA 1VACA 3ARBB 3QIBC 3V6ZB 2UVFA 5F9AC 1KEMH 3BESR 1ETZA 3C09B 4IOFD 2V5YA 4FTVB 1MCHA 5HYEA 2UWEA 2GSGA 5GS0C 3ARFB 4HWEH 5E2TH 2X4SB 1NFDB 1PQZA 3L5IA 2BVYA 1G6RB 3RDTA 5DWUL 1IL1B 3HC3L 2EC9U 4OGYH 2W60A 3ARBD 5IQ9A 3SGEI 4H88L 5GZOC 2E6JA 4FTVD 3WMSA 2YUVA 1RZFH 3WXWL 4MNGB 3RA7L 1JHTA 4ZODA 3ILPB 3S4SA 3WSQH 3FB6B 1B0RA 1ZA6B 3OF6A 4GW4B 1UKSA 3O45A 2EDOA 1LVEA 3LQMA 2NY5L 3NACL 4FZEH 4WIQA 2JCCB 1WCQA 5AZEL 1WZ1L 4PV8B 1M7IB 2DI7A 2IFGA 4ZTPH 1BFVH 1U8JB 3L3IA 4H0IA 1SBSH 4L3EB 4LP5A 5ESVB 4PTUB 4MVBD 4DKFH 3DROA 4WWKB 1DFBL 3DNKA 1CVSC 1MH5B 5L8KB 1VGEH 2A77H 3RGVA 5FHAH 5FUCC 1TQBC 3GSOA 4D8PB 2DJUA 2DKSA 1YYLH 1HQ4B 1MLBA 1ZTXH 4K3JH 4U6YA 3RWFB 1JF6A 5DZOA 4ENEC 4MA1B 4L5FH 5D8JH 5AUMA 3WLBB 4AEEA 2I60H 3MZTA 1LEIB 4Y5VA 4XAKD 4PJHB 4CVXB 1SYSB 2NX5E 4R4FL 4LVNB 4PRPB 3T4YA 2K3TA 1YC8A 3ARPA 2AI0L 1KTLB 1A6VH 3SKUD 4ODSH 3QULB 3MRBB 3P0YL 2ICWA 5C0DB 2C7UA 2UYLB 3SDCC 4GS7C 4WO4C 3DYMA 3RX8A 3O3DA 1MY5A 4P5TA 4IDLA 4P2RB 3KPQA 4KQ3H 3D6GA 4TULH 1EHNA 4NBZB 4G6MH 1YECL 2VH5L 4NO5A 4YXKH 4X4MA 1RI8A 1T83A 3MROA 1INDL 3H42H 1LE5B 2KKQA 1K4DA 5E8OB 2R23A 2X4TA 5A2IH 4XCCH 3O3EB 2P8LA 3VD9A 1WWBX 3G6JA 3O2WH 3OAYK 3OQ3B 1I3GH 4O2FB 3QUYA 4PJ8B 4P2RD 3PNWB 4OIAA 4QRTB 3U83A 1UB6B 5C08E 1UH3A 4EJ1C 4ZOEA 3ARSA 1P7KA 1JE6A 1FL5B 3D9AL 2A9NH 3WN5A 2ORBH 5EPMA 4Q2ZB 5ANMB 1XF3B 1CFSB 2ICCA 1ZLWH 1TCRB 4MXQD 4D94A 1KELH 2WWMC 2R2BA 4UOW0 2NMSA 3S36H 2FGWH 3P9WB 5F96H 2EEDA 1MWAA 2VZ3A 5BCAA 2BSSA 5D2NE 5DEFA 5ISZB 3AUVA 5AAMA 1NDMB 5D7LB 3NCYP 2YC1B 4JHWL 1FFQA 2DD8H 4XNQA 2GTWA 3QUZC 4FXKB 1PJ9A 4PJAA 1QHOA 1J1OL 3N1PC 2E27L 3KNBA 4XZUB 2XXMB 1ED3A 5C07A 4V2BA 4LMQI 3FFDB 4GG6A 4NQEB 3EGSA 4JDVB 2K9UA 4L8SA 4TVPL 3QWOA 4G9FB 1J0KA 1TETL 2CO6B 2PTUA 3NAAL 5ISZD 1HEZB 4UNUA 1MREL 1UZ8A 5D7LD 3PGCA 5DJ6B 4NC2B 5CCKL 4UU9B 2GITA 2P8MA 4C4KO 3A67H 4MA3A 5HHPA 4ZG1A 5JR1L 4LCWE 3VFUB 3X14B 3HMWH 5ADPH 4R9HA 4NQED 4M8VA 5LBSL 4HULB 1AI1L 3H3BC 3MLXH 2D9CA 3QFDB 4XPTH 4Z76A 1P7QA 1BLNA 3F6IA 6FABL 4IBLT 5H2BB 5F6HI 1WAAE 1NAKH 1FDLH 3O8XA 2A0LD 2H32A 4YE4H 2P44B 2QEJA 4D9RE 4U1HA 4KK8C 2GQHA 1JZ8A 1KENH 1SM3L 2EDQA 2NR6C 1FYTE 1HK6A 1E4XL 3DVGB 1YEIL 4M6AA 2ZWLT 3LSOB 1E4WL 3CVHL 1A6TB 2AQ3A 3LQAH 3RU8H 4ERSH 1KB5H 5D4QA 3UMTA 1EZVY 4OBSA 2X4QA 1OARL 4MYWB 1IAMA 1BP3B 2YD5A 5DC4B 2FSEB 1L6ZA 4KUCF 4AIOA 1JGVL 3JWOH 5IMLB 1S78D 4K7FA 4BFEA 1BEYH 2VXTL 3VG0L 3QCUH 2RHEA 2VB5A 1XF1A 2HTKD 4CVZA 4FFZL 4G7VH 2FL5B 3RZCA 3FFCB 4ZOCA 3DBXB 3OR6A 2NZ9C 1KXTB 2I07A 1MUJB 1OAKH 2JB6A 4OZGB 1HZHL 5D6DA 1IEHA 3OKNA 3FCTB 4Y16C 1N0XH 5BS0A 1D7FA 4PP1D 1I1FB 2IF7A 3VFWB 4WNQA 5D93C 1WK0A 2IG2H 3QUXC 4HUXB 1F58L 1GAFL 4RGNC 4JANA 3FFCD 2EYSB 3NCYS 3V4UH 5DVNA 1G6VK 1ZLSL 5T5NG 3MRNA 4Q58C 32C2A 1T2QL 4Z8FH 4QHNA 1HHHA 3WEXB 4LSUL 1WZMA 4EXPX 1HWGB 1P53A 1MJ8H 2CKBH 1IZKA 5J0BA 3VFOB 3ARGA 1OP5H 4HLJA 1OP3K 2HVJB 3ZYIA 1IMHC 1L9NA 5BRZE 1H15B 4E41B 5C0CE 4EUPA 3UJTH 5D7SL 1VFUA 2B4CC 4Q7DA 2CIIA 4KPHH 3PWVB 4JQIL 2H3NB 4KJYB 3OWEA 4XMKH 1A5FH 1RJYB 5DS8A 3DHMA 3CZFB 3MRLB 1H3VA 1G9NH 3GK8L 4YXLH 2MTPA 4B7IA 1YNLL 2ENSA 3CDGB 5LGJA 4D0BA 2NY1B 3QIBA 2Y7QB 4ONOA 4E41D 1I7TA 2Y06L 3MBXH 4NCDA 5DJYB 2YD9A 1IGJB 4C58B 5ICYA 5JXEC 1NANH 5FYJL 2ICES 4RDQF 1CLYL 4RIRB 5IESL 3UJIL 4NUGL 5LQBH 1D5MA 1G0YR 1LNUB 3EDKA 3DHJA 3THMH 1T03L 3FQWA 4C56E 2FHBA 3CH1B 4Z7UB 2B20A 5DGRA 2R9HC 5ICZA 