5LQNA

Crystal structure of comt in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1h-pyrazol-5-yl)-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1H-pyrazol-5-yl)-1,3-thiazole
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqnA00
2B2CA 3GCZA 2P41A 4NECA 4PWYA 5LR6A 3BGVA 3REOA 5M5BA 2IH5A 1D2HA 1L3BA 1RJFA 2AN3A 4PONA 2AOUA 1SG9A 5EHIA 4K6MA 5FQNA 1JTFA 4YUYA 8MHTA 1HNNA 4YMGA 1AF7A 1KYWA 1TW2A 3AJDA 3OE4A 4PYQA 5E1BA 5FCDA 2IFTA 3ELDA 5C0OE 4YMHA 1X1BA 2PX2A 1QYRA 3G2MA 3M4XA 3DP7A 1RI2A 1ORIA 3OU7A 1Z3CA 5EMMA 3SR4A 4X61A 5HFJA 1HMYA 5LQKA 3CKKA 3HCCA 2GPYA 4AZWA 4H0NA 1JG3A 1G6Q1 4KIFA 3DXZA 2AOXA 3PX3A 4PIMA 4R8RA 4OQDA 4WVLA 4Y30A 5E8JA 2ORED 4R8SA 5EKXA 4F85A 5EOVA 3DTNA 2EX4A 4CKCA 5EIFA 1DL5A 2AN4A 3FUXA 4P58A 2OY0A 3K6RA 1T43A 3G5LA 2I9KA 4OQEA 4DQ0A 3LKZA 3NJRA 2I7CA 4E2YA 2QE6A 2PXXA 5E2AA 2ZIFA 1SKMA 3VSEA 2AOWA 3DXYA 4LWOA 3SMQA 1VBFA 4LWPA 3KPUA 2FK7A 1EQAA 4E2WA 3UA4A 5CM2Z 5EZQA 3T0IA 2PX8A 4PNEA 3THSA 5D1NA 2PKWA 2BR3A 4PIPA 1JG4A 4MTLA 4RVFA 1YB2A 2NXCA 2B3TA 2F8LA 3R6TA 2ZWVA 3TFWA 1ZG3A 5LSAA 4E33A 4JXJA 5F2NA 1SVUA 3E8SA 4ATNA 2CKDA 2Z6UA 1QAMA 2OBFA 5FADA 5MHTA 3BGDA 3GNLA 3PB3A 3I5UA 2GLUA 3LCCA 4RSRA 3HNRA 3LECA 1R74A 3SM3A 4EMSA 2QRVA 2O05A 2GH1A 4E31A 1DUSA 2OPBA 3P8ZA 5D1HA 1VP9A 5FTWA 2ZLBA 3LBYA 3OU6A 3MQ2A 2PWYA 5HIMA 1D2CA 1JG1A 2LD4A 3G88A 1I9GA 5HIIA 2AZTA 4M36A 4EKGA 3B3GA 3EGEA 4FP9A 3C3PA 5T6BA 3PFGA 4RTLA 5EIWA 3B89A 3M33A 3HEMA 2YXDA 3GU3A 4AZVA 1F3LA 4C05A 2Z6QA 2JH8A 4OBXA 2PWPA 3BWCA 2ZW9A 4RV9A 5GINE 3KQSA 5GWXA 5DXAA 3KR1A 3RW9A 4CTJA 1JG2A 3M6VA 1AQJA 1FBNA 2WA2A 1RI1A 4XCXA 2PBFA 3P9CA 2O06A 3FYDA 4F86A 2OZVA 2FRXA 1ZGJA 4PYOA 1O9GA 3KU1A 3FRIA 4QTUB 1NT2A 4BP1A 2IH4A 3FTEA 3VYWA 4QTTB 1NW7A 3T7SA 2WK1A 2ONYA 5DX1A 1NV9A 3HA7A 3LBFA 3O31A 3OZRA 2IDKA 1WS6A 4FZVA 3ER8A 3MTIA 4FT4A 3KPWA 3KHKA 5K0FA 1G38A 5K0BA 3FUWA 4M37A 4CTKA 3BGIA 4BLWA 2O07A 2ZTHA 2PGXA 1R8XA 3E7PA 1SQFA 3HP7A 4HC4A 4EK9A 1BOOA 5E1MA 4RTMA 1G8SA 5FWDA 2C7OA 5DSXA 4MHTA 1JSXA 2AS0A 4ER6A 3CVOA 2PY6A 1VQ1A 4KIGA 4GUAA 1FPQA 2PT9A 4R6WA 1IY9A 2C7QA 3TMAA 