5LQCA

Crystal structure of comt in complex with n-[(e)-3-[(2r,3s,4r,5r)-3,4-dihydroxy-5-[6-(methylamino)purin-9-yl]oxolan-2-yl]prop-2-enyl]-5-(4-fluorophenyl)-2,3-dihydroxybenzamide
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
TKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
publication title no title yet
rcsb
source organism Rattus norvegicus
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqcA01
2I62A 4RTKA 4PINA 3PX3A 3DXXA 2C7RA 1PRYA 2PKWA 5EKUA 1XTPA 3X0DA 2C7QA 1QAQA 3FRHA 3GGDA 1VLMA 2ZIFA 4PYKA 4C4AA 4E30A 5LQJA 9MHTA 2AN5A 2YQZA 5E9WA 4HTFA 4F85A 1D2HA 3CKKA 4DF3A 5GINE 4Y30A 1JG3A 2ZLBA 3TMAA 1EAMA 5FCDA 4FZVA 1G38A 3BXOA 3OU2A 4RSRA 3KPUA 5EVJA 1L3CA 2NXNA 3KQYA 3P2IA 4F84A 3EVDA 4HC4A 3SSNA 3FTCA 3ELUA 3FUVA 4A6EA 2QYOA 4HTFB 3TFWA 1YFJA 2CMHA 2P35A 2FYTA 3DH0A 3P2KA 4QVGA 1U2ZA 2VZ9A 4R6XA 5KVAA 3HCBA 4M36A 4RWZA 3LDGA 5EEGA 3GNLA 4CXMA 2BH2A 5K0GA 4PYMA 1TW3A 2H00A 5EKXA 1SVUA 3A25A 2WK1A 3VC2A 5HFJA 4CKCA 3KPWA 4R05A 3HVKA 4IV8A 1NW5A 2Q41A 3G5TA 2P7IA 2B78A 3AXSA 4XUDA 3ERCA 2BR3A 5LQKA 3CGGA 5DTMA 3AWIA 5DSTA 3TM5A 2GH1A 3E23A 1EJ0A 1NW8A 4OQDA 4DCMA 5E1BA 2XVMA 2PV0A 3OFJA 4PONA 5ICGA 3DXYA 3LKDA 1FJXA 3KPVA 2EJTA 5KS2A 5E1MA 2FK8A 5LSAA 4RTOA 3BT7A 2YVLA 5T64A 2ZTHA 4KVZA 3TLJA 4GC5A 4BP3A 3FPFA 7MHTA 3OU7A 2Y1XA 3B3JA 2QY6A 4FGZA 3P97A 4ER6A 4OX9Y 2IDJA 1QYRA 1XCJA 3HA7A 3LDFA 1AQIA 3PB3A 4MQ4A 5F2KA 4HG2A 3KPJA 5ICCA 3SM3A 2CWWA 1L9KA 3PS9A 5DPMA 2XYVA 4PCAA 3NJRA 1P39A 1XDZA 2PXCA 3G2QA 5FQNA 3SVZA 1FP2A 3GXOA 3KKZA 1NV8A 2CL5A 2YXEA 3TM4A 4B17A 4DM3A 5EMLA 4CTKA 1N7IA 3AXTA 3O4FA 5FHQA 3FUUA 3LDUA 2UYCA 3B89A 4Z2YA 2JHAA 1RI4A 2ZWAA 4OBWA 4OQEA 1ZHFA 4PYIA 4CWAA 3OE4A 5IKMA 1Q0TA 2BZGA 5HEKA 3VC1A 1P91A 4X60A 2F8LA 5K0BA 5LQCA 2ZSUA 3BGVA 1HNNA 3EEYA 4ZTBA 4YUWA 5K0NA 5LR6A 2YR0A 1WXWA 1SQFA 4RTJA 4P7GA 5JR3A 1VIDA 3MAGA 5C0OE 3OFKA 3DOUA 2H11A 1I1NA 3GIWA 3G8AA 1TW2A 3FUTA 4EKGA 1VP9A 4QDKA 3RW9A 4MWZA 2PX4A 1MHTA 4E2ZA 3P9KA 3NWEA 2AOVA 2ESRA 1BHJA 1SQGA 4LG1A 1X1CA 2OPBA 1XXLA 3C0KA 3DMHA 3PFHA 4HH4A 1RI2A 4PYLA 1XJ5A 3BWMA 2G70A 3S68A 3E8SA 2V74B 1DL5A 1EQAA 1NBHA 3CVOA 3KQSA 2GA9A 5DX1A 2PT6A 5M5BA 3ME5A 2PXXA 3A7DA 3TOSA 1RI1A 3QOWA 1WXXA 2O07A 5KYGA 4FS8A 3LBYA 3CC8A 1TPYA 1X1DA 3M4XA 4F86A 3LGAA 5HIJA 1IXKA 1KPIA 4P58A 2O05A 1R6AA 3EVEA 5EMJA 4NECA 3M6UA 2AS0A 4GOMD 2QRVA 1YB2A 3UJ9A 1BC5A 5DXAA 5DM0A 1VBFA 4AX8A 5C9ZA 4DKJA 2ERCA 2EX4A 3C3PA 3PX2A 1YZ3A 1JG2A 2BR4A 5E2BA 2I6GA 3UZUA 4GQBA 3G5LA 4RTLA 4RTPA 4X63A 5FWDA 2G8NA 2IIPA 3E05A 4YMGA 3FTDA 4QQKA 3UA4A 2XVAA 4BLUA 4RTNA 4YV0A 1HMYA 2QRVB 2XYQA 3I9FA 4O29A 4M38A 4AZVA 5BW5A 3REOA 2HMYB 1N7JA 2YXLA 3GWZA 2LD4A 3KQPA 5E8JA 4FR0A 5G02A 3MCZA 2KW5A 1YFLA 3FPGA 4AUKA 1I9GA 4ER3A 3KQVA 3KHKA 4WXHA 5FHRA 4RTRA 3NDIA 5GM2A 3KQQA 3I64A 5CIYA 4R6WA 2JH9A 2P3QA 3RODA 4X1OA 3DLIA 5E1OA 3UWPA 2HTEA 2GB4A 4FSDA 1SKMA 5DSXA 1R18A 3G7UA 4A6DA 3B7PA 2N47A 3OCJA 3C3YA 4C06A 3EEOA 5EZSA 4BLVA 5FWAA 3SSMA 4V0QA 4CTJA 5CM2Z 1B42A 4PYOA 4OBXA 4U7PB 1XVAA 2ZBRA 2IDKA 4KRGA 4PGHA 3HA3A 4E31A 3JWIA 3ANXA 1JG4A 3DTNA 5JUWA 3DP7A 2PT9A 1NE2A 2PBFA 2NXCA 1BOOA 1IY9A 4OA5A 2Z6UA 1VP3A 4BY9E 4V0RA 5GIOE 4G56A 5DT2A 3MGGA 2VDWA 3THSA 1RI5A 4DQ0A 2JHCA 3LKZA 3R9XB 2ZW9A 2ONYA 3FPEA 2IBSA 3JWHA 3T7SA 5DXJA 3CBGA 1I4WA 2ZZKA 2GS9A 5EMKA 1RJGA 4PGGA 1DUSA 2ZIGA 5KQRA 5K03A 5LQAA 3LCUA 1JG1A 1WY7A 2IPXA 3HCEA 5CVUA 3FTEA 1KHHA 1NT2A 4AZSA 3BWCA 2O0LA 3HCFA 1DCTA 2I9KA 1R8XA 5EG5A 2YUIA 4WVLA 3RIEA 2IFTA 2B3TA 3ID6C 1ZGAA 1KYZA 3CJTA 3EVCA 2VDUE 5H02A 4EMSA 2OKCA 3ELDA 3KR2A 3HCDA 3K0BA 2HWKA 3Q7EA 3NVMB 1KP9A 3THRA 1VPTA 1XDSA 1Y8CA 5GWXA 4E2XA 3M6XA 1H1DA 2PJDA 2HR1A 3BWBA 1NV9A 1G8AA 2QE6A 4DCGA 4P7JA 4DA4A 2O06A 3EVZA 4RVGA 4E70A 5ICEA 4XCXA 3UJ6A 1EJ6A 1FBNA 4E33A 2UZ4A 2PX2A 3DULA 3HNRA 3IV6A 3KR9A 3HTXA 1F3LA 4GUAA 3AJDA 4K6MA 2CMGA 4ER7A 3BZBA 5HIMA 4YUVA 2IH5A 3I58A 3V97A 2OZVA 2ZZNA 2ZCJA 2Y1WA 3KQWA 2AOWA 2P40A 4GEKA 4MIKA 5EGSA 2IH4A 4C03A 3T7RA 1QAOA 4ER0A 4YUYA 4UOEA 3LCCA 2OO3A 3LPMA 1SUIA 3P9NA 2NP6A 3HP7A 1L3BA 3GU3A 2GAFA 3FRIA 1AV6A 3NDJA 2E5WA 3HVHA 3O7WA 4P7FA 4C04A 1JQ3A 3D2LA 3ELWA 4LWPA 3TR6A 1G60A 4HGYA 3G2MA 2H1RA 3VYWA 3HCCA 3LX6A 2HNKA 4M37A 4KIFA 3BKXA 3MHTA 3R0QA 3LHDA 2ONZA 2AR0A 5BP7A 1EIZA 3B3GA 2B9EA 4GOND 5E9QA 3UJCA 1JSZA 2FCAA 5CVDA 3UJBA 2O57A 3OPNA 2YXDA 2XBMA 5C1IA 1ORIA 1RJEA 3LBFA 3KR1A 5BW4A 2ZWVA 5EPEA 3LL7A 4QDJA 3TRKA 1YZHA 5EZQA 2DULA 2EFJA 4P7KA 5FQOA 1X1AA 4E2WA 1M0EA 5DRTA 3QV2A 1KPHA 5HILA 3PTAA 3F4KA 5K8VA 1QZZA 1NW7A 1XCLA 4HGZA 1L1EA 5K0LA 3G8BA 5LQRA 3WSTA 4EK9A 3C6KA 4QPNA 3EGIA 3IYLW 5P8WA 1KPGA 3GRVA 5FADA 2HV9A 2WA2A 5EEHA 3ER8A 4QPPA 2V7EA 2OXTA 5EHIA 3FPHA 4YV1A 5DX0A 4IKPA 4X41A 3OZRA 1R00A 2NNWB 1VE3A 1ZKDA 4KIGA 4KWCA 1KYWA 3BGIA 1NW6A 3PFGA 4KDCA 4YMHA 3SXJA 2PX5A 5F2OA 2OB2A 2B25A 5DTQA 2AVDA 2R3SA 1D2CA 3KQOA 3ORHA 3GDHA 3P8ZA 1JR4A 5CVJA 5MHTA 2OY0A 1ZGJA 5EC8A 3EVBA 3AY0A 4OA8A 1O9GA 3UJ7A 3MTIA 2WA1A 3DMFA 5E8RA 1N2XA 2PLWA 3L8DA 4RVFA 1FP1D 2XYRA 2R6ZA 3UFBA 1O54A 1SG9A 