3CXDL 4PJXB 4X8XA 2NY1D 5C9JA 5EORH 2C1PB 4CGTA 3GMNA 3I6KA 4KVNH 5D6CA 4CRPA 1DQJA 4F7MB 2L4OA 3R06B 4HV8A 2XACC 3CUPB 1UQSB 3BKCL 1U8IA 4N5EC 4NM4H 1Q9WB 1V3JA 3CCHB 3TBVA 2DYPA 5SWZA 1DDHB 4XNYH 4PV9B 3CFKB 3CFJA 2P5EE 1M4KA 3ULVF 2IAMB 2VAAA 4XVSH 3B5TA 3AGVA 3PWNA 3JTTA 1HKFA 3FQNA 1KIQA 1BVKB 3LQZB 5HGAB 2F15A 4MAYB 5DQJA 4G6JL 3DV4B 5HHVH 4E0RB 3HC0B 2HJFA 1MWAL 1A6AB 1E6JH 3KYKH 1AKJB 5F70A 1DBKH 1MHPH 2FX8H 4M4PA 1QBLH 4HS3A 4X98A 5F3HB 1JFQL 1JPSH 2IAMD 1U91A 1ZLVK 5HPMB 2VABB 1JPST 3NABH 2VYRE 3W11D 4GQ9L 4Y89A 2V2XB 5T3ZL 4MAYD 5DHVH 4AH2B 4NZTL 3OPZL 4HX1A 4WW2B 5JHDB 1KG0B 1MRDL 2R0LL 4JPWL 5JIPA 3BHBB 3T0EE 1AKJD 2ZKHH 2DQEH 1CR9H 4POZD 1I9RL 4G6FB 1UXWB 2ZUTA 3SDCA 4WO4A 5F1SA 4OIBA 3P0GB 4NQCB 1AR2A 4OIIL 3RJDA 4ZSOB 4FG6D 4JPIA 5JHDD 2ZJSL 4POYA 5D9SB 4P3DA 5L2KE 4IRSB 1FGNL 3KPTA 4WUUE 3ARBA 1KN4L 3WDJA 3QDJB 1Z5LA 4G6FD 3IXAB 3K0WA 4WHTB 3SCMC 1WGOA 2NTFA 2CLRB 43CAA 2EO1A 1JZ6A 1J05A 4NQCD 2DTMH 5BVJB 3EOAB 3D69B 1NFDA 3T0XA 3P30L 3PDOA 3TNMB 4DW2H 1YN6B 4IRSD 4JFHD 2VOTA 1FNFA 5CKGA 4BZ2L 3TH3T 4NC1E 3QDJD 4XVJH 3STZA 4PLKD 2H1PH 5D7KE 2CUHA 3LRHA 1TTFA 1QBMH 2V7NB 3MV8E 4GW4A 2DQIL 2Y07H 3WHE1 4F9LC 5FECB 1S7WB 1LK2B 4Q0XL 1JI1A 3QUZA 1LK3L 3JWDL 3OKOB 3V2AR 2K7QA 3UAJC 1QRNE 4NYLB 5KVEL 4PJIB 3E0GA 3M17A 4QEGA 1U8JA 5I73B 4KQ4L 3KPNA 5ESVA 2GYSA 4PG2C 2PO6B 2P1YA 3MLWL 4KHTL 3I3EA 3ZYOA 2WIMA 5IB3B 1CDUA 3O6LL 1MRFL 2E6PA 1EERB 3N1GC 5AG9A 1XF4A 4FQIL 3H9ZA 1CGXA 4AEIL 4GBXB 1U58A 1CS6A 1CFBA 4ZOAA 5A2FA 2JJVA 1N6QL 1JVKA 3WLBA 1UZ6F 3HMXA 2QSQA 1CK0L 3D0LB 5FM5M 1I8LC 4PJHA 2ADIB 1A2YA 1N26A 2PO6D 2DDQH 4WFEE 5DJ8A 4D0DB 4P2OC 1DCLA 1SMAA 5FO7B 1R5WA 5K9QG 3RVTC 4RQQB 3VFNB 2XWTA 4XPHH 5D72H 3C60B 3HCVA 1GGUA 3OKDB 4GBXD 3B5HA 5DMGD 2YK1H 3PQYA 4OJFH 3LDBC 3O11A 1CE6A 2M8XA 2VQ1B 4G8GE 4HZAA 1BIHA 1U3HB 2NCMA 4QRPE 1DQTA 1KCSH 1WFUA 4JE4B 3X13B 4IRJD 2X4PA 1BQLH 3LKPA 1OSZB 1J5OH 1LE5A 1GOGA 5E8OA 2YKLL 1TTGA 3P77B 3O3EA 1JHKH 5INDB 3C60D 3WLWD 3L95A 2FX7L 5E8DH 3EJYD 5EBMB 4TNWF 1MIML 5JXAH 1TVHB 1KBGH 1U3HD 4P48A 3MLYH 5HHXL 1JK8A 1CTNA 5B39G 5KVGL 2HJLB 4KMLB 3TIEB 3WDHA 2HH0H 1P4LB 2NY6B 1HIMH 2CK0H 4LAQH 4PJ9C 4X4XB 4ZUUA 4QXGH 1CFSA 2C1OA 3PE9A 3LPFA 5DLML 1UB5A 3PHQA 3WNLA 5BZDB 4M9PA 4OCNC 3UBXI 5HI5D 4M6NH 3GBNL 1DANU 1AD0A 4UBDC 3VXOA 2DLTA 4QGYA 1FO0B 1QNZH 1YMME 4Y16A 5A16B 4CU6A 3V5DB 2HJKA 2UV3A 1XGTA 1SJEB 5EU4A 1UKQA 4KUZL 2P24B 4I48A 3S37X 4HIIB 1BQHG 4K8RH 1UM6H 2D7PA 5DJXA 3LZFL 3QUXA 3BD4A 5HDBF 4HUUB 5K9OA 1DTUA 4LSSH 5IV2A 2H26B 4GKSA 5E5MB 4N0UA 1P2CB 4H1LH 4PJDB 3Q6GH 1RZGA 3MGOA 4GKZB 2QKIB 2EZ0C 3B4NA 5DEGA 3I50H 4NIKB 4NZUH 1HEZA 4OLXL 5DJZB 1IRAY 4NHCH 1EMTL 3V6OE 4NKMA 5DTFB 1QTYT 4PJ5A 4OGAD 4UU9A 3HAEB 1FSKC 4R0LC 1OTSD 1QLEH 2F58H 1DQQA 1D9KB 1A4KA 5GJTL 5GS2D 1J10A 3U7WH 3X14A 5DDHA 1IM9B 1LQSR 1XGYL 4AYFA 5KANG 1CBVH 3VGBA 3MRKB 3H3PL 4MJ5B 1NBQA 3QFDA 5ACZB 3IDXL 4RMTA 2VDNL 2Q86B 4JKMA 2VLJB 3G9AB 2EXYC 4I0CC 3DSFL 3RY4A 3WUZA 4LGRB 5I71C 1YDPB 1Z9OA 3S34L 4P46B 5ESQA 4PREB 2FBJH 1D9KD 3K1DA 3V7AE 4NZJA 1S7SB 3MREB 4QY8B 5DC9B 5T5FH 3TFKD 1SJHB 3LSOA 3T2OA 1S7VB 1R24A 3DRQA 4QRQB 3BZEA 5D5MF 2OP4H 5C09E 3CFBB 2PYEE 2VLJD 4X6BB 3MXWH 3QXAB 2G60L 1NCWH 1D6EB 2FEEL 3MLZL 4JHZA 5C0JB 3MCKB 3LKRB 1F97A 4GRWF 4LKCA 1AFVH 4N9GB 3WHXB 3BZFA 4L4VA 2ICWJ 5HGGS 4F58H 3VWKB 1CCZA 2FHCA 5D1ZC 3QEQE 3RP1A 