5LQBH

Complex structure of human il2 mutant, proleukin, with fab fragment of nara1 antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
QVQLQQSGAELVRPGTSVKVSCKASGYAFTNYLIEWVKQRPGQGLEWIGVINPGSGGTNYNEKFKGKATLTADKSSSTAYMQLSSLTSDDSAVYFCARWRGDGYYAYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved cancer immunotherapy by a CD25-mimobody conferring selectivity to human interleukin-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Interleukin-2
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2016-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lqbH02
5IUSA 4LHQB 2J6EA 5KG9A 2X42A 2CDGA 3B9KC 3W81A 1RIUH 2XI9A 3EYSL 4PFEA 4GJTB 4Z76B 3G6DL 4JM2B 4TN9A 3KPMB 1XR8A 3VXMB 3BN9C 4E5XB 4R9HA 4PRBA 3OAYK 4PBVC 1I3RA 5GRVL 4P2OD 4JJ5A 1KIRB 4HT1L 5E4IA 3M8OL 2EICA 2MSPA 5IMKA 1PDKA 2NLJA 3JWDH 1MY7A 3BE1L 5EU4B 4G6KH 3FFCD 4ZDHA 1MREH 3FQXB 2OJEB 4AT6A 3WIFA 2P8LB 4P5KB 1A6PA 3MGOB 2Y36H 1YZZA 5GGVH 1JMZA 3LMJH 4H1LG 3L5IA 4KJWC 3T4YB 2X1OA 2FSEA 4X98B 3FHAA 3MLUL 4JVPA 4X80H 3BDYH 5D1ZC 3VI4E 1AI1L 4MQ7B 4K7PL 4HKBB 5F89A 4NO0D 3V2AR 4KTDH 3D0VB 5F9DC 4QO1A 3VJ6A 1HWHB 3UAJD 4YBLC 5EUOA 3MOBL 3RVVD 3BKMH 4LSPH 3JVGC 4QHLA 4GSDH 4F7MA 1DUYB 4S1SL 3L3OA 1ZVHA 3WFEH 5D1QC 1CGWA 4KPHL 2IBZX 2GY7B 1A1MB 1RUPL 3HAEG 2Z93A 3IJYA 5IOPA 5GRJH 3MLPA 3FFCE 5M7QA 4Z7UA 4OCRL 5HYEA 1URLA 3REWB 2B1AH 4CNIA 5FGSA 4X7SH 3IKCA 3FHQA 1LK3L 4LGRB 3K81A 5DMKB 4OV5B 1A7NL 1BREA 5DMIL 1OP3H 5DEFB 5I6XB 1TZGH 2FX9L 1BJ8A 3LS4L 3U6RA 3LKPB 3T0BA 3WEXB 5J13B 3T0EE 2YPVL 4PBXA 4F58H 4NC0B 4LPYA 4JFOB 3DECA 1I8KB 3T0AA 2DQJL 3N9GL 1RHHA 4Z95L 3QEGH 1J9CT 4JFDD 4ETQB 1KXQE 3GSOB 3RIAK 2R1YA 3DI2B 1JMXA 4RMRA 4AEFA 4O9HH 3HZKB 3IDGA 2QHRL 1AIFB 2EC8A 2XQYG 4JKLA 5SX4H 1SYVA 5KW9L 3UPRA 2FD6L 1NGYA 3IXAB 5EOQL 4RFOH 1P2CB 1X5ZA 4EKXA 4BZYA 5E8OA 4HCRA 1KB9J 1X9QA 2BSED 4LLMA 4TSBH 4IHOB 2J8HA 5ESAB 4J4PC 3HAEA 3MRDA 5E5RB 3HB3D 3EO0B 2ADJB 5LCVH 3VRJB 1CE1L 1ERNA 1UWGL 1DZBA 1VEMA 5ID0A 3F7RA 1A5FL 5E8DL 1U3ZA 4YNYB 3RX8A 3WD5L 2FL5A 5K9OA 1DQDH 3BP4B 5ANME 5I1EL 4HBCH 3EOAB 4UAOC 3NPZB 3O9WC 5DJ0A 1QLFB 1A1OB 4GRWH 3V8OA 2A6JB 1TCRA 4HUWB 1E4KC 2WUBL 3O3BA 4KRNA 1I85C 1ZHLA 3SCMA 5JR1L 1GZPB 1AD0A 1RK1B 4XNZB 4ODWB 4XGZA 1KEGH 4HKZA 5FHAL 5ADOH 1Q9WA 4ODBD 5GS1A 4H8WL 4Z5RA 5CEZH 3AXLA 1YNKH 2H3NB 5JA9A 5IKCA 3I6LD 4EUPG 1HNGA 4MS8D 1RURH 1NGPH 3LEVH 2NY2B 2FJFB 4YC2C 2YBRA 2FWOA 1FL6B 1ZAGA 4P2RE 3B8YA 5DZOA 4FQ1H 4RGNC 4FFVD 4JFXA 1TLKA 5A3ID 3O2WL 3A67L 4KTEL 4N1CA 4OD2A 1QSVA 3B9VA 1MVFA 2WQ8A 4NCC1 4P4RB 4HGMA 3MQIA 1YQVH 4JVUA 1A3LL 4X5LA 1WCBA 3RIFK 3TYGL 4LSSH 1JZ2A 3DURB 1BQHG 2ZG3A 3PWPD 5B4MC 5IB2A 1KFAL 1Z6JT 2VDLH 4HS3A 3A6CH 3MV8B 4QEGA 2R56H 3MUY1 5SWZD 4WY7H 4FP8L 5HHNB 3TLRA 4IRZH 1NCAL 4N0UB 1BF8A 4OSUH 5FKPA 1LO4H 3MGOA 4Y4KA 4NZUH 2GUOA 4EZMA 5B39A 5GZNC 3C8DA 1M7DB 2QSQA 4YHLH 2C9AA 3GBMH 3LPWA 3KYKL 4O4YH 4G42B 5J4MA 1T20B 3NFSL 3ARDA 4Q9RL 1FIGH 1QSFA 1RK0B 2QL1A 1LE9B 1KCRH 1RUKH 1ZS8B 4DGYH 1GGYA 5KVEH 3SJVE 3CLEL 1LNUA 4HEPG 1L6ZA 2HTKD 2FO4A 5DHYA 3O3DB 4XWOD 4WI3A 3EDJA 3RDTD 3ULUD 4I0PD 5F93C 1K5NB 4KTEH 2ATPA 3ARGD 4I1NB 1UQSB 2GI7A 3CUPA 2P5WB 1GC1H 1JWUA 2MFNA 4JY5L 4HJJH 4TUJA 2P46B 3F5WA 1F11B 3HC0A 4O51A 3MPCA 5MI0C 3BQUA 3SE9L 4ZS6D 4L4TA 3F6IA 3ZTJG 1U0QA 1GZQA 1CDGA 4PTTB 2UVEA 3CFDB 3WFZA 1CF8H 4LHUD 3O4LD 3K8MA 3U4BL 2M8XA 3RY4A 4PIRF 4U1MA 5B8CB 2Y25A 3EOTH 2NY4B 2IJ0C 3EYFA 1Q9OA 1QFWL 1WBZA 3CMOL 2Q3ZA 2VDNL 2YC1B 3WEXA 1U6AH 2IFGA 3WS6A 4P2OA 3G04B 1IAOA 5MEND 3OV6A 4H5SA 2BVOA 4ONHA 1HDMA 5DJXB 3RWCA 4OGYH 4BH7A 1UJ3C 1K3ZA 3IFLL 4LLUB 3X3FH 3OHXB 4KHTL 1R3KB 1EGJA 1A9EB 3ME0A 1Z9MA 1UJ3B 2A2QT 1J1OL 2Z31A 5SWZA 5CLWA 3WLBB 5FECA 4KHXL 4LP5A 3MJ9A 3FONA 2PO6A 3UTQA 3P4NA 4PJAB 4H26B 4JLRA 3DJ9A 4HAGA 3P4OB 3ULUL 4GQPH 4NQEA 4LLMB 2YA1A 3T04D 3LKNB 3C60B 5D7KD 5K9QI 3HA0A 1UH2A 1FH5H 1TQBC 3U2SB 3B83A 5DJ6A 3QQ9D 2EH7L 3MACL 1KACB 1IC4H 4L4VE 4U1LB 1SBSL 4LPTA 3VG9C 3U48A 1KLGA 4ZUVA 4P2OC 4XCEB 4DWHA 1BLNA 1S3KL 5FEBA 3OWEA 3CLFL 4KI1A 2V7NA 3SJVA 3CZFA 1MCLA 3BH9B 4L4TD 5EU7C 3BT2H 3EYSH 3SKMA 1JZ7A 3MCLL 1U95B 4LHUA 1JK8B 1WFNA 1WIUA 4P4KD 5GRUL 4E0RA 4WWID 1IGMH 3BP5A 4NZJA 5SX5H 3DUSB 5J06A 5IBTH 2MCG1 1QSZA 3LPGA 5EO0A 3B43A 3BOVA 5F7LB 5CZVH 5ADPH 2JJWA 1RZ8A 2WV3A 1HIML 2OX5A 6FABL 5KANI 1T5WA 3MZGB 4GW5B 5TF1H 4EVNA 4Z7VA 5C0RL 1SEBB 3FN0L 1DEDA 2VXQL 5FA3B 1HZHH 5HGHB 2VDML 5IQ7L 3LMJL 2OZ4L 1N3NA 2CXGA 5HDQH 1P6FA 4QRRD 3DBXA 4LKXB 4P2RA 4G8IB 4LVOB 4YWGL 1U8HA 2MOVA 3MODH 3G6JE 4QNPE 1MIML 1I9IL 1KCSH 3RNKA 3HR6A 4DK3A 2HTLD 5KOMC 4KZEL 3K46A 1CQYA 2O5ZL 5CP3H 2Y6SD 5FYKD 4JY4A 1J87A 1A6VH 3VH8B 1A3RL 1FPTL 1XR9A 2OR9H 5LAXA 2BNRA 1JPSL 3BKJH 1TJHH 3TVMD 2DLFL 4RNRB 4ZTPH 5ACLA 4OZIF 4CMHC 5MERB 3RDTA 5DHYB 3FOLA 4PV8B 4F9LC 1BX2A 2ATPB 1HCFX 4ZUTB 5C0BE 3K2MC 3HUJF 2I24N 4JE4B 4KRPD 3EOBA 4JFPA 4D9LL 5EO1A 2VABA 4BSWA 5DFTA 4HKXB 1BZ9B 3MLYL 1Q9KA 3MRPB 1JNJA 4PRIA 3JWNC 5C2BH 1VGKB 4R90H 2DQFB 1MREL 2DQIL 3CDGA 5F44A 4QHKI 2O61B 4G6KL 3WO4B 4LVOC 4QLRA 3S37H 1FVDA 4LK4A 3OGOE 3BZDA 2DQCH 3ET9F 