2I7CA 3I5UA 2A14A 2IH2A 2BR5A 8MHTA 4QQNA 1EG2A 2ZBQA 1UFKA 5CVVA 1P1BA 2EJUA 3FZGA 4BLWA 4PNEA 2ZIEA 4PWYA 3A27A 2JH8A 5DM2A 4QVKA 1G6Q1 4PYJA 2IGTA 4FT2A 1M6YA 1R74A 2YTZA 3ELYA 4EQZA 1JQDA 4PYNA 4RTMA 4C08A 2UYQA 4DMGA 1D2GA 3EVAA 1R8YA 3M70A 2FPOA 5B1SA 4CKEA 2OYRA 3GRRA 2JG3A 2AZTA 5EOVA 3EGVA 1BKYA 2FK7A 3A26A 5E9JA 4YUXA 1INLA 3KPYA 1M6EX 1G8SA 3R3HA 5HIKA 5CCXA 2QM3A 4AZTA 5HZMA 2PY6A 1UIRA 5F2NA 1AQJA 2AOUA 3P9CA 5LQNA 5K01A 4PCLA 1ZG3A 3C6MA 5DLYA 4PIMA 4RTQA 5KQSA 1L3IA 1WG8A 4X61A 2DPMA 4ER5A 3KR0A 3NWBA 5ICFA 4Y2HA 4POOA 4YV2A 5K05A 2VDVE 3MQ2A 3CCFA 3EPPA 1WZNA 5GM1A 2AOUB 3MTEA 4PIPA 3G88A 4QTTB 5T67A 2IBTA 3FPJA 3OU6A 4GF5A 3NVKI 2P8JA 1NBIA 5K0FA 5HIIA 4LECA 1XDUA 3PVCA 3FTFA 2G72A 4R8SA 1ZQ9A 2C7OA 5T6BA 1UWVA 1JTFA 3SR4A 2C7PA 3UJDA 4JXJA 3KQTA 3G89A 3I53A 4GOOD 4QTUB 2FHPA 1QANA 2VS1A 3OZTA 4LWOA 5CUQA 1VL5A 5FA5A 2PWPA 5FUBA 2ZVJA 4GOLD 2Z6AA 5E2AA 2EG5A 3NTVA 3LCVB 4R8RA 3HEMA 3LECA 4FSXA 3DMGA 3KQMA 3MCTA 3MERA 1KXZA 1V39A 2UYOA 1QAMA 2OB1A 2VP3A 3BGDA 3GJYA 3HM2A 4HRAA 4RYLA 4E2YA 3TQSA 5LQUA 1MJFA 2P7HA 3GO4A 3HVJA 3U81A 5GIPE 5HOQA 3KU1A 3FUWA 2PVCA 5EHGA 1O9HA 5FTWA 3PLAE 2JHPA 3M6WA 3DLCA 2Z6QA 4RVHA 1ORHA 1JTEA 2AOTA 5CD1A 1Q0SA 5EIFA 2K4MA 3GRUA 2ZFUA 5EMMA 3NMUF 2ZULA 3B3FA 5CCBA 3BWYA 3M33A 1JSXA 3BKWA 3CJRA 3VSEA 3R6TA 2AVNA 4HSGA 3JWGA 2PX8A 3V8VA 1IM8A 2AOTB 3DXZA 4IWNA 5FA8A 4PYQA 3UBTA 4MHTA 2ORED 3FYCA 3P2EA 1X1BA 1OR8A 3DUWA 2AN4A 2NXJA 4IV0A 5DTRA 1YF3A 3GCZA 2OBFA 4XUCA 2JJQA 2GLUA 5ERGB 3TPZA 3QOXA 4L7VA 1T43A 3TKAA 3IHTA 3EMBA 2ADMA 2G1PA 3EMDA 3P71T 3SMQA 3E7PA 4BP1A 3NW9A 3ER9A 2PSSA 2PXAA 4U7TB 2IP2A 3T7TA 2AN3A 3EGEA 5DM4A 2P1DA 5BXYA 2CKDA 4EKIA 1JQEA 1RJFA 4RTSA 3M6VA 2PGXA 2FRXA 3GRZA 3P9IA 4H0NA 4YUZA 3R24A 1AF7A 4XUEA 4GBED 2G71A 5CVEA 1NKVA 5GOZA 3K6RA 3O31A 3PT9A 2B2CA 5K0CA 4GC9A 2NP7A 2NYUA 3BUSA 3OZSA 2AOXA 4EVIA 1WS6A 2UYHA 2ZZMA 1RI3A 3JWJA 1P1CA 3IEIA 5IH3A 4ATNA 2GPYA 4E32A 3G2PA 5K0JA 5U4XA 3HVIA 3UJAA 2BM8A 4M7RA 3SGLA 1YUBA 5GP1A 3Q87B 3GRYA 4RV9A 2YX1A 1SUSA 1VQ1A 1FPQA 2P41A 5D1NA 3CJQA 3SSOA 4DZRA 1Z3CA 3HA5A 3LSTA 4KW7A 1PJZA 5K0EA 5K09A 3SX0A 2P3LA 1F38A 1KIAA 3DR5A 5DM1A 5DRYA 5E1DA 3EVFA 4C07A 2P3OA 4KDRA 4RX1A 3FYDA 5DX8A 4RVDA 4FP9A 5FULA 4C05A 5EQJB 3MB5A 10MHA 1RJDA 2ZBPA 3A7EA 4MTLA 2PWYA 3B5IA 5D1HA 4AZWA 3OE5A 3A4TA 2NXEA 4CKBA 5DWQA 3G2OA 3UA3A 3EVGA 4ISCA 3H2BA 3T0IA 3UJ8A 3FUXA 3HCAA 4FT4A 1NW3A 1KR5A 5EIWA 1G55A 1X19A 3TKYA 2BM9A
chains in the Genus database with same CATH superfamily
3ZWVA 4CKBB 1KE1A 4CIAA 2GRAA 4Q3DA 3PX3A 1E3IA 3CXUA 3W5IA 4PRKA 5CBKA 1X9GA 4CMHA 4KFSA 4XCVA 2CKMA 2GPTA 3OUZA 3MCWA 3RR2A 1HC7A 1NY6A 2EC5A 2HBZA 3FF1A 3NP7A 1Q77A 2HK9A 3L04A 4YEDA 2IBMA 1I4TD 5E9WA 1D2HA 2E37A 3Q2IA 3QBTA 2UXDB 2YJGA 2G04A 2ZVDA 4LYAA 1A71A 1DOAA 1N1DA 1JG3A 3ZGOA 4DV3B 2XIQA 4CV0A 5EVJA 1XT6A 3DP9A 4FOPA 5JV5A 4HNTA 1H0RA 1P1RA 3JWPA 5KYVA 1A1SA 1OHHA 4M6WA 4JLVA 3G9TA 4FIZA 4B3HA 1NLUA 4FGWA 3V2GA 4ZU6X 5CA0A 5L6MB 1DSSG 5JFOA 1TW3A 4UAGA 1VYHA 1GPKA 3A25A 3ZZTA 1UP6A 1TU0A 4M6WB 4BX9A 2B3DA 2J3MA 1ZBDA 4OL9A 1TKCA 3AETA 1BD3A 1HY3A 2AUTA 2OSBA 4ZTUB 1LSSA 3DL4A 2XR1A 3OA2A 4DR4B 4UU1A 1A2KC 4HZGA 1ODTC 1TA0A 3WFIA 1LJ8A 4HB3A 4PONA 5J2TA 1ZOLA 3AETB 2QI9C 2UYGA 2VQSA 5DW0A 2IOHA 2VAMA 2Z4SA 5H82A 3JQDA 1UH5A 1O0CA 1BGWA 3TLJA 3OM9A 2KX7A 4IH1A 1SC3A 1JFSA 1SQSA 4IQ8A 1F2VA 3UAVA 1FYDA 3OLXA 3MK31 3P97A 2YYYA 5EIHA 1GGMA 2WYOA 5J2TB 4YRDA 4WH0A 1DG1G 3G5AA 4F04A 1T4CA 4MR9A 1UJ5A 3NIFB 3L8ZA 1SOUA 3QFFA 4Y6OA 1PR1A 1LF5A 1ZHOA 2VJLA 4IIVA 2D7DA 2CL5A 2HIMA 2H59A 1MKYA 1T4CB 4MR9B 1P1KA 4COOA 4ANFA 1JSLA 4OLAA 4XWWA 1YAJA 5FUYA 5CLJA 2IYXA 2DT5A 3E18A 1U3DA 3LQFA 1QFMA 5B37A 5BR4A 2JCVA 5KWEA 2SKDA 2HIHA 5L53A 1NT4A 2AMJA 2JGRA 1ISGA 1OLXA 4LNHA 1DKOA 3MAGA 1EX6A 4JVNA 3SDZA 3VTKA 1E7YA 3AR4A 3VNBA 4OMCA 1CDEA 3H6GA 1WDKA 5AKIA 3OZCA 3RVKA 5FP0A 2F3RA 3AILA 5JS7A 1U9YA 1BG6A 2OQ2A 4IFEA 3V4LA 1OLXB 5LD2B 1VB5A 1NXVA 4N18A 1P17A 2Q0HA 5DH9A 4L57A 2ZJAA 2ISSD 3HCWA 2F67A 4GDMA 4V1CI 1K8XB 5AHKA 2WSLA 5MFPA 5DO9A 5AOVA 1YONA 1MN6A 1LPNA 1V2HE 2I2WA 3SX2A 1XQXA 3TNFA 2Y0CA 3P19A 1N3LA 2X77A 1POWA 2ZSHA 2I4NA 5KKAA 1JWLA 4MZXA 2VT2A 1GM5A 2C4NA 2WC1A 1Z0KA 4S2EA 5BO5A 3LBYA 1RBYA 1D2AA 2YICA 1UM9A 4KAAA 4MQ5A 3VR6A 2IITA 3KDAA 5KO2A 4ZT6A 1KPIA 1XDWA 1VKRA 3H05A 4YJGA 4OYHA 1JJAA 4NG5A 4QQ8A 1CUFA 3O03A 3QX9A 1DZIA 5CG1A 3WQQA 1MQ9A 4RV4A 3ANTA 1JEDA 4JYBA 1UM9B 4E07A 1EDEA 1F2UB 3WDKA 4YJGB 1PR6A 3TBKA 2YV4A 1GN9A 1E60A 2X0JA 3P1JA 4X64B 1SG6A 3FSJX 4RUKA 4BMOB 1DJMA 1CFZA 2E82A 3W3AA 1BS2A 1FBTA 2PV7A 3LQ4A 5LZ8A 3REOA 1P77A 1PJSA 3ROEA 4P54A 3UT6A 1JU4A 2P9JA 3KUXA 4P3YA 4YIKA 4ZU3A 5B7NA 1EK6A 3Q11A 1H5UA 3VFDA 5FHRA 3UOWA 2IHZA 1WTAA 4TYMA 2A5DA 1G5QA 4H7PA 5CIYA 3BIOA 4PR0A 2EVWX 1V8OA 2COKA 2IC5A 3SM9A 2ZWOA 1ISRA 3PIIA 1JHYA 1V45E 4OFXA 2R8ZA 3RVBA 4K9SA 2R44A 1T5DX 4GNRA 3UEOA 1HE3A 2RGWA 2X5JO 4BLVA 2CSUA 1FFWA 3N8DA 5A0TA 3QUSA 2ACWA 1EFHA 3N8NA 4E5SA 4OX9B 2ZBRA 3LMKA 4HAWA 5EWMA 2WIDA 1JG4A 2CGEA 4YLEA 3KVYA 1W5AA 3GUCA 5CCEA 