4TTGA 2OJEB 3HE7C 4EDXB 1R3IL 4U31A 3IFLH 4ZFGL 1B4JL 3MRRB 1Y6KR 3RBSA 3LN5B 4G3YH 1GCFA 4ACPA 2VZTA 3ARRA 1A7RH 2OL3B 4OFDA 1T80A 5I1AB 3QXDB 3FCTA 3SBWC 3RNQA 3U6RA 1HHKB 3VXMD 4DUXA 3D2UB 2R4RL 4BFBD 2CXKA 2AJ3B 5IBTH 3KR3L 5HYJB 5I75B 4XC3H 1NCTA 2BFVH 1OQOA 2DQHH 2DMKA 5GZND 5F9JB 1JN6B 5H35A 3T2PA 3PGDB 1CFTA 3MODL 5F7LB 4ZAKB 1KB9J 1OTTC 3QUMB 2VDOL 3LEVH 3OB8A 5DXWA 1O5DT 3HZYB 4G43B 1U0QA 4M4RA 3D2UD 4QYOA 3SJVE 2FB4L 3HZMA 2VXUH 5HGBA 1UM4H 3RTQB 1MCWM 1K9TA 1UXSB 1MJUL 4FNLH 5DJ0B 1PG7X 1IKNC 1H15A 1R5IB 1PKQE 1CL7H 5JW3H 5E2VH 4GKNB 5E4EC 1HHIB 4UT9L 3FT2A 3L3JA 1TMCB 3OR7B 1DQMH 1EHLH 3PWVA 4DOHE 1MI5B 1JWSB 1OGTB 1EZVX 3UJJL 3D39B 4DKDC 1IC5H 4GSDL 3RTQD 4XXCC 2DIJA 4XNMB 4L3CA 3EOTH 1OD9A 1ACYH 3CDGA 2R15A 1RUKH 4FZ8H 4K07A 2AABL 3N85L 3WL9A 3NTCL 5EU6B 4JZJC 1IGJA 3SCMA 1H9VA 1RZJL 1A3RH 2UZXB 1ZSDA 2XFXB 5CBAB 3D18B 3T3MF 5ERWB 3NPZB 1MI5D 2XN9E 5EZOL 1KEGH 3DI2B 3D39D 1S3KL 1ZXQA 4ZTOL 3VH8G 4U0RB 2I5YL 4IMLA 5IB5B 2DM2A 5EC2B 5D7IB 1AGBB 1J1PH 1UCTA 4P5KA 1IGIH 3AB0B 1ZS8B 1WT5C 4PJXA 5JQ6L 1OSPH 4XHJC 1J88A 3BN3B 2D03L 2X4RB 4CUCA 5I1IH 4Z7VF 1WBZA 1YUHA 3R06A 4U1NB 5J57B 1QSFE 3MRDB 4WU7B 3FN0H 1DDHA 3CDFA 1NGQH 4PV9A 4F9LA 3QIWB 3EKCA 4TSCL 5IQ7H 1QD0A 3NA9L 3VE0B 3P4OB 1O0VA 5AYUL 3HRPA 5DMJB 1BVKA 4NKOB 3WS3B 2AJZA 2X2YA 1R3KB 4M8QB 1A0QL 4PJ7B 4PG2A 4UINH 2RJMA 5LKNA 1A7QL 2NLJB 4XWGH 5FA4B 3O9WC 4K23L 5D1QB 3ULVE 1A6AA 3PP4H 1CF8H 2VLLA 5LXGL 4CN6A 4RAUB 5J6HB 2I27N 3MXVH 2FD6H 3QIWD 4K9EC 4OF7A 4YHKL 2MWCA 1CFQA 4EI5C 3L5WB 1LO0H 4X7FC 1FCCA 3NFNB 3HN3A 1IAIL 2A74B 1I8LA 1QPXA 4J3WA 4X7EC 1MHHA 1T21B 3ARDD 2VE6B 5IFAL 3DUHA 4P2OA 3LOWA 4HW6A 5D1QD 4M5YL 5H94A 3BP6A 5KSAC 3KLAA 3L3KA 5J1AB 3VD5A 1NQBA 4MJ6B 5DWUH 1UXWA 1D5XA 4HC1A 3HC3H 4O2CB 4OUUB 3U0TB 4M7LL 1T5XB 3HG1A 4H88H 4OFIA 1RK0A 5I66A 4HXAL 5CHNA 2YPVL 3WXWH 4XP4L 1MCJA 3WE6B 1AO7E 1DLFL 3BAEL 1MVUB 2EXWD 4OZHB 3CVIH 5IW3A 2ENYA 2NY5H 3NACH 3ROLA 1WCBB 1WLHA 2VUOA 1F2XK 3BIAX 5AZEH 1WZ1H 3KYMA 4WHTA 4LLYB 3EYSL 5K9KB 1NEZG 2BVPB 4NNYB 3WJJC 3UCRA 1QFPA 4XVTL 3ORJA 4NN6B 3TF7C 2YPLB 3D69A 5HYIA 4ZFFB 1DFBH 1WZKA 4HWNA 1DLHA 1G0XA 1GC1C 3VGAB 2BCKB 3V9FA 1H3PL 3D3VE 4ONFL 2HFGL 2IH3B 3F7VB 1AP2A 4U3CA 1EA9C 2A6KB 3OAYH 1AD9B 1NBYB 2VDPL 3RL2A 3T8XA 2J8OA 2J1KA 3ZMRA 1A1NB 1U8OB 2ARJB 1YJDC 3GB7A 3H7BA 3O4OB 4F3FA 2WINA 4R4FH 3RWCB 2YPLD 5EA0L 1I8MB 5FECA 4LLMB 5A2JH 2AI0H 3DIFA 1CICC 1BJMA 3BPNC 4JZOA 2CRIA 3P4NB 4NYLA 3MQIA 2Q7YB 3P0YH 4GRWH 1ONQB 1HXYB 1FNEA 4D0CA 3G5VA 4ZO7A 3JTSB 2GFBA 4ODWB 4KJPD 4N8PA 3MBED 3OGCA 1AC0A 1PSKL 1YECH 2VH5H 4H25B 5SWSB 4KKAD 4MHHG 2DLHA 1INDH 3EDDA 2F74B 2ITDB 4CW1A 5IKCA 3QWQB 4M1DL 5AD0B 3FB5A 4G80B 2AK4E 4R0LA 4J3VA 3MC0A 4UTBL 5CBEB 4IRJA 2ADIA 5HYSA 4D0DA 4LL9A 3CX5K 3JV5A 4PGJA 1KC5L 5SWSD 1N5AB 1XT5A 1RJZB 2EC8A 4QO1A 5IFJA 4NRYA 1VB9A 2WNGA 4NN7C 3SE9L 3D9AH 3OKDA 3RUGA 2BHZA 2NX5B 4OF3A 4LNVA 5H37H 4PGEA 4RSVA 9CGTA 1U3HA 3VWJD 2JKXA 3LKNB 3S9DB 3X13A 1CXHA 2GJZB 3LAFA 4JGUA 1BWMA 4NFDA 5E8EA 2FECL 4LPTA 3SKOB 4LKXB 1QHPA 2I9LB 3CSYA 4JHWH 3LVEA 4HGKC 2AP2A 4GG6F 2OYPA 3EFFB 4JFFE 2NX5D 1J1OH 4Q6IB 1ORSB 2E27H 3ARYA 1TVHA 5DRZA 3VFRA 5GGTA 3OX8A 4PRDA 5KW9L 1KJ2B 1LO5A 1RZKC 4TVSa 3TIEA 3X11A 4TVPH 4X4XA 3ESUF 3I02A 4FQPA 1TETH 5SV4A 3HE7A 1MREH 2X1WL 3F7RA 5C08B 4BFIA 5CCKH 4JFED 1P5UA 1JI2A 1I7RA 4YK4C 5JR1H 1EEUA 1FO0A 