5AD0B 3PG2A 4NT6A 1JTOA 4Y5VB 4MJ2A 1KELL 3V4VH 4LARL 3QDJD 4LKCB 1U8QB 4G43B 1BMGA 2BNQE 2Y07L 4ZSOA 5ID1A 5GRZA 2VLJB 2ZG1A 1UCTA 2D9QB 4JG1H 4S1RL 4Y5VC 3SGKA 3TNNA 5L9DL 1N6UA 3S4SG 2EO1A 4XWGH 1P4BH 3KXFD 3TN0C 3CSYA 2C1PA 3PL6B 3C8HA 5EBLB 1GL4B 1O7SA 1JRHL 1KULA 1SHMA 2HJFA 1VEOA 2VKXA 1UACL 5B38G 1IARB 1DBJH 1YUHB 5GJSL 3TZVD 1DFBH 4WTZG 4QRPA 3NGBB 5D96B 1LO0H 3LN9A 1RIHH 1N5AB 2NCMA 3U9PL 2J88H 4I3GA 4EIGB 3SE8L 4K07A 4NKDB 4WY7L 4LVNC 1ZTXL 4YHYC 4XVUD 1KENH 1T1WB 4TRPH 1FYHB 5DRNA 2VLKB 1S7QB 3BP6B 1F4XL 3HI6L 1KLGB 3LH2H 4IRJB 4XP9L 1P7QB 2OCFD 4OGZA 2IANE 1CDBA 2X4SA 1QLRA 3SQOH 3RTQA 4ODTL 5LWYL 1KB9K 3NTCH 3GSVA 3SKMB 5E2VL 2BHZA 4XNMB 4YXKL 1HNFA 3PWUA 5J57B 4NQDE 1GYAA 5IFJB 3DLQR 3L3KA 5ITBH 2NY4D 5GGUA 2NW3A 2XFXB 3RVXC 4OZIA 3X13A 1FNGB 4OCYH 3S5LG 2DBLH 1QFUL 4DCQA 5HGDA 4PREA 4X6DF 2ZUVA 5TE7L 5I0ZA 5GGRY 4YHNA 4NPYA 5I1IL 4Z78B 1ZSDA 4Z7QE 1B0GA 1S9VB 4M6OL 4HUKB 1UKTA 2OL3H 5DI8B 4GAYA 5EFIB 3ZKMD 1LEKB 5DQJA 4MZ2A 2EO9A 4PJFB 1I1AA 3V4PL 3IDXL 4H1LH 3O0RL 1Q9LA 1MFAH 4I3RH 5I2IB 3GMRB 3KYMB 3N9GH 1AO7A 3DVNA 1VFMA 1W0YT 5FGBA 1HILA 1QA9A 4OFYD 3MFFB 3BSZH 3WKMH 2Q3AA 3MR9B 3BZ4B 4KJPD 1H5BA 5IB5B 3MBXH 3SKOB 1ZMYA 5DJYA 4A2LA 4AG4L 2DLEA 2NY0C 3AVEA 4U1IA 1HK6A 1NBYB 4JPVL 4CL7A 1CR9L 1A14H 3GZKA 3RAJH 2IPTH 4GLRI 5SWQB 1W8OA 8CGTA 1AE6H 4HGWB 3W39B 1CIDA 3AGVA 4JHBA 5F96L 3GB7B 3CX5K 4J1UA 3LEYL 3S5LA 5GS1C 4X5WA 5EUOB 2DMCA 4M8QA 2AVGA 4HS8L 2P24B 3JTTB 1MI5E 1IAIL 2BCKB 4PJGB 2EH8L 3QFJD 4M62L 2NX5E 4LLQA 5K59F 1JWMB 3GFUA 4HFUL 1BZ9A 1EGJL 3OBAA 4ENEC 2E8ZA 4YHZH 2DD8L 5IVNA 3MV11 5DMYA 1V7NL 1LK3H 2PF6A 5D93C 1S7RB 4FFYH 1T6VN 3L3JA 2D4FA 3SQOL 4LSRL 5GHWL 2YWYA 5ALCH 1NEZB 1S78D 4PRHD 1M7IA 4X4XA 2O26U 5DD6B 1YJDC 4PJ8A 4AMKL 3QWRD 2Z91B 4OM0H 1FC1A 4A6YB 2YZ1A 5BS0A 3TO2B 4YXLL 2ZKHH 1Y6KR 4L3AA 4HXBL 2NZIA 4MVBD 3CDCA 4RAVB 5KN5B 3GO1H 4RFNB 2A9ML 4P2RD 3L95B 5C0CD 2Z35A 5D1XB 3W11D 2DM4A 4OQ1A 3Q1SL 3QUYB 1IBGL 1QRNE 3O11B 5E00B 3PWJB 1MAMH 1YNTA 1F3DJ 1PYWA 1T7VA 2BVPA 4PJBE 4ISVB 4JFHE 2GSGB 4Y4HA 5DK0B 1W0VA 3TBTA 4D0DA 1G7PB 5I1AA 4LMQE 3GSXB 4KDTA 1LHZA 5DSCA 3MRIA 1KB5A 2XV6B 1G7LA 5J1AA 3N1QC 3MRFA 5T1LD 2X4RA 3ZHKA 3L1OH 2VXVL 2D03H 4OLYH 1H3UA 4JM4L 4HQQL 5E08H 2LTQB 3BP6A 4U4BA 5B8CC 4M7LH 4UILH 4C83A 2ICWI 1QFHA 1AGBB 5EO9B 4IOFD 3LKRB 4LOUC 3BZFB 1JPSH 3BKJL 4MDIA 5JDSA 1K4DB 3T77B 4ACPA 1GSMA 4EBQH 1LO5A 3HUJB 1HINL 4DTGL 1E4XL 4HXAH 1AD0B 5FM4A 5TF1L 4OV6F 3GIZL 5DQDL 2EH8H 4NKOB 2XZAL 4MWFA 1V7MH 4NBZB 4LF3B 4LSSL 5C2BL 1GHFL 3G5YA 4K3GA 4JG0H 3G5ZB 5H37H 1CD9B 4UINH 4D9QE 1IGIH 2DWDA 3A0OA 3QEUB 1CU4H 4Z7UE 5BZDA 1P1ZB 1BPVA 4J3TA 5DYOB 2P44B 3AM8C 1VFBA 3ZKND 5KSBE 4JEGB 4DAGH 4RMVA 2RR3A 2CKBH 2FJGA 3ARDC 1QLEH 1PLGL 4D94A 4X8JA 3STBA 3KNBB 2H8PB 5F1NB 3PGFH 1FYTB 4NUJA 1INDH 1QR4A 3MV8A 5F1IB 5AYUH 5KG9B 4GS7C 1BIIB 1U8IB 25C8H 4JN2B 2GTWB 4Q74A 4O9HL 3SGEI 1FNEB 3QIBC 3QJHA 3S35X 2WWMD 3TESA 2MJWA 1BD2B 1C5DA 3PGCB 3V6OA 5A16B 1B4JL 5J6HA 4GMTL 2V2XB 3W82A 2X2YA 1N7MH 4XXCA 4BSJA 4MX7B 1YNLL 1LNUB 5ADPL 5CZVL 3RTQD 4DW2L 4RFEB 1MWAL 1PEWA 3P9MA 5FO7A 3HNSL 4XVJH 2PCPA 1JF6A 1CXEA 3FQTA 5DA4A 4QWWD 4FZEH 5KTEH 3QFJA 4YDLB 2NNAB 4FZ8L 5HYFA 1G9MH 4N0FB 4UUJA 4HK0B 3MYJA 1MFAL 4M8VA 1D6VL 4WHDA 2WUCH 3C5ZA 3P0VL 2CKBB 2FATL 3PDOB 2HT3C 3IETB 1MIMH 3QXAB 5EOTB 3NOIA 3UBXA 4AYFA 1UM5H 5DHVA 3EJZD 4OJFH 1L9MA 1C12B 3DETD 4PRHA 2VERN 1F8TL 2CO7B 2C3VB 3LVEA 2E7HA 3SKJL 1S9XB 2PETA 5DZLA 5GJTH 5H94A 5I1JH 3CVHA 5HGBA 4JFHD 1WT5C 2BOBA 2IAMB 4MNGB 5IOPB 2BJMH 5F1OB 4Y2DB 4BFIA 4EN3D 4TTDD 1EFXB 4XVSH 5D6DC 1RIUL 4HZAA 1A9BB 4JG0L 3OAYH 1S7WB 5KVFH 3GMMB 1MWAA 2VDRL 4R2GB 5FUZH 2AV1B 5DS8A 1KG0A 1GOGA 1WFTA 2GSGA 4R4NC 1I4FB 4EDXA 1A4JA 5JW4R 1NFIA 1QRNA 1VESA 4G9DB 4AM0A 3IJHA 3W0WA 4UT7H 1ZT1B 3RL2B 3QEQA 2BSTA 5ETUB 1MFEH 1I8IA 2VLME 3MV9B 2KPNA 1JNHA 3EJZC 3L5XH 4TOYL 1NEZG 3BHBA 5CIPH 3REVB 1A6TA 4Y16B 2H45A 1J88A 2AK1L 4YGAB 2VAAB 1ADQH 5C6WH 2H2SD 1VADA 3VWKD 3KPSA 4MD5B 3R8BB 5FDYA 3DIFA 4NNXB 1KF9B 1HINH 4DTGH 2EZ0D 4MB5A 5D5MF 1WZMA 4BZ2L 3G08A 5HPOA 1DTUA 2OZ4A 1IZJA 2H1PH 4EJ1C 3LKRA 1MJ8L 5C07D 2GSIB 2UZIL 4PB9L 2H9GB 1NFDA 3HAEB 4O58L 1MCRA 4HDIB 5I1LB 3OF6A 4AEIH 1KC5H 4PJ9A 5TDPB 3BGMB 4E0RB 2LU7A 1BZQK 1FV1A 4FG6D 3GSNB 2BZDA 1S7TB 3BW9B 3CH1A 4M43H 3QCTL 4DAGL 1YDPA 2AW2A 1NMBL 4XNQB 5FDWA 1D9KA 1QLRB 4KV5F 3RFZC 1OSZA 3MLXL 3SN6N 1WIOA 1OAZH 1XF5A 3SCMB 5MHSD 5C0CB 1T3FA 2IGFH 3QHZH 4FQHB 3BUYA 3RGVB 3Q5YA 4U7KA 2F5BL 1VFBB 5EZOL 4OGAC 4Y4HD 2ZJSL 1XMWA 1J05B 3AXLB 5AAWA 4P3CH 5FB8A 4OIIL 4UT9H 4WO4D 5C08E 4GG6A 1V05A 3I3DA 5HHVL 3D2UB 1NCAH 4HXBH 2IH1A 3RAJL 4H25B 4JFEA 3VFSB 1I8MB 5EA0H 4OLVL 4Y2DC 1RJLB 4Q0XH 1IBGH 5HVHB 1X5XA 2FIKB 4WCYL 1M71B 4HUMB 4P23C 2V9TA 1YMHA 4X4MA 4LASL 1KPRA 4XCYA 3ARGB 3MMEB 4EI5D 4QRPD 4JQXA 1NCCH 8FABB 1W72H 3U7WL 3EOYG 3WDJA 4P5TB 3WJJC 2W60A 3VXSD 3EO1B 4EI6B 4GXVL 5DC9B 4L8CB 3RPKA 2V5MA 4GRLC 1OTUD 4MLSA 5D7LA 1NUDA 3QAZC 1QUNA 4K55A 1EO8L 2VXVH 3K3QA 4TSCL 4BKLA 4LPUA 3TPUB 5F7MC 2NY5H 4P4KA 4PYHA 4UNTA 2V7HB 2W65A 1M7DA 1C1EH 