3HCBA 3FUUA 2ADMA 2EJTA 3GRYA 3IEIA 1EIZA 2GB4A 1NKVA 4ZTBA 2ERCA 5FA5A 4DMGA 2PXCA 5FUBA 3SVZA 2BM9A 4LG1A 2YX1A 5IKMA 2VDUE 2B78A 5ICCA 2P7IA 1X1CA 3GRVA 3NTVA 4HG2A 4HGYA 1VIDA 5DTQA 2P35A 1VE3A 1XCJA 5K0GA 1O54A 1ZGAA 2YUIA 2JHAA 3DXXA 3FPJA 1RI4A 3HVJA 4FSXA 5E8RA 2NP6A 1BKYA 1ZKDA 2XVMA 3A26A 1O9HA 4HTFA 3EMBA 3HA3A 4RTJA 1TPYA 2JH9A 3UJ6A 4EVIA 3BWYA 1OR8A 3FTDA 5K0CA 1WXWA 4OX9Y 2H1RA 2C7RA 2GS9A 2O0LA 2NNWB 4IWNA 3RIEA 4BLUA 4RTOA 2NYUA 2XVAA 3KQTA 2B9EA 4E2ZA 1PJZA 5ICEA 3UJCA 5KQSA 3D2LA 5DXJA 3C0KA 3Q87B 3BZBA 4IKPA 5DRYA 3I64A 1EJ0A 3FZGA 3JWHA 3KR9A 5JUWA 2JJQA 5DX0A 2IPXA 5GM2A 5EGSA 3HA5A 5DPMA 3ERCA 4IV0A 3KQVA 1WG8A 3GDHA 3KQQA 5E9QA 4MIKA 5DWQA 3EVZA 3SSNA 4DCGA 1VP3A 4ER3A 3PTAA 2P3LA 1XDZA 3BXOA 3HCDA 4AZTA 5HZMA 1JQEA 3M6UA 4XUCA 4RTPA 2FK8A 2VS1A 3OFJA 5EMKA 3EEOA 4C03A 1NW8A 1P39A 3OZSA 2YTZA 4V0RA 2PX4A 2ZZKA 3X0DA 4RTQA 4RVGA 2ZWAA 3B5IA 2OB2A 4B17A 4L7VA 5EEGA 4DCMA 1RI3A 3DUWA 5EHGA 2P3QA 5EMJA 1L1EA 3DLCA 3GRZA 2UYCA 3KR2A 4DA4A 4ER5A 1SQGA 2AOVA 4PCAA 2QY6A 3P9NA 5H02A 4U7PB 4DM3A 3EVAA 3UJBA 3B7PA 5KS2A 4LECA 2JHCA 3BUSA 4PYKA 2R6ZA 2OO3A 2OXTA 3UZUA 2HTEA 3IV6A 3UJ8A 2H00A 2ZULA 3A7EA 2CWWA 1UFKA 4P7KA 3WSTA 3NMUF 4XUEA 1KR5A 1R00A 4Y2HA 4KRGA 2BR4A 5DM1A 2ZIGA 3SGLA 3THRA 4BLVA 2P8JA 3EVCA 3BT7A 5K0NA 4QDKA 2IIPA 4C07A 1NW3A 1MJFA 2ZSUA 5K8VA 1L3CA 3F4KA 4HRAA 3TRKA 3LX6A 3JWJA 3KQOA 3OZTA 4FSDA 5GOZA 1KIAA 2O57A 4A6EA 3UJAA 4MWZA 2JG3A 2GAFA 3K0BA 1M0EA 1P91A 3LDGA 2YXEA 4OBWA 4KW7A 3FPEA 2Y1XA 3UJDA 2HWKA 4QVGA 3GIWA 3CBGA 3TOSA 4RTRA 5B1SA 1PRYA 5K0JA 3R9XB 1XCLA 2AOUB 1B42A 2G8NA 3UJ7A 5T64A 2OB1A 3GXOA 4YUWA 1U2ZA 4RTKA 4C06A 2WA1A 2PJDA 2BZGA 3G8BA 4P7FA 4QVKA 5F2OA 3TKAA 2NXNA 3HVHA 4QQNA 4ISCA 4IV8A 3AXSA 4CXMA 3DMGA 3P2EA 5GP1A 5BP7A 3B3FA 4YV0A 1QAQA 3I9FA 5IH3A 3M6XA 3AWIA 3AXTA 3R3HA 3SSMA 3DULA 5E1OA 5EZSA 3G2PA 4QDJA 4C4AA 2IBSA 2YXLA 2E5WA 4BP3A 4Z2YA 3TKYA 5CIYA 2UYQA 4FGZA 2KW5A 2IH2A 2I62A 3AY0A 4CWAA 1MHTA 1D2GA 1M6YA 4PCLA 5EEHA 5KQRA 2VDVE 3G8AA 4MQ4A 1V39A 3VC1A 3BKXA 1VL5A 5FA8A 3KPVA 2EG5A 3MCTA 3C3YA 3V97A 2DPMA 4C08A 1RJDA 1X1DA 