1KV3A 4OLYL 3SBWA 1BFOB 4NO0B 3JSSA 1C16A 5LBSH 3GHBL 1AI1H 1PZ5B 4V2CB 1QFHA 4U1IA 4DN4L 3PP3K 3P73B 3PIQA 3KLSA 6FABH 4HUUA 5EIIA 3EYVA 1HNGA 1OGAB 2MJWA 4PBWD 1P1ZB 1BBDL 1P2CA 3HPJA 1BECA 1ZGLP 4WFFE 1FFRA 1KCKA 3FO1B 2XXCB 4OAWB 2QKIA 4XBGA 1SM3H 3MNWB 2ZCLL 2EDTA 4NO0D 1E4XH 1YEIH 3U4EB 5HDBE 1G7LB 3CVHH 5DMIH 4YDIH 2OMBA 2ZOKB 4YDJA 2Y25A 1D9KA 3V79C 5KSVA 2D31A 1OARH 1OGAD 3VRIA 4EVNA 5F3BB 5J3HC 4Q97A 4N1HB 2VL5B 3WIFB 3U9UB 4MJ4A 2XTJC 2QBWA 3T09A 3BPOB 1IKNA 1JGVH 5DEZA 3MRKA 3GMLA 1YNKL 3CC5B 3TA3B 3JV0A 5ACZA 5A2KH 5HDLA 2VLJA 1U8HB 2CRZA 4NUJA 1D5BA 1YDPA 2YMXL 3NCJL 3VG0H 1B0GB 2XZZA 5ETUB 4XX1G 4FFZH 1OW0C 4XXCA 4X6CA 4QY8A 3T1FB 3UYOD 1OP3H 5I2IB 5J56B 1FFPB 1HZHH 4UOW1 1R0AL 2XZAL 5HGHB 1DQLL 2MSPA 4R3SA 4HC1L 5CMAA 2VXVL 3TA3D 2W0FA 2P42B 2HRPL 4Q9RL 4X7SL 7FABH 5IB1B 1RZ7L 1TZGL 1F58H 3C6LB 4RFOL 1GAFH 1OT1A 4LQFL 4QHKJ 4KK6D 4CDGC 5D5ME 3IDMB 3VXMA 1RFDL 2XWJA 2NY4B 4ZUVB 1WT5A 4FMKA 2ADJA 4QF1B 1CDGA 1ZLSH 4GRWE 3SDAB 2XKNA 1T2QH 3WDIA 4D9RD 3MRRA 4LSUH 5CJXC 3SKMA 1MAML 3C6LD 5E00B 1DEEB 3IETB 5JLZA 5EC1A 3OKKB 1WISA 1BQSA 1KTDB 4A6YA 3O3AB 1ZKAA 4FQCL 1HHKA 1S9WA 1B9ZA 2NY4D 4HXBL 3I6LD 5E2JA 1IKFL 3GMOB 3C09C 3UTSB 3KYAA 4JRXB 5KSUB 4K7PX 3QNZB 5D7SH 3ARFC 1FORL 1MCBA 4KK5C 3KPLA 1W0WA 2R2HA 4JQIH 3DECA 4NQXA 5J9PA 1T1ZA 5I8CB 3VFPA 3FOMB 3EDJA 3GK8H 1NLBL 5J12B 4ZQKA 1YNLH 3SY0A 4EI5A 5F71A 3A6CL 2AXJA 1ZT1B 3UTSD 2DIBA 5T1KA 1ZA3B 5I18H 1T2XA 2W0PA 1W8OA 4JRXD 2Y06H 2QHRL 3BKYL 3V6BR 4S1SL 3BIKA 5BZWB 3BVNA 5FYJH 1L0YA 3VA2C 1CLYH 1UXSA 5IESH 4MAUL 4WU5A 2C3XA 4WI9A 4NUGH 3UJIH 1FZMB 1N59B 4ELKB 5BV7L 3TO2B 5C92A 5IF0A 5KSAA 4JAMA 4JVWA 1T03H 3GMRA 5E1HB 1NMAH 1L4IA 4I4WB 5DSCA 1HHIA 3CXDH 5CEXA 1RZIB 2N4IA 2R39A 4P57A 2ZUQC 2EDWA 1GRWA 1MI5A 1NCCL 4XCNB 3IVKA 3D39A 4FQXB 2FEDC 3BKCH 3QPQD 3OXSA 2KQNA 4OCMC 4Z77B 1LP9B 5E24E 3IDIB 1CGSL 3WNKA 5DUPL 4TVPE 1FLTX 2WAHA 1IAOA 1TPXC 4R97C 2D2OA 2WUBL 1GH7A 2J5LC 1VEPA 2XFXA 4LVNC 5ERWA 3WJJA 1ERNA 5H8DA 4G6JH 5FB8B 1UG9A 4FQXD 2K7PA 3BEWB 1MWAH 2BOCA 1U95B 3HNTL 2YN5A 1AGBA 5GRJH 5F7DB 2OK0L 3EOYG 1F6LL 1ZS8A 4E5XA 3CXHK 3T3ME 4DAGL 4DN3L 4LRIA 1JFQH 4ODTL 1IGYA 3DX8B 4JO4L 1ZT4B 3FAWA 4KRPC 4GQ9H 3AU1B 4M3JA 5T3ZH 3QDMA 3GUTB 1M7XA 1VFOA 5GGTL 2EDHA 3OPZH 3MRDA 1MRDH 4ZS6C 3IXTA 2NXYC 4JPWH 2IH1A 2BNRB 4H8WL 3QSKB 1CICA 4KKCC 4Z7VE 3V5HA 4YH6A 4PJ8C 4F15B 1I9RH 3MNZB 4ZPVB 5HVGB 4XRCB 2VDRL 1CI5A 1QVOB 3GKWL 4JFOA 3ARDA 4OD3L 5F6IB 4YDVB 2NLJA 4LSTL 5FA4A 4Z5RB 5DO2D 4PB9L 1U92B 5EUOA 3B3IB 1FO0L 2KPNA 2ZJSH 3AFLA 3QI9C 1K6QL 2AEPL 4U2ZA 5HDQL 5BMFL 2BNRD 1FGNH 1RJLA 3IDGA 2AS5M 3T65A 2BJMH 4LLDB 1U93A 1KN4H 1KPRB 1MAKA 1ZHNB 1G7IB 2VZUA 1NFDF 4MJIE 2P8PA 4LOUC 1CU4L 2BNUA 2KQMA 2A74A 3X3GL 2H32H 4MNQE 4N0YL 1DQDL 2G2RB 3KLDA 3VGGA 2X7LA 1IEAB 3AMKA 1X6NA 4JFZH 5IW6B 3P30H 1FL6A 4IDJL 1X6LA 3GEWB 1IAKB 4G6AD 5B4MC 3O41B 4BZ2H 2DWEB 1KNOA 4L8BB 3T0EB 4YBHA 1I1AC 3AXLB 4OZHA 1F00I 2D0FA 2DQIH 5L2JB 3LKQA 3U1SL 3IAQA 4GRLC 4N8VB 4Q0XH 1LK3H 3JWDH 4BJLA 5KVEH 3IJSB 4JDTL 2AGJL 1IQDA 5DJ2A 5I19L 1KXQE 1T7YA 4LCCB 4TOYL 3EDFA 3HR5A 3IF1B 3MLUL 5EN2B 2YPLA 3S5LB 4I0KA 1CGVA 1YPZA 3MLWH 4KHTH 3PL6D 3AM8C 4GAYB 4BH7B 4ZFFA 2YA0A 3UTPE 5GISL 3SGJA 5E9DE 3SPVB 1MRFH 4OD2A 2BCKA 4PGBA 4PJHF 2AXHA 4RGOL 4FQIH 4I2XB 4AEIH 4DCQA 2BXYA 1X7QA 1AD9A 4JGJA 3SKJL 4LPVA 4U1GB 1XEDA 4UIKL 1CK0H 5ITBL 1LILA 