2ZI5A 1QH1A 1XC7A 1BA3A 3O7MA 3RS5A 2QGFA 4C0QC 4NYJQ 1T1SA 2ZPAA 1G4HA 4ZV4A 1RRCA 3NTLA 2Q8QA 4R9NA 5EWMB 3IKTA 1G2OA 1KEPA 3NQ41 1RZUA 3NOQA 3WLMA 1G9SA 4L5YA 1UKYA 1IWBB 3MWKA 2AZXA 1EX1A 2XUGA 4RKFA 5SZJA 3CE9A 2JGIA 5AESA 2WUGA 4GOXA 1FTYA 3T7SA 3TTUA 4WADA 1T29A 4G36A 1ORDA 4N54A 4D8TA 2K2QB 1KMCA 2EQAA 2GM5A 4TS1A 5K3EA 3T52A 5C52B 2HFKA 1DRVA 4UVDA 4NYJR 1IPFA 3DHYA 3HCEA 4MKRA 4TLDA 1AO3A 3X1KA 4A2PA 1FX1A 5H4HA 5JQGA 3CRQA 3MCUA 4HGPA 4BO7A 1B4DA 1KSGA 3T61A 4UFPA 1PQYA 3OLWA 3RJMA 2HLNA 2QT1A 1W0KA 2O20A 3LWNA 4YXWD 2DY0A 4IKEA 5AI6A 3AEQA 4PZLA 1KS2A 4TS3A 5JQGB 1O94A 4OQYA 3HJAA 1USGA 2P79A 2RB5A 1NNEA 2ONCA 3CRZA 3SI7A 2R4QA 1BHQ1 1L0BA 1SHKA 3ADPA 3AEQB 3D0OA 4G5RA 1GPWB 1JN0A 4HLQB 5HKAA 3BA6A 3I4LA 3ZDBA 3P0FA 1ZN7A 4J16A 2CCGA 2O06A 5HA5A 3TXYA 4O2BF 5ICEA 2YUTA 1ZGCA 3L7AA 5F78A 3F5DA 2IU0A 2OORA 4NMWA 3LC1O 3L02A 5FUMA 4JBNA 5IBRA 1B7GO 2GN0A 2M98A 2DX7A 1DKLA 1NLFA 1HH4A 2JJ8A 2IVFA 2WM2A 3A1FA 5B57C 3KQWA 2AOWA 4LHZA 3JD0A 3K2EA 3V4RA 1GNRA 1AZLA 1ZIPA 4NTZA 1ZNXA 4OAPA 5BUQA 3OF5A 4R1MA 4Z99A 4AS3A 2J3HA 3HU5A 3SEZA 1T9ZA 1BMFA 2WAXA 2Z3WA 3BXXA 1PJ2A 2QN6A 4LS3A 4CMIA 2CVZA 1JYEA 3ZJUA 5HKLA 3DZHA 2WJYA 4LWPA 2X40A 1RQLA 1W49A 2Q46A 1EXDA 1AGYA 1TYAE 1HL7A 3HXKA 2H4XA 5FOVA 1FJGB 2EIXA 4NDAA 4CMIB 2JJ1D 5BSTA 4CVNA 3SBOA 2HA2A 2R66A 3I9LA 4MR8A 1U0LA 4BVEA 4Z1MD 2WLSA 1NATA 2MHCA 2XBMA 3HO1A 3RFTA 2HIGA 3R5SA 1Q50A 1JWAB 5JHHB 1KZGB 3OTHA 2R0QC 2PH5A 4PAOA 5DNDA 4HAYA 3L5KA 1NJGA 4PEVA 3VZSA 4MR8B 3O8DA 5FBLB 1PTJC 2H4YA 2PTHA 3GLGA 1MRZA 2UVPA 3ASUA 1RLMA 3FWHA 2CBXA 1VMAA 4R8LA 2OLJA 1GG2A 1IPEA 3UC5A 4GZ5A 4O4HA 1X7WA 4RJLA 4ISBA 3HLTA 1UC8A 4QDXA 3U2QA 5KYXB 3GLGB 3KS9A 4Z7JA 2PUBA 1EKXA 2UVPB 5EHIA 1SVOA 4XFKA 1T1RA 2WUDA 4QFDA 5FFNA 4G97A 3IPYA 3G9UA 1X7WB 4KIGA 1IK6A 4O4HB 3AQ4A 3H1FA 3UFXA 4G25A 3K1ZA 4OIMA 1CY4A 4K6FA 1NBEA 3THWA 5MHTA 1K1EA 4K9RA 2P78A 2OZKA 3T15A 1O9GA 4HWPA 2C92A 5TVKA 4AXBA 3UFXB 2MU1A 3ZXUB 4RVFA 4P6VF 4CGZA 1J0AA 3AI2A 2PHZA 4WK0B 3THWB 3CF0A 3TRIA 2WTXA 1RYFA 3M4ZA 4QGSA 5CYOA 5LMNB 1SG9A 4Z4QA 1P2VA 2Z2XA 3D3QA 1QYDA 2B30A 2I7VA 3I5UA 1KJJA 1UKEA 3L4SO 3AUTA 5CT5A 3AKYA 3VJRA 3W5HA 2IHYA 2IS2A 2FE4A 1QF7A 1P1BA 3QVOA 4IHJA 4KPGA 4RMIA 3LL4A 1F51E 3SJAA 3MJRA 1E0SA 1UFQA 1L7VC 4EGFA 3W05A 3MD0A 3WY9A 4DQLA 4AS1A 2PLNA 2YZKA 2ACEA 5HZKA 4GFDA 1DWQA 1RXWA 1ODJA 4IHJB 2DSNA 2AIRA 2BEVA 4RPIA 1YB6A 5D5PA 1WMFA 3T1QA 2B5OA 1GVHA 1KJNA 2NZVG 2B4YA 2M2IA 4AZVA 3QENA 4L3OA 3W2FA 5IYZA 3FNRA 1KJ9A 1VKOA 1TCBA 4RLFA 2QM3A 1HO3A 3VDXA 1Z74A 3W34A 1SXGA 4KQ9A 3W5JA 2BEVB 1DAEA 3O3MB 4IJUA 5JSYA 4OHRA 1J56A 2ETXA 3HUTA 2WJJA 2JAPA 4YRQA 2HYDA 4JEUA 1EWRA 1L3IA 1EFDN 1OY1A 5IYZB 3PEUA 3F2IA 3KR0A 1OZGA 4Q4DA 4G0UA 3WRVA 3H8SA 1XMVA 3F0TA 3ODPA 2HXSA 2HK7A 4W5NA 2GD6A 1QDEA 1RVV1 4PIPA 2YIVX 4QTTB 3G2IA 4QAQA 3GZJA 5GM1A 4YR9A 2ZREA 3QU7A 2P2SA 4NMLA 1XZCA 3PDHA 5K51A 3WIEA 4A0QA 3PNYA 3V32A 3PVCA 5DNUA 4FGJA 3RRBA 5JW6A 3RVOA 1XUOA 4DNFA 1PUXA 1SCJA 3SR4A 1YS9A 2PU5A 4JLWA 1JV2B 2FHPA 4IGIA 2AWNA 3FIUA 1ND6A 3S70A 1MG0A 1VE1A 2H07A 3D2BA 1EVYA 2QPLA 4ZWNA 1WDMA 1R9GA 4RF2A 1FDWA 4UZEA 1IUPA 3QVMA 4WA7A 1AKWA 3C8UA 3WNVA 7AT1A 3K0AA 1PE0A 3UPUA 2AEFA 3DFUA 4TTTS 5AW8A 1YDMA 5B53A 4ZYWA 2EBWA 1XD8A 2O0HA 2QTAA 4BECA 2YHUA 2C2ZA 2X0EA 4RU1A 1I2ZA 2C61A 3N86A 4H08A 2ZJYA 1TAHA 5J23A 4MLZA 3K0AB 4H3VA 3V8QA 2JA1A 4WCFA 4LV6A 2H8KA 1DQPA 2AEEA 3M5CA 2R8XA 3OHMA 3TCKA 1JR6A 2ZULA 1U2RA 3B3FA 3D4IA 1K66A 2QORA 1IL0A 2PEZA 3BKWA 1IZZA 4TUYF 1C9MA 2A9VA 1NAIA 3NHFA 1OXTA 4KX5A 3AC0A 4N0PA 3W8RA 2HO5A 3CLUD 4UQPA 4EI7A 1C4XA 3V8VA 2O2IA 4JS0A 4WCFB 2OAGA 4ZHQB 5KEIA 4PYQA 4BPRA 2R1TB 2WB2A 2FKNA 1ZP6A 2X2FA 5HUHA 1NL3A 1Z9BA 2OCAA 1QZXA 2I2FA 4XWGA 4YCNA 1Z4JA 2BOVA 1OMOA 2A4KA 3L18A 5F4ZA 3T5AA 4BE4A 3VPGA 1W44A 5LN1A 1H2ZA 3URKA 5TLSA 3NH6A 2IU6A 3QW4B 5BSKA 1WV0A 3RKSA 4KQ2A 2IP2A 4DLLA 3L7NA 3IP6A 4EKIA 1GGEA 1JQEA 4MV6A 2X8WA 4EJ2A 4YMIA 4M1KA 1FFHA 5FUQA 4RDXA 2QN1A 5TF4A 1NR7A 3BOSA 1KQNA 2XLCA 2VF5X 2OUKA 1Z5NA 4F6RA 1GQOA 2UUBB 3ZLJA 2ZZMA 1Z07A 2XY4A 3CEAA 4ZAGA 5F35A 1MO2A 1OW3B 3RSGA 4KRXA 3ZQJA 1TC2A 2ZRIA 1G3MA 3GFOA 1YCHA 3RYIA 1KO4A 1OREA 2C42A 4CEHA 4M7RA 3PF8A 3BWEA 1ZM4A 4R1UA 3JQ8A 1MV5A 4Y67A 4FCCA 4F6RB 1G5IA 4JL6A 2NZ8A 1FU4A 1Q3KA 1VJ5A 4JVSB 1FPQA 4H15A 5JASA 3LSTA 3RYIB 2OQVA 1U2PA 3VU3A 4ZQCB 2CNOA 4I9UA 4CEHB 2G08A 2V6GA 2NYAA 3JQ8B 4FW9A 3HPQA 4DR5B 1ICEA 2JIDA 4LMPA 1E99A 1EX9A 3DE7X 1FFCA 3RE1A 4GDFA 4MTLA 3QFTA 4DC0A 2O8NA 2DWOA 4UAUA 2WJGA 4YAEA 4LF8B 2DBQA 1HG0A 2P9EA 1P7CA 4X8HA 2OR3A 1ZINA 4D3DA 5C7YA 3OQNA 3RC2A 2ZAGA 1MEEA 2OV8A 5AM3A 4GMGA 2I8CA 4HWOA 1P19A 1SXJA 1TAQA 2FWNA 4DREA 2WZBA 3A6KA 2BEJA 2XE7A 3ZV4A 4UHJA 1C7ZA 3RS9A 4FMDB 4CM8A 2HMSA 1IUOA 1E2HA 3GGDA 3ZCQA 2VPIA 2XNJA 4C4AA 3ZW7A 1V8DA 1H6DA 3N8KA 4OJQA 3LSYA 1XHFA 4GPTA 1ZA2A 3ILYA 4KO3S 4FZVA 2PYZA 4CM8B 2DWUA 2WTAA 2YJZA 3BXOA 1TEVA 5BWOA 3GX1A 3KQYA 1WUTA 4N01A 3SSNA 3GMSA 4B3CA 3QUCA 1OJLA 2MSDB 1J90A 3A9RA 4R1QA 3RU3A 2HZ7A 4UASA 2IZOA 3HCBA 4QXRA 3ZHZA 2AUNA 3PKZA 4YPVA 2Q21A 