4GEKA 5CVEA 2BH2A 3HVIA 4WXHA 2H11A 3I58A 4E70A 5CCXA 4GOMD 3M70A 5HIKA 1SUIA 4GOLD 4PYIA 3P9KA 5DRTA 4GC9A 3MGGA 4V0QA 5E2BA 2ZCJA 3A7DA 4KWCA 5GIPE 2Z6AA 3EVFA 5FQOA 3G5TA 3CJQA 4R05A 1IM8A 3O4FA 3P71T 5DLYA 3FTFA 1YZHA 2AOTA 1P1BA 2BM8A 3SX0A 5GIOE 5HIJA 2PX5A 2GA9A 2ZBPA 4KDCA 1L9KA 1Q0SA 3KKZA 3LCVB 3LSTA 3OPNA 4X41A 5BW4A 1JQDA 3GGDA 4O29A 3DMHA 3O7WA 2AVDA 2VP3A 3EGIA 5DT2A 4GOND 5C9ZA 1YZ3A 2QRVB 1F38A 3NDJA 3R24A 3U81A 3V8VA 3ELWA 2A14A 3KQWA 3SSOA 4A6DA 3JWIA 1G60A 4U7TB 3EMDA 1XDSA 1FJXA 4RYLA 1R6AA 4RWZA 1DCTA 4RX1A 5DTMA 1QAOA 1EAMA 2XYQA 4QPPA 5KVAA 2AVNA 4QQKA 2XBMA 5K0EA 3CGGA 2UYOA 4OA8A 4OA5A 4XUDA 1N7IA 2ZIEA 3TR6A 4POOA 3R0QA 4E32A 2R3SA 3GJYA 3Q7EA 3ME5A 4PGHA 3KPYA 1KXZA 1VPTA 3P9IA 1UWVA 3ELYA 3SXJA 5HOQA 2C7PA 1KPHA 2P3OA 3C6MA 3GRRA 3LGAA 3NVMB 3DOUA 3MCZA 3GO4A 3EGVA 3IYLW 1EJ6A 5CD1A 4RTSA 1KP9A 3HCFA 3G2QA 3OU2A 2Q41A 3NDIA 3UWPA 1R18A 5JR3A 2FYTA 2IBTA 2ESRA 5K03A 1YUBA 1G55A 2XYRA 3FPGA 1YFLA 4C04A 1FP1D 3ELUA 4ER7A 2FCAA 3MHTA 2P7HA 1P1CA 5K01A 4G56A 3UBTA 5GM1A 1Q0TA 1ZHFA 3BKWA 3FPHA 3HM2A 1X19A 3EPPA 1XJ5A 4PYMA 1EG2A 5EPEA 4CKEA 2PV0A 3A4TA 3LDUA 4HH4A 2NP7A 5ICFA 3QV2A 4X1OA 2CMGA 2V74B 2ZBQA 4GBED 2AR0A 5EQJB 1QANA 5CVUA 1X1AA 3BWBA 5ERGB 3IHTA 3S68A 3QOXA 4EQZA 3VC2A 3PLAE 5EMLA 3T7RA 5CVJA 1AQIA 3MERA 4UOEA 5CCBA 3GWZA 1I4WA 3RODA 3PS9A 1WY7A 3KR0A 4CKBA 1TW3A 2PSSA 3G7UA 2HNKA 3QOWA 4HGZA 3MAGA 4P7JA 1G8AA 4X60A 4X63A 3TPZA 2G1PA 1NBHA 3MTEA 3UA3A 1ORHA 1XTPA 2ZZNA 7MHTA 5LQCA 2P1DA 3CJTA 2AOTB 5HEKA 2YVLA 3NVKI 1KYZA 5EG5A 3E05A 2JHPA 1NW6A 3CJRA 3LCUA 3OCJA 4KDRA 3LHDA 5E9WA 5BXYA 3P97A 5K05A 1JQ3A 2VDWA 3ORHA 4R6XA 2QM3A 3FUTA 3LPMA 5DM0A 2G70A 2P40A 2B25A 2EFJA 3L8DA 4M7RA 4YV2A 3HCAA 3T7TA 3KQYA 2BR5A 3EVGA 2UZ4A 3FPFA 4HSGA 4HTFB 4PYNA 1JSZA 3PFHA 2ZVJA 3FUVA 4FS8A 3NW9A 5EVJA 3UJ9A 4AUKA 3PT9A 3OE5A 1I1NA 4FT2A 4DF3A 3C6KA 4YUVA 3PX2A 5KYGA 1IXKA 3BWMA 2NXJA 3ID6C 2V7EA 4RVDA 3EVEA 3P2IA 2VZ9A 5CVDA 3G89A 4FR0A 4GF5A 5EKUA 5FHQA 1JR4A 5K0LA 5G02A 2CMHA 1XDUA 2OYRA 5BW5A 3P2KA 5K09A 3I53A 3H2BA 4AZSA 2FHPA 5FULA 4PYJA 3KQPA 2ONZA 3M6WA 