4Y16C 4Y4HC 4OM0L 2X44D 5GGQH 3D85A 4HF5H 2VDQH 3T0EB 1M4KA 2BERA 2HRPH 3V8CA 3VGAC 3BKYH 3VMNA 3GMNA 3IDIA 1IAIM 2C3XA 4FXKA 2NTFB 9CGTA 2A9MH 1I75A 2BJML 3K4ZA 32C2A 1RZKH 1YYMH 3X12B 3QDGB 4GBXB 1D9KD 1CBVH 4CRPA 4ODXA 2GK0A 1F4WH 4OFVA 3VFTB 5HYIA 4R3SA 4LKCA 5A2IH 5F7UA 4NQUA 4UIMA 1A14L 4MNGA 4WEUD 1Y6NR 2YK1L 2A74A 1EMTL 2GTZB 4XBGB 2JTDA 3OKNB 1AXSB 4KY1H 4QGTA 3MV7A 2OS7A 5GRWA 4RAUA 4HUXB 4WI6A 1YECL 5K9QG 4F7PA 1WC7B 4BA8A 1W72A 4JFED 2XPGB 2IFFL 3ORJA 5KSAA 1MFCL 2Y6SC 5I8CB 4MNQD 3OKEB 2A83B 4NQSA 4UQ2A 5BW7C 5IV2A 3H9SA 2BNRD 1CE6A 1S7SB 2B2XL 2X9YA 2AJVL 2J6EL 1BVLB 3QT2A 1I7TB 2PYEA 1P5UA 3SE8H 3EGSB 3MNVA 4YE4L 4DN4H 5BXFB 43CAA 1I8IB 5E8EA 4P5MB 2QADB 3EDDA 2OMBA 2FZ3B 2QHLA 1H5BC 2RIKA 1FFPA 3EYOA 3CSBA 5GGRB 5T5NG 4FRWA 2FR4A 5GXBB 3DX7A 3EIFA 3LQAC 2AXFA 3LQMA 3SEPA 4PS4H 1CLCA 1MHCA 4R97B 5GISL 5HI3D 3P4OA 3GJEA 1CK0H 1MEXH 4U2YA 1F4HA 2XQYK 3VXME 4K8RD 3VCLA 2ZCLL 5FOBA 2DMKA 4PR5B 5I1LA 1L7IH 4GAGH 5DJ6B 5A3IC 3C6SA 3RBSA 1G0YR 3DX6A 1XH3A 5EU3B 3WIHH 4QXUL 5JW5B 3IF1A 5AG8A 3HZYB 4U1LA 2D7TL 1QBLH 2D0FA 5FCSH 1E4WL 1F6AA 1XGUA 1LK2B 4OZHE 5EO9A 3UTPE 4HF5L 4JREB 3IXTB 4YHIB 3NIGE 3KPNA 2X89A 3CZFB 3P0GB 3B9KA 3HI1A 3OPZH 3WL9B 1BFTA 4D8PA 1UYWL 3OKDA 1KUMA 1G7HA 4NWUL 1NMCC 1UXWA 2R23A 4LCWB 2R8SH 2WW8A 4QRRE 1F6LL 2VDPL 4NQCE 3HI6H 1QLEL 3FO1B 4Y0GA 4PG2A 5FK9B 1IE5A 1G7QA 4GRWF 3ZHDA 3GSNL 3O41B 1SY6L 1SJHA 4NWTH 2ED7A 3BSZL 4NQCD 4PRAB 4PGCB 4F37K 1EMTH 3F6LA 2PNDA 4X9BA 5C0AE 1AJ7H 1QFWI 4O2CA 1YN7B 1S7UB 1ZWIA 4KH2A 3R1GH 4YDJA 4Z8FH 1ACYH 3QO0B 4K2UH 3KPMA 4ELKA 3AAZB 1RIVH 3TBWA 4Y4FC 1YQVL 1T4KB 4NKIL 5LGJB 4WHTA 1YMHB 2F9BT 5DZNA 4HFWB 1V7ML 4CAGA 3UTPD 1CFNB 2GIYA 5LXGL 1OOAA 4HPOL 3IDJA 3OKOB 4JPIB 2YSSA 3EO1A 4EI6A 4NUJB 5ICXA 4WU7A 3GK8L 2XT1B 3DGCR 4AENB 2VXQH 1EH9A 5DRXA 2V7HA 2A6IB 4V1DD 4GXUN 3HMWH 4URTB 2FO1A 3RVTD 4GG8B 2LQRA 1YMME 4JO4L 1J0IA 2ADIA 1X6NA 2ADGB 4U1KA 3K7UA 1AQDA 2NTFA 1G9NH 4QXGL 3HRZB 4CN4A 3RZCC 2CK0L 3LEXB 2GT9B 1T04B 1WV7T 2BVYA 4QY8A 2ATKB 1A7RH 1F5WA 3LKOA 3MRQB 4M9OA 3C2SA 2GAZA 3KJ4C 3STZA 1P4BL 2FGZA 5EIIA 2P42B 1N8ZA 4OTXL 1G9NC 3H0TA 4LIQH 4XI5C 1A3QA 4QRTA 4KWUA 2BOCA 3EO9H 1T0MA 1U8JA 2F8OA 1RULL 2B8OT 1YY8B 3ULVL 4YZFF 1ORSA 1RVFH 3BPOC 5GS0H 4Q58C 2CJUH 1MFEL 4CNIB 1HQRA 5D7SL 4P9HC 2Z31D 2PO6C 4OAWA 5T3XH 3QUYA 3S3SA 3WHE0 3ARFB 4X83A 3EDEA 2QQKH 3OJDA 5DVOA 1F58H 1ND0A 1KJMA 4N0RA 5I76B 1DBML 1QEWA 2NY0D 1J11A 1BVLA 1J8HE 3WHE1 3OKKB 4P9HH 2RCSH 1S7XA 4FFWC 2C5DC 1T66C 5DUMH 4DGIH 5C0BB 5J1AB 2FEDD 1CLYH 2EKSB 3K1DA 4LSRH 5GHWH 2N7BA 2EIZA 1G7MB 5CWSB 1KN2L 1MWAB 3ROOB 1K8IB 1PZUB 5GGRA 3MBXL 3UYPA 1HXYA 2VISA 4F9PC 2VRAA 3I75B 2VWEC 2DYPA 5E1HB 5EWIL 3ZDXF 4G3YH 2EYSB 4QXTB 3FB8B 4I4WA 4U0RC 4XC1H 3ECBA 4YHKH 3LEYH 4GFTB 3EFFA 3NGBC 3RWIA 3QH3B 35C8H 1NANI 3FB7A 1MIEL 1Q8MA 3V7MA 5EU6B 3HE7B 3QFDB 2JLLA 1QD0A 5JW5A 1EK3A 4NNXA 4FZ8H 3BN3B 4U31A 1VERA 4HC1H 1BVKB 3IFOB 4UB0L 5IJVA 3C5ZC 1IQWL 3V0VB 3V0AC 2NY6D 1G7JB 5DHVH 4L1HA 4WI7A 2F53A 2IAND 4YHZL 4YUEH 4L3EA 3NCCB 4POUB 3RWFB 4BFBD 4HUWA 1N2RB 1MQKL 3PWPE 3CFIC 4DGVL 3OKDB 4HDIA 4WW2F 2I07B 2OTPA 5IG7A 3QIBA 4GLRH 4X5XA 3MOQA 4W70A 4KUCF 4NGHH 1AXTH 5KSAD 1M05B 3QUYD 4YPGA 2DQHL 2EYTB 4WI2A 5T5NF 3O41A 1SJHB 5HI5D 2DAVA 4LGPB 3L5HA 3KS0H 4JAMB 3BIKA 3TV3H 1DJSA 1LQSR 4RGNB 2YBRB 4UQ3B 2NY1C 3I2CH 4C59B 3QO1B 3QJFA 3W5MA 5DJAA 5E94A 3QUZC 2L0DA 5EZLA 2IPUG 3QHFL 5SX4I 1K85A 2H2PC 43C9A 3RZWA 3G5VA 1F3DH 4P2CG 1IM9B 4QF1B 3I6GB 2CO6B 5CD5C 4MX7A 2AGJL 4APQC 5CEZE 4FQLL 3MFFA 4FOMA 1UM4H 4RGNE 4NC2B 4GT7A 1QQDB 1F90H 2XACC 4RIRB 4XWOC 3SHSA 4NUGH 4RA0C 1OW0C 3ZT7A 1H3PH 3Q6GH 4JM2A 4X9HA 4NO2B 4XZUB 4L3CB 1KSRA 3NFSH 3S8WA 1MUJB 4ODHL 4YAQB 3H9YA 4ZOEA 1K8DA 1D5MA 5MEPB 4KRLB 1X7QA 1KN4H 2H32A 2ZUQC 5HI5C 1QSFB 4N1HB 2UWEF 3MJ9H 5AAMA 4EN3C 4HGWA 1FCGA 2R2HA 4OD3H 5T3ZL 5I71C 2EEBA 1R5IA 2XWBB 4YXKH 3CDFA 3O8XD 1IAKB 2VLRD 4LCWE 3IVKA 2IALB 5E24E 1B6UA 4ZODA 4S1QL 2VSCA 4Q9QH 2OTUA 4M6ML 2OM5A 5F1SA 5IM7B 1A3LH 5ICZA 2YK1H 1YEJH 5BQ7A 2EE6A 4YR6B 3CCHA 3DX8B 2ZWLT 3MREA 4A6YL 2BXZA 3BQUB 3L6FA 4OT1L 4GKSA 3T0DA 2D7OA 1T21A 1NFDF 2R1XB 4HKBA 1G6RA 5DRZA 1VFAB 5E2UH 4NZUL 1J12A 1NEZA 2EDFA 5CBAA 3FRUB 4JM2C 3QPQC 3ES6B 4NN5C 3WDIA 1N64L 3GBML 4PJBB 3I9GH 1CD0A 2ESVA 1QRNB 4G9DA 1EXUB 4HJ0D 1QSEB 2VLLB 3HHRB 3IFLH 1HCVA 2VZTA 3FO0L 2VITB 3RL2A 5J12C 1MCNA 5I18H 4Q9CA 3DSFH 2GJ6D 1X4XA 2HT2D 1B4RA 3RL1A 2K9UA 1OP5K 5I1HL 3IDUA 5FXCH 4QHMA 3WNPA 1QBML 2BRRL 2HT4C 3EAKA 3PQYB 3DIFB 3ARSA 3KDMA 4M6MH 2DYPD 3O6FD 1JGEA 2OL3A 4HWZB 1OAQL 3C5ZD 3FQWA 1M7XA 3OGCA 4FNLH 4LSUH 2YD8A 1CE6B 1S7SA 3TFKD 5T3ZD 2HVKB 3PP3K 4L4VA 4MXWH 5FO8B 4FQXB 1NFDB 2VDLL 1G7LB 4G80A 4HPYL 4XP6H 2E9WA 3DETC 3EFFB 5D7LD 1KC5L 1NKRA 4HJGB 4IRZL 5IB3B 3WD5H 4NZDA 1ZEAL 3V0WH 1A6AB 2UZXB 4N8CL 5C0EB 4OLXL 4PJ9B 5TDPA 3CXHK 3BWAA 3KR3L 3AS2A 2IADB 3V5HA 1K2DA 1WVZA 3FJTA 3WIHA 4A2MA 3OAUH 5E0QA 4WO4C 5KVMC 2CLRA 2EDTA 5DK2A 4P5TC 5KVGH 4POYA 4N0YH 4PJXF 2IAMD 2DF3A 4CVXA 4JFFA 2YD2A 4NM4H 4IRSB 5BV7C 4Z0XB 1E6JL 3KYKH 2N7AA 5KJRH 4I77H 