5LQBH

Complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARWRGDGYYAYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved cancer immunotherapy by a CD25-mimobody conferring selectivity to human interleukin-2.
pubmed doi rcsb
molecule keywords Interleukin-2
molecule tags Cytokine
source organism Homo sapiens
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH02
4WHTA 4LVHB 4XCYB 1WZLA 1CK0H 4MCYB 1W72H 3IRPX 4C58B 1A7PL 2GK0B 2GYSA 4HIXL 5EA0L 3WFHB 1Q0XL 1SEQL 1UWGL 4MJ6B 4JRXD 4PRPD 3KYMA 4GFTB 1L0QA 4JREC 1BVKA 1BGXL 4NSKA 4JZJC 4LP4A 4XTRC 3B5TA 1WBXB 4I5BA 1WFTA 4HLZG 4PB9L 1E28B 2XG4A 1P4BH 4HPOL 2QSQA 2WBJC 3LKOA 2C5DC 5IESH 3MRQA 3HS0B 3QNXB 4HIHA 1CTOA 5KSAC 4AT6A 4K23L 2VE6B 3K74B 2R8SH 1CXKA 3R1GH 1T1WB 2VDRH 4FP8H 5ICXA 1A7BA 5JXAH 3BIBX 4MB3A 4Y5XC 1CF8L 2VLRE 1OTSD 1YPZB 5L7XL 4YHYC 4HZAA 1F6FB 1QFPA 2DMBA 5A2JH 1OAYL 3RIAK 2ED9A 1IAKB 4BZ2L 4H0HB 4PJEE 1CICD 1H5BC 3MRFB 3HE7C 9CGTA 2NY0C 2EH8L 4UBDD 1D5IH 5IMLB 1BFOB 4JQVC 3H0TB 4X6BA 5IQ9A 1JMXA 4JN1L 4Y1AA 5EU6A 5HI3D 1U8KA 4AIZA 4LLVA 2NW2A 4PJDF 5F7WC 4F3FB 3TT3H 4IJ3C 4YIQA 1I1FA 4RGMB 4B41A 1QRKA 5I8CB 4U7KA 1C5CL 3FB7B 3L3HA 3P3YA 2D7MA 4ODUA 2HN7B 1BZ9B 2A6JB 1A6WL 4NZTL 4L8SB 1TIUA 5MEOB 5MEND 5LBSL 4F58L 3NIDF 1YEKL 2F5AL 5GIRA 5BV7B 3IU4L 1T7XA 4DUVA 1HKFA 4ZFFB 4OAWB 5FV2A 4FOMA 4IM8A 5GS0C 5CSGA 1YC8A 2YK1H 5HGGS 4J3VA 4Q6IB 5TE7L 5BRZA 3GMRA 4U6TA 4PP1D 1OARH 3GI8L 3TVMB 5BS0B 1D6EB 2PR4L 2QQLL 2FNBA 4ZUWB 1TVBB 3TWCL 1Z6JT 1MUJA 2R1YB 4NFDA 4NO5A 1QPXA 3SY0B 1O5DT 2B1HL 4L29A 3K3QA 1Y6NR 3Q3GB 5JPMB 1ZHLA 3VFPA 4XWGH 3NGBC 4PJBB 3UTSE 1J8HD 5IJKA 1K4DB 4LSPH 2NPLX 4N0UB 4U6YB 4RGOH 4YXKL 4EDWL 3CSBA 3V2AR 1MAMH 3RVTC 2W9DL 4FQ2H 1YPZF 4P99A 3CIQA 2I26N 3KPQA 3M8OH 2BNQB 4D0BB 4M9OA 5HI4D 3LB6D 4PJIE 3QCTL 2LE9A 4MQ7A 1MRDL 1IC4H 4P4KD 4KK6D 3NTCL 3MA9L 3IJYA 5F9OH 1XCTA 1K6QH 3PJSA 4BH7B 5D7IB 5KZCB 3KPLA 3DIFB 2VAAB 2R2BB 3CFEB 5D1ZA 2G75B 2OYPA 1EMTH 3L7FA 5IJVB 1X7QB 4JM2C 1Q9LB 2Y9RT 3G6DH 2CSPA 3CGTA 1GHFH 1NGQL 2DBJA 2NY4D 3S4SB 1DFBL 2AEPL 3DBXB 3AAZA 3QFJB 1VFBA 1Q94B 4N68A 3GSXA 1DQDL 2NY1C 2GITA 1RUAL 1ES0A 1QHPA 1YEDB 3T08A 1H9VA 4YK4B 2HKFH 3VMPA 1JZ5A 4OQ1A 1DEEA 4WCYH 4POZC 1YY8B 2H9GB 3R4DA 4G3YH 3WS3B 2XICA 2ADFL 4Y19D 1NCAH 3INUH 4IRJA 4K3JL 3ZTNL 2VAJA 5DC4B 3RY5A 5HPMA 3ISWA 4XNZB 3F7VA 4TSAH 3QUMH 1RPQA 3FT2B 1M05A 2QBWA 5DHYB 1IMHC 4F7EB 3KWWB 2P5EA 2D7NA 1QQDA 1LEKB 1T83A 3MMEA 4APQA 2VISB 2F53A 2EIZB 1GZQA 1EHLL 2ZSWB 4RCAA 4N8CH 1K8IA 3P4MB 3V6FB 3BZDA 4W6YB 2YPKA 3DTXA 3FO2A 4GAYB 5HYJB 2EKSA 4P9MH 4AYFA 2BMKA 4DKEL 1CLOL 1DP0A 2FR4A 4MHHG 5F6HJ 1XCQA 4L4VA 5DK2A 1HEZB 3O6MH 1U2CA 1KN2H 4D9LH 4IDJL 4BH8B 4PJFE 5D7IF 1K85A 1R6VA 4QWWC 2W60A 2HFEA 1CBVH 2BSSA 1ORSA 3OG4B 3MJ9H 4S1DC 4PJXA 3WIIH 1A6ZB 5CCKL 2XQYG 4F9LC 4G6JH 3DSFL 4OCSL 2HT4C 1JHKH 1IEAA 3ZE1E 3L5JA 3IFOA 1W72A 1D3CA 1XAUA 5KTEL 1DLHA 3KPSD 3P9LB 3UYRL 3X3GH 5HHMB 5DJZA 4RA3A 2AV7B 3QWRA 4RFEA 3MV8D 1QHOA 1IC5L 4RX4D 2Q7YA 3C6SB 5MHSE 3SDXB 4AM0A 4QT5B 4NO0D 3H3PH 3FO0L 4J1UA 5F1NB 5ILTL 2A6IA 2L0DA 1KB5L 4GW4A 5KW9L 2YA0A 4ZUVB 1OD9A 4UT9L 1P7KA 2Y72A 3ARRA 1MAKA 3RTQC 3CMGA 2WW8A 2NY6B 1CD9B 3O3DB 1NH6A 2FSEA 1L7TH 1EVTC 1AXIB 1U3HC 4X4YA 1QFOA 4JZNA 2ZUSA 2B8OT 2DLFH 3O8XD 3QIWC 4I13B 4KQ4H 2J5LB 5C0CA 4TULL 2FEEI 1RSFA 1M7IA 4M6NL 3E0GA 3X14B 1I1YA 3IDYC 3QRGH 2ZUXA 3HNVH 1X5YA 3MO1A 4J12A 3F6IA 4C56B 5FYKH 3KYNB 4O9HH 4K3GA 2ORBH 1QSFA 3HLAA 3BKYL 5T1LA 3GMQB 5J6GB 2YS4A 4IMKA 3SOBH 3VJ6A 43CAA 3FAXA 2B5IC 1OF2B 3EKCA 1C7TA 1FPTH 5JMOC 2XN9B 3G5YA 3KPRB 1NEUA 1J0JA 5JIHA 4MD4B 3LY6A 1U8HB 4U3HA 5GGUA 3VWKC 2YBRA 3E8UH 3WFDL 3P30L 3RWDB 1TQCC 4IOIB 4XXCA 1DVFC 2IADA 2Q87A 1KIQA 5ISZD 3T0AA 4M61A 1H0DB 2F5BH 2BSED 4PYHA 4EXPX 4R8WH 4K3HA 5MEPA 3WIFB 5DMYA 5AAWA 4JAMA 5DUBB 1AP2B 1JYVA 3L3OA 4HMEA 4GKZA 3GRWL 3D5OF 4RWHA 4ZO7A 5DMKA 3SDXF 1AD9A 5E5RB 3RVXC 4YFLI 4JFEB 1LVEA 1JYNA 5D1XB 3MNVB 1SJEA 4YDIH 4Q0XL 4KRPC 1MCDA 5EN2B 1KJMA 4JGJA 3QPQC 3S6CA 4X6FB 2HFTA 1F2QA 4DQOL 5I6XC 1WBZA 3DUSA 4ZNEE 1DBBL 5DI8A 4DJMA 3QHZL 4LPWA 5IW3A 5JORA 5FHAH 1HYRC 3FRPA 5T3XL 5T3XD 5H94B 4KK9C 1T4KA 1FNEA 4NWUH 5TGBA 3X12A 5DRNB 3RDTD 4GMTL 3PL6D 3OAUL 2VLKA 3PV6A 1QR4A 1Q9WA 4GUPB 1SM3H 4R4BB 4YHIB 3WFEH 3RQ3A 1B0WA 4DZBA 2FBJH 3BPNC 1H3WM 2X10A 2E7HA 2K1MA 5D7JD 3SDYL 1OB1A 3IJSA 4DAGL 1Z3GH 4QEGA 3V4VL 4YHZL 1KPRA 4ZTOH 1VFOA 2BVOB 3IAQA 3C2AH 4KK8D 2KDGA 4JKWA 5IQ7H 1XGRA 2CIKB 3IFLL 3JTSB 1MEXH 2VXVL 4Y2DC 4X4ME 2VDPL 2EE3A 1E4WL 3QBTB 3TBVA 5F7EL 2ADJA 3BKCH 5C0EB 1FGNL 4TSBL 3M45A 1J9CT 4MA3B 1Y6MR 4OBRA 4Y5YA 5IB1B 2JB5H 5INCB 4ZS6C 5IM7B 3U30C 1CGSH 4XP1L 2FJGA 1SBBA 2AK4A 5D7KD 4RZCA 4WHTB 4EI6B 2E8ZA 1QFWL 3HB3D 4OLWL 5EUOF 1Y6KR 3VG0H 4HAFA 3AU1A 3I6KA 1QRNA 2Q6WB 2XWBA 2AK1L 2XACC 1M6OA 3QUMA 3LS5L 4BYHA 3KYMB 3BQUC 5HDQL 1BVKB 1ZLSH 2V9TA 2VXSH 3UJJH 3C5ZC 4NSKB 1BWWA 4UV4L 4PRHD 4YHOH 4Z0BL 3NVQA 4I5BB 5I1LA 1P4IH 5CJXC 4M62H 4M5ZH 1MWAL 1RZKL 2V5RA 3LKOB 5CZXD 2QADC 1WEJH 1IGJA 3MRQB 4MAYD 2OJEB 4HIHB 4YBQC 4I77H 4G80A 