3KQMA 1M6EX 5E1DA 2PT6A 2I6GA 4RTNA 2K4MA 3B3JA 2Y1WA 2YR0A 4PYLA 1NE2A 1RJGA 2XYVA 3A25A 5CVVA 1VLMA 2HV9A 3TM4A 3FYCA 4AX8A 1KHHA 4EKIA 2N47A 1N7JA 4F84A 2ZZMA 5DX8A 5T67A 4P7GA 3DR5A 3ANXA 4DZRA 1YFJA 5LQAA 4GQBA 3NWEA 1XXLA 3NWBA 1KPGA 2DULA 3DLIA 4GC5A 3G2OA 4PINA 5E9JA 4YUZA 4KVZA 3ER9A 5DM4A 1WZNA 10MHA 1Y8CA 3LDFA 3GRUA 3FTCA 1NBIA 3TLJA 3TM5A 4E30A 5FHRA 3UFBA 1SUSA 4RVHA 4YUXA 4M38A 1XVAA 3HCEA 2PLWA 1KPIA 2G71A 3KPJA 4QPNA 3EVDA 5CUQA 2YQZA 3A27A 3E23A 3MB5A 4PGGA 5EC8A 3JWGA 2AN5A 5P8WA 2PVCA 3DMFA 3LL7A 1N2XA 3TQSA 2OKCA 3PVCA 5DSTA 4ER0A 2UYHA 5ICGA 2IDJA 2CL5A 9MHTA 4BY9E 1WXXA 2QYOA 2NXEA 1AV6A 3CC8A 2ZBRA 1BHJA 1BC5A 4YV1A 5LQRA 2EJUA 3HVKA 2IGTA 3LKDA 5U4XA 1UIRA 2G72A 5C1IA 2ZFUA 5LQUA 1INLA 5HILA 1H1DA 1R8YA 1QZZA 2FPOA 1FP2A 1L3IA 1RJEA 2HR1A 2PXAA 3OFKA 5DM2A 1NV8A 5LQNA 5F2KA 1ZQ9A 1RI5A 5FWAA 2IP2A 2HMYB 4E2XA 5DTRA 5LQJA 3HTXA 1YF3A 3EVBA 3DH0A 3EEYA 4DKJA 3FRHA 4GOOD 1JTEA 3CCFA 1NW5A
chains in the Genus database with same CATH superfamily
1LVHA 2B2CA 1UBEA 1Y37A 2XCSB 3U44B 4RPIA 2IHJA 3R9XA 1K0UA 1N75A 4M1ZA 1FE8A 2JRCA 5L6LB 1MZPA 1JT2A 1Q84A 4EUNA 2XXBA 4MWDA 3E9NA 4L7QA 4Y0VA 1P1JA 2IYNA 3GWGA 3GLQA 3IPRA 3S4YA 1E2JA 1U63A 1PYOA 1YCFA 3EBPA 3WWZA 2RAFA 4FDLA 1YC2A 4KPUB 5TQ0B 4D8XA 1XJWA 2GM3A 5EUMA 4X61A 8GPBA 2C3PA 1QTRA 1OH8A 2VHWA 3JCZA 4C0XA 4UE2A 5JZSA 1II8A 1PIWA 3GV0A 3PX3A 2PZ8A 1VA5A 2ORED 3TF5A 3ETDA 3D6FA 3GPDG 4G67A 4LRWA 2IYVA 5IMBA 2QV7A 3EQ2A 3GQBB 2VPQA 1JGTA 1QFJA 4K9RA 4R9RA 1LDMA 2XWSA 1EHCA 1AKRA 4DV2B 4U02A 2NZ8A 3S1AB 1YNSA 4OH1A 3QP9A 1SWWA 1QO9A 2WOJA 3KJFA 5GJBA 4P2GA 3JR3A 3ULKA 1TM2A 5TVGA 3ZXYA 1LDYA 2Q9BA 2CVZA 3IVXA 1I2BA 4L3OA 4CV2A 5H8WA 4M21A 3BJZA 3AB3A 3F5FA 3SMQA 3VKFA 4GFDA 4D8UA 1GFIA 3DE7X 3ONFA 3C7DB 5EJ6A 5JSKA 3OIVA 4EEZA 2D5IA 1CUEA 1G5TA 3F8WA 2A9QA 2XWBF 1NE7A 2PZKA 3HKCA 4OEHA 2J9ZB 2FWPA 1V2HE 1N1MA 2ZJYA 2OMEA 1B6RA 3AMVA 2ETVA 2OGWA 4U39A 4CKZA 4JXJA 3LV8A 5TMPA 3BSSA 4QXQA 4GSKA 1UBFA 1AGXA 3FI0A 3H11A 4V0SA 4CM9D 1YVRA 4HRVA 1U11A 5EINA 1Z5WA 2C2MA 1QB7A 2QMOA 1GNVA 3QI7A 1EE1A 1XTVA 4RA6B 4ZI3A 4EVRA 