5CHYA 3GA0A 4OYRA 2IGBA 1JQJC 1ZCFA 2HSZA 5HTKA 4PZ0A 4Z7NB 2CV0A 1JLHA 3DEJA 1O0SA 1NZJA 3VNQA 3L8EA 4JI6B 4LJSA 1IJKA 4QHTA 4IFBA 2H2WA 2W4IA 3AI7A 1THMA 3CWZA 1GXSA 2AI2A 1L5VA 1JPNA 2C0PA 2D1RA 4M21A 4CG0A 3VSAA 4EEKA 2XCSB 3T8YA 2ZRJA 3MQ4A 5L3RA 1KYIA 3O94A 1EJ0A 3PQFA 3HB9A 3LUDA 5ICGA 1UANA 2VHUA 3CF4A 3F6PA 3DE0X 1QMPA 2FK8A 3QVWA 2FWIA 3D2CA 3A1VA 4LGVA 2UU9B 1GXSB 3TR0A 3K2QA 2GPBA 1FP6A 2VNJA 3OU7A 1WCV1 4KSYA 5JNWA 3D8HA 1QYRA 4LVCA 1UINA 3QMVA 1I7SB 5GY7A 2PL9A 3FCXA 4RY8A 2POCA 1E3SA 1ISHA 3PS9A 5J63A 4PPFA 1EVQA 4LZLA 4IJ5A 2X7HA 3L7BA 5JC1A 4DSNA 3BFJA 3B3AA 2J07A 2OECA 3PZBA 4UVHA 4NE2A 1CS0A 4ASUD 3PWTA 4Q16A 3JS5A 2JHAA 1W8DA 1B8UA 4LJ9A 3AWDA 1SKYE 1UP4A 3AUJB 4LDPA 4TL6A 1EDBA 4QUGA 3ROKA 1RXYA 2BZGA 3FAKA 4QQRA 1X92A 3TVDA 3TL2A 1HL3A 3ICPA 5T8KC 5JAUA 3GJ0A 3ICEA 3NT2A 4BEVA 1M2OA 3U60B 1A9ZA 2OM2A 2P9QA 3I6ZA 1EGAA 3R5FA 5AM1A 1AH2A 1XN4A 1EWVA 3HVRA 2C8JA 1DEOA 3LM8A 4BVKA 3ZBPA 1T2AA 1M2OB 3OQBA 4FDLA 2W70A 3HACA 1CRPA 2BF4A 4Q4HA 1RPTA 3HCPA 4PO8A 3KB8A 3I92A 1NPTO 3ETHA 4W9MC 2ACVA 4QFCA 3ZWDA 3QYJA 1VPLA 3JVDA 5FPYA 4PFKA 1S2MA 3KC2A 2A5FA 2EFHB 4KAFA 2QV7A 4Q4HB 1RWVA 2X6QA 4LDAA 2V74B 1U02A 4NBKA 3N7AA 4D4KA 2GA9A 4NQZA 1RRKA 1TM4E 1ZX1A 2G7ZA 1RI1A 2IELA 1Z28A 2WUEA 4FS8A 4RIGA 1DJQA 3R23A 3CC8A 5T4HA 1JE1A 2B36A 4IVRA 2GF2A 1MHPA 4RZUA 3IR7A 1T0UA 1Y1QA 2AS0A 2YWDA 1JZSA 3L4BA 2FLKA 1NKSA 3SBEA 5HJ5A 3CURA 2IY7A 4PXAA 3C3PA 4IDBA 1XQYA 3WB9A 3T4XA 1HURA 1EBFA 3AJ8A 4R2XA 4RTPA 4C2UA 5TQVA 2IYQA 2QSJA 3QK7A 4TVBA 3I9FA 4U8GA 5LJIA 3Q9SA 2JLQA 4DR3B 2YJ6A 2FFRA 3DXFA 1ZIXA 1B2LA 1YBMA 5LXTF 1TYCA 1W5FA 1H85A 1JQBA 1PQPA 3UV7A 2V9CA 2OEPA 2J0SA 2V96A 5C2JB 3RT7A 2M1ZA 4DSAA 3QEAZ 4BRUA 3OCCA 3U9SA 1ZYUA 1T9HA 3P4XA 4YCCA 4CQLA 1EB8A 2DBZA 3VU8A 1YRAA 4US2R 3WWZA 1T2EA 4CKYA 1R18A 1Y1TA 3EF1A 4E03A 5H68A 1N3YA 1YI0A 3OESA 1BJRE 4O8CA 2VHZA 2Z04A 4MR7A 5I7SA 4CQLB 4ZEMA 4XDYA 4JYAB 4EUFA 4L73A 4O1IA 1KOLA 1RHRA 4YFVA 4KRGA 4GQAA 4R69A 5TVGA 1I01A 3FSGA 3L49A 2FZ5A 1JU3A 2FUCA 2J3JA 3BIFA 4MR7B 1KQ3A 1QF9A 4P1ZA 6Q21A 1TF2A 5FFMA 4HAUA 3PG5A 4A91A 3RQIA 2NXCA 3VOBA 3R3WA 5UKDA 3NIWA 4G81A 1UPXA 2C82A 4YASA 3RASA 4BNVA 4D9BA 5AVZA 5DT2A 2QUKA 4HGQA 4X90A 4YRNA 3FB1A 1E1YA 3Q9UA 5EIOA 1ONPA 4LBVA 4IG9A 1TCCA 1D07A 4IF4A 4RM3A 4B43A 1WHTA 1PV4A 3CRVA 4B2LA 2FPGB 1YB4A 3EC7A 5ALDA 5JAOA 1GCIA 1YJ5A 1MC5A 2Y77A 3ZWAA 2WPDD 3FKJA 1HG1A 1IN5A 1K4KA 3TGPA 4NSNA 4R40A 4A0GA 5FBHA 1S8AA 5FO1A 4E5VA 4MW7A 2YHIA 2B5WA 4FI3C 3B52X 4QOIA 2XRMA 4AMZA 4C3ZA 1D1SA 3ITDA 3K9HA 2O0LA 3KLNA 4H17A 3PA8A 1JVNA 1VGVA 1FYVA 1W2GA 4YCJA 1NRXA 2XXAA 1SK9A 1YU6A 1USUA 3Q12A 5CX1B 4KVAA 2YHIB 2F1RA 1O5TA 2PZFA 2R5FA 1JFVA 1I2AA 1KP3A 3VNAA 4DCSA 2K7FA 2GZMA 3Q7EA 4G85A 1C0EA 2C9DA 2DQSA 2H0RA 5K8LA 1A27A 1BWRA 3VDQA 2FTKE 1E3JA 4MUMA 1G8AA 4PYRA 2DHEA 4GX5A 1A04A 5AW6A 2ZS7A 4C7BA 1ESDA 3BXEA 1XCOA 2QD3A 4BN0A 4KFUA 4CG3A 3B9QA 3IP5A 1JMKC 1L5GB 1P73A 5LB2A 4YYZA 1F3LA 4HEA1 4YXFA 3M6LA 4ZMBA 5TGZA 5LYJF 4HDKA 3BN3A 3EARA 4MAAA 3C5WP 4X3OA 4B1FA 1IFXA 4KNVA 3UTDA 1Y8RA 3T1NA 3CMMA 4ER0A 1C1XA 1F8FA 3LQ2A 2EBFX 4I9HA 4IG4A 1Z29A 3TSYA 1FXWF 2FF7A 5DIFA 3WHKA 3LX5A 2NP6A 4HDKB 1YI8A 3ZV5A 3L06A 2GAFA 2ST1A 1F8XA 5KHAA 2GILA 3F5QA 4X3CA 5TY0A 1R15A 3MEQA 3IQEA 1XP8A 3U3KA 4TOIA 5GZ3A 1C1XB 3L6EA 3B78A 4M0LA 4QYSA 2JAHA 3AHHA 3MJCA 2EX1A 2X1MA 4HN2A 3WB2A 2XIJA 4WDQA 1CZLA 3Q3VA 2ZJ6A 3PC6A 4WNCA 2ONZA 2XF8A 1V8ZA 2WWIA 2XD9A 3HWX1 3HJNA 2E1RA 4MUJA 2XA2A 1HF3A 3DBLA 2GFHA 3ILHA 3NO4A 4J2TA 4NPCA 2X0NA 4K6KA 4KX3A 2O0MA 3FG9A 2JCYA 3ZWWA 4D3FA 3LL7A 4F60A 1M2WA 4KFTA 1UODA 5FQOA 3BFKA 3G59A 4JMLA 5HIAA 1X7ZA 3NCTA 1LCIA 1TFUA 1W4RA 1JG7A 3DBLB 3K0CC 4IYRA 3GA7A 4Z0TA 4D56A 1KDOA 4EK9A 4TWIA 4LN1A 3VXKA 4EZEA 1UPBA 3GLUA 2H4ZA 2QUAA 5FADA 1GT91 2XOKD 4W1PA 1FLVA 3KJQA 2JH3A 5FBQB 1X7ZB 1JIVA 2ZYWX 3T9DA 1A98A 1UT6A 3A9CA 3FPHA 5JDIC 1YQXA 4GPZA 3QKSB 1FTQA 2IKQA 4HVAA 4R5MA 1ZC3A 4WX2B 1A8HA 3SXJA 5K3DA 1OZAA 1RXUA 1MB2A 4KDFA 2R3SA 1I3CA 3ORHA 2ZJ3A 3VR1A 1JR4A 3QTTA 4NHOA 1C9NA 1IRXA 4Q6BA 3JQFA 4H1WA 1RHJA 4OA8A 4EELA 4DMKA 5I4CA 4JELA 4TKZA 3ZBTA 4BWFB 3C1TA 1X74A 3KL4A 1PT7A 1V4VA 3FFAA 4J0QA 5GVSA 5I9IA 4M0CA 3CZAA 1SVIA 3MWJA 2AZMA 3WYNA 4CDGA 1ETUA 4ZV7A 1NQWA 2O4UX 3Q2OA 2I66A 2Q0SA 1QGYA 2AKYA 4ZZ0A 1DIHA 4I19A 1J9EA 1XLUA 4L22A 2QZ9A 4JI8B 1SBNE 2TYSB 2XZDA 1H2XA 4PWYA 2GPAA 5U1PA 2JASA 1JALA 4FT2A 4CDRA 1M6YA 3JAWA 3WLQA 3DVSX 1JQDA 1OC4A 5GZ6A 3BQNB 1MORA 4QRIA 3U4MA 1PU2A 4X20A 5FLYA 4KNYA 2G0AA 2PT5A 3U7JA 1KKUA 4NG4A 3JAWB 3GUUA 4KE6A 4A8PA 1EA5A 3ZVLA 4ZYUA 3D3WA 3RIMA 2J4FA 1BXGA 3CS3A 3NFRA 3EIFA 3NDRA 4LE1A 5H59A 5HZMA 5DNYB 1NQTA 4QXOA 2FFJA 5K01A 4IHKA 3SZ3A 5AUOB 5IVKA 2EATA 2ARKA 4V2IA 1IJEA 1WSDA 2BBSA 3D43A 2W00A 4K7JA 1NWHA 5FA6A 3NGLA 3ZBUA 1D4FA 4I46A 3KT6A 1BXGB 1U04A 1ZUD1 4LDQA 2PMEA 4E12A 1E9SA 5KOJA 3BMXA 4GRIA 3DCYA 5LA6A 1CEEA 2QKYA 3H7AA 4TWRA 4D9NA 4LX8A 5EJFA 4C0HA 4I4CA 1ZK0A 4DQVA 3VPAA 4EZBA 3NVKI 2R6CA 2V7BA 4R3NA 4CR6A 1XDUA 5F12A 4LHYA 3RYHA 4KMMA 4DIBA 5KOJB 1CB0A 1Y6FA 1QRRA 