2WQRA 1YDPA 2QQNH 3RZCD 3QAZB 1F4YL 4LCUB 5ICXB 2DQTH 1AO7A 5EG6C 1RU9L 3BE1H 2ZPKL 1GC1H 5EBLA 2XPGA 1CDGA 5HYIA 1WFOA 3OZ9L 4JG0H 5EFIA 5EULV 1WV7T 3SE3C 1CCZA 2EYRA 4ZOBA 5FUZH 4X6BB 2DMKA 1NCTA 4Y1AB 4AIZB 1U8KB 5C8JA 3MXVL 1T7WA 4LLVB 2NW2B 3NCBB 5F1KC 1N64L 3E6FA 4YIQB 1C16A 3CZJA 2WQ8A 3QXDA 1MJ8H 4M43L 4R26L 1BFSA 1A6UL 3L3HB 1SBSL 4ODUB 1JYWA 2DTMH 3JWDH 2EDFA 4KVCH 5D72H 2P7TB 5GIRB 4HFUH 1FZKA 2BVQB 8CGTA 5JUEL 4KDTA 3SCMA 3MXWH 3EOTH 1NAMH 1CZ8H 1JPGA 1YEFL 4UTBH 4TVPH 5BW7C 3UDWC 5D71H 5F21B 1RURL 2IF7A 4GLRH 4DKDC 5BVPL 5IFAH 5BRZB 1FJ1B 3GMRB 4YWGH 2ZJSH 5FCUL 1W2KT 5GRVK 3WXVL 1CVRA 3UPRA 5SWSE 5F93C 1MUJB 1FYTD 4P59H 1KC5L 1CDHA 4L29B 4YDKL 3BXNA 5E9DA 2WBJA 2FX7L 1A3LH 1ZHLB 1OP5K 3VFPB 3LIZH 2DJ4A 4U7SA 1NGPH 3FT4A 3QNYA 4J3WA 4JO2L 3H9SA 5HYSA 5F7MC 1I1AD 4RBPH 1EHNA 5JHLL 3NACH 3MV7B 5HVHB 5I15H 3S5LA 3BW9A 1S7TA 1W8NA 4X5WA 1KELH 3ARDC 4NBZB 4FNLH 3ZE0E 4MQ7B 2CPCA 3A6BH 5ITBL 3S35H 5FA4A 4I0PB 2W0KA 3GSNL 4QY8B 3V8OA 1PX4A 3CXDH 2I27N 3IJYB 1XCTB 1E6JL 3PJSB 3TC9A 1UFUA 3Q1SH 1NLBL 4URTB 1I9RL 5D1QD 3BH9A 4RQQA 4MSWA 1T0MB 5IBTL 3KPLB 5SV3A 2KQNA 2LQRA 3MREA 1NGYA 5D1ZB 3L7FB 4HEPG 4KRLB 4Q58C 4R7NA 3TN0D 1DQTA 1D5ZA 3P73A 1A2YB 4PJ8C 3OAZK 3AAZB 1CU4L 1H8OA 1VFBB 3T1WA 3DMMA 4X8JA 4HH8A 1SVCP 3GSXB 2GITB 1ES0B 3UTTE 4XI5C 2G9HA 4OB5L 1UJ3A 5GSVB 3SJVE 1I1RA 3A0OA 3RWHA 4G8GB 3FRUA 1DEEB 2CO7B 4PJ7B 1E4XL 4MA7H 4C83A 3W0WA 1P7QD 1AQKH 1T5XA 1IGCL 4IRJB 3IKKA 4P2YA 3BPLC 4PJEA 3F7VB 4G9FE 2LVEA 1M05B 3O3AA 5DHXB 5KVDH 4PGCA 3CFJA 3ES6A 2P5EB 1QQDB 2AJVL 5D8JH 5HHQA 4JO1L 1RZJC 3MMEB 3PXHA 4TUJA 4FABH 4H8WH 4I8DA 4M4RA 2XTJD 2F53B 2NX5E 1T89A 4ZO6A 1GZQB 1TVHA 4XP9H 1KYOJ 1ETZA 1UCTA 3LEXA 4O2EA 1GYAA 5C08E 2AABH 2YPKB 3DTXB 2OTPA 3FO2B 3MBEC 1NC2D 2EKSB 2VC2H 5C0ND 2BMKB 2FR4B 2ZCKH 1MCWM 3R8BB 1OSZA 1XCQB 4L4VB 3SQBA 5DK2B 1XGYL 1OT2A 4PIRF 3JTTA 4JY5H 3S37X 2COQA 3AY4A 5LGHL 1B3JA 3RKPA 3LDBB 1HNGA 5EWIL 2W60B 2HFEB 2NY7L 1C1EH 1CFQA 2BSSB 5EU4A 4P2RE 2ATKA 3HE6C 4PJXB 3RVWC 3I84A 1EEUA 1JF5A 2V7NA 1IGTA 1A22B 1FNGA 4P3WA 2UYLA 1IEAB 3JXAA 2ZNXA 3IFOB 1MHPH 3HCVA 1W72B 3O3BA 1DLHB 4D8PA 1PG7X 2NYYD 3GJEA 2D9CA 4LSVL 4F15C 3DETC 4K8RH 1LEIA 1HWHB 5DJZB 5DQ9A 4RFEB 2ZUQC 2Q8BH 4UDUA 5EZIL 4AM0B 1ZANH 3EOYG 4J1UB 1BZ7A 1GOGA 4H1LH 4HCRH 4DN4L 1A6AB 2A6IB 2M8XA 3W9EA 2RJMA 2WV3A 1F3DJ 15C8H 3K0WA 3EYUH 4PJIA 3KLHC 1P7KB 2WSKA 3QIBC 4L9DA 2GJ6E 3K8MA 5F6IC 1ZA3A 1IBGH 4JFFD 2FSEB 2ZCHL 2IQ9L 3WV0A 4X4YB 3F7RA 4JZNB 1A7OH 2IMNA 4FQLL 4WFED 1CLYL 3TNMA 4XXDA 5JXED 4JRWA 4ZAKA 4ENED 4PGBA 1M7IB 1I1YB 4WFHE 5ACZB 4B0MM 2I60L 3MO1B 2AGJL 2YUXA 1B9ZA 1R3HA 3QG7L 4FFYH 1U91A 5I1EL 2OR7A 4N9GA 4XT1C 1QSFB 5HDBF 1A7NH 3HLAB 3T2PA 3B2VL 5LGKA 5T1LB 1JGEA 3TJEH 3HRPA 3MRMA 3VJ6B 4ODTL 2B4CC 4HSQA 4JFZH 5I2IA 1FO0L 4PJXF 1FQ9C 4NBYB 4F7MA 2JF1A 3KS0H 5GGUB 1CL7I 2ZCLH 2YBRB 1J5OH 4G6ML 3CLFL 5HHOE 1KIQB 5FO9A 2P42B 1JTPA 5FYJD 3V95A 4GSDH 2BVEA 4HDIA 1HHKA 1RIUH 4MNQE 2VKWA 1PZ5A 5MEPB 3ULSA 4ONOA 4JAMB 4CGTA 3BUTA 4YHKL 5GISH 4GKZB 2F9BT 4RDQF 3GM0A 5ADOL 5KSBE 3SGJA 5DMKB 3O2VH 5DZOA 1AD9B 1U8MA 4ONGL 2VDNH 2DYPB 2FATL 5TE6L 1SJEB 1MJUH 1BHGA 4Y16A 5LQBH 1I9JL 3MNZA 1KJMB 3GMPA 2AQ1A 3KYAA 5HYEA 5LXGL 1C12A 1WBZB 3DUSB 5KVMC 1DCLA 2E27H 3NFSL 4TRPL 1VEPA 3P77A 4PJFA 3PQYE 3QIWA 1C08A 1T4KB 3PWPD 1FNEB 5M95B 6FABH 3K4ZA 2JB6A 5TGBB 3X12B 2GJJA 2HT3D 2XOTA 4W70A 2X4PA 4K3EH 4Z7OF 3UX9B 3VCLA 4KUCD 5DZLA 2R0LL 2VLKB 1OT1A 1Q9WB 4K7FA 1S7QA 4Q9RH 5IGXL 2R9HD 2FZ3B 4NCC1 5IHUH 3IJSB 1P53A 3PGDA 4WUUD 2PYED 4MA1B 2FX9L 4UUJA 5DDHB 1DLFL 4OFKA 1F42A 4HUWA 1ONQB 4L9LC 1V7NL 1XGRB 1HDMA 3RGVA 1GGCH 1KJ3H 4YNYA 3FB6A 4X98A 3SN6N 3ZKMD 5GRUL 3WDHA 3TBVB 1F02I 2OQJA 2ADJB 4XPAL 4OCXH 4Y5YB 1BQUA 2XNAA 4U1KB 5JOPD 1LO0H 4G7YH 3RA7L 5ABDE 2FRGP 2Y06H 4JKLA 5IVZA 5KS9E 4RWYH 1MQ8A 5LGJA 4Z7QE 1JZ7A 2FJGB 2AK4B 1JTTA 4RZCB 1IT9L 2WUBL 4O51B 1RMFL 4XCEA 4PY7A 4LPVA 3AU1B 2Q8AH 3PWJA 1QP1A 3I6KB 2W65A 3NZHH 5J0BA 4JRYE 2ADGA 1T0NA 2XWBB 1M6OB 3QUMB 3FZUD 2OR9L 1OHQA 2X4RA 3IF1A 2VXQL 4OGAD 3MGTA 3LN4B 3OMZA 2IFFL 4OZIA 5BCAA 4LHJB 4S0TD 1CDJA 3NCJL 3S97C 1KV3A 1NBQA 2BXZA 3OKDA 1IM9D 1IGJB 1MNUL 1WGOA 5E8OA 1MJ7L 1OWWA 7CGTA 1YDPB 1WSST 1XH3A 1WQVT 2WBKA 1NQBA 2ZNWA 4WWID 5C2BL 4P5MA 5DZNA 2Q3AA 1RZJH 3JV4B 4HWBH 4P57A 5GSRA 1LE9B 1AO7B 1EDQA 4LDOB 5EBLB 3U6RB 3UTPD 2XKSA 2XPGB 1HIMH 3SBWC 3EJYC 2A1WL 2DLIA 1CXLA 1TPXC 2CUMA 5LWYL 4NN6C 2OK0L 4RFNC 4M7LL 4M6MH 1MFDH 1D5BA 3WJLA 1ZHNB 2EYRB 3QIUA 3QDHA 2DAVA 5JLZA 4U31A 3KG5A 4GRLA 3TH3T 3E6FB 5L9DH 1C16B 3QXDB 5E6IC 2VR4A 1JZ2A 4MXWL 3VW3L 1OVZA 4DW2H 4PFEA 4R97C 4ZO8A 3ZT5A 4YXHL 1JHLL 3BPCA 1FZKB 3TZVA 5T3ZL 5EOTA 4EUPH 3SCMB 4BFGA 2A9MH 4H1LA 2BHZA 4M3JA 5JQ6L 5KSUA 1JPGB 5HHXH 2BVUA 2C3XA 2PKDA 4LPTA 4BQCA 1MIEL 2HWZH 1OOAA 1RIVL 2EDBA 1RK0A 2NY2D 3O6KL 4JREB 5CP7B 4CL7A 2YUVA 1KCVH 4JZJB 3UPRB 3L95A 3SE9L 1QG3A 5F88B 1JP5A 4NZJA 2IQAA 1Q0YL 2MMXA 1T1ZA 3T77B 5FV1L 1NANI 1J1XH 3QDME 1WT5C 3BXNB 4KY1L 5E9DB 1FFNA 2WBJB 4NRXA 4P5TA 1EFXA 2EH7L 2XY2A 5EU6D 3ROLA 