2HGZA 1J2UA 4E31A 3NATA 4H3KB 4XIIA 1E2DA 2QPOA 2X1LA 3SE7A 4CCWA 1Z7EA 4YCLA 2H5JA 4Z53A 2ZRGA 2J87A 3DEJA 2ECPA 1TUGA 3SC3A 2OZKA 5BR1A 1NN0A 4G07A 4Z9FA 1CZKA 1MNQA 3H18A 3EBOA 4NBSA 4YO8A 3VBEA 4WBNB 5J43A 4FP9A 3UWDA 2OZLA 4LJKA 1Z4PX 1R5NA 3DE5X 1YL5A 1GQYA 5DLDA 1P2DA 2XWJI 3K30A 1Z5OA 1E2FA 2JAUA 2QGZA 2WYHA 1KSFX 4JAVC 4MB2A 3SHVA 3H2YA 3ZDEA 2XQKA 2AMJA 4OLFA 4ZAWA 3K53A 3ZI7A 3WL7A 4DIDA 1J0AA 4XVCA 5HKOA 3BERA 1H1TA 4Z1MA 2QIPA 1NQ5A 4MINA 3WK6A 4TS1A 4I9NA 1M3SA 2NVUA 3TSOA 5I8PA 3EDMA 1ZD1A 2ZTUA 2LNDA 3KLBA 1CYDA 1KQFA 4PPNA 1BXRB 2DFDA 3A9CA 5JEDA 2C1ZA 1NMQA 4S0XA 4Q7EA 3PDHA 2OZVA 4E51A 5L8VA 4ZQHA 4WDRA 2F1OA 2HCBA 3V3TA 2WIJA 3NBAA 2RHDA 4G8CA 2D59A 3JQFC 3GJ8A 4S1TA 4V0ME 4BP1A 3W9SA 2PYZA 4GI7A 4C0QC 5ED4A 3QW2A 2NZWA 4RMJA 2LCQA 2CXXA 3FBTA 4YDRA 2WSYB 3CZMA 4KBYA 4ZVQA 2W6PA 3AESA 5CITA 1PV2A 1WS6A 5H9VA 2GXAA 1QHGA 2YJZA 3KPWA 4I5EA 3L2OB 1OZHA 2B35A 1N92A 2BJHA 3OM1A 4MKIA 4YR7A 4TYNA 4TZ0A 3G0CA 3PZRA 4N8SA 4NIMA 5EJGA 3N3AC 3O6VA 2IYWA 3H19A 4UMVA 1W75A 3K6SB 3MAJA 4RGQA 5IKEA 3T7DA 4NCNA 2VP2A 1Y1SA 5ARCA 4JVLA 4PE5B 3TMAA 2XKKA 2B7CA 1KYYA 5H7XA 2EJTA 4YPVA 1YQWA 3A28A 2QTBA 1HXHA 2CVQA 3C6YA 2R4QA 3HSKA 1SCUA 2H2DA 4LOKA 3U3XA 4AN1A 1P31A 1PAUA 3TX6A 4A0SA 4BFVA 4C6TA 2VVTA 5K3FA 1ZISA 4DZZA 1XRNA 3H5VA 4YMVA 1B0PA 5LFAA 5C34B 1SKUA 1P9RA 2V7GA 4JJAA 1YZTA 2HPZA 1C3EA 3GRVA 4N8EA 4YAFA 3TAXA 1J99A 4YK7A 4Z4GA 1KDPA 3JQEA 4HYEA 3PT5A 5E8RA 1AD2A 2GCOA 1J8MF 1FEZA 1N2SA 4AJOA 3FVQA 3RU3A 3A2NA 1NAHA 1H9AA 4V03A 2W8BB 1DC6A 4ZQBA 3E18A 1SUEA 2I1VB 3JR7A 4CEHB 4IWYA 1M6NA 4WBNF 3UMCA 4NONA 2OSVA 1S02A 2WNHA 3V1LA 1ZKMA 3SS9X 5GVRA 3UF0A 5DM60 1NXXA 2JCBA 3CHYA 1CZHA 3KZKA 3RRNA 2AHOA 1UZMA 2FPUA 3QKUA 4IDBA 2VEDA 4KXMA 1X7WB 5A1JA 2CF5A 2H4HA 1I36A 3OZAA 4H1UA 4WXYB 4PSKA 3LLUA 3HXKA 4YO7A 3RU9A 4REOA 3BFXA 3ERCA 2DPHA 2HADA 3KQVA 3TQHA 1DQPA 1UM9B 1YS1X 2CK3A 4LHVA 4QXOA 4AAYA 3PTAA 2QTLA 5GZ1A 2X5KO 5EJ2A 3AH8A 3AU9A 3O8QB 3OSUA 2FK8A 1EK1A 5EJAA 1JAYA 3GCDA 1GR0A 2WIKA 4IILA 4V0RA 1RXEA 3CO0S 2AH5A 2PZLA 3WL5A 5KEIA 2RC6A 1T9CA 3FD8A 3WRXC 5JSQA 2VI5A 4DNOA 