3DVNA 3MBEA 5J6GB 1OT2A 1SEBB 3MRMB 3G5YB 4H0GA 3RWCA 1HN1A 1QR1B 5DFVD 3OHXB 4LLMA 3C5SB 3QDHA 3QAZC 2DJ4A 5JW4Q 5DD6A 4WHYH 1KIPB 1JNNL 4E42B 5I9QC 3EJZC 5CILL 4J8RB 2R0ZL 2AXFA 3MV8B 1ZEAL 4OZFA 4PJEB 1N0LA 4A6YL 3W39A 1BGXL 1M7DB 5SWSA 5E6IB 1T0MB 1QRNB 4X4ME 5F7WC 4WTWA 4JKKA 1XF5B 3T0DA 3BP7B 4Y4KD 3EYQC 1QP1A 2YKLH 4EUPH 2XY2A 3CDYA 5AD0A 2CKBB 1OB1B 3VWJA 2FX7H 1EO8L 5JDSB 2Z31C 5CBEA 5MEQB 1B4RA 3O4LD 1MIMH 2OBGA 2XV6B 1A9BA 5JIHA 5HHXH 3LS5L 4LPYA 1ZVSA 2HFFA 3FQTB 5KVGH 1X9QA 5E6ID 4K9EL 3U30B 1MEXL 3BWAB 3OZ9L 5GJSL 3L3DA 3MYJB 4OFYA 2YWYA 1U36A 4HBQA 5DLMH 4TNVF 4YC2B 1OW0A 3FO9B 3GBNH 3E6HA 3JWNC 1AR1D 1H0DB 3DUUB 1S9YB 3KYOB 5C8JA 4X5WA 4L1HA 2C4FT 4G8GB 4YHOL 4KUZH 3KXFB 3EFFA 2FATL 4A2LA 4IJ3C 4MCYA 4OQTL 4JFEA 4MZ3A 3LZFH 3AREB 3V0WL 3DARA 5T3ZE 4MDJA 3PF2A 4EIZC 2O5XL 4Z18A 1Z0NA 5C07E 4GG6E 3ZTJH 1YY9C 3T2NL 4LLWB 5DGQA 4RRPG 4TSBH 1UT9A 4EQ2A 3BMWA 3EZJB 1G7PA 4OLXH 5D71L 3KXFD 1EMTH 1IILE 3PG2A 2HFTA 1CIDA 4LP4A 3WFDL 5E08L 5KTEL 5GJTH 4HBCL 2ZUYA 2IADB 4U3XA 1QYGL 1HXMA 3LN9A 4NO0A 5HHME 1GC1L 3FN3A 1BD2A 4C57C 1F42A 1XGYH 4XCFL 1RHHB 2LE9A 4Y4KC 3H3PH 3IDXH 4JY4B 2VDNH 3MJ7B 5FKAB 5GGUB 5DA0B 1BOGA 3DSFH 1K3IA 1OGAA 2I9TA 1LE9B 1A6UL 3S34H 1YJDL 3H0TA 3IDYC 1PY4A 5IBLD 2CLZB 3EHBD 3F12B 3FO1A 2Y6SD 3N1MC 4OLWL 5DD1L 1ND0B 3HR6A 3G04B 1ZHLA 2CH8A 5DHVB 4WVRA 4BZ1L 5FYKE 4XVUD 3MPCA 3DRTA 5TJWK 2G60H 3MLZH 1U8PA 4LHUB 1T0NB 1QQDA 3C5JA 5IG7B 2V2WB 5JPMB 3TJHC 4LSQL 5I8EA 3GMMA 5BO1L 1U8MB 3NGBC 3B9KC 4NGHL 4YBQC 1I4FB 1RVFL 4YGVA 5FYLE 3DO7A 1U8HA 2CK2A 3KGRA 5E8PB 2QQNL 3KJ4B 1R3IH 5FF6B 2UUDK 1B0GA 4ZFGH 3WUWG 2VIRB 1B4JH 3RNKB 2Q8AL 4HFWA 3U36A 1T20B 3MOBL 4LHUD 5I2IA 5MENA 3ZKMC 3GZKA 3MSPA 5IR1A 4YNYB 3CPLB 4MD4A 2VDQL 5F1IB 4KTYA 1H3UA 2YD2A 1RY7B 2NY0D 3KR3H 4OM1L 3O2VL 4MSWA 3C6LA 5IEHA 3OV6A 4PG9A 3MODH 1YQVL 3IDMA 5C09B 5FO8B 4HKBA 3S36X 3MUHL 3IU4L 2VDOH 3I9GL 3HAEG 4OZIB 5DK0A 4J4PD 2EYRB 2FB4H 3QH3B 3D1MC 2CDFB 1LEKB 3QEQB 1RZKL 4MS8C 4G8IA 4QHUA 4RA0C 5CSZA 1DUYB 3OKKA 5DVKA 4U1JA 1MJUH 2H9GA 3CH8A 1E28A 4Y1AA 3O3AA 5GHWH 5C09D 3TYFA 1YMHA 5J13B 4ODXA 4ODUB 3UTSA 5DUBB 3C9NA 4MDIA 2BSTB 3DURB 4U2YA 4YX2L 5KSUA 2X4NA 3QNZA 3QT2A 5CGYD 4EN3B 2HT2C 2A9ML 1KIRA 3B9EA 1BJ1J 3UJJH 4KDTC 3QEQD 4L1DA 5F7UA 5FM4A 4GSDH 4N0CC 3BISA 4NM8L 2XT1B 2DWDB 1N64L 4JQXC 3FOMA 5GRUL 5JW5A 2RR3A 4U7KA 2XOTA 2YSSA 3KPRB 4KUCD 2AABH 4ETYA 2RBLA 1ZA3A 3NTCH 3WYRA 4Q6YA 4X6DA 2Z9TA 4MLSA 1Y6NR 5BJTB 3C8KA 1LGVA 1RZJH 3HUJA 4U6HA 4EN3D 4X99B 3RAJL 4PJXF 5EZOH 4ELKA 43C9A 3U7AA 4KROC 1MJJB 4N0RA 2O93L 3F7QA 4MMZC 1S3KH 4ZTOH 3D0VA 2GAZA 2I5YH 3ARUA 5TGBB 2HLFD 3HHRB 3SJVB 3KPRD 4M62L 3QDGE 5BW7A 1I1RA 3NFSL 3RY5A 4XCNA 2D03H 1H5BC 2V6HA 1JUFB 4KC3B 1PX3A 4FQXA 2CO7B 4WRLA 5EDXA 1I1AA 1W2KT 3GSXB 1PD6A 4RMQA 2ZNWA 1A1OA 1AIFB 4NQSB 2X4OA 5I8OL 3ULUC 3QNYA 1KTKE 1QEWB 5SWZE 4JFQB 2X1XR 3R8QA 4ZNEA 4DOHB 4TSCH 1P69B 3SJVD 4U6TA 3NA9H 4M5ZL 2PUQT 5DQ9A 5AYUH 1FVEB 4NNXA 3TIDB 2CR6A 4W4OA 1A0QH 3L3GB 2BVOA 3BEWA 4WTZG 2BC4B 3W2DL 1A7QH 4K23H 4LVOC 1AY1H 3T4AB 1TJHL 4OF5A 5LXGH 4Y4HB 1YEFL 4KI5C 4LGPB 3T1WA 2COQA 4DVBA 2GY7B 1JPGA 4R4BB 4YHKH 2HTLC 2XN9B 4P59L 1LMKA 1CVRA 3VG9B 1FNGA 2H2PC 3WO3B 5FFLA 3I2CL 3GUTA 1IAIH 1WC7A 3RI5K 5I0DA 3EOBB 4IIQC 2IALB 2YUZA 4QHMA 1WBYB 5C0AE 5IFAH 3VFSA 3MLRL 4M5YH 2BNRA 4Y4HD 1QSEA 4DUWA 3V6FA 2NY2C 3V4VL 1QSFB 