1U8NA 5KSAB 3RNQA 5AWNL 1MCHA 3FT4B 3QNYB 1Y0LA 3H9SB 4PLOB 1E4KC 5HYSB 5EIVA 1KJ2H 3EDJA 4Z76A 3TV3H 5L6YH 4OF3A 5BJTA 1JNNH 4OM1L 5F89A 3TO4A 4M5YH 4WEBH 2GT9A 1QSEA 1U0QA 1TNMA 2WWKO 4UMGA 1GPOH 3S5LB 3ZKSD 3BW9B 1S7TB 4N8VG 1D9KC 1H5BB 3LRSA 2VZ1A 5FA4B 2DBLL 4PTUA 1S5IH 1HSAA 4Q9CA 5DTFA 3OF6D 3ZHDA 3O2WH 5TDNA 4JN2A 3V5KA 3X17A 4XVSH 2VUYA 3BH9B 4RQQB 1QBLH 4MSWB 5HD8D 2O5YL 1NGYB 2PW1A 3B2UD 5DJ2A 5MERA 2B4CH 1D5ZB 4MXQC 3BP5B 4XRCA 2Z35A 3P73B 4Z7UE 4D9RD 3GHBL 5IW1B 3DMMB 4X8JB 1VB9A 4XAKE 1EBAA 25C8L 4LRNL 3CVHL 4ODXA 2VTFA 4PRBA 5JMRA 3HNTL 4ZOCA 4AL8H 3MRDA 4AJ0A 3HFMH 2G9HB 1EV2E 1UJ3B 4WO4D 1LK2A 3ARGC 1YN6A 3QQ9D 3RWHB 1KEGH 3QWOA 1TQBB 4QNPE 5GHWL 3FRUB 5I8EA 1I7TA 3JWOC 4CVWA 4C83B 4WI3A 3W0WB 1T5XB 3AS1A 4OUOA 1AR2A 3U4BH 5J57B 2HAZA 1AI1L 1J0KA 3T2QA 2DQDH 5GS1C 5ANME 3DNKA 2L7UA 3T09A 3GMNA 1YY9D 1I9EA 4PJEB 5I1KH 3O3AB 1A9EA 4LIQL 5HVFB 2JE8A 4O4YH 1FH5H 3CFJB 4PGCB 1X5GA 4NDMA 5HHQB 5E4EB 4TUJB 4MGXA 4D9QD 3BN9C 1G9MC 1IKFH 3UAJD 5FDYA 2H2SD 1ETZB 1MFBL 3LEXB 4O2EB 3AC0A 4EOWL 1PQZA 2X89A 1WFNA 4WDIA 1TJIL 3DI2B 1WISA 1OSZB 5KVGH 4JPKL 3C60C 4U6HA 5I30H 1T2QL 2MCPL 2WP3O 3EJZC 5DC9B 3C09B 1I4FA 2YEZA 3TA3D 4Z6AT 1N4XH 1ODAA 2BHUA 3CU7A 4JRXE 4KKAD 4NKIH 4PRPE 4W4OC 1MCPL 2HH0L 2DQIH 1CFQB 2GW5A 1SVZA 5EU4B 4WV1C 3S88L 2ATKB 4IRJD 4HGMA 4HBCH 4LLAA 5SWSA 3DX8A 2O5XH 2V7NB 1IGTB 1UKTA 1FNGB 2UYLB 1AD0A 2X4SA 5GJSH 4HWEH 2F58L 3O3BB 4JM4H 2Z8SA 4KTYA 3IVKA 1UQSA 4D8PB 4IRSD 4APQD 1S7UA 5MP6H 3GGWA 3GJEB 5HVGB 3HPJB 2XRAL 3HMWH 2XI9A 3PWNA 1LEIB 1WLHA 3DUHA 3F62A 4C59B 5C0RH 2NXZC 1LP9E 2BY3A 4UDUB 1TJHH 1ZTXH 3D2UD 5C71A 1INQA 1BZ7B 4J2XA 3CSYA 2X44D 1KTLA 4BUGA 1NCBL 3UPCA 4PJIB 2AKRA 1DDHA 5FM8A 4XVTL 1QKZL 4PJEF 1DE4B 1KN4L 1P84K 1X5AA 1Q1JL 5CILL 3O6LL 4HWBA 2Q1EA 2Z8VC 2MKWA 3QR2A 1FVCA 1UXSA 2VDML 4R90L 3ZDXE 3IDIA 3TNMB 3MLPA 4XPHL 4ZAKB 4PGBB 2AEQL 3BISA 4NQDD 4IRZL 4UT7H 5MENE 4MQXC 3NH7L 1JRHH 4WHYH 4XP5L 2E7BA 3J8F7 1R3HB 3MRGA 1U91B 1IGIH 4N9GB 2FD6H 3N1GC 3Q6GH 4OGYH 1JGEB 5JDSB 5HYFA 3SJVA 3N1FC 3C08H 3D85D 1FDLL 1F13A 3L1OH 3SE8H 5I2IB 4NQVA 5J3HD 4H20L 4XVUD 4F7MB 1CDIA 2DQJH 3LPWA 1MQKH 1JI2A 3DUUA 1MELA 3BZFA 3EAKA 3MROA 4JLRA 4EUPA 5CUSH 1WZ1L 3IXTA 4LLDA 12E8L 1NAMB 2GFBA 3QUXC 1NBVL 1J8HE 1RUKL 4G9FA 4KROC 5FO9B 4HDIB 1HHKB 2Q7NA 3PXJA 4LLYA 1PZ5B 3ULSB 5HI3C 1NLDL 1PYWA 2EC9T 4M48L 3DYPA 5C0CD 4LHQB 4BK4A 4HXBH 4LBEA 2NX5A 1FC1A 2D3VA 4LCCA 4ESKA 5E08H 4OTXH 4PLJD 3VWJD 3BWAA 1CR9L 3MLRH 2APBA 2EEBA 2VZ3A 1U8MB 4E0RA 5C08A 2UY7A 5SX4H 4Y16B 4V1DD 4PJIF 1ZK9A 2NZ9D 4Z78A 4HPYH 4ONFH 2Q76A 3H7BA 2QHRH 4GAJH 1C12B 1KJ2A 5A1AA 3U0PA 2DLTA 5BXFA 1S7SA 2PTVA 3MUGA 3NAAL 5HY9A 1B90A 3P77B 4UB0L 3EJJX 4PJFB 5JA8B 3QIWB 1C08B 1G0XA 1NCDH 1IQWH 4XX1E 1TZIB 1QVOA 4PP1C 3BP4A 1MCOH 3TPUA 4P2RA 4LPXA 4RAVA 1ROWA 2JB6B 1IZJA 2X4PB 3HI1A 4M1GH 3VCLB 3BGMA 3IDYB 5JIKA 2AI0L 3D9AH 4K7FB 1S7QB 4EN3A 2C4FT 1T03H 1VKXA 5DSCB 2H1PL 4WI8A 1G0DA 1QPPA 3PGDB 1KFAH 4XNUH 4UUJB 1ZT4A 5HI5D 3JZ7A 2V9RA 4HUWB 5D5ME 4I0KA 4O58L 2W92A 5IROA 1HDMB 2ICWI 3RGVB 3FB8B 4XMLL 3FB6B 4X98B 4PLNC 4Y19E 3FQWA 5GGVH 4OIIH 4XAWL 4QHMB 1TETL 4JO3L 4MJ2A 4NUGH 5K9QI 2XNAB 1TTFA 2NW3A 5GRWA 4P4KC 3WO4C 3PABA 2WINA 2IPTH 5FDWA 5IVZB 4KK6C 2VN4A 2OLDA 4U6VH 3KPNA 4U1NA 2QSCL 5LGJB 4YX2L 4UNUA 1UGNA 2D7QA 3OGOE 2AEIT 5CEYA 1QFWI 4XCEB 4X0KB 4PY7B 1QBAA 2IPUG 3PWJB 2W65B 4DGYH 4FQIL 2W0FA 3U7YL 1RK1A 2ADGB 1T0NB 4Y4KD 5TPWL 5GRJH 4HS8H 4KRPB 4LSUH 1I8IA 4X99B 2X4RB 2WWMD 2EDRA 5C0BA 2X41A 3MGTB 3JWOH 1JVKA 2VDOL 3MA7A 4X7DC 3LQAL 5J7CC 1K5NA 3S37L 4LLWA 1CL7H 3PDGA 4KDVA 1U3YA 3NN8B 2ARWA 2PNDA 3KPPA 3OKDB 5H37G 4PJFF 5E8OB 3WYRA 2FLBT 3SDAA 3GNMH 1XH3B 4P5KA 5GS3A 4ZPTA 4M6AA 3WHXA 5E8DL 3FQTA 5I66A 4P5MB 2Z4QA 4OCWH 1V7ML 4ZD3H 5GSRB 4P57B 3RNKA 3RUGE 4DEPC 3G08A 2XTLA 1U8JA 3N9GH 3OAYH 2GY5A 1G9MH 1OLZA 3QG6B 1PG7L 3ARED 1JZ3A 3KPSE 5HHOA 3MFFA 3B3IA 1JF6A 4I0CC 4XPGL 1IC7L 1QYGL 4MS8D 2A9NL 3V5HA 4QKXB 1PJ9A 1V3JA 1ZEAH 1D5BB 3QCUH 4OGXL 3QIUB 2BX5A 3H3BC 3MV8E 4Y2DB 1QRND 4KK5D 5GGSA 4LAJH 5JLZB 1HINL 2R0WL 5KSBA 3UC0H 4GRLB 5IV2A 1FVEB 1KEMH 3H42H 4G8IA 1JZ8A 5BO1L 1M7DA 2GAZA 3VMOA 3GBNH 1PW3A 2W59A 3WLWC 2ZWLT 4J8RB 2DQHL 3BPCB 4OZFG 5IB5A 4OD3H 4WENB 1KIPA 3F6LA 5EOTB 3GZKA 5A16A 2D0GA 5C7XH 4PV8A 2OL3L 3RWFA 4QOKD 3PQYA 1B2WL 2H8PA 4H1LB 4HV8A 4DN3H 5KSUB 3IT8D 3VFNA 2NQCA 1B6UA 5BZWA 4CN1A 3ARFA 1MPAH 1JZ6A 1WIUA 3MRCB 3L3IA 4F80A 1FL3A 5DVNA 3U1SH 3L95B 2R69H 4I4WA 2ARJQ 5J13B 2IQAB 4OZIF 2PXYC 1T1ZB 4HF5H 3KHQA 4XP4L 4KZDH 1FFNB 4P5TB 1MREH 1EFXB 1FAIH 2QADB 2Y07H 3ROLB 1U8NB 5TFSL 1UG9A 3LS4L 4L8CA 4R4FL 3SGDI 1Y0LB 4OLYH 5E24E 5LCVL 1G7HA 2D7PA 5DURD 4Z76B 4U1SA 5EU7E 2NY3C 5BJTB 5C3TA 2UZIL 3TO4B 2E6JA 3QEUB 1QSEB 3GDBA 1A0QH 3HZKA 5DUPL 5EA0H 5C70A 5KJRH 4LQ1A 5ISZE 1MVUA 4TPRH 5KS9A 3WEXA 3FFCA 3LRSB 1U41A 2CRMA 3LQZA 4PTUB 4AK1A 1HSAB 4P3CL 5DTFB 5CZVL 3HZMA 4S1QL 1KXQE 3W81A 4G43A 1LEGB 5E5MA 5TDNB 4JN2B 3V5KB 1UXWA 1YYLH 4HPOH 1HQRA 3U0WL 3O4OC 4JRYA 4K23H 5I8OH 1RAMA 3CU1A 2PW1B 2D03L 5DJ2B 