1H4QA 2GF2A 5F7ZA 3VO8A 4LHZA 1OGIA 2NTJA 2PSHA 3DFMA 3FZEA 4NEGA 4E12A 3TL6A 3B1YA 1V16A 2JK1A 1C1XA 2PZMA 2HM7A 1KZ9A 3O8NA 2AMVA 1E8DA 3EGDB 2FZGA 3AHDA 4LHXA 2NUPA 2OGUA 4Z0HO 2OXTA 3FR8A 5FOUA 1BFUA 2HSWA 1QF9A 5KPDA 5EJFA 1SBYA 2W00A 4MVJH 2ZJFA 2V9PA 1BQ4A 1WBJB 1RXCA 2QJOA 4GNKA 4P7KA 4Y1GA 1NNEA 4BNUA 1J0EA 2JAOA 3D6TB 2J7PD 1IVSA 2RI0A 1AU9A 3SOZA 1M75A 3ROKA 4RW0A 3MJDA 4J6FA 2OFPA 3LWNA 4OB6A 3D7LA 1QIJA 4G65A 4KQMA 3ETGA 3NXKA 3FGZA 5JG7A 4TQ9A 2IWRA 3RGGA 2BGGA 1M0EA 2JGIA 3CNOA 1SC1A 3LYLA 4UVHA 3RC8A 1GCAA 5LOVB 4FGJA 3ZY2A 4L8GA 3DKPA 1XDWA 3K4PA 1B23P 3GIWA 2X3FA 5SZJA 4PC3A 1ESNA 1ECPA 2AOUB 5L3ZA 3UJ7A 3M6FA 4R1NA 2DXIA 1MJ5A 3FFAA 3H2ZA 1JBEA 1LX6A 2A1TS 4GLFA 1CUSA 4WMLA 5DI3A 3JV7A 4YMTA 1RYHA 4WXPA 5AK5A 1DLIA 1WHSA 3FLAA 5DTJA 2C0QA 2VH5R 4AKIA 1L7VC 2UZ1A 4H7KA 2G07A 3IJRA 2XRMA 1KMCA 3W79A 1I0ZA 1QAQA 1AZLA 2DFLA 2RBEA 3AWIA 1VYVA 2DSTA 3C2QA 1W5FA 4MPPA 3WZLA 1CDZA 4N7BA 4Q3KA 1KKLA 2FPMA 4KDEA 5EIBD 3L84A 4JBHA 3VR6H 4AULA 4BV8A 2P6RA 2ZJ4A 1RT9A 2W93A 2ZB2A 2OLEA 5C3UA 3KUKA 1MEEA 3COZA 5DH9A 2BFOA 1PX2A 4JC0A 4GICA 2O8FB 3AM4A 1C80A 1YO6A 1MHTA 1SOAA 1CQJB 4KI0A 4Y1FA 1EQ2A 1P0MA 1GUAA 1KJWA 1UL1X 1NVBA 1XU4A 3EFBA 3G8AA 4KXYA 5C81A 1YCGA 5CK4A 3DUFA 3ND8A 5ALUA 2J4DA 2ODEA 4GEKA 1I01A 2HXSA 3R41A 5HP4A 3PC4A 2QMHA 3I58A 5DYYA 1QGYA 4TLMB 2W83A 1E3MA 1WVGA 3BWXA 2MSDB 2PTGA 4MLDA 2ZDGA 3F7NA 2WD8A 1NWHA 1TIKA 3STWA 1J0DA 4TTIA 5HZKA 3N8NA 1MABB 1V6SA 3JRXA 4XQ0A 3UEOA 1CJSA 4DSZA 2VDQB 2AOTA 3AUJB 5F33A 2OILA 3U3OA 5GIOE 3TI7A 5HIJA 1CRPA 2YJ4A 1T0PA 5J2UB 3TRDA 3AR3A 3NKVA 1CU1A 3K4QA 4I1OA 4IEIA 2WWHA 3EEBA 4ITRC 3EGIA 4EJ0A 2WF9A 4DSUA 1HDEA 2H5IA 2ILVA 1DELA 4OG2A 2NUAB 4BAGA 4JJ6A 3STTA 5C8YA 1M8KA 3AJEA 4AY6A 4DR4B 1KTVA 1J39A 1G60A 5AVJA 2J31A 4ENTA 5FUXA 1K1EA 3EIEA 5TC4A 1KERA 4C0KA 4DLXA 4NK5A 4DB2A 3O47A 2OYSA 4A92A 2WVJA 1FS6A 4CTOA 2RMKA 1HBJA 1JFFB 1JJ7A 3SKXA 2BT4A 2AFRA 3UFXB 4EO4A 2EBWA 4URXR 5ERXA 1O9BA 3QOYA 5KTNA 1BXKA 3BPSA 3I5XA 5LOVF 3ENNA 2UYOA 3TR6A 4ZO9A 1QHYA 2ZKLA 2R3SA 3IMKA 8OHMA 1T8YA 3FBWA 1Q21A 1VHWA 4FGWA 5BSTA 1KPHA 