4PJ5B 1S7VA 3VGGA 2APFA 3BPNB 4PTUA 1RURL 3CVHL 1D5ZB 2NXZC 5E8NB 4S11A 2EE2A 3DXAB 1AY1L 1NEUA 4TVPD 4JFZH 4IOFC 2K1MA 1MFNA 2XA3A 3GO1L 3MCG1 4LLAA 3MV7D 3NZHH 3RJQB 5CEYA 2CUHA 2B0SL 4DZ8B 5EU7E 1KIPA 3JV6A 3HI1B 4D8PB 3VWKA 1A7PH 2EE3A 3A6BL 1N5YL 3VXUE 3QEUA 1CFQB 4Y5YB 3BFOA 1INQA 2E27H 2X4OA 2E7BA 4XBPA 5DMIH 4N8PA 5A2KH 1N7ML 3GJFA 1T1XA 2ESVE 4TSAL 1G7QB 3TZVB 2VXSH 3CX2A 1UWGH 4IJ3C 2V5RA 3AB0B 3HG1D 4P5TA 4PUBH 5EZIH 1YEHH 4LLYB 3ARBA 3GKZA 3PIQB 1CDUA 4WHCA 4E42B 5IW1B 3LS4H 3QCVH 1UM6L 1YY9C 3IDMB 1HHHA 2EIBA 1OD9A 2YS4A 1KN2H 5I75C 3G9AB 4DUVA 4LLDA 1M6OA 1EFQA 4PJDA 4P4RA 1UM5L 5HHQA 1R24B 1D5MB 3DNKA 1AFVL 5EBWA 3HZMA 4PY8J 2XA8H 4F9LA 1LP9F 1VGEL 5MP6L 4NRYA 2HJKB 4HWBA 4HV8A 4M02A 1MRFL 4P2YA 3LQAL 4IDLA 4HIHA 3WLWD 1G6VK 3ZYJA 1JUFA 1XCQB 4KROD 3QIBD 4JFFD 2ITCB 3SDAA 2FHBA 4UZGA 3ULVH 2GKIA 5C6TL 3TC9A 4EQ2A 2W1NA 4JHWH 3VH8G 2NYYD 4U1KB 3WN5C 2ZNXA 1TXKA 3H42L 4B41A 5CD3B 3REWA 1RZ7H 4DGIL 1TZGL 3C9NB 3QA3B 4Y8DC 1KT2B 2D0HA 3MNWB 2Y36L 4RBPH 3QG7H 3QIWC 4H1LA 2KZ1B 1Q94A 1F4YH 4M7KH 4GW1B 4Z7QF 4F37F 3N1FC 5HGBB 4LBEB 3ILQC 3WN5A 4CVZA 2NX5A 5ALBH 4Z95H 3CLEH 4KTDL 3U46A 4PJ7A 6CGTA 2J5LB 4OFDA 2EDNA 1GZQB 5IESL 5C7XH 1UKQA 4I0PA 3HG1A 5KS9E 3CFEB 4ETQA 4H20H 3HCVA 1LO3L 1SMOA 5JO5B 3LN4A 3ARRA 4KQ3H 5E5MB 3EW3B 2APTA 4OZHA 5JLZA 3TH2T 4BM7A 1SYVB 1QVOB 4HWZA 5HDLA 4HCRH 5I76A 5IEHA 3IXAA 4OB5L 2B1AL 3P4MB 3RRQA 1KTLB 3S37L 3OKMA 2XXCB 5JHDA 3RWCB 1DBKH 3QFJE 3HE7C 3UCRA 3QPXH 2WZPD 3D39B 1T7ZA 3MRHA 3PUCA 3X17A 3PQYE 4ZAKB 1INEL 1NLDL 2KUTA 1NGQH 3K74B 4UU9B 1F58L 3LQZB 2AERT 5CSGA 3S96B 1LK2A 1XZ0B 4MQXC 1JHTA 4PJAA 5I8OL 2GITB 1BFSA 2N4IA 2H9GA 4OSUL 4X4ZA 3IDNA 4IIQB 4MNQE 5JUEH 1YC7A 4LVHB 3IRPX 4Z7VF 4XHJC 4IRSA 4X0KA 3CK0L 4OD3L 2VDPH 4U6VL 4U6TA 1I7ZA 5D1QA 2AABH 4QOKE 4H8WH 3V52H 1TQBB 3VI3F 3E6FB 3ARED 3BXNB 5JW4Q 5DJ8B 2BFVH 2PYEE 3O4OB 1HHIB 2I9TB 5IHUL 2PYED 5E8NA 4NQED 3V0VA 2NY3C 2EEAA 2DQDH 3NH7H 4QOKD 3MLTA 5CIPB 3OTTA 2DM2A 4KV5E 2HFGH 4UT6H 5BV7L 5KANG 3RPIB 3P2TA 1RZIB 3FMGH 4QXUH 1FG2A 4U0QB 5DEGA 4KMQA 5HDQL 4YHPA 4YEEA 1KPVA 2VDMH 5IQ7H 1IKNA 4ELMB 3BUYB 4JFYA 2L7JA 1BJ1H 1H15A 3DWTA 5I1GL 1RUQH 2KZWA 4LCUB 1WLHA 4FQPA 4V1DA 1Q9LB 3ALWA 3QRGL 3C08L 3DUSA 4NQDD 4XP1H 4IMLA 3SJVD 1X5FA 3OPZL 4JAMA 1F90L 2O5ZH 2QKIA 2ORBH 3DROA 4WU7B 5ILTL 1I8MA 4HWEL 4BK5A 2XN9B 4GRWB 1IFHL 4OCWL 3U9UA 3AREC 1IGML 3IFNH 5DJAB 5E94B 3QP3A 3FN3A 1OARL 1U3HC 1DEEB 4JFEE 4PJDB 3C5JB 5DTFA 4LVHC 3OL2A 1IC1A 1NGPL 3EYVB 4JJ5B 5EN2B 2CKNA 4NKMB 4ONOA 4GG6E 3E6HB 5DD0H 4JKWA 4TNVF 2EXYD 4IRJD 4LKXA 2XWTB 1CCZA 4HG4K 4JHWL 1FL3B 5ERWA 2Q8BH 5F9JA 4LCIL 2GT9A 4QY8B 4KI5E 2NY1D 4O02H 2J4WL 1OY3B 2R2BA 4J3UA 4F9PA 3I50L 3ZTNH 2ITCA 4C56D 1WT5A 3D5OF 5LQBL 2ZSWB 1XGQB 3O6LL 1RZJC 3WFBH 5JTWA 1K8DB 1ZT4A 2IC2A 1YEDA 5JPNA 3T4YA 2LVEA 4PGBB 1NUFA 1P5VA 4WWKC 2VR9A 2R4RL 4HBCL 4N0YL 3L7EA 5ILTH 12E8H 2HN7A 4GKZB 2QADC 4PV8A 2UV3A 2CRMA 4MYWB 3PV6A 1IGYB 2W91A 3THMH 4XRCB 2B2XH 5EU5A 4EUPH 2FYYA 2GK0B 3MLVL 5EIVA 2WANA 2AJXH 1U8LA 3DO3A 1X5HA 3TO2A 1BJMA 3G04A 4W4NA 3QZWG 4CVZB 5ESVB 2DIJA 3FRPA 4NFDA 2CIKA 5TDNA 4TVSa 1RZKL 1YYML 3WUWB 2PXYA 1FFNA 3MV9E 4N90E 4KHXH 4NQVB 4APQA 3E1F1 5KVDH 1J1OH 5C8JA 1VFAA 4QKXB 1GC1L 2OJZH 4ZFFA 4OTXH 1FZMB 1R3JA 4MXQC 1NC2A 2Q7NA 5LQBH 4MCZA 3U9PH 1UA6H 3X14B 4QT5A 1AC0A 1NLDH 1C7TA 3GMLB 1PZ5A 3QWQB 5IEHB 2G75B 2LVCA 5I1AB 2DI7A 5KOVC 4XMLL 5D7IE 4K3EL 5BV7B 4OZGA 5JIHA 4QRRA 1RJZB 1OAKH 4NO5B 4BFEA 3TCLA 3OF6D 3EOTL 5TGBA 3O6MH 5IW6A 4JM2D 4YFLF 3TPKA 3EDFA 5HYJB 4KFZC 4B5EA 4JRYE 4UU9A 3NIDF 1IQWH 4F8TA 4IOIB 3HI5H 2FJHA 4GH7B 2R56L 1FVCB 3LV3B 4U33A 2AXFB 2W9DH 5E7BA 4XCNA 5D71L 2V6HA 4ZPTA 3NPSB 1YEIL 4X7FC 4WTZA 2WMPA 4ORGA 2EDQA 5F97E 3WNKA 4Y1AA 3VCLB 3CZJA 4Y7MA 2ADJA 1OWWA 4RWHA 4M5ZL 3MUJA 2FB4H 4LQ1A 4BELD 3ZTNL 4U1JB 5F7DA 3SBWC 3ARDD 3ARGC 5DUPH 3BJ91 4MA3A 3H3PH 3ULVF 1QBAA 1UFUA 1CU4L 4NO0B 3FKUS 4MB4A 3G5ZA 2YN5A 1RZFH 5HI4C 2EDXA 4F7CB 3EFDH 1DLFL 3NN8A 3WS6C 3ARXA 3L7FA 4MDJB 3MRLA 5IVXB 2E9IA 2ZPKH 2FX8H 4P3DB 2DRUA 1KFAH 4I8DA 1FDLH 1ZHNB 1EHLL 2ZKHL 4OZIB 1NC2D 2KBGA 4XTRD 5IJKA 1FO0H 4G8EB 4YWGH 5IR1A 3W5NA 1AHWA 4RRPA 1IM9A 3BVNA 4FQQB 3HZVB 1JHLH 4KU1A 4OQTA 4PGCA 4PJEA 5ABDE 1XF2A 5I8EB 1MQ8A 1BWMA 1KELH 4AZ8A 1MCWW 3MX0A 4YHNB 2Q86A 5EZJB 3SKUD 2CD0A 1T1YB 4OD2B 3SO3C 4E41B 1NJ9A 5GS2H 3MZTA 3CPLA 4KKLC 3ABZA 3TZVA 1FVEB 5A16A 3VFOA 3GHEL 4XB7A 1BIHA 3S36H 1OGAB 4WRLA 3HNVH 4QHKJ 3MJ8B 4LMQI 3HFML 3VXQB 4G9FB 4PJCB 3P9MB 2BVEA 3MR9A 5FO7B 1U3JA 5BMFH 1S5IL 5CJ5A 1QKZL 5IFHH 5IVZB 5B3NA 1I1AD 4M6NH 4LFHG 2O5YH 5C0AB 1MH5A 3V6OE 2Z92A 3DX9B 4G42A 2QLVB 1YEEL 4MA8H 2JB5L 4QWWC 5JNYA 4M5YH 3GMPB 4XNUH 2GQHA 5SWQA 1G9MC 4KKCC 2DICA 3BDBA 4N0CD 1KCUH 5DRZB 2X4NA 5T1KB 5BO1L 4H20L 2FYYB 4KJPC 4WJ5B 4M5ZH 3VWJC 5ENWB 2P24A 3JTTA 3MCKA 1U8LB 1JYVA 2DDQL 5ID1B 2J2ZA 1IL1A 1FO0B 1IC5H 3ZYIA 1CLZL 2CIKB 1MCPL 2P8MA 3QI9A 3D48R 1FZJB 3UJIH 3LQAH 5HHPB 2AJSL 3HPJA 3VDCA 3NABH 1J1XH 1EJ6A 2IPUK 4PP1C 3RUGB 1HE7A 5KTEL 5I1CL 3NZ8A 1L6XA 2C1OA 5DS8B 4OCSH 1DVFA 3ZDZE 1CXKA 