5MERB 4LMQI 5I18H 3RJQB 3ZLQC 3N1QC 5CEXA 1Q8MA 5E9DD 2X4OA 5DC0A 1NMBH 1A6PA 1FNSL 4ODBD 4XBPA 1K3ZA 4EEEA 4NPYB 5HDOA 3SKJH 4YHNA 5BMFL 3LPGA 1OAYH 4ODXB 3LH2H 3KPOA 1BEYL 5L0QC 3MRDB 4NC2B 5T3XE 4BZ2H 5DD1L 3GO1L 5EO0A 1LK2B 1YN6B 5JIIA 1RVFL 5FKAA 3QWOB 3QI9D 2BHYA 2N56A 3TNNA 1I7TB 4JN1H 1E4XI 3KGRA 5EU7C 2AJ3A 2EXWC 2R2EA 4GMSL 4LU5H 3QHFL 4ODHL 1IEBA 2H41A 2IG2L 3QEGH 5H35A 5CJBA 3GMNB 4NWTL 4I3SL 3KXFD 4NZTH 1A9EB 3ARUA 3KPMA 4NDMB 3HMXA 2F5AH 4B7IA 4NKOA 3QUZA 4PUBL 3IU4H 3TBWA 4WW2C 2YKLH 2H3NA 5JA9A 4K55A 2L7JA 3T1FA 1TZGL 2J88L 4K07A 5K93A 1IAIH 3RIFF 5F7FA 1YC7A 4YH6A 1PQZB 3O0RL 3ARDB 1KPVA 3CFCL 4WDIB 2QQLH 2ATPA 2NCMA 5D7KE 3TWCH 2ERJC 3B9KC 4U6HB 2NLJA 4KTEL 1NANH 3V0VA 1UEMA 2YEZB 4S1SL 1T21A 4M93C 5C0JA 2Z31A 1L6ZA 3IFNL 4J6RL 3W0WD 4CVZA 4AEHL 4PRHE 5D70L 4ZS7L 4X9GA 5SWSB 3PV7A 3DX8B 1G84A 4PJ8B 4JO4H 5D7JC 1RIHL 1XT5A 1SY6L 1AD0B 3LMJL 4POUB 2X4SB 4LSTL 4HEME 3QDMA 3IVKB 4KK8C 1UQSB 3EDDA 4ZSOE 1S7UB 2OP4H 3KR3H 1LK3L 1XF4A 4ZODA 3NTCH 3PWNB 4UAOC 4Z95L 3P4LA 2FX8L 2DF3A 2XFXA 3WBDA 3P0YL 3QEQD 3V6OA 3ZO0A 2MCG1 4FZEL 3FL7A 1E6OL 3T0ED 2VWEE 1TZHA 1I3RA 3CSYB 1KTLB 3FQUA 2J7LA 1NCCL 4P2OD 2A74A 1YNLH 7FABL 1F3DH 3MZGB 4WGVB 1DDHB 2K7QA 4IDLA 1NGQH 4WY7L 4HQQL 5BV7L 5IP4A 3WL9A 2C1OA 2DM7A 3CK0L 1FZJA 2JJTC 1RUAH 1XEDA 4U6XA 1FVCB 1I9IH 1L7IL 1UXSB 2HKHL 3IDIB 1NGZA 3TIEA 1OQOA 4ZOAA 4LSRH 1ADQL 4OJFL 3K2MC 2ADFH 1LDPL 4W6WB 4TOYL 1ZGLP 3V7AE 3MRGB 3SDCA 5CZXC 1S7RA 3QPXL 4OLXL 1DQJB 1RJYA 1U8PA 2OI9C 3EYOA 4FQQA 5DD0L 3SJVB 1YPZE 5IVXE 3RZCC 3UP1A 3O6FD 4CN4A 5DXWA 5GZND 5GGTL 4WV1A 4DOHE 4NQVB 3ULVL 3WS6A 5JOEA 3ULVD 4HS6B 4MD5A 5HGDA 1FYTE 3CMOL 1U8OA 3DUUB 5ETUA 4I18C 3MROB 4JLRB 4PJ9A 4AEIL 4EUPB 5ANMA 4LLDB 3AROA 4LVHC 2VDLL 5CEZD 1YMHA 4G9DA 4G9FB 4DKEH 5L8JB 4LLYB 3MRBA 4F15B 4I2XE 3RIFK 4ZAKD 4LBEB 4KHXL 3HUJE 1TJGL 2NX5B 3UBXA 1F3RB 4LCCB 2RAMA 1BBDL 3W39A 3BWAB 1XR8B 3ARVA 1GIGH 2B0SL 4ODWB 1N0XL 1AKJA 5C08B 4I48A 1F6LL 2NR6D 3TLRA 3ZE0F 3PHSA 1F97A 3QIBB 4Z78B 5F6IB 3H7BB 1QSZA 5JHDD 1KJ2B 1NSNL 1RUQH 3U0PB 4EQ2A 5BXFB 4YPJA 2N1KA 5HY9B 4K2UL 2FECL 5KTEH 1F2XK 4OT1L 1QBBA 4FA8A 4PRPA 1QVOB 4YFLF 3WHE1 3TPUB 2W38A 4P2RB 4RAVB 2HFFA 5FA3B 3HI1B 5L2JB 1ULVA 4BSJA 2JJSA 5CJ5A 3L3KA 1IC5H 1T5WA 1H3UA 3ARTA 4OCRH 4EN3B 4ELKA 1VKXB 4N0UE 5KN5A 1PY9A 1VADA 1LD9A 1KB9K 3HI6L 1FORH 4H88L 1ZT4B 4RGMC 5DWUL 2JLLA 1TMCB 1I1AC 3KJ6L 4UINL 3CDYA 2XKUA 1LP9A 5DRXA 1E4JA 2JCCA 3HI5L 3X13A 1B0RA 4Y16D 4C4KO 2H32H 4LQFL 4TULH 3ECBA 1H8NA 4OSUH 5I8KH 1CICA 4M6NH 2NW3B 4YAQB 2WINB 5FDWB 2GJ6B 3KPNB 4U1NB 5DK0A 2R29H 1BIHA 4Q6IC 4PGEA 5CEYB 2XTJE 2A2QT 4M1DH 3QFJE 2W0FB 4XH2A 3TN0C 2ARJA 2VH5H 3FHAA 1RK1B 2IH1A 5MENA 3CUPB 1UC6A 1OD7A 5F8QC 5C0BB 1OAXL 5I71B 3MA7B 1GZPA 4HT1L 2OCFD 1QR1A 1K5NB 4QLRA 3OR7A 2IAMD 4GKOA 4X7FC 5EU5A 4LLWB 3CZFA 1HHJA 3P30H 5E56A 3QFDB 3T04D 3KPPB 4GT7A 2CXGA 4GOSA 3STBA 1QNZH 3SDAB 4P5KB 4ZPTB 3OB0K 3WHXB 1QLFA 4MXVF 5I66B 3K4DA 2Z4QB 3RNKB 2ZUWA 3G08B 1U8JB 1ACYH 4HK0B 1OAUL 1MHEA 2C9AA 3EO9L 1I75A 4TNWF 5HHOB 1YNKL 1J8HA 3B3IB 4OCYH 2P5WD 4NJ9L 1K8DA 4KZEH 3V5HB 4MNQB 4HBQA 1CDBA 4KKLD 4QGYA 1DTUA 5GGSB 1DBJL 3WNPA 3MRPB 2I9LA 5KSBB 3SQOL 1CD0A 5IV2B 4UNTA 2FEDC 5T3XH 4G8IB 1J0YA 2VXUL 1M7DB 2GAZB 4P4KA 3BGFB 1UENA 5FYLL 4JFFE 5J89A 5FYLD 5EOCJ 5KOVC 2P8PB 4YK4C 5IB5B 3VXNA 1NGXA 1KIPB 3D0VA 4WFEE 5A16B 3EO1A 5GRVL 3SDYH 4DAGH 4ZXBD 4PV8B 3RWFB 5J4MA 3PQYB 4HV8B 3VFNB 1S9WB 2CMRL 4YR6A 5BZWB 5A3IC 1AY1L 1IAOA 3MCLH 5C9JA 3ARFB 5AYUL 4XGZA 3IFLH 5JW4R 2CIIA 1J1OH 3CVIL 5IOPA 3L3IB 2VXVH 4XBGA 4XNZC 1KIRB 4XNXL 1FL3B 1K9TA 2ENSA 2NY5H 5GQBA 4AQ1B 1RULL 2E7LC 4HWUA 4I4WB 5CHNA 1MCEA 3H9HA 1FGNH 4OLZL 4TSBH 4GKNA 3KNBA 3BPOC 3QIUD 2HT2C 1VENA 2IGFL 5D5MA 1CQKA 3CDCA 1IVLA 4L8CB 5CJOL 3CLEH 4Y19A 4LCIL 4U1SB 1RZFL 5SWQA 4OI7A 3U9PH 5CINH 3HZKB 4GKSA 3FQNA 1V5JA 4XCCL 5FYJE 2DRUA 3ULUF 1D7FA 5HDQH 3TZVD 1WWCA 5KS9B 3WEXB 5HJ3A 1QLEL 3LQZB 1ZVSA 4F2MA 4UV4H 3HZMB 4KI5D 4G43B 3GBLA 5E5MB 4X9FA 5KANG 1U6AL 1F3JA 1UXWB 3VGAB 4GG8A 5JXEC 1HQRB 5KSBF 5IB3A 3NA9L 5C86A 3BN3B 4JRYB 4OD1L 1XIWA 1IILE 4JCMA 1F4YH 2IAND 5CEXB 5CWSA 2X4OB 4P5TD 4XBPB 1RU9H 1T7YA 1UJTA 3O11A 2ZPKH 2VERN 3BH8B 4YHNB 1G7QB 3HAEH 4JHWL 2FO4A 3KPOB 5F7LB 5T5NG 4AIOA 3DURA 1N7MH 3PWPE 5J56B 1RZ8A 2NXYB 2Y1VA 3AM8C 4XCFH 2DQUL 4XNYH 5JNYA 2Z0BA 2I07A 1IJ9A 1DUZA 4JJ5A 1QSED 4TNWK 3VFMA 4EIZC 2NZIA 4YDVB 5CBEA 1WZKA 2AJ3B 1N5YL 2NY6C 1Z0MA 4Z7VE 3AMLA 2R2EB 4UV7L 3NCCB 3UROR 4M43H 4JY6A 1CQYA 1IEBB 4WUUE 2PYEE 3FONA 4OFYA 1DSFL 3KPSA 1A6UH 4HGKC 2ZUTA 5EUOE 1NGWB 4OIBA 2DJUA 2D2OA 2DB8A 3MODL 3KPMB 3DV6A 3IFPA 1JGLL 1MH5B 4MVBC 4NKOB 3FMGL 3QUZB 2DI7A 3HNSL 4QRPD 3GMMA 3TBWB 4NO0A 1HK6A 1IQDA 1YECH 2H3NB 2QSTA 2WLZA 1YEFH 3T1FB 5JOPE 3FOMA 4JKKA 5IKCA 2X4TB 1JGDB 5F71A 5BVPH 3PP4L 5I75B 4NUJA 1L6XA 1D9KB 5KS9F 3WXVH 2OJZH 2KBGA 3I85A 2ATPB 4N90D 4CKVX 4Z7QF 5E1HB 2NLJB 3O8XA 1TENA 1T21B 2FX7H 5C0JB 2Z31B 2HT3C 4GG6A 4CVZB 3IKCA 5DR5H 2B1AH 5TF0A 2YMXL 1BFVH 2HMIC 4S1RL 5IUSA 3VH8G 1A7RH 4QF1A 3TJHD 1LHZA 