1XEWX 5DEIA 1DBRA 3I04M 3AVWA 4BDTA 1E6KA 4MWCA 3G89A 3D0QA 4S24A 4LWOA 2OXFA 4P3KA 4RZ2A 5BYJA 3OPYI 1EFKA 3V4PB 3RYHB 3WKAA 2A0XA 2WI8A 3AFOA 4QYIA 3PPIA 1Q91A 1UMBB 1JA0A 3G85A 3BGDA 4E2YA 2Y1DA 3BL8A 4KO1S 4EHBA 2E48A 3UWOA 1GPAA 2QVXX 3DHVA 1U0TA 3EIXA 3LLMA 3FUWA 3OPYB 4QYIB 1RRMA 5EWLA 3OKAA 5BW8A 4TMXA 4DJAA 2JD2A 1NVUQ 3O83A 4TL9A 4C9BA 2FW6A 4GGMX 4JEIA 4FMPA 2XRFA 1C8KA 1JI3A 3VDRA 2WZDA 4HJXA 1TZ2A 5EWLB 3S2IA 2JPDA 1BXZA 5CCBA 3I6QA 1A4XA 5TEWA 4IJKA 4BQFA 5CX4A 1A69A 5IANA 1ZQ1A 2AVNA 3CX7A 2C0CA 1NVKA 4XOUA 4MHSA 3R5TA 4UXHA 4ZO6A 5EKDA 2B2XA 3CRNA 5LBUA 1VCOA 3MJ4A 5BN4A 3H5RA 3U3XA 3IC5A 5FA8A 1NXXA 4Y18A 1YTUA 3OPXA 1SB8A 4TXHA 4LW8A 3QITA 3UB3A 1NXSA 2FNAA 3ZQ6A 4EW6A 4D79A 4JI0B 1NQUA 1ACJA 2X8LA 3OFSA 5BN4B 1AQNA 1EGHA 4G0NA 2O8DA 1SFRA 1JHXA 4IXTA 2IODA 5AFSA 1P9NA 5JS6A 4AKHA 5KTPA 1RABA 3HS3A 1Z0JA 4IKOA 2Y6VA 4JBYA 1E2DA 5BOSB 4C0LA 1ZJZA 1X8KA 2QNBA 4U7TB 2NT4A 1SRQA 1JEJA 1UZLA 1FUEA 4UNNA 3PXCX 8ABPA 2H1FA 2O8DB 2GHTA 2HXYA 3RHZA 2BDUA 2QTFA 3ZYCA 3Q8KA 1OAAA 1QJ4A 4MQLA 3GLRA 3PUHA 4GBED 4Q7JB 2V7QD 4V0SA 3UOGA 4HOYA 2GK6A 4I1UA 4MI9A 5IVDA 2IL1A 4CE6A 5J2UF 1SVWA 4JA0A 4EF5A 5KOHA 1J7KA 4YBZA 3RHTA 4YAGA 4D9JA 1U65A 5AT1A 3OE7A 4H7HA 4CDMA 1QZUA 1U2GA 1ZUIA 3A05A 4GP9A 4XRRA 4JJ8A 1OH8A 2LBPA 5U4XA 4EL5A 5K0JA 3U09A 4QE3A 4EGCB 5JI2E 4CG2A 4UUPA 4MIYA 1O6FA 3VBCA 5F7JA 3COVA 5KOHB 2H06A 1GPNA 1Q6YA 5FXMA 1IN4A 1TVKA 3QJYA 3K1JA 3U7GA 1HYQA 1UBOS 2H2AA 2WMOB 2KBEA 3PCXA 1KBOA 4XJSA 1CRLA 3K5HA 1QOQB 4WZZA 2VEDA 2LWIA 1W6RA 4FE4A 2B0JA 4TN5A 2H85A 2VJCA 1CLEA 3JQGA 3ZW9A 3SJCA 1LNSA 1TVKB 3IBYA 3IMKA 4FFRA 4ML3A 2F55A 2HN9A 5BORA 2VUUA 4AUMA 4HDAA 3OH8A 4JKYA 2OHFA 3JQGB 1TQDA 3EWSA 4OTZA 6REQA 1I0ZA 5LP6F 1Z6PA 2IYZA 1B6RA 1KETA 2QMQA 3FSRA 4OG2A 1FVOA 2E4VA 2WUWE 2XA9A 3KVOA 4K2HA 4LRXA 1BJKA 3OI7A 3UCXA 2P30A 2VDJA 6REQB 1Q95A 5JZOA 9MHTA 3BK7A 2XDQA 3QRWA 4J49A 5A3RA 1XA3A 5DASA 3WK4A 3PCTA 4Y30A 5JBQA 4DR6B 1SUBA 4AO7A 2GAAA 2XNDD 4F7WA 2B9VA 5ER6A 2R97A 1W5EA 3KAJA 4RY2A 1DJNA 4BTEA 2XDQB 3OETA 4HADA 2R1VA 3L9XA 4ZI7F 1CC1S 3BGOS 2V1XA 4J0CA 3F6EX 3GVCA 4XDZA 3R3VA 4IZHA 4PXSA 3TNYA 2VL7A 3FYSA 2AD1A 1Z47A 4PNPA 2BH2A 1QE5A 4MDEA 2H00A 4DSOA 4I9GA 5T3YA 2DJIA 3LFHA 4NBNA 3IOBA 2R1VB 3LBAA 5GADl 2EEPA 5F7OA 3TD9A 1COZA 3IHWA 4I4NA 2O2DA 2Q3CA 3NNSA 3U3MA 4BO0A 3N8IA 4FZJA 4I1OA 3KALA 4HXFB 4ZARA 1QGDA 4CETA 5A3SA 3AWIA 1YD7A 4BE7B 2GH1A 3ED1A 4A27A 5IM4F 3EXIB 3VR5A 3CH4B 5TRTA 4BO3A 4Y2UA 1A7KA 4I1YA 3Q8XB 3KPVA 3DM5A 5D3ZA 3QU5A 3S2GA 3SLRA 5CEJA 4Y2SA 1ZL0A 4QU5A 2IXGA 3CQ9A 1THZA 1WP4A 2IX9A 1DV2A 4WCDA 5HK8A 1JR3D 1CQZA 1W9MA 2Y1XA 1Q7RA 2BN4A 4FFOA 4H60A 3NYWA 3OUUA 4HYEA 1B1AA 4MW4A 4QT0A 5JG7A 3VZDA 3AB8A 2VYND 5F2KA 3K3PA 5BV2P 1PHPA 2D62A 5K99A 3DKVA 3AONB 4G1FA 5F5NA 4CMEC 5JLJA 1B76A 4Q9NA 1R8SA 2YW9A 3SVZA 2DFLA 4FGLA 5A71A 3KKZA 1P7ZA 3AEUB 1NV8A 5GMOA 3EBOA 1HLDA 4DDKA 2PUEA 5EMLA 1NSFA 4XR9A 4E4TA 4EGQA 3OX3A 1TAUA 1U7PA 3HPRA 3K96A 4I1VA 9ABPA 5KJFA 4MS3A 1XPRA 2RI0A 3OT1A 4BZXA 3HYSA 4JBLA 1T0BA 2CDNA 1GCGA 2NUPA 1YZKA 3AHCA 4WNYA 2ZSUA 3EEYA 3KOUA 4L8VA 4ZTBA 1DX6A 5MN4A 4NEGA 1DC5A 1FYWA 5K8CA 13PKA 2PSEA 3PRHA 3GRKA 3D6TB 4JFAA 2YR0A 4LPKA 3D3KA 1E94E 4MS3B 2PZGA 1PZFA 1BVRA 2NSDA 3OWXA 1HX7A 3HZOA 1Y5RA 2ZBDA 2WIGA 4FOSA 1UXHA 2NUPB 4YIHA 4EKGA 1C9KA 1T25A 3PITA 5TPZA 2Q5FA 2AN1A 5AW5A 1ZGGA 3IAAA 2QG4A 4WZBA 2L19A 3KJXA 1W1UA 4QUHA 2ESRA 4K1LA 4OFWA 2OPBA 1NJ2A 3VNVA 3BWVA 4NBVA 4EW3A 2PLRA 1G64A 2I71A 2J3DA 4PYLA 5AKHA 2GM3A 5LZ4A 1ZUWA 1HI9A 1H8HA 2QR2A 3CWQA 3OEHA 2WF7A 2WSSA 1MJGM 3ET4A 2XWQA 3IUBA 4FX5A 4KTVE 4NF2A 4YWHA 5I5EA 2GFIA 5IHXA 5MDHA 1L2TA 3AHJA 3RSHA 2LUOA 1EWYA 1YJQA 1MOSA 4LQDA 5C53B 3OF2A 4KC0A 3L92A 1XVUA 1AURA 5BOVA 2FQ1A 4EWLA 1IBSA 1SVNA 3RD5A 1OWOA 4MYRA 1I94B 2FAXA 3ZDYB 1Z8FA 3WWDA 5EMJA 1K9VF 4F4UA 4QAJA 3KSBC 2RH4A 2P4SA 4LNAA 1HRKA 1MC1A 1TYBE 1UCFA 1GD1O 3NX4A 1QRUA 1OLSA 2GYVA 1JG2A 3F74A 4DM7A 4PBRA 1C30A 2Q1YA 2IIPA 3DBIA 3HB5X 4G01B 3T9EA 2WFLA 2OCKA 2RHGB 2ZR9A 2CCJA 3G1TA 4YCLA 1M1XB 2FSVA 3EUWA 4JL5A 2YXLA 1F2TA 5H3CA 4I3HA 1OLSB 5JDCA 1ECPA 4YGYA 4Z9YA 2A9KA 1C30B 3KHKA 2IPOA 2KS6A 1AK9A 5AVRA 2WFLB 2GT1A 3GJ8A 4PQRA 3WQRA 4ARIA 1H42A 1KDYA 3UYLA 3W3AH 4XLLA 1C3VA 1GEGA 1S7CA 2QAGA 3ZXIA 1H23A 1F2TB 4QOEA 3VTAA 4AU1A 1IG3A 1N25A 3NM5A 4GR5A 4PX3A 5EUCA 4B4KA 1NMZA 3EFOA 3R4CA 4EFLA 3FW1A 2OZLA 3B13B 1NUQA 3FNHA 3V7FA 4N3GA 4M55A 4QOSA 5F2EA 5C5DA 2DOKA 3B6JA 1BIFA 3BF8A 3MT7A 3REFA 3T12A 3UV6A 2QAGB 1PNTA 5KNCH 1GAWA 1CUIA 5J4YA 4IHQA 4FR5A 3EFOB 3QFSA 3EZ6A 3M34A 3KXIA 5B3LA 3BE8A 4YMSA 5IS2A 1YR2A 3ROTA 5JZBA 1HNXB 1ZH6A 4EUKA 3PUIA 4OHWA 1SBZA 1R0BA 4KLCA 4QBGB 4TYPA 1QYVA 4W8OA 3RLIA 1RTTA 2OHVA 3CEJA 2WIBA 3AZQA 2ZM5A 1U1GA 4D9EA 4C2BA 3NS7A 2V6IA 3L1KA 4OA5A 2OAP1 1RZRA 4EMTA 3MRXA 3AHIA 3S44A 2W2MA 2D3WA 4FYJA 1YRLA 2VDWA 5THXA 3K94A 3ROPA 3GA5A 1E3MA 2JJYA 3LA6A 5EE5B 4B3DA 2JB9A 1OC2A 3QYAA 4CT4B 1EE9A 3D6JA 4AK9A 1M8GA 4UBIA 2M32A 2VF2A 2FQYA 4TS4A 1K7XB 2GS9A 5ILOA 4DCVA 4P8RA 4ESEA 4DIEA 2VDWB 1J5XA 2ZKLA 