4NNYA 4XI5D 4F3FB 2X1XR 4GW1A 1A4JB 4P2OB 2HT4D 1SM3L 1CFSA 4I18C 2BHYA 4MNHA 1NCBL 2BVOB 4XP4L 2G5BA 5FYLH 1DQQB 4BH8A 2CSPA 1N26A 3QBTB 3GSQA 3TCLB 5T33H 3FFCB 1SBSH 4F7EA 5D8JL 2E5EA 5IQ9A 4WDIB 5HHOB 4KZDL 2HFEA 4I77L 1DBMH 3C60C 3WLBA 3VD3A 3HAEH 1Y0LB 1IEHA 4PJIA 3WFDH 3AFLA 4ZPTB 3N85H 5GGTH 3D3VB 3DVGA 2X89D 1TENA 1TVHB 4IEFB 4IDJH 5BJTA 4PRPA 4P5KA 4LCIH 1KNOB 1FNSH 2P5EE 3U36B 4Z6AT 5B38A 5DFWH 3O3AA 1J18A 4YBQD 5LJYH 1QPPA 4NBXB 1D5ZA 4LSUL 4HS6B 2J7LA 3V6ZA 1D9KC 4PJEF 3PWVA 1AGBA 3BIBX 4XP4H 1YDPB 5HGDB 1F6FB 3IDYC 2CIIB 2NY4C 4DEPB 1FJ1B 2RFXA 3S35L 3ARYA 2NY2C 5LGHH 1AQKL 1MHEA 2CKBL 1MHPL 3L3OB 3ZE2F 2NY7H 5DGQA 2EDRA 1NSNH 4EQ3A 1MLCB 3BDYL 4JY6A 3RKDC 1T03H 5SV4A 3TF7C 3GIVA 4GQ9L 3QB7C 1ETZB 4PJCF 4MMXC 5DUML 4NM4L 5ANMA 4P4KC 2HJLB 2ICES 2OTWB 4DJMA 5JIIA 1RZ8B 1LWRA 1KPUB 2Z0BA 4Z76A 4ODSL 2ZUUA 4PRPE 5BW7A 4F57L 1OAQH 3NH7L 3G6JB 4TULL 4WENB 2VH5H 1R24A 43C9B 1N3NB 3GEWB 5IMOA 2OK0L 4HXAL 5BZWA 3P77A 2W07A 5EBWB 4LEOB 5IT2L 4WUUB 4MAYB 1K6QH 5T1LA 5I17B 2I5YL 1BIIA 1U8IA 1HHKB 4FTVE 4QRSB 3UAJC 4IIQC 1J8HD 1E28A 1XCQA 4MJID 2WM0A 3H9SD 1DSFH 4LPVA 3SE4A 3VFUA 4UDUB 3FQUA 4RZCA 1C5DB 1NGWA 1T89A 1IGIL 3B6SA 1RZGB 3WFHA 5HHVH 4MJIE 3WUWG 2J8UE 1JE6A 1IILE 5KVGL 5C08B 4RQQB 4U6YA 4WFGD 3EKCA 3PP4L 3OJMB 4XMPH 32C2B 3KXFB 3R1GL 1WAAA 4AMKH 1P7KB 3FCTB 5DD6A 4YXLH 3IVKB 5A2LH 1NCCL 3E8UL 1MJ8H 3FFDB 5DQ9B 1JZ5A 4JFFE 4QNPF 5DJ0B 4HK0A 1V3JA 3W9EA 1A1MA 4KMLB 2X4TA 2Z93B 1FO0A 4PLJD 2DN7A 1RMFH 1TCRB 4RSVA 3U46B 5AWNH 5KN5A 1VGKA 4HIEA 4YK4B 2ITDA 3MRGB 1BQUA 1LO3H 1CIUA 1C5BL 4MJ5A 5JXAL 5I1DA 5F7HA 1JPGA 3VXNB 1W72B 3EYQC 3MUZ1 5GS1B 4L9LA 1INEH 1AQKH 3B9EA 3FQNB 4UT7L 1QO3B 3QUKB 3DVFA 2XTLA 5DLMH 5KSBA 4WO4B 3QXVA 1CFSB 2AK4B 5L8KB 3C87A 1FL6A 2AI0L 4Y2DA 1ADQL 3BGFC 3VFMB 4PJAE 2G5BB 2C1PB 4K3JL 1DQQA 2AJZA 3MA9H 4JFDA 3D39A 3O4LE 2BSRA 1CXLA 3ESVF 1JWSB 3GM8A 4NOFA 2WUCL 4DKFL 1JTPA 3SDXA 2FHCA 4QHMB 2F8VA 3SDAD 4JB9H 3TIEA 4RFOL 2FBOJ 1K3IA 4YDKH 4XVTH 4K7FB 3NA9L 1I4FA 4TPRH 4EDXB 3FQWB 4MJIA 5A43C 4CW1A 5TE6L 2EE9A 2DWEA 5HVHC 3DRQA 3MLRH 1MFDL 5EC2B 5IB4B 1Z5LA 4PJHF 1ZT1A 3NCBB 5E2VH 1AP2B 1NAKH 4M1GH 3QR2A 3QDMB 1J1XL 1EA9C 5IBLD 4AY0A 5GS2D 1A6AA 3VFNA 2ZOKB 3O6LH 1AE6L 2VXTH 3VD7A 1FVCA 3LV3A 1JN6A 5EUOF 3VG0H 2H2PD 4MWFB 4OI8A 1JHKH 2CLRB 1T0NB 5L0QB 4KKBD 2BNQD 1DDHA 2EDEA 1IAIH 1A1OA 1C5CL 1WGOA 5EPMA 2GJJA 1HH9B 3K0WA 4JZNA 2DWDB 3JTSA 3BWUC 4LNRB 1J7VR 3TCXA 3E2HC 1AI1H 4OKVB 3F12A 3TBVA 4OGYL 4UBDD 3Q6FA 3BP7B 2OP4H 4AK1A 4PTUB 5I0DA 5JDJA 1WAAF 2HKFH 1UKSA 1TZIB 2EYRA 1NAMH 2H3NA 2AAVA 1ETZA 3LB6D 2H8PA 4CVWA 3RIAF 3RUGF 4H0GA 3NCJL 4IRJC 1RU9H 4EN3A 5TPWL 3K2UH 4U1MB 5B8CA 4S1SH 1CD8A 1OGTB 2MWCA 1T80A 5IBLC 2AXGA 4RDQF 3D39D 1MFCH 1T3FB 4OFKA 3BEVA 4U3CA 4PJ8D 1S9VA 4YHMH 2AV7B 2V2WA 2BVUA 4NFBA 4TQEL 5ISZA 2W0PA 1Z3GH 1T1XB 4C56A 4PJFA 2J1KA 4WGVB 1MI5D 5C0DB 3P77B 1RSFA 4G8EA 3MACH 2EDHA 1GGIL 2XWJB 2AI0H 2Z8WC 5FYKE 5F9JB 4HMDA 3G5XB 1I1CA 5ISZE 5EBMA 5HHNA 5DC4B 1K4CA 4O00A 2EXYC 1BFVH 2HWZH 3UTQB 3P30H 3VXMA 4WEBH 2E3VA 1E27A 4H26A 4ELMF 1FO0L 3W0WE 1BBJA 1FYTE 3C08H 3QRGH 4ALAH 4ZS6C 2GFBB 1NCWH 4K3DL 4POZC 1VCAA 3JUYA 3BESR 1KGCD 4Y1AD 3ARZA 1OW0A 3GB7A 4J1UB 5BRZA 3S5LB 4X80L 2A6DB 3VGHA 1SBBA 4XRCA 1IGJB 4ZQKB 3TT3L 1W8NA 5DQ9A 5CINH 2VLMD 5EIIB 4R4ND 3KYAA 2YD9A 4OZ4B 4CJ0A 5J1SC 1QG3A 4GXVH 5FUOH 1S9WA 5CJBA 4UT6L 2YUWA 3QNXB 1IKNC 1HQRB 5D5ME 4P23A 1ES0A 4OBSA 1WZ1L 5T1KA 1R5VB 4YLQT 3PL6C 5A1AA 4X4XB 1DSFL 4J3VA 3MO1B 1MJ7H 4J3XA 3EYFB 4MCZB 4KK6D 2R9HC 2VC2H 4M5YL 2OYPA 1D3CA 2JB5H 2W9DL 3H42H 3JSSA 5CGYC 3S97C 4OZGB 1CTNA 4GAJL 1YEGH 4PY8I 4OLYL 5GGVL 3IFPA 4KI5C 2JKXA 5IMMB 5E9DD 5MEOA 2GHWB 4AQ1B 5KSVA 3T8XA 1RUAL 1YJDL 4N8VB 3PWJA 2BXYA 1D5BB 4J3WA 3F8UB 4E9LA 5D71H 4OZHB 5JLZB 1EX0A 4G7YL 4D9RD 4EI5A 3P4NB 4NP4L 4CMHB 1IEBA 5D9SB 2M26A 4OFYA 2NY6C 4YDLC 4G8IA 4NNPH 1LDSA 4U1GC 1MF2H 5DUPL 5K9KA 2R0ZH 3QI9C 2CRYA 1OD7A 3MV8D 5FO9A 3T1FA 2P7TB 3U4AA 2FB4L 4PP1D 3FN9A 1MCOL 1NBQA 1F45A 1CICB 4Y89A 2NY7L 1KLUA 3D25A 3VWJA 4FQIL 1Y0LA 4L8SB 5F7DB 3PXJA 4JHZA 1FV1B 3MRRA 2YPLB 3DMMC 4P9ML 2P8PB 5F7EH 2BSSA 4OLUL 1EHLH 2I27N 1HN1A 4MAUL 1BAFH 3RWFA 5MEQA 4G6JL 4GS7B 4TNVK 3WMSA 3UROR 3P0VH 3JWOC 4PLOB 5ITFB 1IM3A 3MXWL 1BBDL 1NGXA 4P23D 1F4YL 4JZJA 4M7KL 3KPRD 1WAAE 3O6FC 1KJ2B 2DQUH 1RFDL 3ZKQD 1WIPA 1OSPL 2DKMA 5FM5M 4NKOA 3IU3A 4ONGH 4XPBL 5FHAH 5ADOL 3MLTB 1DUZB 3G5YB 4LRNH 5TE7H 4EXKA 1UZ8A 3D69A 3UTSB 3TWCL 4ORZC 5TQ0H 1QR1A 2AQ1A 4WHYG 1CT8B 5E95B 6FABH 2V2TA 5I1CH 2JCCB 3HR5A 3L3HA 2IFFH 3RNQA 1P1ZA 2X4PB 4TSAH 4JFYB 1DQTA 3I02B 1U8OB 5FK9A 2HRLA 3DPBA 2VIRB 3PWLA 5EZIL 1L7IL 3GIVB 3TBSA 3BN9D 5IBUG 1CI5A 3AMLA 4X7TB 3UBXI 1P6AB 2IG2L 3GNML 4P2RB 3RY6C 3ZKNC 4FFZH 3JV4B 4FZEL 5HGGS 5JORA 1C16A 2CR3A 2OJEA 1NCTA 4KK5C 4P57A 5E6IB 2DLIA 3SKNB 2WSKA 1FGNH 3QIWD 3H7BA 4P4KB 4RWYL 3TJEL 3GSWB 4G8GE 2HFTA 3H3KA 4Q7DA 4PGEB 5E56A 2IMNA 1NDGB 4K23H 5CHNB 4ZS7H 4XVTL 4Q6IC 4OJFL 2FSEB 5F6IB 5IMOB 3P4LA 4XP5L 4J8RA 2C4XA 3A6OA 5L8LB 5FUCE 4PJFE 5ERWB 4L5FH 4WW1A 1ZVSB 2GY5A 2PUQT 