2AK2A 4QVIA 1FU4A 4PZAA 4KODA 2ZJZA 4WZAE 5DIZA 4L28A 2UUOA 3SNHA 4BPBA 1TM5E 1KP9A 2HA4A 1LGYA 4AF8A 2DTEA 1U7UA 2FX3A 4FW9A 1MH9A 3UC5A 1G55A 1ZSVA 1O6GA 3TX2A 1I1QB 1YFLA 3WYEA 1XMVA 2QAIA 3CKLA 3BE4A 4NFHA 4RPHA 3ZU5A 4D6YA 4E09A 5JTUA 4B2IA 1XTJA 3N5CA 5K01A 1Y98A 2XH8A 4G4JA 2G76A 3RWBA 3QVKA 1L5MA 3EN0A 1Z5PA 1LQTA 1T3SA 2VWPA 4FWBA 4JR1A 4UU0A 3SJCA 3W8EA 3RT1A 5IM4A 1RC8A 4PYMA 4V0OA 2HBYA 3LDUA 4BXOB 4NARA 3GJSA 3QUBA 3FDZB 4NG4A 4EQZA 3A9UA 1JB1A 1EGAA 3T7RA 2UZAA 1UOPA 2IGBA 2JJMA 4MRMA 2Q0XA 5ELLA 3RHSA 3PC8A 2D3TA 1RAHA 1THZA 4BJHB 3QOWA 4D41A 2ZSFA 4WKBA 2XW6A 1DJQA 4PC2A 1RIFA 4BB0A 1GQRA 3C39A 4I6GA 4EVQA 1TU0A 3HC7A 1XK6A 3M1LA 4RIIA 1PHRA 5LQCA 2ZZNA 3O4RA 4BFUA 2JFOA 2VN8A 4H77A 4EUEA 2IHZA 4TV8F 1MMFB 1KAHA 5J2UF 5K3OA 3BE8A 4K46A 4AN0A 2DQZA 4GBGA 1A8HA 3NJ8A 4C4RA 2D0IA 3LHDA 4PWZA 3MWKA 4H35A 2DWQA 5KCMA 1ZMTA 5DM0A 1D5CA 1BRTA 1BAPA 1M7BA 2EFJA 4YI5A 5AVZA 3K9GA 3K70C 3ENQA 2Y1EA 1RYZA 4KV9A 4HVAA 2Y9MB 4TMXA 4BMNA 4CIBA 2HT6A 2PBRA 3ABZA 1Z4LA 2XQJA 3AKEA 1E5LA 2LPMA 2VBFA 2V1XA 1AG9A 4FOLA 3BWMA 1IAVA 3GRCA 4CVNA 3CZ4A 2P0YA 2G9RA 3GFPA 4KLRA 3G89A 3PL1A 2WTMA 4V3BA 3L0IB 5BQOA 2PQMA 5K0LA 5CDFE 1K98A 3OTWA 1E0DA 3BQ9A 4M8LA 5JZBA 3H2BA 2ZAYA 3HB7A 4BPRA 1M2VB 1O94A 3ZCTA 2ZAGA 5ADWA 5KYWB 3I0NA 1MIOA 2XMRA 2Z8XA 3HN7A 4L8VA 5LN1A 3M6WA 3KXPA 5TDHA 3OKFA 2JGAA 3TNJA 2F17A 4WBSA 1ZJ5A 1OY1A 1XI2A 2Z8ZA 1H4VB 1H5QA 1L4UA 1EJ2A 3ESQA 4ZEXA 4XLTA 4G0XA 1BHO1 2XXAA 3TM4A 4F46A 2FLKA 4AX8A 4ENQA 2B8TA 1B6GA 3W4IA 3A37A 4JLJA 4UU1A 1STOA 4H0CA 3V8EA 5K3AA 4BX2A 4TWJA 4BLTA 3S0JA 2E4ZA 5JXHA 2J30A 5DNCA 3VDNB 2O2DA 3BH6A 4GQBA 3BGSA 2O1EA 2JJ2D 4EKYA 4Y2QA 1DB3A 4NU0A 4WE3A 4HZIA 1N0UA 2BCEA 2AD1A 5E9JA 1IWBB 2GPAA 3G2OA 3UXYA 1KR2A 1EK5A 4OFZA 4BX9A 4CKXA 3C4QA 3EF0A 1VLJA 1P7ZA 1XZNA 4JODA 2IDMA 2ZJ5A 3S5JA 4EG0A 2ZJ0A 2OWEA 3UFBA 3M6AA 1X8LA 1VYTA 4GR9A 1YHNA 3KALA 4WLOA 2BFWA 1NN1A 2Z6QA 3D02A 4CKWB 3E23A 2OUIA 3KWJA 4A1FA 2E21A 1ISGA 3V4SA 3OZDA 1JI3A 2FFBA 3W6NA 1J7KA 3CX4A 2PUVA 1RM5A 4F97A 1AN9A 1GQFA 2YWCA 3AONB 4ZV4A 3H8SA 5LWHA 2H52A 3HUDA 1YZLA 1BE1A 