1DUSA 1U8ZA 3SJ7A 2FOLA 5TDHA 1PYOA 2XE4A 3NPMA 3SC2A 3TQFA 1KWGA 3T0GA 3C3DA 4LYEA 2VJOA 2VFAA 1XROA 3DV9A 3KSZO 4TYNA 3LCUA 3EXEA 3I5AA 1T5IA 4N5LA 2VJPA 1M8KA 3W3AD 2Y99A 3I30X 2JANA 2WFMA 3C7KA 3SC2B 2PUVA 3IXMA 2YUIA 3IP8A 4GI5A 3GPDG 3K9GA 2Q3LA 4I1RA 3RIEA 3W7AA 2QX7A 3EXEB 2WHQA 4E5YA 3FWNA 5LKAA 2FEAA 4CKWB 4EMSA 2BHLA 3VR0A 4IRXA 4QLAA 5KNCD 3TLGA 5B6JA 3D81A 3QW2A 1L5KA 1I32A 1OX5A 1EVKA 2O1EA 3HCDA 1L9XA 3KFXA 4OB8A 4TN1A 1KP9A 4JT8A 4XD7A 4P22A 5IXSA 3RC8A 1XDSA 4LCBA 5K2MA 5CLHA 3W9YA 5AW9A 3DWIA 3TLGB 1ML4A 1AV7A 1MBZA 2P69A 2ZRHA 1H1LA 1XQWA 4Q47A 5TARA 3SQOA 4Z3KA 4UXIA 3CPSA 4LTMA 3UJ6A 1EJ6A 2G6BA 5I7RA 3HCNA 1C4OA 1DGQA 2F00A 2FEKA 4QFBA 4UM8B 3CU5A 3NI2A 4ZVKA 5YASA 3QWIA 5J43A 4UEWA 4AMUA 3BZBA 2I7XA 1UAAA 2G4VA 4G1BA 3TH5A 3HFRA 1PJBA 2O0KA 1S3GA 1H1LB 2DH5A 2X4GA 3DL2A 2Q3DA 2G8LA 2ZT5A 4OSPA 2RBEA 2OWDA 3FDFA 4QX6A 4PN7A 3SZOA 4HKTA 1WQ4A 1EIWA 4WXEA 3DLPX 3UBMA 2BLNA 4V0ME 1FSGA 3NWJA 1LC3A 4I2VA 5COQA 4RS4A 3U4GA 3QY9A 1K7EB 1QOPB 2V6JA 3OQPA 4NK5A 1YSCA 1VE5A 3D7NA 3NDBB 1OUMA 1EINA 4DBZA 3VYWA 6ABPA 3T3IA 3V8RA 4JQCA 3U5TA 1V1RA 2UUPA 2W8BB 3FTPA 4XVQA 3MHTA 5BWNA 5FI5A 1TUGA 1PJCA 1J0XO 3EZXA 1XFDA 2OVBA 3HKEA 3KWMA 1RMYA 4PHCA 3V3KA 1LKZA 1UK9A 2GTPA 4Y9TA 5CVDA 3UJBA 3H9CA 3OJWA 1NG1A 4QA9A 1OASA 1V1RB 4X7MA 4XIFA 4EHAA 1KYQA 4G0ZA 4BFXA 5EIEA 1BX1A 1SCQA 4C3VA 1OYWA 2I3DA 2V7PA 2X0IA 3HKEB 3U0VA 3QM1A 2YNMC 1CB7A 2VZLA 3BRCA 2BMEA 3VSDA 4ETIA 2OCLA 1MB4A 3R5JA 4A5SA 4W5HA 9LDBA 4ZDKA 4J07A 4L75A 4KXYA 5AHOA 3ZVMA 2EGUA 3BF7A 2ZKIA 1DJOA 5F21A 3CF6R 3EHDA 4C0XA 2K7ZA 5GPBA 1PCXA 2QK4A 2B37A 1BFKA 1KEZA 5HE9A 1Z0AA 2PX0A 3BB1A 1GUAA 2A67A 3KKKA 4HP8A 3SCZA 3OZRA 2BI8A 2JIRA 2VZ8A 2FPPA 2X41A 1FNDA 3MMXA 3TOVA 4R2MA 2WG1A 3TX6A 5ALOA 3KYDA 5F2OA 1PDWA 1Q1GA 2GBFA 3PL1A 1PSDA 1RYEA 1D2CA 4JCOA 1E2NA 1LDBA 1ZGJA 2FW7A 2GM9A 2QP4A 5B1DA 3RNLA 4EO7A 1PZGA 2B6NA 1H8ED 2RIPA 2WA1A 4LTNA 3SLGA 4JJ4A 2LZ0A 4OH1A 4IUCS 1SIWA 4N5IX 3JQ7A 4X8OA 3FBTA 4TQ9A 1JDPA 5DDIP 4ZVNA 2P6RA 1A9YA 5C8ZA 2R11A 3A36A 3T7KA 2HNAA 5BQOA 3COSA 5IN5A 3KEMA 1U8EA 1OB2A 4XIYA 2EW8A 1EG2A 1RWMA 4RV5A 1NM5A 3EC2A 4NULA 1WIWA 4IO1A 3JQ7B 1V41E 4ZEXA 1M0TA 1NNUA 4K28A 3WLOA 1VMDA 1TQ4A 1ZGZA 5CD9A 3L0YA 4D4MA 2AXQA 2HQ1A 3EXG1 3NC0C 3DWFA 5C8YB 3QKRA 4M1SA 1EGQA 1KI8A 2B8JA 5DBHX 4UAJA 1OXSC 2ZRPA 7ADHA 1Z34A 1VJTA 2G0TA 2NLOA 3ADOA 5C80A 4MINA 3D6FA 1WW3A 3U3DA 1AS0A 1ADBA 3ENWA 2HW8A 1U4OA 2EKLA 1DWPA 3P0EA 3QKRB 1SXPA 3RHFA 1RMQA 1ZI9A 2QYHA 3RTAA 3QEJA 2VP9A 2DM6A 1RACA 3FH0A 1A8QA 4HFJA 3VDMA 5J1SB 3K8OE 3RJTA 1SR8A 2PMFA 1WF6A 4G4SP 1XCMA 5IK2A 1LD3A 5SYMA 1XHLA 3S7ZA 4CFZA 2JARA 3V7NA 4P92A 3A9WA 2B5VA 1XO1A 1QP0A 3GJ4A 4OJNA 2QOEA 3FPJA 3NTRA 1FDUA 1K5GA 1QB7A 2P8JA 1NBIA 2CJXA 1HOXA 1VPDA 1AM4D 4L50A 4UOQA 3E1KA 3TDMA 1E9EA 3PQ2A 3GFQA 4KWHA 1D2MA 4TV8B 4B3TB 2QPTA 4MV1A 1DCKA 3FDZA 2CFOA 2PLAA 5TE9A 4H1TA 3EB9A 4ZAZA 4HRXA 1BVUA 1YO6A 2HU8A 2KMLA 3H1PA 2Z5LA 4GLOA 4ZJPA 4LV8B 3GT4A 4O33A 4R8RA 3NIDB 3LECA 1WWKA 4FSXA 2O8CB 2IZ1A 4K9PA 4W99A 2EU8A 1KXZA 2QZSA 1VG1A 2RGDA 3FDZB 3HM2A 5HHTA 2GN8A 2P7HA 2ZJ4A 4RXUA 4EFDA 3A1SA 4D0SA 3IOCA 4S05A 5BSWA 3MWGA 1Q7EA 1O9HA 5JYBA 5FTWA 1LLQA 2RJOA 5JCJD 3TOCA 821PA 4B4UA 2CUZA 3HJTA 3HWSA 3O4VA 3VHQA 4BMPB 3OOJA 1DPFA 2Q5CA 2DAPA 2RARA 1LV7A 2HBQA 2WJHA 2GO7A 3EODA 4J1NA 4RHXA 4TT3A 2C88A 3U3JA 3NMUF 2DPLA 4NHEA 3CF2A 1UMDA 3OJEA 2I99A 5F76A 2KSQA 1CULC 5DHAA 2H3EA 4MGHA 3USCS 4F46A 1SZPA 2BCEA 3FYCA 3M82A 2P1RA 1VGQA 3P2EA 4BAGA 2D0IA 2QQFA 4OJYA 1MRSA 1UMDB 2J3KA 3SYLA 1F06A 3EZ7A 4IDAA 4N3AA 1DWOA 1N7HA 1XMPA 4GH5A 4MUGA 4P35A 4BIMA 4Q9JA 5KPDA 1LQTA 3R3SA 4AYWA 3E7PA 3NOVA 4MIEA 4DY6A 4JODA 2PSHA 1RWXA 1M2GA 2X9VA 1VI5A 3LIPA 1PR3A 3UTCA 3M6VA 5IT9A 1N2HA 1TX4B 4EKYA 1ZY2A 1RQRA 2KM1A 1TC1A 3R24A 1AF7A 8OHMA 2I3GA 1VG0B 1TIPA 4GC9A 2HJHA 4DWVA 2BF7A 3BUSA 2UYHA 3PUYA 5BWCA 1XKTA 4DZZA 3PXXA 3TIFA 1FNSA 1EFRA 1TECE 3ZD9A 4DLBA 3D8BA 4GX0A 1WJGA 1TJ5A 1WCXA 3QNMA 1JQAA 1BH2A 2WBLC 3DDCA 4HB4A 4HFRA 2BBTA 1QE0A 4FFVA 4ZT3A 2ZT8A 2WAOA 3UO8B 3WNDA 1VL1A 2QD4A 4FDVA 3SSOA 4XX0A 3TOXA 1K6MA 4KW7A 2R7LA 3TDNA 3UGTA 3VC3A 4FBLA 1MX9A 2VQDA 5DM1A 1QVZA 4IYJA 1DFHA 3SJBA 5L8VA 3WGIA 2YW2A 4NNJA 5J58A 1A8SA 2WNIA 2WYUA 2ZB3A 3ZNQA 4W5RA 2Z9BA 2C2KA 2J67A 3EVNA 4A1FA 5HCIA 1RXCA 1XRRA 4BBPA 4XX0B 2R7NA 1J07A 4ROTA 3VJMA 4F3KA 2GCGA 3C70A 2A3RA 2I33A 5FDFA 3OFND 4H7FA 1ZR2A 3B38A 1E5QA 4GS5A 3AY7A 3EC1A 4DPLA 4U2FA 1H4QA 3KKQA 1HZJA 4UM9B 3CUUA 2EHDA 3OTWA 2OM6A 2OKGA 4IV5A 4KQJA 4KZKA 5AOCA 4IUYA 4LRYA 4EVRA 3C8MA 4NZZA 4RIIA 1FIUA 2XDYA 5ARBA 2E4ZA 5AW1A 4EY6A 4BP8A 3ZNPA 4DLTA 3WMGA 1GITA 3A9VA 3AR3A 4OV6B 3ENQA 1UOOA 1VIYA 5CFOA 1IQ0A 5FJJA 5IAEA 5BR7A 4JHXA 1Z22A 2WF5A 4PGAA 3O47A 2II6A 4UATA 2XB9A 4KGDA 4UZSA 4YBRA 1JBQA 5LU9A 3P9ZA 3I1JA 5DF1A 4JEHA 3HFGA 4NZOA 1XZJA 2Q45A 4YAIA 5CFNA 4RQAA 1K0FA 1Y7LA 3UMSA 3R9XA 1XD2A 4C7MA 2FYTA 2ZAOA 4LPSA 1H2AS 4LUCA 4KODA 4D7AA 3R0ZA 3UMYA 2J46A 3BWXA 5EYPA 4B6GA 3T9FA 4W5TA 4C7VA 3IT2A 2F8SA 5EIBC 2DKOA 1YBHA 3OP1A 4JJAA 4ZCLA 2BFMA 