3TIDB 1I7RB 3RDTB 3BGFB 5HI4D 2DBLL 2F58H 3L9RA 5C3TA 2F74A 3BX7C 4TYUA 3WCYA 1IQDB 3QEQE 4UUJB 4NN6C 5JPNB 4HJ0C 3QISA 3L6FB 2FRGP 1YECH 3OSKA 4F7TB 1ZS8A 4TRPL 2FCBA 4RAUB 1MJJA 3UJTL 4Z9KB 4KKAC 3BZEA 3B9KD 3ROLB 5EOCH 1X6LA 2DTMH 3MROB 1KIQB 1JPTH 4NT6B 1XF1A 1A6ZB 1TJGH 2YHGA 3CUPB 1BVZA 5HPMA 2VLRB 3O8XB 3FFDA 4NNYB 3STZB 3MBEA 3CFBB 1WITA 3UTTB 4G9FE 4PB0H 1OT2A 2FH6A 2NY3B 5HJ3B 3VI3E 4WUKL 3MXVL 3KPPA 3TO4C 1UVQA 2ZJSH 2RB8A 5TE4H 5I1DB 1PQZB 4ZFGL 4BZ2H 4PRHE 1FFPB 4E41E 5CJOH 1I1AC 2XICA 3SGJC 2OL3B 3DXAE 2D2OA 4MXWL 3SPVA 3VD4A 5FA4B 2J88L 3M07A 4WO4A 4PLJC 3GJEB 3W0WB 4XP6L 4X7CC 2NYYC 4OCXL 5I1KL 3DV4A 1I1YA 3BZ4A 4JQVA 1GC1C 4NKDA 1WZ1H 1WBXA 5HD8C 4BFGA 1JWSA 3EBAA 1H5BB 5IB3A 1G7MA 5CWSA 1FFQA 3RHWF 3OB8A 3RWDA 4PRBB 4XP9H 4MD5A 4R90L 4PJBF 4PJHA 3VXUD 4IOIA 3TA3A 4U6XA 1LMKA 3RP1A 4ZTOH 2IADA 3V5HB 4G6AD 4FQLH 4CW1B 1XGRB 1I9IH 1KCSL 5EU4A 2GSIA 4LL9A 3OX8A 2YEZB 3CK0H 5HXMA 1U9KA 3WIFB 4W4OC 4YO0B 5CAYB 1JJUA 1SY6A 4XNXH 1J0JA 4PJGA 4J7RA 2FLBT 1NGXB 1DFBL 1WJ3A 5E6ID 3HLAA 2VLKD 1OPGL 4YDIH 3QUMA 3OZ9L 1BOYA 5IFJA 1AGEA 4QXGH 5GGUB 3WXWL 4ZUVB 5CJXC 4O2FB 5HVWA 4RAHA 2OK0H 5CKGA 2W0KA 1NMCB 4FQ2H 3B5HA 1UZ8B 3MBED 3OG4B 1WTLA 3QPXL 4IRSC 5D2LA 4Z8FL 1OSZB 2IMMA 2YA2A 2W9EL 2IQ9H 3GKWL 2UWEB 4LSTH 1KJVA 1INQB 1YEJL 1ZLSL 4XBPB 5IG7B 2FNBA 1CLOL 4OCMC 2X4PA 2I26N 4OKVA 5BS0B 3L3DA 1J8HA 3I6KB 1U92A 1H3WM 2JE8A 4PJXE 1CFNA 4C54A 4P3DA 3IJYB 5T1MA 5CJXA 1WCQA 2AEQH 1LEIB 3B2VL 4UTAL 4G6MH 3M1BA 3OKYA 1P9MC 3L95A 4JRWA 2QR0A 4KKBC 1OQOA 1W0WA 5F7FA 5IGXH 5FYKL 4HW6A 3BD3A 2A6KB 3Q6GL 1NL0H 3VFSA 1ITCA 4XMPL 1HHKA 3T3MF 5LGHL 5EZJA 4ODHH 4UV4H 1T22B 5T1DH 2UYLA 4MQSB 1FAKT 1T5WB 4M3JA 5J11C 4MNQA 1KXVC 3ARWA 1G7PA 4RMTA 3QEGL 4YH6A 1OM3L 1T20A 3QEQD 4U3HA 1T0PB 1KYOK 1NLBL 1UB6A 3D6GA 5C08A 1LD9A 2PTUA 3DBXB 2JIXA 4IDJL 3LKSA 2HJKA 3HNSH 2E27L 3JVGA 3I50H 3FRPG 2DLTA 4LCYA 4RIRA 1WICA 4BKLB 1EUTA 4L9LC 2RAMA 3LS5H 1UC6A 5J0BA 1O7VA 3RZCD 4OM1H 1QSFE 4YFDB 3MLZL 1LDPH 1U42A 4YAQA 3UJIL 3HC0B 3AMKA 5INCA 4DEPC 4MLIA 1DBAH 1RQ5A 2X70A 5ESAA 1U8JB 1MRCL 4HIEB 4HWNA 2OL3L 1BEYH 4APQD 5BMFL 3QG6A 3MUGA 4ODVL 5DO2D 5MHSE 3T4AB 4RMWA 5CSBA 1H0DB 3QEHA 1FBIH 1KIQA 4OQTL 3HG1E 3HMXL 4HUVA 3LHPH 1MCKA 5FGBC 5K9JH 3P9LB 4WV1A 3LN5A 2JJSA 1OTTD 2A9NL 4CADA 3PNWB 1MCBA 3WN5B 3MREB 2PR4H 4L8SC 4FQJL 1JF5A 2APVA 4TUOB 4XBGA 3VFMA 1V5JA 5DDHA 1O5DT 4AQOA 4XX1G 1NCDL 1XGTB 3AREA 4ZYKB 3VXRB 1JV5A 4P2QE 5GRXG 4HEME 1U8NB 2Z31B 2P5EA 2X40A 3H3BC 1UGNA 4ZFZA 1KV3A 1KCVL 4NQSB 2B0SH 5F88A 2XN9E 1DQJA 2PW2A 4MJIB 1UEMA 4HMCA 4UAOB 1ZGLP 2BDNH 2LAGB 4YHKL 1OT1A 2CH8A 1NGZA 3V0WL 4YBLB 5JHDB 4JN2A 4CUCA 1BAFL 4JFXB 1C5CH 5T5FH 4PGDA 1LVEA 3TJHD 3QH3A 2L7UA 3CIQA 2HMID 3TA3D 4ZUWB 3QWOA 2O5YL 3VGAB 3T3PE 2VC2L 3MRCB 3BPLC 1WZKA 4MXVF 2UVFA 4JR9L 3RZCA 5FYLE 1JNNL 3LB6C 25C8L 4PJ7F 5E8PA 1N4XH 1SYSA 3CFCH 4G80B 3JXAA 2AQ3A 3IGAA 3JTSB 1RUPH 4R26H 4QTIH 1KNOA 1KTDB 1MLBA 1MRDH 1UB5B 3QDMD 4M7ZC 5LBSH 5ID0B 2VLKA 4GRMA 3FT4B 1A1NB 1ZLWK 2XG4A 3NA9H 3SGEH 3NZHL 1PKQB 3BP5B 4M00A 3ULUC 2F54B 3RGHA 4NQXB 2ZUXA 4QCIB 5AWNL 3Q5OA 3IXTA 2ZOLB 2OI9C 4ZUSA 1KB5H 5C07E 4KMTL 5ESQA 2CRIA 2Q1EA 4Y2OA 2UWEA 3GUTB 4Z0XA 5IIEA 5IW3A 4XGZB 1XEDA 4HKZB 1E0OB 4HKJA 5EZLB 5DD3L 1CGVA 1MCIA 3DMMB 1XF3A 2Z8SA 4JM2F 1LEIA 5E6YA 3M1BB 4BFIB 2PYFA 2UY7A 4IBLT 1RJYB 3QDME 2N56A 1FNGA 3RGVC 5JA8B 2FBJH 2HJLA 4YQXL 4RMQA 4ERSH 1Q0YH 5DD5H 1EHAA 5HVFB 5CMAA 3LY6A 2V5SA 3AU1B 4ONFH 3STLA 5BRZD 2UYLB 5FGCE 3MJ9L 1FE8H 1JL8A 2DKUA 3MV8E 4XPFH 4CBPA 3NFNB 4XPTH 2VQTA 3H3PL 5ETUA 5HYSA 3Q1SH 4Y4FD 2HYMA 4HK3J 3VFWA 3KYMA 3GMRA 2VZSA 1LD9B 1PEZA 2QQQA 2EDJA 4P46C 3HRPA 3AS1A 2ZUTA 3K2UL 2QSCH 1XIWA 1A7QL 1HSBA 4XCFH 5BVJB 4LIQE 1LO2L 1YEFH 2AKRB 5DUBA 1IGTA 5CINL 2F5AL 3U1SL 3QUXA 3G08B 1NC4D 3O2DH 1JGUH 3ZSTA 4UBDC 2GJ6E 3EOBB 4JFPB 1YN6A 1DLHA 1UWXH 4LVNB 4QYOA 4NYLB 2HVJA 1I3VA 5GIRB 3MRJB 3ARBD 3DX8A 3FOMA 2CKBA 3PDOA 1FYTD 1V3LA 2IH3A 5GZND 4LAJH 3NAAH 4GKNA 1RZJH 4WUKH 2OXHA 4FQJH 3W39A 4DZBB 5CEZL 4P2QD 1FVDB 2AQ2A 3FRUA 4TNWF 2C3VA 5ISZD 2ZUYA 5LBSL 4M8QB 3SGKC 3SDAB 5H94B 1SJEA 4M7ZB 1JP5A 3L3IA 1F11A 1QSEA 4KY1L 4ZSOE 2VUOA 3H9HA 2VDKH 5J6GB 3OXRA 2F19H 2MPAH 4JKPL 4J3SA 4C57C 4P46D 1MCDA 3O4OC 1FFNB 2B7DT 4EEEA 2VXUL 2ZCKL 2B4CC 3FAXA 2XNAB 5C3LD 1S8DB 3BPLB 3AS0A 4AL8L 1GIGH 2DL9A 2VJXA 4PV9A 1NFKA 3NCYS 1SM3H 3X11A 1ZLVK 1KGCE 1ORQA 4CN6A 3DV6B 4PRIE 4QRPB 2G75A 1AGFB 4X6FB 3I2CL 1YMMA 3OKKA 1N5AA 4FMKA 3P0YH 4P5TD 3OMZA 5C0BA 5T3XE 2V5YA 4KKCD 1JNHB 1N6VA 2ZSVB 2X7LA 1EFXD 5C0GB 5TGBB 2YRLA 1HQ4A 3ZE1E 2VAAA 4NDMA 4JDVA 4ZUUA 1EV2E 3V4UL 4PJXA 4KQ4H 1UJ3A 4M03A 5C71A 5T1DL 3BWAB 3MRBB 1NCUA 2PO6B 1GGCL 5J1TC 5CEZD 4XVUC 2W60B 2WP3T 3WE6B 3CSPA 2NLJB 4XT1C 1UJTA 4JJHA 2AABL 1KBGH 2Y06L 2Q8BL 3RTQB 2I9LB 3QXUA 4JG1L 5TQ0L 2Y1VA 5L9DH 4HH9B 2BNUA 5J8OA 3JZ7A 1UCBH 5GRJL 4P2QA 5CGMA 2KQNA 5L2JB 3LQZA 3ZO0A 3IAGC 1BVKA 3O2DL 4NP4H 4HIXL 1Q72H 1WZLA 4Y19A 3EYUH 3DHJA 4KVCH 3BW9A 2W0LA 1DQML 3EJJX 2R39A 5H2BA 3P11H 5FYKU 1L0XA 2YEZA 2PTTA 2NXZD 1NMAH 4LCCB 2M1KA 4M6OH 