4RAUA 4P9HC 3QDMB 4WTZA 4AMKH 3QYCA 5BOPA 1JNLH 1CG9A 1KCKA 4RRPA 5ITBH 1F8TH 1OAKH 1BJ8A 1YEEL 1F45A 5D1XC 3ZKMC 5IW6A 1B4JL 1S78D 1LO2L 3GB7A 2XFXB 1NLBH 1UACL 3GSRA 4G7VH 1I9RH 3UTPE 3S9DB 4ODSL 3DVNA 4BSVB 1YYML 3BUYA 1TZHB 4OQTH 1I3RB 3FQUB 5J12C 2EXYD 5EC1A 5ISZA 2A74B 1SYSB 1CGTA 4MX7A 3L5XL 4F9PC 3SDDD 4YHLL 3SE4A 4YQXL 1H3PL 1VFAA 4QTHB 2VITA 3WL9B 1CU4H 1SEBA 4X6CA 3GRWA 1FZJB 3WJJC 3MBXL 2QV2A 4CADA 2OMBA 2PO6A 4U6XB 3UZEA 4OB5H 3VRIA 4P2QD 5E1AB 3BD4A 4JQIH 1NGZB 2Y5EA 4RNRA 1Q9KA 1TLKA 5EU3A 5DJ6A 4LARL 3BIKB 4N0YH 3G9AB 4DUWA 1MCWW 3C60B 5ACMA 1BM3H 1IGCH 1A9BB 2D0FA 2DWDA 4PG2A 1IL1A 1S7RB 3BI9X 1X9QA 3SGEI 1U8PB 1OCWL 3EYOB 2VLJA 4FQQB 4PJCA 3E6HA 3O4LA 5FGCE 5EC2A 3BAEL 3RDTA 3PL6A 1U92B 1MY7A 4JHZA 3OQ3B 4WV1B 3IETA 4JO1H 4QHUA 4K9EH 3A6OA 5HGDB 3G6AA 4NQUA 1U8OB 2UVEA 5ETUB 4PJ9B 5ANMB 3VFVA 2DIJA 2OMNA 1GGBL 5EU6E 1FFPA 1QA9B 3MLYL 2OXHA 1YMHB 5DHVH 4G9DB 4UQ3A 3PDOA 3IU3A 5TF1L 3OKLB 3MRBB 2DJSA 4K94C 5AAMA 3IDJA 1XGYH 2Y5TA 5DRZA 3UBXB 5ID0B 3QCVH 3W39B 5JQHC 4G42A 2FJFA 5EWIH 2NY7H 4FQPA 1AKJB 4I48B 2CJUH 1EJ6A 1EO5A 4FQXD 1A3RH 2FGZA 4RGND 3S35X 1HHGA 2HJFA 3DHJA 3HR5A 4XP6L 2O93L 1YJDC 1Y18A 2FWOA 5BRZE 5FM5O 4TSCH 3B6SA 3EDFA 1Z9MA 5B8CA 3RVUD 4JRXB 2FYYA 1CN4A 4PRPB 3I2CL 4LSVH 2HFFB 2D7TL 2OZ4H 4D9RE 4PRHA 4QRTA 3L3KB 3WUWA 1JE6A 1TTUA 4FZ8L 1QLRA 3VU2A 4ELKB 4BFEA 3VFOA 5KN5B 1VADB 1LD9B 3ZL4H 4PRNA 4MAYA 3HN3A 2GUOA 5F7NC 1LO3L 3A6CL 4Y88A 2VXTL 2ZCHH 4QNPF 5D9SA 1JK8A 2IQ9H 3RJDA 1LP9B 3LEVL 5DRXB 3UMTA 2JCCB 2VDKL 3X13B 1GGIL 1B0RB 3T3MF 4QRSB 4OIAA 3C8KA 3MJ7A 3HAEA 4GJTB 3ECBB 4FXKA 1CICB 4LAQL 1CDCA 3T4AA 4LIQE 5JW3L 1JMZA 2BNUA 5DK0B 2I60H 1DUYA 4F33B 4PGEB 4D9QE 3QG7H 4NZUH 4ZUSA 4LEOA 1HNFA 1S7XA 3QDJD 4X80H 1U95A 4Y4FD 2FH6A 1I7ZA 4HIJB 3BDBA 1FSKB 4HX1A 2V17L 4XH2B 5E0QA 4DKFL 2ARJB 1U3ZA 1JPTH 2YD9A 3OHXA 1U3JA 4O2CA 1FO0H 5MENB 1G7PA 1F6AA 2UZYB 1PZUB 4XPBL 2VABA 5IJKC 4JE4B 1GZPB 1W0YT 5DK3A 3OR7B 1KOAA 5EU5B 1HOCB 3CZFB 1NBYB 3ESVF 3CLFH 4FFVD 4WEMB 4PJ5A 5F44A 5FYJH 3STLA 5IVXA 4L1HA 5HVHC 1P5VA 3IAPA 4MDIA 3QULA 4F7TA 1QLFB 2WMPA 1FYTA 5ADOH 4U1LA 2KZWA 3GJFH 1XF1A 2P5EE 3TM6A 5DO2C 1MHEB 1YY9C 5INDB 2MWCA 3CDGA 4UILL 5B4MD 2F53E 1BZQK 1J8HB 5EOQL 2R8SL 2VDRL 1K8DB 4FP8L 1D5MB 2ADIA 5D4QA 5CD3A 2ZG1A 4I2XA 5D1ZC 1I1AA 5FGRA 3U36A 2BOBA 4U2ZA 4KQ3L 5JZ7D 3HUJA 3K2UH 1LP9F 2I9LB 2JCCF 5I19H 3NFSH 4TRPH 2J1KA 5FGBA 4I3GA 1RD6A 4X7EC 1L9MA 3QJFA 3MV9D 5C0BD 5HHPA 1A1MA 1SJXA 5GRXG 1JTOA 5HDBE 2VDQL 3WO4B 4HUUA 4P4KB 2Z8WC 2MSPA 3GSNA 3L3JA 2R0LH 3GMOA 3GSVA 4XCNA 2Q20A 3VXNB 3TT3L 1NGXB 5IGXH 3PHQA 3RKDD 4P9HH 5D1QA 2CD0A 1YQVL 2JIXD 4OQTA 2P1YA 4YE4H 4YR6B 4IRJC 5C9JB 1IAOB 4OLUH 5E99H 3TN0A 1UZ6F 3NFPA 5E5UB 4XGZB 3TCLA 1KPUA 5IOPB 2NY4B 2P45B 3ULUD 2E7MA 4M7KH 4JDTH 3H9HB 5E7BA 1T83C 4GKNB 1UA6H 3KNBB 5HHVH 4APQC 2Y23A 2V5MA 5D5MB 4YEEA 2X4UA 3UJIH 4U1GB 4GXVL 5EO1A 4Y19B 3REWB 3X11A 1P7QA 2DD8L 1RMFH 2OM5A 5SWQB 1U42A 2A6KA 1W8OA 1ND0A 3BSZL 4GKSB 1DQQA 5T1KA 4PS4H 4D94A 3FQNB 2XIDA 5BOZG 3MZTA 2OR9H 3V4UH 4RGOL 1PFCA 2VXQH 5HJ3B 1MHCA 1R5IA 5C0CE 4F2MB 2IFFH 4FMFA 3F65A 1G7IB 3QUYD 4FQ2L 1WCBA 1F3JB 3BVNA 4GG8B 3M8OL 3RL2B 5IB3B 1MNUH 3LKNA 3BX7C 3VE0A 3ARBD 1IC4L 1NC2A 5DHVA 4V1DE 5HXMA 3QXTA 3ALXA 1HYSD 1K6QL 3VXUA 3RWJB 3O11B 1FBIH 4JVWA 5GGQL 2FO4B 3DURB 1HWGB 1OLLA 1EMTL 1RZ7L 3NPSC 3QXWA 2AJZB 5LWYH 2V9QA 1RZ8B 3G6DL 2OK0H 5J3HC 1X44A 5JNYB 2RIKA 2I07B 1DUZB 3SO3B 4PG9B 4P46D 3VFMB 4K94H 3RUGB 5CBEB 2XKNA 5KBNC 3CX5J 5FOJA 3VXQA 2CKBL 4GBXA 1L4IA 3FFCD 4KPHH 3FONB 3KPSB 4MXWH 2QEJA 1IKNA 4HKZA 5EORL 1T6WA 2FB4H 1HXYA 5D5MF 4HAGA 3C5SA 3DV6B 2OZ4A 3OXSB 3IFPB 4QRRD 3MV8B 1G9NL 2VZSA 4QHLA 4XBEH 5H8DA 4MZ3A 3GMMB 4HH9A 3INUL 4NO0B 4PLJC 1IQDB 4AG4L 2LU7A 2D4FA 3FOMB 4TSAL 5IKCB 3QUML 1FVDA 5HTSA 4NBXB 3V52H 1F5WA 1MIEH 1RIVH 4NUJB 4JFFA 3GSUA 5EBGA 3BWUC 2WUCH 4IMKC 2EE2A 3D39D 5M94B 4GRWE 3NABH 3REVA 1D6VL 3O8XB 2H32B 1PSKH 5FIEA 3VXPA 2A83A 3O4OB 2IALA 1CE1L 4M8VA 1RZGA 1OPGL 5MEQB 5C07D 1JBJA 3IKCB 2HFGL 4XXCC 2BVYA 1N8ZA 2YD7A 4JFYA 1IRAY 1KN2L 1ZWIA 4LLQA 1ZLUH 4QF1B 4D9LL 2M26A 3WDIA 4RAUB 2H6PB 1RUPH 2DM4A 1X5XA 4PLKC 2H45A 5HI5C 5DQDL 5ID1A 2C4XA 3MJ9L 1CG9B 1EA9C 1ZLWH 4MJID 3WIIL 4TUOA 2VNCA 3HZYA 5C6TL 1FO0A 3GSQA 3WSQH 5IW6B 2BRRH 1HSBA 3AXLB 3GB7B 4HD9A 4NNPL 3GHEH 2V2WA 4WWKD 3DVNB 3BUYB 3CCHA 4JGUA 3OKNA 1TFHA 5EC1B 1BLNA 5ISZB 4ZYKB 2AQ3A 3X3GL 4MX7B 1N3NA 2XWJB 5E2WL 3NCYS 1S8DA 4E41D 2VITB 1QRNE 1SEBB 3EDEA 2RCSL 4JG1L 25C8H 4LRNH 4CADB 4X4ZA 2BJMH 4YZFF 2PO6B 1X5IA 3GJFA 2VN7A 3D0LA 5I76B 4MHHI 3LKSA 3VRIB 4EVNA 2YR3A 4JFOA 5J6HA 1A3QA 4RNRB 5GHWH 1Q9KB 5F1IA 5DJ6B 4EZMA 1L7TL 4PGZA 4MA1C 3TH2T 4XTRD 3BO8A 2DQEH 1N26A 2C3HA 2DLFL 3VGEA 2DWDB 1ZKAA 4QOKE 4KQ4L 1UZ8A 2VLJB 4G8EA 1BPVA 3JUZA 3PWPA 5JW5A 1F58H 3E6HB 4FG6C 4M93B 5EC2B 4LIQH 3M07A 3WXWH 3RDTB 3PL6B 1FFQA 4Y5YC 3HNVL 4GG6F 3IETB 2APWA 4QHUB 3P0VL 5FYKL 4O9HL 3G6AB 4WRLA 2ORBL 4Z7VA 1CXFA 5D7JB 4KKCC 3KLSA 3EYVA 4WUUA 1PGRB 2PYEA 5AYQA 3VFVB 4EOWH 1FFPB 5EUOA 3SOBL 4QXTA 3PDOB 2DI9A 