2XN9D 2NYYD 4F2MA 4WGWB 4HUVA 3W81A 2IGFL 4HXAH 1ZV5A 1BBJA 1V3LA 2YPVH 2JJSC 4XP4H 3AROA 1DLFH 2R1WB 3BAEH 2B1AL 1B6UA 4K8RD 3X12B 4GMTL 4KI1A 4FXGA 1JGLL 1CIUA 4HPOL 3MNVA 2VDML 3RVXC 3H2WA 3EYSH 4HK0B 3FTGA 4FTVE 1HINL 1T1WA 4P3WA 1XGRB 1UJ3A 1C5DB 4XVTH 4G9DA 3U2SA 4PTTB 1WTGT 5JORA 1NFDE 1JYVA 4N8CL 5HHQB 1Q9KB 1YEKH 1T5WB 2VN4A 4QRRB 4NKDA 4ZUWB 1EAJA 5D2LB 3TM6A 1H3PH 1ZT7B 3BDYL 2HFGH 4ONFH 1INQA 2DI9A 2ED8A 2VDPH 1IC7L 5KSBA 3D85B 3PL6A 4IRZL 4MNGE 4LVHC 4IMKC 4PJIF 4KRLB 4NP4L 5IJVB 2VLMD 2DMCA 5EA0H 5IT2H 4TN9A 1RUML 1VENA 4LLUB 5AYQA 1SVCP 2PXYB 1A8JH 4NBXB 4QRRD 2EC9T 3FQXB 5L8LB 3IJSA 2Z8RA 3T0WA 2LU4A 1TZHB 1AO7B 4K94C 4XAKE 4HS6A 3IF1A 4EDWL 3GIVA 5EN2A 1Q0YH 4S10A 3O6FC 4H5SB 4NT6A 3P40A 3RX7A 5IW1A 2A83B 3FOLB 2GJ6B 4JFDA 1VKXA 3B9DA 1MQKL 1E4JA 5IMMB 1M05B 4UDTB 5ALBL 2X70B 3QEHB 2PXYD 1MQ8A 4PP2A 1DR9A 4P46C 5K9QI 3B8SA 3QHTC 4M1DH 1JPFA 4WI8A 4XPAL 3MRCB 3K2UL 2JTDA 4UTBH 2HN7B 4PJHE 1NBZB 3RUGF 1FAIL 1SEBA 2DAVA 2NQCA 2Z35B 4MNHA 5HHOA 4AT6B 2VXQL 3QG6B 1HSBA 4QT5A 1T66C 2GJ6D 1KC5H 4Y4KA 5MHSE 3QIUB 4CJ1A 1KIPA 3SE9H 4E42A 1FE8L 5IHZB 5BQ7B 3TH2T 5CJOL 4ODHL 2H45A 4ZO6A 3O4LA 4IOIB 3VWKC 1S7UB 4WGVB 4RFEB 2WUCL 2XWBB 1KYOK 1S7TB 4KDWA 5E6IA 4ZFOA 1T0MA 1JJUA 1BZ7B 5CUSL 3VCLB 5EZJA 5IEKA 1XF5A 3BP7A 2ATPB 2ZSWB 3QIUD 4GH7B 3PP3H 3RHWF 3B83A 1CLOL 1S8DA 5JDSA 1NMCC 4R2GB 4M3KB 4UQ2B 4Y5XC 4LDOB 5D96B 2VXSL 5KW9H 4GFTB 3ES6B 4K71B 3B9KA 5TF1H 4MQXD 2YD8A 1BF8A 2XZCL 1A3LL 3MYJA 5HHNB 5I75C 4L29A 2EEAA 3CX2A 4EBQL 5ANME 2LTQB 4HMEA 1YEDB 1FZJA 4RFNB 3FB8B 5EUKB 1I8KB 3NCCB 4QOKA 2EE3A 4ZAKC 2X89D 4HHAB 2Q6WA 3LB6D 4PRIA 2FHFA 5JW4R 3DUUA 1S9YA 2JLLA 1GGIL 25C8L 3BGMA 3G6AB 3KYOA 4OLYH 5GGSA 2QR0B 1KOAA 2DRUA 1P84K 4M1CC 1HOCA 4KH2A 1P9MA 3UZVB 4MB3A 3TLRA 4HIXL 4PJDF 5IVXA 1HQRB 4DN4H 1GJIA 4FRWA 1NLDL 5C0ND 1PYWB 3TBTA 2E9BA 2IBZX 2H41A 1BBDH 1QFOA 3DGGB 4HIEB 4LPCA 4KRMB 3HPLB 4RMVA 5EBWA 3K81A 3SDXA 2ZCLH 5DR5L 4WHDA 3OB0H 1NAMA 4P4KB 5KANI 4JHAL 5CGTA 1T89C 3TZVC 4I3SL 5DYOA 4KY1L 4NRXB 2WK2A 3TBSA 3O6ML 4LAJH 1INEL 1QR4A 4ORGB 2JK5B 4PJCA 2VLKB 1Q9OA 5IVOA 1RHHA 3KYNB 1H3XA 1YNKH 1SHMA 4JY4A 1CGTA 3MJ7A 4GW1A 1PFCA 5GGUA 4MD5B 4PY7B 4P4KD 1F4WL 1LE9A 2YMXH 3NCJH 1ES0B 1U8QB 1M6OB 1TQCC 1XMWA 4ZUTB 3TPUB 1IM3B 4KDTA 4X5XA 5GGRB 3FT3B 4JQXA 2BVQB 4MQXC 2EDEA 2VLKD 5F7EL 4MX7B 2CKNA 2C3VB 2YWZA 3OKEA 3G04A 2XZAH 5FA3A 1R0AH 1DQLH 3MJ8A 4HC1H 1PDKA 2VXVH 2HRPH 4TRPL 4Q9RH 4LNRB 5T1MB 4X7SH 1GOFA 1RZ7H 1AGDA 2R2EA 3SOBH 1TZGH 4XP9L 4Z78B 4HMCA 4RFOH 2V2WA 5E94A 3A6BL 4LQFH 5JPMA 1L0XA 1F11B 1RK1A 2DM3A 2DQJL 4BSWA 1RFDH 4PRBB 3L6FA 3DMMB 5DVLA 1B3JA 3OKLA 5M94B 1KJVB 4M03A 1H5BA 4TQEL 2E9JA 4PLNC 4U1SA 3FFCE 2EYTB 5DK2A 1T20A 3MO1A 4U3HA 5L7XL 1MAMH 3MX0A 3GSVA 5CP7A 1VCAA 4HWUA 4QWWD 2R56L 3L9RB 4FQCH 1QO3A 1EEZA 4HXBH 4ISVB 1IKFH 3S7GA 4J4PA 1T22B 3IDJB 3S88L 1MFAL 4JM2C 1F4HA 1I3RB 1WEJL 3LRSB 2OTUB 2DLIA 1FORH 4CADB 3NIGF 4ONHA 1A1MB 2F53A 2G75B 5FOBB 4XPFH 1GGYA 2DI8A 2HVKB 5HD8C 1JWMB 1SBBA 4XBPB 2UZYB 1CGYA 1NLBH 3C5ZC 3A6CH 3TESA 4OZIA 3K3QA 2EYRA 1PAMA 2GK2A 3PWJB 2QHRH 3QH3A 3BKYH 2NXZB 2KZ1B 3NPSC 4S1SH 1LEKA 4IIQA 5DK3A 1R3HA 3STBA 4RMRA 1MCLA 1NFKA 3GI9H 4MAUH 4KVCL 5BV7H 3EJJX 4GRWB 4WV1C 5TDOB 4KHXL 4AMKL 4G8EA 4E41E 4YHYC 3ALXA 4PR5A 1M71B 4DJMA 2UY6A 3O2DA 1NSNL 4RCAA 3JVGC 4L9LB 2NXZD 1KCUL 3JXAA 2JJSA 1V8HA 5DJCA 