1B6DA 1TNNA 2Y7QA 3W2DH 2GCYB 1H8SA 2K7PA 1HOCB 3C09C 4UDTB 3O9WB 2ICWA 3MLUH 2C7UA 1RUQL 3MGAA 4RWYH 3WJJA 4I2XB 5HHMD 3OR6A 3ULSA 2EDLA 1JYWA 4KHTH 1AGEB 4OZHF 5FIEA 4DOHB 1T1ZA 4NRZA 2O61A 1FFOB 2NX5D 1HHJB 4X9IA 1PBYA 3CXHJ 5JXEC 1MOEA 2H32H 3IDMA 1ZA3A 1KJ3L 4Y5VA 1J5OL 2FDBP 1U3HB 4B0MM 5CILH 4JZOA 2Y23A 3GSWA 3BEVB 5ALBL 5L6YL 1A0QH 4E41A 4L3EE 4XCYB 4G7YH 3G9VA 5BOZG 4K8RL 3QYCA 5GS0L 1DN2A 3JWDL 3A67H 3FQRA 4OLEA 1A4KB 3CSYB 1RY7B 4PY7A 2G2RB 3B3IB 4X6DA 4M6AA 2J4WH 3GSOA 1IC7H 1TJIL 5F1IA 4ZDHB 1R3LA 4R0LC 1T2QH 2IGFL 3KPRA 4KGJA 3GRWL 2V5TA 1TTGA 5JHLL 3A6CL 2F74B 3VXUA 2IQAB 4KK8D 2LV4A 4KDVA 4GRLD 3JWOH 3DO7B 4QYOB 1FIEA 1N59A 3FMGL 4Z7WA 3EYVA 1JGDB 5DJ2A 2CDFA 2OR8A 4F7TA 5E6ZA 1DN0B 3BD5A 1GRWA 4WGWB 3D0VA 1PKOA 5F9AC 1P4LB 4QXWA 1XH3B 5EU3A 3TJHC 2NW2A 4GBXA 2X1WL 3V79C 3KPQB 4LASH 2P1YA 5JIPA 3BD4A 4EDWL 4KKNA 4JFDE 4N0CC 1P7QA 2HA1A 3ZKSD 4MGXA 1TZHB 5FOJA 4XPTL 3CFBA 4XVSL 4WI9A 3G6DH 3QQ9C 1WBYA 1CGXA 5DR5H 4PRPD 3S3JA 4K94C 3WL9A 1JZ3A 1TJIH 2R1XA 5CZXD 2Z35B 1IEAA 4CMMA 2EDKA 2DKSA 5L2KA 5D1ZB 1IJ9A 4YHML 4OV5A 4EUPA 5D5MB 1ZT7B 3ZTJH 1F3JB 1A7OH 4K3EH 4Y4HB 1W0VB 3TBTB 1U58A 4U1SA 4L8DB 2FJFA 3GJFK 4JCLA 5C0CE 1U8MA 1Q1JL 5J3HD 4OLZH 1N4XL 4JN1H 3LRGA 4K8RC 4WW2A 2X7LB 3HI5L 4LLWA 4R8WH 5HDBF 2AEPH 4LSVH 5C92A 4OIAA 3BMVA 4NWTL 3IDGB 3VXTB 1JYXA 4ZMAT 5I8OH 2W0FA 5K9JL 4ZTPL 4PJ5D 5F8QC 4C83B 4DFIA 3VRLE 3N85L 3OKOA 5F88B 4OCNC 2HKHH 1OTTC 2JJSC 1F8TH 2HVKA 4L4VB 3ZLQC 4OKDA 2IPKB 4ODUA 2JIXD 4X4ME 2I25N 2JELH 4N68A 5GJTL 1CGSH 1AR1D 1EAJA 1G9EA 1MCHA 4RISL 4Y4KB 1XGYL 4Y16A 3FL7A 4XXDA 1T1WA 5CUSH 2IPTL 3VE0B 5DJ8A 5HBBA 3ZDXE 3CGTA 1B9ZA 4L9DA 3U4BH 5KVFL 4DN4L 5IHZB 3P0YL 4C4KT 2VMFA 3VXSE 4HIIB 4FFWD 2FX9H 4WIQA 5C09B 4JKMA 4ELME 4G5ZH 2NY3D 5GSRA 4OZFH 3CLFH 3WXVL 1FPTH 1UXWB 2R23B 2WINA 2XXMB 4XNMA 1N8ZB 3KYNA 2B5IC 2WWKT 2EIEA 3BKYL 5D2LF 3QULA 3V5DA 4GRLB 1YPZA 3U0WL 3MLRL 4MQ7A 1N6QH 2XKUA 5JQHC 2ZOLA 1MAJA 1CBVL 4U6HB 3CC5A 4IM8A 4R96A 5C0BD 3S37X 1CT8A 2V2TB 2P49B 4QHLB 4TQEH 2MHAB 3UYRL 1EVUA 1VFOA 1EO7A 5IVXA 2VXTL 4JRYB 2DB8A 3MJ6A 1FZKA 5DQJB 1EAPB 1WCBB 4U7MA 2FIRT 4RAVA 1D7FA 5LG1A 2EKSA 4TSCH 3QZWA 4WUUA 2YSSB 4PJIF 4ZPVA 5IFHL 4QRUA 5D2NE 5T33L 4MB3A 3SQBA 3S4SB 3BH8A 1QFWH 2QADD 5D7IB 4ZOBA 4OUUA 1OB1B 3NIFF 2IBGA 4G7VH 1H3TA 2A6IA 1R0AH 2WIMA 1OP3K 3DO7A 4UOW0 4RZCB 1X3DA 5I18L 5INCB 3WIIH 4JGJA 1KB5B 3K1KC 1DLFH 1ZHBA 5HY9A 5JOFA 4KUZH 1MI5A 1RJCA 4R2GC 3QHZL 3CJJA 3WJLC 4X4YA 4YHYB 1XIWB 4HJJL 3VXQA 2WNGA 3TN0B 3B4NA 4LIQL 2NXZB 1BBDH 2NY1B 2PO6D 4X6CE 4X5WB 2JK5B 2XTJC 5H8DA 5C0IB 2YD7A 3HNTH 1DBBH 1Z9OA 4XCEA 1OF2B 3OAZH 1DLHB 1BD2E 4I0PC 4X6EA 2IAMA 4TUOA 4BQCA 2O5XH 1C5BH 5TDNB 5L88H 4XCFL 3T77A 1T66D 5CD3A 1HXMB 3TYGH 2ILLA 5IEKA 3CFDA 1EHXA 2QQNH 4MA7L 1R5WB 4X5XB 4M1CD 1U95A 4LHUB 1HEZB 4S2SB 3RWJB 3WUZA 3KJ6H 1M7IB 3OKLA 5J9PB 2X4UA 3PGDB 4M43L 4P59L 1OAUL 4YBHA 1YEEH 3MJ7B 3R4DA 2Z91A 1HHGA 2JJVA 2YC1A 1T03L 4G6ML 3G6JF 5F3BB 5KSBB 1YEKL 3H9HB 5LKNA 2NR6D 3OAZK 1UVQB 3OHXA 4NM8H 5BZDB 2BK8A 3F58H 5J56B 1UWXK 4Q9RH 3NCEB 2EDWA 5DMKA 2YD3A 1RI8A 4M4RA 3TIEB 1II4E 5JR1H 3GI8L 4M48L 4GRWE 3FTGA 1MNUL 3KNBA 4NQDA 4QXTA 3CFCL 3HS0A 4Y4FA 4WI8A 4XP5H 4PLKD 3PABA 1RZKC 2IPKA 4NQEB 4U6VH 1LEGA 5EC2A 5IB4A 2HT3D 1Z5LB 4MNHB 5KVDL 4I9WD 4Q9QL 2KDGA 2X4RB 5HDOA 1T2QL 5F6HJ 3BISA 3KLHC 5E9DA 5ELIA 1EGJH 4JY4B 4TSBL 5D4QA 3BUTA 4AIZA 2HFEB 2ARWA 4YUEL 3HE7D 3BGMA 2FR4B 5LCVL 5FYLD 1KEML 5GGSY 3HE6B 5I19L 2C3HA 1U3YA 4L4TE 4JO2H 3S35H 1DDHB 3EFDL 5F9WB 3VU2A 3F58L 1EJOL 1VPOH 4R0LA 1XF5B 3KS0J 3RWEB 4N0FA 2XN9D 3QXWA 2VABB 4PJGF 5IJKC 2ZNWA 4I0CC 3SDDC 1DR9A 4H88H 2EYRB 2HH0H 3RJDA 4BJLA 2FGWH 4CGTA 4Q6IA 5FB8B 2DIAA 1YPZB 4LF3A 5MENB 3QDJE 4BZ1H 4P46A 3IS0X 5E1AA 3L5WB 3QI9D 1FNAA 2DOCA 4HS8H 3CXDH 3VA6A 5TE4L 2Y7QB 4PS4L 3FB6A 1G7HB 1X5KA 2VE6A 3STLB 3KPOA 3CVHB 2JB6B 4TTGA 4P99A 2F8XC 3O2WH 5FA3A 1HI6B 5T1MB 1B0RB 4X7SL 3SDXE 1IAII 4C56B 1S78C 2CDEB 3G6AB 4MD4A 5FUZL 1HYSC 1MIEH 4X8JB 4PP2A 1OGAA 5I1EH 1A9BA 5DXWA 3WJLA 5AZEL 3DUHA 1LE5A 1FYTA 4HLZG 4KKLD 2OQJA 1U8HB 4X7DC 4WHYH 3UTSE 1FGNL 2FWOB 1A6WL 1QFOA 1QQDA 5SX5K 1OB1A 5F8RC 1JGEB 4K23L 5IVZA 3S88H 1E6OH 2V9QA 2W65B 1NFDE 3GMQA 3QQNA 4UTBL 1MH5B 3VMOA 1HDMB 3GI9L 3DURA 1MI5B 2GFBA 1X5AA 4Z18A 3BKCL 2D7NA 5GSVB 4X6DB 2CPCA 4U1HA 2X4NB 3KPSB 1Q0XL 1EEZA 2DI8A 3KWWA 1ZGLB 3SBWA 1IGCH 4MD0B 1BX2B 4NOBA 3NIDE 2MQ0A 4XC1L 1F2QA 3GHEH 4R3SB 3SO3B 2NNAA 4JDTL 3QRFM 1ZT4B 1I3UA 4JFQA 3U7AA 2YD5A 1RK0A 2HLFD 1LE9A 3IJSB 3NABL 4KK9C 1YPZE 1GGBH 1RV6X 5D1QD 4N5UA 1Q1JH 1U8KB 4FG6C 2JCCF 3MRKB 3V4PH 1PG7H 2NTSP 1HWGB 3SGJA 4EIZC 1A2YB 5H37G 2GAZB 1HHGB 4GKOA 1SMAA 2PTVA 4YEFA 4FXLA 2VDNH 1I7TA 3VXSA 4PLKC 5KSAC 3UXFA 1U93B 2F5BH 1QBMH 2BRRH 5CLTA 1RD6A 5IMMA 5MEOB 4PTTA 1FDLL 4MJ5B 5ECJE 4YDKL 3GIZH 3QUXD 4XMKH 5L2KB 4JDVB 1AY1H 5IF0A 1U8NA 1FZMA 1R3JB 3O6FA 3F7VB 3MNZA 5FF6A 4XB8A 3VMPA 2IBBA 3FZUC 4HPYH 1AO7B 3DVNB 3HS0B 5J11B 4AM0B 4JY5H 4HGKC 5EH1A 4NQEE 2Q8AH 4XPGL 4NO5A 5LVEA 1H3XA 3SOBH 3ARVA 4LLUA 2W9LA 1NGQL 1ZHKB 5K59E 4FMFA 3MLYH 4WU5B 