1XD2B 1U8UA 2WM8A 3DZKA 1CR4A 2Q41A 1BS9A 1FL9A 1QHFA 4YHBA 3ULKA 5C35A 1QVAA 2YINC 2VDQB 4HEQA 1VECA 2CMFA 3ICCA 3CB4A 1ZK3A 1D8TA 2V7XA 4HAZA 1LI4A 1WXIA 4FFPA 5ICSA 4RVOA 3AYZB 3LKDA 3LS2A 5BV8A 5K4GA 4DSUA 4JYZA 2GD0A 4B5LA 4AN0A 3PQ7A 1ADFA 2DTDA 5K6AA 3IEXA 3BCUA 4ER6A 1A9PA 4R2LA 1OWPA 1NRIA 2WHPA 2MIIA 5ES4B 4U2CA 1E7MA 1C1HA 4FCVA 4NY1A 1H94A 3OLQA 4MQMA 3QF4A 3KHSA 3TQCA 4YJ2B 1FP2A 1SXJD 1Q83A 2FMHA 2W2LA 4QREA 1U2TA 1M10A 1U0NA 2WHPB 1H3EA 2IT1A 1DNPA 1Z08A 2VBGA 4OHPA 1ECJA 3MIIA 4PYIA 2Z1DA 3QF4B 4ZQEA 3T9CA 3EDQA 4DPKA 3Q3EA 4BJHB 1UBJS 3KK0A 4NZPA 1RYDA 4XDHA 2G7MC 1OYOA 2JLWA 2ZI3A 3CFYA 3R7DA 1UK7A 4J0EA 2BGMA 4C5BA 2H51A 2QTMA 2VDMB 2VDKB 5KOYA 4R9SA 4RCYA 2ORVA 3DOUA 1PVDA 3I05A 4TLMB 3FUTA 4UMEA 5EHNA 4DMHA 4ZI2A 3GDGA 4Q03A 4CMCA 4MWZA 2LCFA 1WXFA 3S1AB 3T4PA 2G6TA 3HRHA 3I9JA 1AN9A 3NWEA 4FU0A 3IDFA 3ZW8A 4C4YA 2FMKA 2XGOA 5FYDA 3BWDD 2H2IA 2WE7A 3H8WA 4BQPA 1ZONA 1QPZA 5GV7A 4K3VA 5LD2C 5AJVB 4X92A 3JATA 4U9UA 1E6CA 2JGMA 4GPBA 1G8GA 3JALA 2F4VB 4H59A 1KVTA 3U5ZB 3PYXA 1YRHA 1TIKA 2OP1A 5IMBA 1UKBA 2DUMA 4H4DA 3TQIA 3JATB 4F06A 2UVQA 1XTIA 4RPCA 1SVSA 2J3EA 3FCYA 2RGYA 3JALB 5CH5A 1O1YA 4EYOA 3R0XA 4L15A 1KFKB 1LJUA 3OSZA 1M6WA 2RH9B 3O6VA 4RNCA 5K3SA 2A9OA 1C3JA 1MU0A 3FPAA 2M9MA 3IEKA 2QV0A 3GRAA 1Y7HA 5NLLA 1YKSA 2O9JA 1W19A 2PEYA 1XA0A 1FUYB 4R7TA 1DEXA 1KJWA 2H1CA 1R6VA 1X14A 1XKQA 2BGJA 3FKQA 4QD3A 1KRWA 4MYDA 1XLVA 1IM5A 1SCNE 1BDJA 3HN2A 2I2AA 3I28A 4G41A 4M0FA 4RSMA 5B3JA 2WF8A 5E8JA 3U39A 5FWYA 3GBSA 2ADOA 3K31A 4GKKB 4RQTA 1J8YF 3LCJA 5FLKA 4MMZB 3QI7A 1EFAA 4R1OA 1QYWA 1NVTA 5FWYB 3D4LA 1MD9A 2JRLA 3I8SA 4DRYA 5C34B 4II7A 1IN1A 1Q84A 4GKBA 5DSXA 4EFMA 4A4DA 2JF0A 4KRYA 4G3XA 4UUOA 2GJ8A 3AB7A 4KTTE 3OCJA 4PLPA 3EN0A 3QEMA 5FWAA 3MRTA 3SQNA 1RSZA 3FCUB 3R3JA 1XTBA 5BSRA 4B40A 5MN5A 1GN8A 2IDKA 3B36A 4RD0A 2DLCX 4HQLA 3B20A 1ISSA 2Q4EA 4X8LA 1V37A 3MLEA 3QEMB 4EDFA 4MLCA 1U94A 4INOA 3ESYA 1JKJA 8AT1A 3LO5A 4DA8A 3REGA 5HZHA 4J3FA 1IQPA 1EWTA 3KELA 2AYZA 1YJAA 4IWYA 3EQZA 3ACCA 1QTNA 1U5AA 2XTJA 4PTLA 1FZTA 2O3UA 3CE6A 3IJPA 3KFVA 1PQ4A 2VAVA 1JKJB 1VBMA 2XUKA 1AXEA 1F4LA 4RK6A 3WIDA 4M1ZA 1GU7A 2VJMA 3JWHA 1TOAA 1KZHA 4J0HA 3CBGA 3JSAA 1P7WA 3WDMA 1TLTA 1ZD2P 2OQIA 1NVWQ 3JARA 4MICA 3LY7A 4B4WA 3EUFA 1FVXA 3O0TA 4WZAA 1N5DA 1DEKA 2R00A 1R6UA 1EDOA 1TVMA 3I1IA 1P7PA 4ED9A 2V98A 1ULSA 5IKOA 5A7HA 2G9RA 1LBSA 4QOHA 3HWWA 3JARB 5L4LA 3K70B 1V1MA 2C9CA 4R9RA 2I03A 1FVHA 4WZAB 3FHTA 4Z7OB 1VE6A 4FPXA 2ZXFA 2LCIA 3R77A 2HF7A 3TTYA 4I81A 4MYUA 4Q9IA 5H02A 3BD8A 2XPCA 3E9YA 2YV2A 1Q1AA 1IIBA 1QCDA 1T8SA 1V1MB 2FP4A 3IS3A 3PNSA 4O4LF 2CLIB 1NYLA 2HJ9A 5BYBA 1K6XA 2QD1A 2OXEA 4FW8A 1XLTA 5IZ4A 2HR1A 1BGXT 1JPJA 1VE9A 3H9EO 4AB1A 3WX0A 2FP4B 5JD3A 2A57A 5EIAA 2QRNA 5DIZA 1O94C 4L16A 3TYXA 2O2EA 3DULA 3HTXA 3C7TA 1KQGA 1IUKA 4FNAA 3DLTA 4IINA 5JZVA 4MJLA 5HIMA 3TLZA 1X86B 1UBNA 1NF9A 2C7BA 3OMXA 2E1PA 5E6SB 1ZRSA 4NMXB 4C03A 4QPJC 4J16C 2WTBA 3A31A 3SC6A 4EA9A 4KGZA 1SVMA 5KZMB 1QK5A 2ZJBA 2Y27A 4AKIA 1QQ7A 4E08A 3VM6A 4EITA 1N5LA 2FEWB 4OK6A 2OORC 1L4UA 3DBOB 1CF4A 5BYAA 4JVOA 2N9UA 5CIQA 1L4YA 1NUTA 3PBKA 3IVMA 3PC4A 5H81A 3T3NA 1NXQA 2YKGA 3HR8A 1TL7C 1Y9AA 4ZVOA 3X3HA 3LX6A 1Y4AE 1XRLA 3V1LA 1NVFA 4WKBA 1MENA 2PKXA 2VNIA 3HSYA 1ST2A 4FFSA 4HDOB 5A1JA 4CRWB 1B15A 3CH5A 3IIIA 1JJVA 4RK7A 2DSTA 1EUZA 2Z98A 3HMKA 3PUJA 3N6XA 4FQ7A 4Z53A 1RWPA 2HIAA 3AJEA 4QVIA 2F8TA 1RFGE 4EHFA 2Q6OA 1ABBA 1AUVA 2TMDA 2XQJA 2ZWVA 3BSWA 4O3FA 3TRKA 9ATCA 1APBA 3PJRA 1Y3BE 1GGNA 1Q3HA 4K6OA 3FCCA 2CEKA 3U19A 3AT1A 5BQPA 3UW3A 4E2WA 4DZTA 5DRTA 4L0CA 2P65A 3GARA 3QEKA 2Q5JA 1NW7A 1S02A 3RUFA 1OXKB 1JHUA 3MELA 3R7BA 2V6MA 4C6HA 2NVBA 3M1AA 1OI3A 2QLFA 1E0DA 2A3NA 1QLWA 2EF1A 2AGVA 1QX4A 3HNPA 4HY3A 4Q9LA 3S5UA 3W78A 4F2GA 2ODWA 3AERA 4RFLA 3U9TA 3WK5A 1JJ7A 4MROA 3RANA 4ZCRA 3UKOA 1D8AA 2Q5QA 4XASA 5DX0A 2WZQA 4CLHA 3IKVA 3BBLA 4QEZA 2NNWB 2C5GA 1VE3A 2ID7A 4KWCA 5CEEA 3TLXA 1KYWA 4MUFA 1SUAA 2PKCA 3U9LA 3UWSA 3QUQA 1A8UA 3A32A 3AERB 3CNQS 3IBCA 5IC6A 3KQOA 3BIJA 5AKLA 1IHPA 3CX8A 3FDIA 3ZIAA 4Y1RA 3MTIA 5IBQA 3P7MA 4F71A 1EBUA 5IDWA 1WLSA 2I1WA 4OGGA 3GRCA 2EWVA 3D7RA 1LX6A 4WN3A 3VJLA 3RUPA 4QM6A 1EWKA 1OI4A 1UBTS 3CN7A 1M8PA 3Q4GA 2RE8A 2CDCA 4R16A 5JJCA 3DQZA 2IYSA 4DLXA 4E3WA 4QRDA 4UTOA 2A14A 1F0PA 2XHZA 4Z0PA 3SAJA 1R4AA 3SD7A 2WJWA 1T5HX 1TE2A 3ZDFA 3MPOA 1ZH4A 3WOHA 2RH8A 3LQ1A 4RQUA 4FBMA 3A4MA 6CHYA 1M34E 1QG6A 3BCRA 2WRZA 4B3FX 1IVNA 4KFCA 4RY0A 1MNQA 2HADA 1OZ0A 3M70A 3OPMA 4N6GA 3W4IA 2DHQA 3HY6A 1KO5A 3NWOA 2JLYA 4L07A 2PJRA 1THTA 3QOYA 3OQIA 3PNKA 4MWBA 4BVAA 4TYYA 2X0RA 2XADA 4F96A 3GPLA 5DW3A 4NBWA 3B2EA 5CLFA 1AQJA 2XUOA 1P7YA 4AJ4A 3ADDA 1ID1A 3E7FA 1VFPA 3HDGA 7YASA 3OQIB 2X1HA 3VOSA 4K0KB 1ZNYA 3NZEA 5K05A 1RCFA 1UT8A 2FUG6 2VDVE 3MQ2A 4AFNA 4CMJA 2GXAA 1E6UA 3MTEA 5AJZA 4D97A 4BU0A 4EABA 1VHQA 2BGIA 3IBGA 4HF7A 4N49A 2D5CA 3IQZA 5EE1A 3VR3D 4B80A 1CIVA 1G4AE 1VJ1A 2ZQZA 4TMVA 2IF2A 1P45A 3EWIA 2XAUA 1ZQ9A 5D3QA 2IV7A 3KSAC 3MYYA 5T6BA 4EGAA 1ECGA 2VG8A 3TZHA 1G5TA 3COWA 1AUQA 3DHWC 4B6JA 5AVVA 