2VZSA 1UJTA 4PY8I 1CGSH 4XNZC 4YFLF 5DUPH 5HI4C 2ZPKL 1Y18B 4F7TB 4UOJA 2Z92B 3P3YA 4G5ZL 5BJTA 2WUBH 4RBPK 5DJAB 3MLPA 5EFIB 1LO3H 1KGCD 2XRAL 4HGWA 1J8HB 1E27B 1BREA 4GLRH 2P5WD 4ZFOL 4GG8A 1Z6JT 4S1DD 5TGBA 4OTXL 3HNTH 1OTUC 1U8LB 2OK0H 3QQ4A 4AK1A 2BVEA 3QHFL 4PJXE 4DAGH 4AIZB 4NO2A 4ODTH 2IANA 4JO4H 5JOPD 3GSXA 1ORQB 1R6VA 1J8HD 4NQSA 5GGTH 4IMKA 3NA4A 2PTTB 2W9EL 2W38A 2ADGA 1BJ1H 4XWOD 4H8WH 2VDLL 4FFVC 1LEGB 5EUOF 3BGFB 1FN4B 2Z91B 2OQJA 4JG0L 4ZUSA 2VDRH 1NH6A 3FHQA 3GKWH 2FIRT 4OD3H 4QCIA 3TBWA 4GAJL 3B6SB 4LSTH 1R5VA 3T4AA 4PB9H 1FO0H 3UO1L 4GXUM 1A47A 1K6QH 2AEPH 5HDQH 5FUZL 35C8L 5BMFH 2FJHA 2FIKA 3NFPA 5LAXA 2RQ8A 4P2CG 3PHOB 1Z9MA 3PV6B 1ZLUK 1JRHI 3L7EB 4LEOA 4BQ6A 3X3GH 5JHDE 1CZ8L 1WBYA 4DKEL 4N0YH 1DQDH 4PLOB 1NUGA 5C0FA 5CFHA 3FT4B 3TNNA 3CFIC 5AAWA 1EFXB 4HWZA 4HG4J 1A6WL 4UI2A 1S7XA 3TO4C 2Q3ZA 4DEPC 1NAML 3RL1B 3WHE0 4OZHF 4D2NA 4BUGA 5HVHC 4ZFZB 4NQCE 3NMEA 5I1CL 3BEVA 4O00A 1A7PL 4I1NB 3CVHB 2P7TB 1EFXD 3DV6A 3VRJA 2IBBA 3OJVC 2PCPB 4JFHE 3GJEA 4OLUL 5E95B 3DYPA 3U1SH 1QRKA 2DQFA 3LIZL 3TCLA 3QDJE 4BSVB 5CSGA 4JDTH 4HUNB 5D1XC 3RPIA 2AGJH 4W4NA 5I19H 3WFEL 3MA7B 4TOYH 2Y4SA 4XAWL 2B8OT 4HKJA 5FGCE 1VACB 1AGFA 4GMSH 5HHQA 2CLVB 3IU3A 5GISH 1ADQL 1ETZB 5D2LA 4RGOH 3K80A 3NCBB 2UWEB 5D2NC 2GSGB 3FKUS 3WKNA 5CINL 3SKJH 1S9KC 2CD0A 4UIKH 4YPGA 4KXZI 5ITBH 1TXKA 2PR4L 1G84A 1N3NA 5C9KA 3RDTB 1N4XL 3HA0A 4HUKB 4ODVL 2W60B 3QQ9C 4LEXL 5DRNB 3CJJA 5DZNA 1MCIA 4MHHI 1HHGA 4PJIE 1TZHA 3VXUD 5CILH 1JHTB 2R0ZH 1YQ2A 4MQSB 1B0RB 2MKLC 4B0MM 1ROWA 2Z0BA 1TLKA 3O45B 4YPJA 3ULUL 2GJ6A 3RDTD 2RIKA 5CEYA 3VXRA 3ZYJA 4A6YH 1BGXH 1C1EL 3FQUA 4ZNCD 3TVMC 3RI5F 1M05A 3QXUA 2ICEA 1BFTA 3L3IB 3ZHKA 1T89A 5EG6C 5CEZL 4LFHG 3DROB 3BKJL 3P2TA 1EO8H 1FHGA 3OF6D 3RGVB 2W1NA 4WENB 3QG6A 3GSOB 3LS5H 3DJ9A 1MLBB 4K9EH 4U6YB 1MEXH 3QNXB 5AUMB 5IP4A 3L3HA 5GJSH 4Y5VB 3RUGE 2Z8VC 1QBBA 4LIQL 1DN2A 1PBYA 1HHJB 1S9VB 1FLRL 1MSPA 3T4YB 3H9HA 1UCBL 5B3JF 1ULVA 2O61B 5EOQL 2ICWB 3B8YA 3TWCL 1UEYA 2C7UB 4N8VG 1UGNA 3GRWA 3MR9B 2N1KA 4HEME 1NCBL 3O3DB 2ZSWA 1A9EA 5E2WL 3KPQB 5FO9A 5KS9A 1HH9A 3O0RL 1W0VA 1YA5A 2FATH 3O2DL 1R3LA 2MCPL 2X89A 4OQTH 3S5LG 3UTZA 4NO5B 3V0WH 1IGML 4IM8A 3P9MA 4EI6A 5FKPA 2O5XH 3ES6A 2R23B 1EFQA 3MRIB 1A7NL 3T2NH 5I76A 3E6FA 2P8LB 2EDKA 3ZKND 3G6JB 2JIXB 3QUYB 3WIIL 4QHKI 1H8OA 5FYJD 5D71H 4GAFB 1YEGL 3RVWD 2K1MA 5ACMA 3WFDH 5E08H 2DBLL 5KG9A 3EO9L 5KTEH 3HLAB 2W65A 4HBCH 1H8NA 1P7KB 2ED9A 3CD4A 1QYGH 2CDEA 3WN5B 1F13A 5EPMB 4UAOB 4LK4A 1GC1H 3WXVL 2FJGA 3ZO0A 4FABL 2QQQA 4XCFH 3M8OH 2V5TA 5GS1B 2R2BB 4XGZA 2JIXD 3QUYD 1HQRA 4JM2A 3RWJB 1MWAB 3T3PF 1A6UH 2BSSB 5DEFB 5DHYB 1YJDH 2F54D 1DANT 4KKBD 5E5UB 4XNQB 4K3EL 2ED7A 2GTWB 4PJDE 5SWQA 2FH8A 1H3TA 3C5ZA 1DVFD 4PJAB 3PABA 4OLWH 5DD1H 5F97E 1EVUA 3KNBB 3GMQB 2APWA 1PX4A 4XT1C 5IHUL 1G7QA 2BVUA 4BZ1H 4AG4L 1XR8A 3QYCA 5C07B 1J0YA 3LD8B 5ILTL 4GG6B 3EGSB 4NRXA 4RX4A 1SY6L 4ZO8A 3M45A 1CD1A 3EYFA 5C3LD 5MI0C 4XH2B 3LPGA 1UZ8B 2AJSL 4WV1A 3PGCB 2ZUXA 3RIAK 1IGTA 4LSQH 3OAZK 3WNPA 5BO1H 4NGHH 3KPSB 1I85A 2P8MB 1RVFH 1NC2D 4MA3B 2VLJE 4MD5A 4PY7A 5HHPB 4WWID 1WUNT 2QQNH 2LABA 3GSUA 5C07D 3JVGA 3TPUA 3QCTL 4CMHC 1IAII 2Q8AH 5TQ0L 1VHPA 4R4NC 2I26N 3KLHC 3MOBH 5F9WC 4Z76B 1P7QB 1BLNB 2C3VA 4WI2A 3HZKA 4O51A 4OD1L 1Q38A 3KPSD 2VDQH 1NGPL 2H32B 3O8XB 3K7UA 5D7JD 5L9DL 5BOPA 5TDPA 5FHBH 3MUY1 5KVDL 3QQ3B 4OM1H 