4FQIH 4PJCE 3P30L 4XPHH 5EU6D 3ZL4H 5F7WC 3LRSA 1EDQA 4XP1L 1RVFL 2J5LC 3J8F7 3RU8L 4OLUH 3SDDA 3U30B 3MODL 5FKAA 5B39G 1RUML 4KMTH 2XY1A 3HC4H 4NRYB 5JUEL 4HV8B 1TPXC 2X41A 3V4VL 5DFVD 4XPAL 2AEPL 4LSVL 3QIWA 3AY4A 4R8WL 3IB4A 4G8FA 4W6XB 3TPUA 4Y19E 3RWIB 1MLBB 3QDGD 3LIZH 3VFNB 4L8BB 3PJSB 3H7LA 4FNLL 1XR9B 1AGCB 1JGLH 3ULSB 2NXYC 4OZGF 4RBPK 1YMMD 1PKQA 3PP4H 4PRNB 3QIUD 1PFCA 1WK0A 1EO5A 2XKNB 4V1DE 4M61B 4QCIA 1DUZA 1Z9LA 3HTLX 2OR9L 4S1DD 3QA3A 5DQDH 1I3GL 5CGTA 5MERA 4GO6B 4W4OA 1D9KB 1CXFA 2OTWA 5ESQB 1KYOJ 1F4AA 1S7UA 1ZWIB 4CU8A 4OUOA 4Z78A 1U3HA 3P3YA 4LQFL 2C4FT 4A6YA 3EYUL 2GW5A 4HFWA 4HIXH 2APBA 1K6QL 1E6OL 4FFYL 3IDJB 1ZHNA 2XYCA 4GRLA 1A4KA 1JNLH 1VKXB 4CKVX 2OZ4H 4HUXA 3PE9A 4KUZL 3W2DL 5D1XA 1RHFA 1UM6H 3S7GA 4Z7WE 4KJYB 2A38A 1LE5B 2OQJB 5JORB 5JO5A 2HWZL 2CDGB 1G7IB 2Y5EA 5FFLA 1VA9A 2A83A 1CL7H 5DMGC 1KJ2L 2J3SA 4O5LH 1SEBA 1VGEH 5CHNA 3DARA 4U05A 4KZEH 3B6SB 5DRWA 3MLWH 5A2FA 1CN4A 1I8KA 2DMBA 1JGDA 5DJ2B 3ZZ1A 1AQDB 1S5HA 1SVCP 1WSST 1YNKL 3CXDL 2OP4L 3B5GA 2G60H 1MAML 1H3VA 1ZVSA 4MNGE 3F7PC 5CP3A 4PLNC 3P73A 1ZGLA 2NZ9C 4OUUB 5KSUB 1Z3GL 2F54E 2R69H 1RU9L 1PKQE 4LU5H 1OAKL 5C0AA 5CJQH 2GITA 4OF6A 1CS6A 4KVCL 5L7XL 5MEPA 3AROA 3EUUA 3GNMH 3NCYP 3D1MC 3IDNB 4IIQA 4X98A 1FN4A 4G8GD 1NMAL 3GMPA 5F6HI 3EO0A 3T3PF 1BQHB 4BK4A 2X05A 3PXHA 3MNWA 3TJEH 1M1SA 3VXMD 3DRTA 1ONQB 1ZLUK 1HHIA 5FHBH 3OAUL 4H1LB 1GGIH 3TA3C 4KUCD 1ND0B 3PGFL 3HE6D 1F3JA 4UNVA 4NN6B 4PJFF 3WKML 1DUYA 1U3HD 3BEWA 3BT2L 3CCHB 1UWEH 1Q9KB 1UADC 3KPTA 2Z8VC 3CH8A 1YC8A 1QHOA 4FQXC 1DANU 4GKSB 4BQBA 1HXMA 1A7BA 2BSRB 2F58L 4JB9L 4ODWA 3HCVB 1S8DA 1PGRB 1CG9A 1L7TH 4KRMB 4LQFH 3T2PA 4V1DB 3OKEA 1OLLA 4U1GB 4NNPL 2FX7L 3LKPA 2BNRE 3TWCH 3KPRE 4G6AC 5AUMB 3QPQD 2JJUA 2GYSA 4P49A 1YMMB 1J10A 1FGVL 2P45B 1UACH 4OD1L 4EXPX 4HHAA 4FN0A 4Q9BA 1RHHB 1FNEA 4GBXD 3T3ME 3QDMA 3ZE1F 2J8OA 1ZXQA 3T65A 2BX5A 1FSKC 2FZ3A 4Q2ZA 4WFFE 3QXDA 2EEDA 5HHOA 3BYTA 2DM3A 3NBNA 1CF8L 1KENL 5E03A 4BUGA 2UUDH 1G1CA 3E6HA 3UPRB 3D0LA 3U0PB 4X8XA 3GBNL 5JOPE 1MHCB 3O6KL 5BCAA 1P2CA 4HWEH 5BRZE 1MJ7L 2A1WL 3BI9X 3UEZA 5C09A 1MRDL 4IRSD 1WF5A 5F9OL 3T1FB 3WFEL 4YJZL 1QHPA 4WVRA 3MOAH 4E5XA 4KROB 1OPGH 1CZ8L 1REIA 3WS3A 2HKHL 5CP7B 4M48H 3VFPA 2E9JA 1BD2D 3LD8C 5AG9A 5EC1A 3MRRB 3IETA 3SDYH 2XKNA 5DF0A 3HE6A 3PWPB 3VFVA 2QV2A 5ITBL 1JI2A 5D1XC 1I8LA 3UZVB 2KH2B 3KPNB 3TT3H 2NY5L 4LGSB 3JUZA 3LKOB 1NQBA 4Z77A 1MF2L 1GZPA 1IM3B 5D72L 1S7VB 2XZCH 4K94L 4WFHD 1Y18A 1J1PL 5F70A 1Q9WB 3OR6B 3WKNA 3VW3H 1C08A 4JY6B 3O45A 1T7YA 4MAUH 3L1OL 5EIQA 1VKXA 5T3XL 3RKPA 3PDGA 3L3JB 3I84A 4ZOAA 3QG7L 4ZPVB 3VJ6B 4LARH 4QRUB 1TJGL 3RKDD 3G5XA 3ARFA 3JWOL 3WDHA 3O2VL 4MVBC 1A6UL 4K7PX 5CJOL 4L3CA 4X99B 5D7LE 5F7NC 2DQGL 1DBBL 1AKJB 2ERJB 1VACA 3SDDD 2F53D 2IANA 5IESH 4WNQA 4FFVC 4H5SB 5HY9B 1YA5A 1QYGH 1JZ6A 1QNZH 5I2IA 1UB6B 5BV7H 1T83A 5F7YC 2P5WE 3ZE2E 4D3CH 3ZKMC 3QUZA 1HKFA 3R06A 5IW6B 3JV4A 4HS3B 3ZE0F 2F15A 4F2MA 4M1CC 5SWZB 2XOTA 1X5GA 3LSOA 4XPHL 4OB5H 5C09D 5L6YH 1IGJA 1NCNA 1T89C 1E28B 1P4IL 3I75A 1XCTB 1NMBH 3QFJB 1M6OB 2FATH 3VGEA 3UP1A 1DBKL 4GXUM 5IB5A 4XCNB 4N5EC 4KAQL 1NDGA 1L9NA 5KZCB 3MLSH 3FZUD 1NKOA 4YR6A 4P48A 3QIUA 3ARDB 1S9WB 4FS0A 4OLWH 4U2ZA 4XCCH 1ZANL 4W6YB 2Q7YA 3LCYA 4LDOB 4N0UE 2WBJD 4RGND 3CFKA 3J7HA 5EUKA 5HHXL 5BOPA 4HFUH 3SKJH 4HIHB 1R6VA 3VG9B 4HD9A 5D7IF 3KPQA 2AJXL 3FCTA 3S88L 1YEHL 4G7VL 4WWKD 1JPST 4H0HB 2BVQA 1WFUA 2A9NH 2BCKA 4PB0L 1EERB 1S7TA 3CH1B 5C07A 3QCVL 4QHNB 3W9DB 4F80A 1WUNT 4O51B 1DL7L 2BNQA 1I7UB 2VITA 2PXYD 3BH9A 5D2NC 1YY8A 3GM0A 2R9HD 3ZKXB 1EFXA 5GGSB 2A77H 4LEXL 3NN8B 5C0FB 5C0CA 4D0CB 5I30L 2YKLL 2DQEL 4HCRL 5TF0A 1JV5B 3BJLA 1IT9H 4XNYH 4L9LB 2AP2A 4Y4KD 1I9RL 1Q9OB 3JV0A 4NN7B 1BQSA 1WWWX 1QSFD 2VWEE 1ZANH 2HLFC 4NWUH 2IG2H 3L5JA 4ODVH 3SGDH 1DQLL 3O3BB 3TH4T 3N1GC 5FO9B 4ZO6A 1M71A 3CFEA 4JVWA 4LSQH 3T08A 1T5XA 3T2OA 4UV4L 4M7JL 3ARGA 3UTTE 5SV3A 4PGZA 1HXYB 2VISB 4K9EH 1FVEA 1PD6A 2ADFH 3C5SB 5AYUL 1OTUC 5C0AD 3N1PC 2EYSA 3GSXA 5CKAA 1DE4B 1A8JH 1F4WL 4P3WA 4MAYD 5A40E 4PJCA 4JQXC 1G1YA 2DQEH 3SY0B 3KJ4B 2ID5A 2HLAB 1GIGL 1TFHA 4JFZL 4JKKA 2D3VA 2E9BA 1N6QL 1BD2A 3PGCA 3I3EA 4PJAF 3VFPB 3RTQC 4GW4A 3QCUL 2V17H 1JN6B 2R4SL 2G9HA 3V6BR 3PHOA 5IB2B 4GG6F 5IHZA 3GSNA 2RGSA 1YPZF 3A6BH 4R4BB 2M2DA 1DBJL 4RFEA 3GKWH 5JDSB 1QZ1A 4ZUSB 2D4DA 3WFBL 4X9GA 4Z77B 3VWKB 2MKLC 3FB6B 4KRPB 5KAQG 2WINB 2OTUB 5I1KH 4DN3H 1NCBH 2AEQL 3MRLB 4PJHE 3WNLA 4FQHA 2VLKE 2YD1A 3C2AH 1IL1B 3DMMA 4FABL 3C5ZB 5FV2A 2BP3A 4G8GB 2R0LL 4X7EC 5DT1H 4RGMC 1IM9D 1N0XH 3ILPB 1EJOH 1VPOL 3QNZA 2IH1B 1I9EA 1BJ1J 2GJ6B 3BQUC 5KVEL 1KJVB 1OM3H 1ULVA 3H7BB 3L3GB 2AXGB 4PJBA 5F7KC 3NFPB 1U8QA 4G43A 1CLZH 1QSED 3F5WB 3MSPA 5F1KC 1EXUA 5ISZB 2VLLA 1CFTB 3S36L 4Y2DD 2QEJA 2FJGB 4IOSD 3HFMH 43CAB 3AUVA 3TBYB 3PHQB 4QF1A 5EBLA 2ARJA 3RX7A 3VRIB 3RHWK 3SDCB 3PQYD 3HZKA 2AV1A 3LSOB 1YNLH 2GJZB 5DUBB 3RX5A 3L9RB 2R1WA 4XZUA 1YUHA 1JZ8A 1QBBA 1GAFH 2Z92B 3DX9A 5JMRA 3KVQA 2VL5A 3VWKC 5IFAL 1H8NA 1U6AL 2NXYB 5JNYB 1DCLA 1JGVL 1TETL 3MRDB 5KSBF 1A6VL 2Q7YB 2BRQA 1S5HB 3ZDZF 1MJJB