3HE7D 3NCMA 2NY0D 3BT2H 1TJIH 3OB8A 1FNFA 4KK5C 4OI9A 5AZ2H 4UAOB 3IDJB 3L3DA 1BD2D 3WN5A 1T2QH 2MCPH 1T7VA 4JR9L 5DRZB 4HJ0C 1KB9J 3B9VA 3P4NB 3D1MC 4G42B 2YD4A 1WVZA 4KJWD 2HG5A 5B3NA 2F5BL 2HH0H 3SDCD 1ZLVH 2CO6B 2CK2A 1HHGB 5LVEA 2HJFB 1PEWA 3HR5B 4X6CF 4JHAH 4QGTA 2FECI 3ILQD 2F58H 1AFVH 3B6SB 3VD3A 5GS0L 1AGCA 4YDIL 5B8CB 5GS0D 3ETBF 1JCKA 2FYYB 4FTVA 2R15A 2VRAA 5A43C 3BP7A 2ICEB 4PJ9D 3Q5OA 3TO2B 5E9DE 1P1ZA 2LVCA 4PRHB 3VFGH 3WUWB 2Z8RA 5FHAL 1QLRB 5DJDA 2CLZA 3VFOB 4ONHA 1JWSA 1IM9A 3GKWL 4PRNB 4MAYB 2OI9B 3WNOA 4KXZH 4DGVL 4ZSOB 1MFEL 1BOYA 3FQXA 4XVTH 5D6DA 4NWUL 4PJCF 3RZCB 2ILLA 1HKLH 5EZOH 2CXKA 5D9SB 1AHWA 1SM3L 3OSKA 1JK8B 3O6LH 5CILH 4EI5A 2FBJL 2DL2A 2BOCB 5I73C 2R4RH 2FGWL 3GSWA 1R3IL 3C8KB 3MJ7B 3HAEB 4XPHH 4Y4HA 4FXKB 3C2AL 4KDTC 3KXFE 3SCMC 4IHOA 1N0LA 3T4AB 1MEXL 3DJ9A 1FGVH 2BNUB 2ZG3A 1DUYB 3F7QA 4HUXA 3ZYOA 2R39A 4ZUSB 4LEOB 1S7XB 2R0KL 3RU8L 4L1DA 1U95B 3BKCL 3N50A 1I7ZB 3SGEH 2JB5L 4HX1B 1UM4L 3PGCA 4QXWA 4JM2D 4X7CC 1FN4A 4O2CB 1BJMA 1G7PB 3UPAA 4XVJL 1F6AB 3MRIA 2A73A 4KMTL 1QBMH 4AIXA 3QZWA 4LHUA 4LFHG 1J1PH 2NY1D 2F8XC 1RUKH 3WUZA 4EIGB 3STLB 1GOHA 5IVXB 3W0WE 5FO7A 4P3DB 2X5PA 1KIUA 4X4XB 1ZLSL 4MDIB 3UJJL 4DOHB 3QULB 2APVA 5DD3L 4F7TB 4OLEA 4YHOL 1BQHA 4NZRL 3V5DA 3BZEA 3OXRA 1FYTB 5IVNA 1P4IL 3LHPL 3A67H 1OP3H 1P4LB 1MF2L 1M4KA 4GRMA 3CDGB 4I77L 1CXHA 2GSGB 2FIKA 2ADIB 5CD3B 1OY3B 4I2XB 3U36B 1I1AB 4HWZA 4BJLA 2BOBB 2DKSA 5CGTA 3QEQE 3BE1L 4TUKH 3HUJB 3NAAH 3T0EE 5HBBA 4UB0H 3E2HB 1WAAA 2G5BA 4PP2A 4EI6A 3QJFB 1MFAH 3DMMC 4Q7DA 5HHPB 1A1MB 5IEHB 4LGRB 3WD5L 5FUZL 1UJ3C 3GSNB 3L3JB 3OF6A 3ZSTA 2AI0H 5EOCH 3W2DH 4WGWB 3GSVB 4XCNB 1WITA 1TQBC 3PHQB 4XC3H 5TJWK 1Z9LA 3ALPA 3MLTA 5D1QB 5EBMB 4R2GD 1A4KA 2YC1A 3RFZC 1U2HA 2XZAH 5I1DA 4QWWD 3TN0B 1T66D 3JWDL 2FIRT 4Q2ZA 3NFPB 4S1DD 1EHXA 1KPUB 1A47A 3BHBA 1FRGL 3E3QE 4HFUL 3EYSL 1MLBA 1JWUA 4XAWH 1TETH 3MXWL 2DQGH 3CVHA 5GGSY 3EOTL 5E4EC 3VXMD 1NAML 4MLIA 4WUKH 1CZ8L 4IOFC 4QCIA 5DQJA 5GGRA 4UTBL 4XNQA 5IK3A 2E5EA 4WO4A 1LNUA 1SYVA 3STZA 5IFAL 1T89C 5B39G 1C5BL 5IVXF 5GJTL 2QSCH 4PGJA 3ULVE 4GRWH 1FHGA 1NFDE 3X11B 1P7QB 2APXA 3T0EC 3FT3A 2A6KB 4RFOH 1XR9A 1ND0B 5CEZE 1A3LL 3WNNA 4LCYA 3LIZL 3C09C 1NGPL 5DFTA 5TPWH 4RISH 4PRIA 3AY4C 3RTQD 3W11C 2XT1B 1MHCB 1R5IB 5E2UH 1U3HD 2XTJB 3LQAH 3S37H 1WCBB 3BVNB 3HUJF 5ADPL 4JFHD 5I15L 1TVDA 4TTDD 1KELL 2CQVA 3LKNB 4FNLL 4NP4H 4WFFD 1P9MC 3VE0B 5DMJB 1NC2B 3A6BL 5DHVB 3VA6A 4KKBC 1QZ1A 3S35L 3UYPA 4OV6F 3E3QC 1CI5A 3CXDL 3ARSA 1V7MH 4MJ4A 1ZV5A 3DRTA 4HFWA 5JHDE 4NCC2 3DGGA 3D18B 3VXUB 3Q1SL 4K3DL 2J3SA 3V4PH 3MLXH 1VGKA 4LP5A 2Z92A 4N0FB 5HYQA 3TA3A 4DWHA 4M4PA 1MLCA 1R0AH 4NT6A 5K9JH 1PBYA 4Q97A 1SJVA 3NA4A 4L5FL 1FL5A 4W6XB 1DQLL 4Z77A 1NEZA 1FYHB 3QDGA 2MOVA 4OGXH 3U79A 4LVOC 3THML 2BY2A 1T1YA 3BESR 5FKPA 2XKNB 4TVPE 1HINH 3VXQB 3VWKD 2Z93A 4EBQH 4Z7WA 5DJYA 1BVLA 4IRSA 2HJKA 1DVFD 4HUVA 3BPOB 3DX6A 2Q86A 2YRPA 4HKZB 3VMNA 1GC1C 5IHLB 2UV3A 4CJ1A 1MIML 2DQHH 1DBMH 4ZAKC 3C5SB 4MA7L 4C55A 1AQKL 4P0DA 1XIWD 1OAQH 3D2UA 4HH9B 1LO4H 2OL3H 4KAQH 4ZNCD 4XC1L 3RVXD 5KVFL 4Y2OA 1CFVH 1FVDB 2NR6C 4GAFB 5KVDL 5L88H 4HLZH 1JHTA 4PBVC 2X1XR 5EIQA 4UT6H 4JFFB 3QPQD 3TEUA 5FEBA 3JVGC 4WVRA 1JF1B 5I9QB 3REVB 3FKUS 3JWDC 1G6RH 4XP9L 4XP4H 5B38A 4JB9L 1MCRA 5DT1H 4KK9D 3H8NA 4NQDA 1FL6A 2A83B 1UB5A 2IALB 1RZGB 2Y6SD 3BDYL 1OM3H 5IEKA 2ZCKL 1ZVYA 4HG4J 3IAGC 4OFYD 3IDMA 3BEVA 3ARPA 1N5AA 4R4ND 5DUPH 2WBWB 4KVNL 1WBYA 1KCLA 3SKNA 3CX2A 5ID1B 3SGJC 3D85A 3WKNA 4JKPH 4TUOB 4L4TD 3WCYA 3HZYB 2DTSA 5CZVH 1FO0B 3GI9H 3GSQB 4PJGE 1HSBB 4Y16C 5GZOD 2IC2A 3DSNA 2DS4A 1MHPL 2V2WB 1PKOA 4WHDA 4RSVA 1QSVA 5GGVY 5I1JH 3U0WH 2O5ZH 3CCHB 3OKNB 4FXGB 4ZDHA 5DJ0B 5IFHL 5F72S 2P5WE 3EOBA 4PJAA 1N3NB 4K8RL 3S4SG 1UCBL 3MNWA 5DVLA 4IIQA 4KHTH 1S8DB 2HTKD 4NFBA 2VQUA 1FNSH 2Q8BL 3WKML 1KGCD 3OKYA 1L0YA 3MUY1 1ZANL 2X6MA 4N9OB 4HCRL 3VWJA 3GJFB 3D0LB 3LKSB 3RX5A 4EVNB 15C8L 3EYUL 1XF5A 3GO1H 4OZIE 1U8QA 4I9WD 5J6HB 4V1DA 4BSWA 4WIQA 5L2KA 5F1IB 3BQUD 4KUZH 2A77H 3C5ZD 1EJOH 3MLSH 3BO8B 4ZPVB 4GMSH 3RGVC 3QHFH 1UZ8B 2XA8H 2IG2H 3QH3A 1IARB 4UZGA 4G8EB 5JW5B 3PWPB 4NWTH 4I3SH 2CUHA 4HGWA 3MLZH 2X70A 3SGKA 1JL8A 1UKSA 2R0ZH 3TT1H 5KAQF 4FFYL 3S36X 3OR6A 4Z7VB 4NM8H 1A7NL 1X5ZA 2B39A 1I85A 1TZGH 2J88H 1JGUL 3AVEA 1R24A 2PYEB 1T3FA 4WUUB 1F11A 5EUOB 3O0RH 4QXTB 2PETA 4R7DA 1AIFA 4CUCA 4JFZL 2VB5A 3VXTB 1ZGLM 3CFCH 2AS5M 3MLUH 2PO6D 2EYTA 3QXUA 2OTWA 1AXSA 3L3DB 4FFZL 3WN5B 5FYKU 4KWUA 4KTEH 1KCUH 2P4AB 8FABA 4S1SH 4ODVH 4C57C 4H8WC 2HG5B 5J12B 4J6RH 4GSDL 1H15A 4YGVA 2E6PA 4KI5E 2VLJD 5IG7B 3PNWA 1RIHH 3O4LD 1H3TA 2VDNL 4N5ED 3MGAA 4ZFZA 3RHWF 3MYZA 1AGCB 1MJUL 3BGAA 2ZOLA 1A7QH 4Y4KA 1LK3H 5LQBL 4LOUC 4L3CA 3BP7B 4Z95H 3QXAA 2IANE 3WLBA 5IBLC 3ZTJG 2FX8H 5CMAA 3P0YH 3MRLA 5TDOA 4DCQA 4MA8L 3W82A 3FAWA 2E27L 3WJLC 3QIUC 4JQXC 2OXGA 4J4PA 3JUYA 3B8YA 4ONHB 1NCUA 1IM9B 1OQXA 2IJ0C 3D25A 1R3KA 4LKXB 4GRLC 1A21A 6FABL 4JDZA 3FQXB 2WLYA 3DOSA 1LQSR 4HZLB 1QSEE 3N06B 4JJHA 4GW5A 1AHWB 4GW1B 4KUCF 4Q9RL 4P48A 5TDPA 5IHUL 1OWRM 4K8RC 