3O2VH 3QO0A 4GOSA 4TTDC 2EDNA 5BVPH 4G42A 2J12B 2VITA 4BUHA 1BM3L 4XPGL 1CDBA 1WFOA 3MRFA 1F11A 1YQVH 3GJFK 4PJBB 3VXME 4N68A 1P7QD 4B53A 3IU4H 2HT3D 2X4QB 3I9GH 4LQ1A 3ULSA 3VGEA 5DJDA 2HWZL 4CBPA 5I1LA 5CWSA 5F1KC 2CXGA 3PWPA 1XIWB 3SN6N 1RZKH 2UZIL 4K7FB 5MP6L 3PHSA 3RKDD 4CVZB 4DVRL 5ID0A 3RZCB 4YX2H 5GRXG 1FNAA 3J7HA 3OR6B 2FYYA 1RZ8A 3QG7L 2I07B 3BD3A 2JB6B 1B2WL 2G75A 2A9MH 3OKNB 2HVKA 4NJ9L 5CGMA 4M7ZB 1XIWD 4AJ0A 2MQ3A 4FN0A 5BS0B 1C12A 2R0WL 4NM8H 5L6YL 1GOHA 4WNQB 3HUJF 4ONGL 5GRUH 3NIGE 2KDGA 5EIVA 5JW4M 3T0EC 3RZCD 4JANB 3FMGL 3PWJA 3SDDC 4LHUG 2B7DT 4OZFH 3TV3L 2APVA 4KJWD 3RAJH 4X6FB 3UBXA 4PJGA 3DETD 4KMQA 2XNAA 2VERN 5TDOA 4XNUL 3JV4A 3MRNB 5BS0D 4HIHA 2CIKA 32C2B 3TO4A 4EXKA 1HHHB 4L8DB 4M93B 2MQCA 4JKWA 4M62H 3SDYL 4LCCC 1BZQK 3NFSH 1TVBA 3ZHDA 1MI5E 3IFOA 3ARGB 5CD5D 1A14L 5MEPB 2P5WA 2XQBL 4UTAL 3D39E 2X09A 4OI7A 2Q8BL 3MFFA 2GCYA 3BXNA 3G5XA 4EUPB 3OSKA 2GKIA 5HYQA 2CIIB 4U1GC 2EDYA 4M5ZH 3BI9X 5D1XA 1DP0A 1T6VN 4NKQB 4NC1C 2BZDA 1Q94A 5LGJB 3W2DH 2QHLA 3VJ6A 1TJHH 4TSAL 3QIBB 1YEFH 3GRWL 4AEHL 1I7TB 5ICYB 3BPLC 3ZKSD 2LVEA 2FECI 3REWB 2ADFL 5FM5O 5D2NA 2VKWA 4P59H 3BGAA 1D5MB 1RJCA 2WIIA 2GSIB 4NPYB 3I2CH 3FQWB 1O7VA 3IFNL 4CVUA 5DURB 2GY5A 5ICZB 2ILLA 3MLRH 5C9JB 2FLBT 4UUJA 4X6EB 3GMNB 3I6KB 3R1GL 5D6CB 1LEGA 1DQJB 4P23C 1IEBA 3V4VH 4HV8B 1CGWA 5GS0D 1EJ6A 4LSVL 3INUL 1OY3B 3NZ8B 4L4JA 5SWZB 1JYWA 5C7XL 3B6SA 3CFJB 2IGFH 2V9QA 4Y5YA 2VAAB 4DUVA 2Y72A 5DURD 5BOZG 3TVMA 3PWNB 3JTTB 3LN4A 1KIQB 2B1AH 3UPAA 2D4DA 1JF5A 1G1YA 4GMTH 1JGLH 3MCLL 5GZOD 5J89A 4YC2C 5E6YA 1G9NC 2HJFB 4W70A 2VRAA 2VDMH 4MMXC 1V7NL 2FH6A 1D5IL 5M95B 1HINH 4HS3B 1TQBB 4G8FA 3RVUC 2F8OA 3IGAA 1U91B 1P4BL 1AGEA 2FZ3A 5E0QA 4N8CH 4R6UA 5JQHC 5KSBF 1FYTA 3AREC 4HX1B 3BDYH 2D7QA 1GPOL 1IC7H 2AERT 1P4IL 1EHAA 3I75A 1N7ML 4IRZH 4QTIL 4OZHE 2P7TA 3NCFB 4NP4H 3SDCB 4GS7B 4WO4B 1RUMH 4ENED 1NL0L 4YHML 5GIRA 4JPIB 5JNYB 4I3GA 4CJ0A 4P3DB 3ZTNL 2MOVA 1P7HL 2YPLE 1NCDL 4F80A 2CLVA 1Z5LB 4NQVB 1MQKH 3QEGL 1J0IA 4WO4D 3SDCD 2BVTA 2H8PB 2NTFB 4WY7L 3MJGX 43CAB 5ALBH 1TIUA 2DKMA 1J05B 3VXUA 1EEYB 4P2YA 4XPAH 2Y9RT 3BJLA 3OG4B 4LLQA 4RDQG 3PDOB 3K2UH 1FAIH 2VXQH 3PJSA 4WUKL 4PJEF 3STZB 2DLEA 5DRNA 4R96A 2FO4A 1K8IA 2O5YL 4H1LG 1FE8H 2CGRL 4R8WL 1L7TL 1VPOL 4LU5L 5CJOH 4ODHH 3V6OC 1FNLA 1BMGA 3G9VA 2WUCH 3VRLE 1UENA 3QUZB 5SWSE 3KG5A 1U3YA 3TT3L 3IDNA 2FDBP 5CUSH 1C7TA 3M17B 5I6XC 2MCG1 2QL1A 5F9DC 4NQDA 2WWMD 3KPNB 5C0RL 2IFFL 5ESAA 5F6HJ 1A7OL 1CLOH 5C0CA 4JFYA 3HRZA 1XF4B 3SKNB 2VXSH 2EKSA 4NRZA 4XP5L 4XP1L 1U58B 4X5LA 3QUZD 3QNXA 2XZCH 1A3LH 1JNJA 1X5ZA 4UDUA 3WJLA 4OGZA 1PG7W 4EBQH 1A2YB 2GUOB 1HHJA 1MVFA 1S9VA 5DJ8B 2Y5TA 2J2ZA 1R5WB 4JZNA 4LLVB 1AE6L 1XCQA 2O61A 2XWTB 2WBJC 5IUSA 5IVXF 3T0BA 2A6DA 3GO1L 1R3JA 1GGIH 25C8H 3HCVB 3MR9A 3PQYB 3O11B 2QQKL 1CE6B 2WQ8A 3J8F7 4I18C 3VXSA 2B2XL 5B3JE 2X9XA 4NHUA 3UZQA 5E6ZA 4HIXH 2DQGL 2J3SA 2HFEB 1S9XB 2X5PA 4JFEE 2X4PB 3LKPB 3O81A 1NLDH 1CDYA 3UPCA 5GSRA 5J13C 5MHSD 1KLFA 3MRIA 5JA8B 4F8QA 3FO0L 2IQAA 3L95B 2CRMA 3QDAA 3PQYD 2JIXA 5DR5H 4JHAH 1JK8B 4PJCF 4RWYL 4JM4L 4KK8D 1LD9B 4I3SH 2F54A 2NR6D 4KY1H 3HLAA 3O6MH 4GLRI 4ZUUB 1DVFA 1INEH 1CGUA 2C1OB 1U3ZA 1X5JA 1EIBA 1UB5B 3PHQB 3EO1A 5GS1A 4BQCA 2A1WL 2ZOLA 3QO1B 1HYSC 3RWJA 3A0OA 2UVEA 1AD0B 4NBYB 1I7UA 3VXOB 1F4WH 1OGAE 3DXAB 5DHYA 4TUKL 4Y16B 1GIGL 2HJKB 4YBLC 1XGTB 5EU4B