1NI5A 2RGCA 1QANA 1SG0A 1ZK2A 4V39A 4DIOA 1OBOA 1GZ6A 2WIFA 4HH1A 5HRAA 1GCUA 2YZGA 3ZYZA 2VXCA 4KBGA 4Q7EA 3LCVB 4M0EA 4V2UA 2CLEB 2DCMA 3MERA 4LKRA 4ACAA 2YYZA 4KXUA 5IAOA 4C0WA 2ZJ5A 4IRMA 5KNDH 1YKGA 4GI7A 2QU8A 4JDPA 3UNXA 2A92A 3HJBA 4ZYZA 2FEMA 1NAHA 1N57A 2HPHA 4NV3A 1EUYA 1WKVA 1G3IA 3WAJA 4DLKA 3AGQA 1C29B 2CJFA 2C3MA 3FHCB 2ZTMA 3M6WA 2I4LA 5JRDS 3DLCA 3TNJA 3Q6IA 1MO6A 3A3PA 3R40A 2WF9A 4LJ7A 4U1RA 5TX7A 1EGMB 2BLLA 1E59A 2QR5A 1GUZA 4K86A 5CX1A 4BBAA 4C6TA 3IPCA 1KGDA 1PUIA 3H2KA 2QT9A 3R0IA 3NHYA 4KQMA 4R2HA 5EQFA 3UOAB 4PGMA 2MR5A 1U7UA 1P3DA 3WI7A 1A5AB 1I7QB 1RLOA 2I6XA 4JR1A 3I5XA 4L4SA 1KJIA 1P1JA 1OR8A 2JFXA 1ZN9A 1SAYA 2AN4A 1TO6A 3DUWA 2QN8A 3GYGA 1O96A 1A9SA 4WCFC 5F1YA 4YMUA 1Z7BA 5A6SA 4FYXA 1T2DA 4KMRA 5K8UA 2XX3A 3D5EA 4GYYA 3V9PA 4UHDA 5LXTA 2IYRA 3I32A 1FFGA 4PZZA 1WB5A 1P4SA 2QMUA 5FTMA 3QA3E 5TF0A 3ER9A 1U0SY 2NN3C 4Y6LA 3OKCA 1O96B 1ADYA 3AI1A 5A6SB 4ARUA 3N5CA 4I55A 4BGIA 1VHDA 2PPVA 4V0KA 5LXTB 4YJFA 3H9UA 4TQGA 2XUFA 4RVUA 4O2RA 2PZAA 2PGXA 2PMWB 3LV8A 4JV5B 2XNKA 3B5JA 4H0NA 3W90A 4YUZA 3AKEA 4PX9A 1ZSVA 4TMWA 1T8WA 3C3AA 4REQA 1DAPA 1EEHA 1FYXA 4I55B 2B1RA 2DBVO 1J0DA 2WNSA 4UEQA 5K3BA 1I51A 4X71A 3RARA 5KNDD 4EVIA 3V8NA 2X5XA 3NEJA 1COWD 2CNKA 3R3UA 3VAAA 4EW1A 2B82A 2LCQA 1VLQA 2I9PA 1ZD8A 1YU9A 1NMQA 1X7XA 2Q1SA 2X5OA 3ILXA 4REQB 4QXMA 3PNMA 3WJAA 2CXQA 4XRGA 1ILEA 2G07A 3V4OA 2VPWA 2D1FA 2YWRA 1B41A 3V6LA 1FSFA 3VPBA 2H3HA 5EKSA 4JXZA 2ES4A 2WPNA 3A4LA 1I0LA 2GQ0A 2P2NA 4M1QA 2G1UA 4D98A 4EHKA 1FMLA 2QUIA 3UHAA 2FVXA 3CNEA 3LLSA 1II9A 4B6PA 3JCZA 4LYYA 2DTEA 1ZWKA 2HXGA 3HDHA 3FYDA 3NKVA 2N42A 3OECA 4J7XA 1XZFA 3F9RA 4BWVA 2CLKB 3BMQA 2HMVA 1L7PA 3GPCA 3NHMA 2PWBA 2WG2A 4NFSA 4ZT2A 4II3A 2PNFA 5JJBA 5FH9A 3IMFA 3G5UA 2DHDA 1B0AA 4P5DA 1H2BA 1E9AA 4WZ6A 5HF9A 1HT3A 5A04A 1A50B 3G2HA 3Q0TA 3QHAA 4HR7A 4JB2A 3BMQB 2PUFA 5FL7D 2VKTA 2AK2A 3JZAA 1N78A 3JWEA 4EW2A 2I91A 4G1EB 3DB1A 4WOCA 4MS1B 3UH0A 1ISFA 1Z7YA 2ZVQX 1DVRA 4ZK6A 2PUHA 4O4IF 4N7MA 3FRHA 4EX6A 4KN9S 1VLMA 4ZHSA 4PYKA 1CQIA 1R27A 4KUGA 1GPBA 5GINE 1MNAA 1A88A 1QONA 2Y0DA 4UMFA 5EE0A 5JNUA 2YN0A 4JI5B 1EFPA 3AY6A 3CH7A 3DO8A 3B1VA 2H1HA 4YRRA 1JTVA 1P5RA 1SXJC 2XMBA 5FLEX 4PLCA 1N2IA 2GEUA 2PS9A 1AGPA 1YKFA 2PAFA 3GCWA 4HC4A 3CLRC 1VRVA 2IP4A 3HU1A 3D6MA 4FDUA 3TFWA 2ZE7A 5J4LA 3RYTC 3NAGA 1O3YA 1EFPB 1U2ZA 2GN4A 2IYFA 4Q3BA 5JAQA 4N5DA 5KVAA 2XT9A 2XVYA 3UKJA 4FWIB 5JO0A 2G36A 4GZLA 1I9CA 2ID9A 2MYNA 3GGSA 5AK0A 3ZLVA 1CVIA 2WK1A 3CR8A 5C7LO 4IIGA 1ZK4A 4C2TA 1QV6A 2C4MA 1HYHA 3C7CB 4QTXA 1XV5A 2D5IA 3A0RB 2D74A 4YFYA 3ZDQA 1LY1A 4DN6A 3LYLA 3K72B 3ERCA 2ZB4A 3P96A 2JKYA 1NBAA 2NAPA 3UG7A 2ZYSA 2C4TA 3JRXA 4BCBA 5DYYA 1FU8A 1FXWA 4MVJF 2IVZA 4MW0A 2PO7A 2XVMA 1XDBA 2D13A 3YASA 1ZJWA 1FJXA 2YFYA 1KI6A 3NNDA 4RTOA 1FJ2A 3G68A 3MTBA 2IYLD 4LKOA 5CH3A 1NF2A 3BT7A 2IDMA 4OHYA 1R5JA 1VRWA 1D3AA 4BP3A 4EENA 1GRRA 3MNFA 2HRQA 3CXRA 3CPJB 1YDFA 1OROA 4F4DA 1F17A 1TM2A 1BD4A 1L4BA 1S89A 4J0KA 3LHKA 2HQRA 2V9ZA 3N2IA 4IQ0A 4MQ4A 3SKVA 2BZ1A 3SM3A 1L9KA 3VO9A 4X66B 4K1XA 2PZKA 2ZR7A 1E2BA 4C6SA 3R9IA 1V11A 4YK7A 1UKAA 2FE1A 1SIOA 3BXPA 4DM3A 1RAIA 3I2JA 1MC4A 4QTZA 3PQ4A 3ZTWA 5INTA 2G25A 3P9SA 4HAIA 1U90A 4J91A 1E7WA 1V11B 1GQSA 2PGLA 4LVUA 3ZN2A 3OZVA 1Y3HA 1HNNA 2B92A 1YI1A 2F9MA 4KYUA 2DFTA 2Y2UA 2Q4DA 3M3PA 3N8HA 3A11A 1SQFA 1A7AA 2YS7A 4GGPA 4P7GA 3K0SA 1TT5A 4MK4A 4IIXA 2C95A 3BMCA 5J3JA 2GJAA 1O5OA 4I5IA 1OFTA 3U16A 3A58B 4D42A 1TYDE 4FOLA 3I09A 1U3FA 1ZVVA 2JIQA 3KEOA 4GBJA 5DHPA 4FFBA 2HPAA 3BMCB 2P68A 3PDJA 1IDN1 1KH3A 1T9BA 2Z8YA 2BMJA 1Z6ZA 2JVJA 3BA1A 1TMGE 1JQKA 1YR3A 2JFYA 2WFZA 3FGNA 3GDWA 3LHSA 3HN6A 4WESA 2VP6A 3RVJA 2CK3D 4X93A 2BGLA 3RNOA 3H2ZA 1P5FA 2GD1O 1TU3A 2CXOA 2JFHA 5I9NA 3HHEA 3ESQA 4FFBB 1NJFA 1K88A 1IEWA 3G02A 4BIIA 5KYGA 2NIPA 1CZHA 1CS4C 4X1KA 1U8XX 4WESB 4CKWA 4UQLA 4QGBA 4WT7A 2ATVA 2KLBA 4MQBA 3MWEA 1QX3A 1VIAA 2MYTA 3BSSA 4P58A 2O05A 3DL7A 2F1KA 3HKCB 5F52A 2VH1A 1K0UA 4U9IS 1PZMA 1KK2A 2WYVA 4RHCA 4RHUA 4X1KB 5TQ2A 3PHLA 1H6AA 2QL6A 4NPAA 2POQX 3KDSE 2ZI7A 4QUBA 1T9KA 1RYZA 3MWEB 4IFIA 1NXWA 4MUNA 1J8DA 2I6GA 5F9MA 3T5CA 4RTKA 3HU2A 3ZHVA 2C7RA 2ZCJA 3E05A 5AW0A 1TZMA 4HQOA 4B4VA 2Y9PB 2NZWA 5TQ2B 2WQZA 4JNKA 5CXSA 3VKFA 5K0GA 1GG8A 4GRDA 4LXTA 3FNGA 4G5HA 4M1EA 4MV3A 4H35A 4OU4A 2OQRA 1GOTA 3U26A 4AUKA 4FR2A 3USES 4AF7A 5EZ6B 3IVGA 1SU4A 3KHTA 3L4BC 1ZLYA 5JS8A 2CXHA 1HXHA 2BSXA 2Q5OA 4RL4A 4AX4A 4R6WA 1FPMA 1Y82A 4KQHA 1F14A 3O4JA 4Q4AA 2W43A 3ZOKA 4ES6A 4EYSA 2DPGA 4TM8A 1WKCA 2ZT6A 4TZKA 4QSHA 1R12A 1LDMA 1U4NA 3UANA 4R4JA 2GR9A 5FF9A 3CVWA 4RK4A 3GYBA 1ZXBA 4Q4AB 3U7EB 1MB9A 5JCXA 1CP2A 3K9FC 3B1ZA 2E9SA 2ECFA 2XXJA 2CD7A 1YHYA 2H54A 5EXXA 2PQ2A 1EQ2A 1OU4A 2JFWA 3O8NA 3OLVA 4B31A 2PAAA 1R8JA 4LY3A 1O6ZA 2CFIA 5K1ZA 1FRFS 4FKZA 1O9BA 4KQCA 4PG5A 3PNPA 5J5CA 1FNBA 2WU0A 3T4UA 3WO0A 1MAUA 5CM9C 3Q7TA 1XTQA 3D1VA 4MYHA 1MAWA 3U7RA 3GUVA 1T3LA 1L7BA 3G1WA 3THSA 3O82A 1DJPA 3O93A 2H1WA 2H4FA 2JFOA 2ZW9A 1CUYA 2YWJA 2YBDA 5JANA 3GAMA 5DXJA 2I2CA 1GARA 3DDHA 2BH9A 3QVJA 1QMGA 4R9UC 4PS1A 3EQ8A