3GSWB 2HKHH 4Z7VF 2N7BA 4RMRA 3AREA 1WIOA 1BWMA 4Y4HB 4UIMA 3TZVC 4OM0H 1SJHA 3OKEA 4Y5VA 5ICYA 3ELAT 4MWFA 4KI5C 2CLVA 4OJFH 3UO1H 1LDPH 3LV3A 4TOYH 4QRPE 3OGCA 4JGMA 3IS0X 4CU7A 3QPXH 2EC9U 3C5JA 4U0RB 1XF2A 1LO0L 4G7YL 2FEEL 4NM4H 2ESVD 3P9MA 3PGCB 5J13C 5HGHA 2RQ8A 3LKQA 1FN4B 1AJ7L 4P5TC 3ULVH 4N90E 1F4WL 4PRAA 2O61A 4O00A 3VDAA 3CMOH 3QZWB 2AJXH 4ZUTA 4AT6B 2VLLA 3GBMH 3FQRA 3ZKXB 2F54D 1RV6X 4QOKA 4AEIH 4WJ5A 1ZVHA 2OL3A 4DFIA 5CEZH 3NZHL 3DX7A 2VDLH 4XI5D 2EDYA 3TO4C 1EEQA 5FGCB 5FO7B 5J1TC 1FV1A 4QRQA 2NY2B 4E42A 1MFCH 5DMIH 4PR5A 3V5DB 4KHXH 5JR1H 1I8KA 2OTUA 1G6RA 5IQ9B 3KHOA 3P0GB 2B0SH 2FL5A 5EU6B 1KBGH 4X8XA 2C4FU 2FIKB 4CDHA 1I1FB 3RGHA 1JV5A 5HPOA 1RZJL 4HWBL 1DJSA 4HWZB 1EO7A 2R1XA 1NSNH 2JELL 2Y25A 3TYGL 1HIML 4OT1H 3O9WA 2YPLD 5E2TH 3TH4T 1PKQA 1EX0A 3ZYZA 3P40A 5DLML 3MBED 4M6ML 3WE6A 1MFDL 3GJFK 3RHWK 3EHBD 4PJ5D 1P5UA 4NZDA 5L9DL 3DVFA 2EDKA 3MLTB 5A2LH 4CNIA 2BC4A 1Q72L 4KGLA 3HI6H 4P2QE 4N1HB 5T5FH 4F37F 3CSPA 1EEZA 4RIRA 4NO5B 4DW2L 5DWUH 5I1DB 3MJ8A 3R8QA 4Q2ZB 3HE6D 3KJ6H 4UINH 4CMHB 2X1PA 4RMVA 3BHBB 3TJHC 1MLBB 3N85H 2MQ0A 1JWUB 1VACA 1WTGT 3IDXL 5FHBH 5F9AC 2A9ML 3GK8H 2X4NA 4QCIB 5GGRB 5DQJB 5HHXL 4XNQB 4M7JH 4WO4B 1KCRL 1LNUB 1XGQA 3EBAA 1SYVB 3STZB 4QXGH 4XWOC 3QI9A 4M1CC 4A6YH 3DETD 3KPQB 1S78C 4UTAL 1KCVL 4CAGA 5IWLA 5DFVC 4DTGH 4WI9A 3FT3B 1J1XL 1OSPL 1XR9B 1KTKE 5DA0B 5TE4L 4LCYB 3EFFA 3KXFA 4IOSD 5J8OA 2VQTA 2BSRA 5TQ2H 4BQBA 1UYWH 3KLHD 4U2YA 3F7YA 2AERT 4PRIB 3Q0HA 3RI5F 1R3LA 1MCKA 3MQIA 1CFSA 1OAXH 2G60H 4ORGA 4MCYA 2JJWA 1JNNL 4TN9A 4M5YL 4WEBL 4GAGH 2W9EL 3RVVC 1GPOL 3CFBA 1WAAF 4P23D 1KJVA 2VUOA 4RGNE 1S5IL 1QFWM 5CZKA 3O2WL 2VL4A 4HFWB 3DRTB 4NYLA 3ZKNC 3DGGB 4XVSL 5F7DA 5C0FA 1VGKB 2Z92B 4LSDA 5HYQB 3TA3B 3EO9H 1MLCB 3I6LE 4NT6B 2VE6A 5C0AD 1T1WA 4BFBD 2DQFA 1FL5B 2HRLA 5D93B 2B4CL 1NEZB 3QDGB 4MJ5A 2XQBH 4JPVL 5HPMB 4FQHA 1T1YB 3WNKA 5T1KD 1DANT 5FKPB 1VHPA 2AJSH 3EYQC 5TQ0H 3FN0H 3NMEA 3MX0A 1IAKA 4AL8L 4TQEH 1VGEL 2DN7A 3EGSA 2Z93B 5DJYB 3OJ2C 4KMLB 1BVLB 4IRSB 2HJKB 4APQB 4HUVB 3MRFA 4PV9A 3DX6B 2Q86B 1KEGL 5I1AA 2XXMB 1KULA 5FYLH 5ELIA 5F96L 3I3BA 2EDEA 2HTLD 1X4XA 1K8IB 3U82B 1AC0A 1GGUA 3QEQA 1NC4D 4OZHE 3D2UB 4LEXL 3T0EA 4P2CG 4GXUM 4HWNA 4PB0L 3QWQB 3VD9A 4P2OA 2X1OA 1S7WA 2A6JA 3VXUD 1JHTB 4O4YL 1FH5L 3VD7A 1QOKA 4HXAH 5F97E 3ABZA 2DLHA 1EGJH 4LNRA 4YC2B 3ZZ1A 3WHE0 5ITFA 1ORSB 1IKFL 4OLZH 4MXVE 3QT2A 1T04A 5DRWA 2EO9A 4I1NB 3RVUC 4JVUA 3JBG7 5B38B 2XA3A 3G5VA 2YA2A 2IGFH 4NQDB 1FL6B 1FE8L 1UB5B 2J8OA 1P9MA 2HLAA 5IEKB 1FCGA 4GBXD 1PD6A 2QTEA 2FJHA 4F57L 5KVGL 2R56H 4CJ0A 5I30L 4LCIH 1KENL 3EDKA 1RZFH 5KSVA 3C8HA 3IDMB 3BEVB 1UB6A 1N5AB 4N0RA 5JPMA 1WBYB 3B4NA 4PJBA 3F5WA 4NKIL 3B5HA 3SKNB 1K4DA 4XCCH 3O6FA 3NPSB 2DQIL 2Q7YB 4LCCC 4MYWB 3D85B 4U6YA 4F8TA 3AUVA 4HBCL 4GW4B 3DYMA 1DQMH 1NFDA 1T2JA 1S5HA 2O5XL 3I9GL 3DHMA 5C09D 5GJSL 4HWEL 3RI5K 2MQCA 1BF2A 1ZXQA 2MKLC 2W1NA 4Z7WF 5MP6L 4ZDHB 3RY6A 2GIYA 2ZKHH 3EOBB 1CDYA 2R2HA 3HMWL 1QFUL 5I1IH 1ZLUK 5C0RL 1EAPA 4IIQB 5C0CB 4KV5F 3MFGB 3TGXA 1PLGH 1S9XA 5A2KH 4ZFOA 5J06A 1IM3A 1TJHL 1ZTXL 2GI7A 4CVXA 1XGPA 1ZLWK 3VWJB 2A6DA 3CFEA 5CGMA 1LILA 3MV9E 5C0BE 5TH2A 3MACH 1Q9LA 1XF5B 4EN3C 2ICCA 1U8QB 2DQUH 4V1DB 2X40A 4BSWB 5L2KB 1D5XA 4ALAH 1Q94A 2P48B 5JHDA 4R0LA 5K59F 3JVGA 4L8BA 4O5LH 43CAB 3MCKA 5IROC 1KXVC 4FFVC 3DX9A 4FFWC 3G5YB 1DSFH 3QH3B 4UNVA 4MDJA 2YD8A 4HGWB 4MD0A 4UT7L 3SKMA 1JRHL 2X70B 5F70A 5I0DA 2IADB 1SMAA 3TFKC 3ULUE 2QLVB 1IGIL 4M61B 1KCSH 2VL5A 2FD6L 3OR6B 4KJPC 1T1XA 3OJDA 3T0DA 4OGYL 2V5TA 1R24B 1T3FB 3EJYD 3FT2A 3L3OB 3RBGA 5B21A 1F11B 4U0QB 3KWWA 4R7DB 2GY7B 1AIFB 5I1HL 4R6UA 1AXTH 1JPSH 3D48R 3SE8L 5ECJE 4G5ZL 2EYTB 2VISA 5JZ7C 1AXSB 2DLEA 1JN6A 4BZ1H 2DQJL 1B88A 2YD2A 4DGIH 5D7LD 5CUSL 2A38A 5I71C 1NAKL 5E6ID 3BJLA 3T65A 1YEGH 2YSSA 5DI8B 1A6VH 5JORB 4PJAF 2BFVH 1H15B 1KLUA 2YMXH 4A6YA 4NKMA 1IEHA 4YGVB 4GRWB 1VA9A 3UZQA 3PNWB 1GL4B 3SDAC 5E08L 4JPWL 3MLRL 3PV6B 3MOAH 4ZFZB 3UTQA 1SHMA 5E00A 1ED3A 2ZOLB 1J12A 4Y4KB 4ETYA 3T2NH 4DZBB 2PN5A 1F90H 1F00I 1JI1A 4WNQA 4L3CB 4RDQG 4HPYL 4ONFL 1OB1B 3QXAB 2QHRL 3ULUC 2C26A 1XZ0A 4GAJL 1KPRB 3RBSA 3WLBB 4NQCD 5CMAB 1CXEA 3MRLB 5TDOB 4DCQB 2IAMA 1OGAD 4HIEA 2DQCH 4ODSH 1ZLVK 1YYMH 1KSRA 4ERSH 3DI3B 3GUTA 5M7QA 2FLRT 3D25B 1R3KB 1I8MA 1AE6L 4JDZB 3L5XH 2EE9A 4YDLB 1EFQA 4HW6A 4M1GL 2GTZA 2HJLA 4F8QA 3D9AL 4GW5B 3C6SA 4PJGA 4MQSB 3BGFC 2WANA 5TDPB 5FUOH 3FFCE 4OCLC 4HLJA 1YEIH 3AREB 3G6JE 3C6LD 2APFA 1NPUA 4UIMB 5CJ8A 1DL7H 4OF0A 1SJHB 2LAGB 2P5WA 3LN9A 2ZUYA 4IEFB 3OKEB 5JOFA 1NJ9A 3OB0H 1IGFL 4J23A 3BKMH 2FDBP 1MCBA 4LARH 4QRRE 3DARA 1QRNB 1ZSDA 3OKKA 5GGVL 1OAZL 4Y8AA 4OIIL 3ARFC 3KVQA 4FTVD 1DBKL 3QNZA 2B7DT 3VGDA 2ZUVA 3C5JB 3RY4A 3ARBC 3JWNC 1ZOXA 2IPTL 3P9MB 3TIDA 5I1LB 1NCWH 3VXOA 4U6VL 4FQJH 3LKQB 4LSSH 2E7CA 3B5GA 3D39E 5IMMA 4NGHH 3PG2A 4C56A 4NHCL 2O61B 4G80B 4GRWF 3VD4A 5AD0A 2VLLB 3FQRB 4ZXBA 4QOKB 1WWAX 2OL3B 4DGYL 3DX7B 4HKBA 4OF7A 4EI5D 3MYJA 5TF1H 5C07E 3ARGD 5GRJL 2NTFA 2D7OA 5EBWA 4ZTPH 4E42B 3JWOL 1NFIA 1EGJA 4Y4HD 5EFIB 2GQHA 4HK3N 2P44B 3ORJA 4P4RA 4PD4J 3OPZL 5D2NE 4X7TA 1I8KB 2OTUB 3MUJA 4JQXA 1G6RB 5CFHA 3MJGX 4AEEA 2FL5B 2FHCA 1HQ4A 5C8JB 1ZA6A 3VGAC 2A0LD 2I5YH 3GNML 4MJIE 3JV0A 2EDDA 3KLAA 4RMWA 5I1CL 2MHAA 1JV5B 3ZMRA 4OCWL 2Y4SA 5DURB 3P2TA 3N9GL 1UWEL 1G9ML 3FRPG 5IVOA 5D7SH 5I73B 1WF5A 1W0VA 1CFTA 3F58L 2H2PD 1PKQB 4LSQH 3I2CH 1I7UA 1FNLA 4LHUD 5T3ZD 1ZEAL 4NNXA 3LEYL 3QCUL 1OP3K 2M2DA 3RWIA 2CDEA 4E41E 3BZ4A 3EO0A 4YBLB 1GAFL 2NXYC 1II4E 2HLFC 4FZ8H 3UC0L 5C6PB 3EJZD 1KEML 3H42L 2ICWJ 4CNIB 2BC4B 3VDCA 2J4WH 1B4RA 1MCFA 4FS0A 1EEZB 4RIRB 3A6CH 5DRNA 2W0PA 4H0IA 2X9XA 3MJ8B 2ICES 2VXTH 2IANA 4R4BA 3VXRD 4LKCA 1FAKT 4KH2A 2VDKH 1VACB 1YEHH 4KTDL 3S7GA 2ENYA 5C7XL 4XMPL 4DN3L 1I8LA 2X4NB 4WI2A 3GMLA 3QUZC 4J7RA 4UIKH 2DI8A 2IWGA 4GLRI 4ZQKA 1XGQB 3V6OE 4XB7A 3QI9B 5JW3H 3L7EA 1BAFH 3P11H 3U1SL 1CLZH 3CPLA 4X5WB 2R69L 3S36L 2UWEE 5I75C 3S34H 5T1DL 3RAJH 4HF5L 4G6FD 4KZDL 3B9AA 1MREL 1FAIL 2OS7A 3O81A 3EFFB 3KXFB 4YJZL 2BSRB 4G6KH 3F7YB 3EYFA 1HI6A 4OLYL 2EZ0D 4XPBH 1R3LB 2Z31C 1BD2E 1CFSB 3LVEA 3MREB 4GQ9L 4ORGB 2UZXB 4QRPA 2X05A 3VI3F 5DS8A 4R7NB 1NDMA 2MTPA 3IJHA 4G8FA 1A0QL 3VD5A 5KJRL 2Q6WA 1INDL 3CFBB 4TPRL 1KJVB 5AZEL 2VZTA 4MQXD 2VZVA 1UM5L 2NMSA 3WFCL 4E9LA 1O7SA 1JYXA 1A14H 4NYLB 4QHKI 3TESA 1YYLL 5F7DB 5C0FB 4NN5B 2OJEA 3WIHL 3BMWA 3P9WB 4UILH 3V6OC 4PY8I 2X1WL 5I8OL 5EOQH 3T3ME 5LJYH 2DQFB 5I18L 5CD5D 3UJTL 4LCUA 2VZOA 4MJ5B 1NMBL 4FQHB 1X5KA 4KQ3H 4UOJA 3SKJL 5JW4M 5E4IA 4OF8A 3LH2L 2O26U 4PRID 3ES6B 5C92A 2C3WA 2RHEA 3EGSB 4K71B 3MRRA 3QUXD 4PV9B 4CN6A 5CBAA 2J6EL 2VDQH 4KROD 5I1AB 4R3SA 5LKNA 1TVHB 4OGZA 1FCCA 1BMGA 3QEQB 2CR3A 4O02L 1EXUA 2YUZA 4LU5L 3T0EB 4KJWC 1YQVH 3QEGL 4P2OB 3B43A 4Q9QH 3SDCC 1S7WB 1OW0A 1HHIA 3SDDA 3JTTB 2CDGA 1MRCL 2P7TA 3ULUH 4UQ2A 2BVQA 1HH9A 4LVNB 4LNRB 5CGYD 4MQTB 4U1IA 4ELME 2YKLL 3ILQC 5ITFB 1T6VN 3HZVA 4PRDA 1T04B 5DRWB 3WS6C 3QDGD 3V6ZA 4P2QA 1IAIL 3G5VB 1LMKA 1QO3A 3ARXA 5E6ZA 5CKAA 4OKVA 1ZMYA 2X2YA 1FJ1A 4PJ9C 5HYSG 2HLAB 3HCVB 3D3VD 2FJHB 3UXFA 4GXVH 3LPFA 2Y36H 2DD8H 4AENA 3VRJA 3HG1D 5KSVB 1UB6B 3S5LG 1YEJL 3BSZH 2BXYA 5DQ9B 3F5WB 2JCCE 3O6FB 2BVTA 4X7SH 4OD2A 1CGXA 4ZOEA 4L3ED 3QQ4A 2LV4A 2GK2A 3W9EB 3ALWA 1NFDB 4LVOB 3MV7A 1S5HB 2AXFA 4BUHA 4JO4L 1YMMD 1UH2A 3HRZA 1ZA3B 2GHWB 2M1KA 1VEMA 2OP4L 4KFZC 3KR3L 2NTSP 5C0DA 4I0PA 1G7MA 2R2HB 1ZT1A 4QY8A 5FAAA 4U4BA 1EAPB 4YFEA 2ZG2A 5EUKA 4XXDB 5IHBA 1S9XB 1PDKA 1UZ6E 4ZFOB 1IM3B 5GGQH 1NMCB 1T0MA 1XGPB 4CVXB 4YXLL 3H6JA 5T33H 2A6DB 2JJSC 1RZ7H 5TH2B 1EEYA 2FCBA 1YNLL 1NMAL 1CTNA 3I02A 2CK0L 4JFDD 4FQXA 3EOAA 1W0WA 1A2YA 4K7PH 1D5XB 3TCXA 4RMQA 5JHDB 2DOCA 1ZT7A 4R0LB 1VPOH 5IT2H 4HHAA 3L3GA 4L8BB 2BP3A 3MRMB 3MCKB 2CKBH 1I9IL 1CXIA 2YPVL 5DD5H 3DX9B 5GSVA 1OTSC 2AJUH 3S96A 2E9BA 4J3TA 4MDJB 4G8GA 2HP4A 5EORH 4U05A 4NHUA 2DIAA 4MD0B 3SKMB 5DGQA 4LSRL 4PJ7A 3SKUD 1CICC 4G6AD 1G9NH 4Y8DC 4UBDC 4JCLA 3VXME 2VL5B 1WTLA 4AG4H 4BELD 1T1XB 2AXGA 3OJDB 3T3PE 5FO8A 1BOGA 5L8LB 4PJBF 4WU5A 5EIIA 3T0WA 1FSKC 3MOBH 1CLCA 3QJHA 1JN6B 3ULVF 4OZHA 4FQCL 3ZT6A 1NFDF 1D6VH 1RFDL 5L2KD 2XZQH 3MNZB 3GMPB 5B3JE 2LU4A 2BY1A 4ACPA 3T65B 1CE1H 1OPGH 2YSSB 2HFGH 3WLWD 4YDJA 1KLUB 4A6YB 4NKMB 2YWZA 3QDJA 4Y4FA 4RMUA 4R2GC 3ZHLA 1E27A 4HJJL 3HMXH 4QTIH 4JFHE 1GIGL 3BMVA 3V0WH 3UTQB 5DQDH 4WFFE 1T66C 1ED3B 4RAHA 5E00B 3MLVL 4Q6YA 4BM7A 4WNQB 2G2RA 5C6TH 4DVRH 1LE5A 3ZDZE 1MHHA 1XZ0B 4EJ1C 1HZHL 1BQLL 1RUQL 4NNPH 2IAMB 3PGFL 4FXLA 4HIEB 1C5DA 1FLRL 2PXYD 4B7LA 3GUTB 4YNYB 1NUFA 1I8MB 5E2WH 2OQJB 1IAIM 3CH1A 5HI4C 1J0IA 3LB6C 2GTZB 2HJLB 3CXHK 1CIUA 4PJGB 3T2OA 2RCSH 4JG1H 4OCRL 1FZOA 2NY3D 1A6AA 4XPFH 1BP3B 1FORL 3UZVB 3BRDA 2VLMD 3X3FL 2P5WB 3P4OA 5JOFB 1NJ9B 4D3CH 4J3OC 3AB0C 3UYOD 5CJQH 2W91A 3OKKB 1ZSDB 3B83A 3QNZB 5F8RC 2XWTA 2NY4C 4TTDC 3IF1B 3ZE2E 3MV9A 4OSUL 5I8KL 1JGVL 3HC3H 4OZIB 3IS1X 2GSIA 2VYRE 3TIDB 2BRQA 5ACZA 3VXOB 1B0GA 3MLWL 2R29L 4J4PD 3WDJA 1MI5A 3P0VH 5IMMB 3GM8A 3RWGA 4XMKH 5AD0B 4M1DL 3AMKA 4ZXBB 2JIXA 4U1GC 3K80A 4UDTA 4HKBB 5E03A 2VH5L 2B2XH 3MYJB 2BDNL 2NTFB 3MSPA 1V3KA 5EBWB 2XQYK 4ZMAT 4Z5RA 1NFIB 1T20A 3MPCA 2FBOJ 3U9UA 1X5LA 4JR9H 5ALCL 2EXWD 4P4RB 3C9NA 4X7TB 4LCWD 3H9YA 3U48A 5C3LD 2FHBA 3DRQA 1HQ4B 1QNZL 1ZA6B 2D9QB 4YZFE 4F7PA 1V3LA 3KLAB 4L4TE 1YZZA 2MHAB 3KYKH 3L6FA 4J3UA 1XIWC 3MTRA 4PJGF 1ACYL 1W0VB 1CFTB 2DYPA 5GS0H 1OGTA 4OCYL 4ZUUA 3TBSA 3WO3B 3TZVB 1I7UB 4KZEL 4NJAH 4OI8A 1RUMH 2HA1A 4NNXB 4ETQA 3BIAX 4KU1A 2CDEB 3RWIB 1NCNA 3BZ4B 1HILA 3EO0B 2RR3A 1KGCE 3QUYA 3B9KD 3SO3C 4GG6E 3O2DL 4QXUH 1RK0B 3GKWH 4DGVH 1QTYT 1MFEH 2Y6SC 3ARBA 4I9WE 4JANA 2VOTA 2CGRH 1VERA 5J11B 1V05A 3QDAA 4D0DA 4KRMB 4LFHD 2IANB 3DXAD 4FQ1H 4LKCB 4NRXB 2DDQH 5FCSH 2FZ3A 4R4NC 3RNQB 5SWZD 2FGWH 1R3IH 3IGAA 3TPKA 4HMCA 1ZS8A 5DDHA 3GMLB 2BZDA 1Z2KA 5GRYA 1ORQA 4ZQKB 1ONQA 3MCLL 2BNRD 3L5HA 1A7PH 5F89B 5GXBB 1J1OL 1KLGA 3LOWA 2GT9B 4P46A 4HIXH 1Q0XH 1SEQH 1UWGH 3L7EB 3O9WD 2NY5L 5GZOC 3CPLB 2R0KH 3RU8H 2YZ1A 1BGXH 2CKBA 2KQMA 3MRHA 3WNMA 4U1KA 1UM4H 4JZOA 4NOFA 3G6JA 3NCFB 4BQ8A 3D69A 4X6CE 4NRZA 4LRIA 4L4JA 3O8XC 4PB9H 1AGFA 2HTKC