4HYQA 1JEDA 1JZSA 4UNNA 1N6RA 1NYLA 1OC2A 2W6JD 1L4MA 3V42A 1SBZA 3C3AA 2PZBA 4DJFC 5I48A 3E4CA 1FSZA 3C7CB 4WKGA 3CF4A 1D07A 3GCGA 3NALA 3QVGB 5BR7A 1WSDA 5TPWB 2ZAMA 4QPCA 3FBGA 4FBMA 4U2KA 3LL4A 2YASA 4CEIA 4KDFA 4MB6A 3B1FA 1A82A 4K28A 5TV2A 1NIPA 1VKJA 1J00A 1Y9ZA 1GCOA 2GCIA 3BGVA 2PS0A 4K9KA 1QIGA 4R2JA 2AN3A 4UAUA 2JVJA 2XLCA 3RT7A 3U0BA 1ONBA 2G5GX 3K4HA 3M34A 1B41A 4TL6A 1Q14A 3UMBA 3LSYA 4YMGA 3BD7A 3S40A 4RXMA 5BN5A 5FH9A 1T2AA 1FFXA 2ZATA 4YROA 1PQWA 1DJLA 1R0RE 3AZOA 2I2CA 1UJBA 1MTZA 4LJ6A 2E4YA 3HZOA 3TB6A 3HXQA 2NNLD 3DNFA 1SXJD 5IBRA 5I9MA 4LMPA 3A11A 1M2NA 2HD4A 5EKXA 3VR5H 4RE5A 4BEWA 5BQFA 1DIRA 4RXUA 4EMBA 1MAHA 4YAKA 5JTTA 3DT8A 2PDAA 4EB0A 4YRKA 1U8FO 1E99A 3LKZA 1YV9A 4AS2A 2HFKA 4D9IA 4JT4A 4L50A 3GP8A 2ZS9A 4F6RB 1KFBB 1GGVA 1RZUA 2OWDA 1K6EA 2R6JA 1IZYA 1YQUA 2BKLA 2XDWA 3EOBI 3GJRA 4UD2A 3R7SA 3OOEA 1V8OA 3VSEA 3K7EA 3AR8A 2LDXA 1MXHA 4LOJA 4F1KA 5AI0A 1C7QA 1DPGA 2XMQA 2FE4A 2X9LA 3CLTD 2E89A 2WSLA 1EP2B 2JGDB 1T4DA 2IHTA 4JA0A 5DBGA 2A5JA 1Z2CA 3R3YA 4N5MA 2YQ5A 4RVFA 3F1KA 1GPBA 3A05A 2RARA 3TFWA 2GZ2A 3DC2A 2FW0A 3G0IA 3WXBA 1C3LA 1P3DA 5F2NA 3NCTA 4OJKA 3F90A 1YGYA 3B6IA 3PB3A 1HURA 3WLHA 4ZCIA 4E11A 3N2EA 1GYRA 2IEBA 1N0WA 2YH2A 3WYFA 2UXDB 5EWMB 2I5PO 1ZJYA 1L4YA 3CE6A 2OPBA 2YXNA 3IB6A 2D8MA 3NBFA 4XGQA 5HE9A 3H6KA 1CEQA 2CHFA 2G09A 4JN6B 4JEHA 4NYMQ 5C8VA 5C8XA 4LFAB 3F4BA 4IIJF 3W9UA 4BVKA 1DV1A 1XCOA 2LD4A 3WGKA 2YMLA 1D4OA 1CJBA 4RKRA 1E8MA 1Q12A 2EFDB 4E3WA 4JXXA 1U3CA 2WYVA 2I67A 1HQCA 3HEMA 3OZ7A 3H5NA 1NUQA 4GSYA 4WKCA 1FMLA 2QUKA 2F3UA 4RSHA 4XOIA 4XRGA 4PANA 2PWPA 3BWCA 1C8LA 4GS5A 4TT3A 4UPEA 2ZCUA 5GINE 5F3WB 1VPVA 1PU2A 3KFXA 3L3BA 1AQJA 4INOA 1X7ZB 1CNMA 4BATA 2FEXA 1NUTA 1T6NA 2O06A 4L02A 4UPVA 5IJXA 4EGSA 5F9HA 1JHAA 3V80A 1I2AA 3BIFA 4NYJR 2IPAB 4FW8A 2LV8A 4IFBA 4WLEA 2GERA 1Z2NX 1V11A 4RK7A 3PVSA 5G0TA 3SZRA 4E5SA 3ZVMA 4A8TA 5AOVA 3OZRA 1DKNA 2HCFA 1X39A 3Q3EA 5EGNA 3T5BA 5LDDC 3WZ2A 2Y2VA 5L40A 1H2RS 2B5WA 4NDAA 2A67A 3WE7A 3KVYA 4Z9XA 1SU4A 4LY0A 2IUUA 1WZCA 1SHZA 1KGDA 4UU8A 1OHHD 2GCNA 3T7JA 2JZCA 3NT4A 5JNWA 5DN6D 3NTQA 4MHTA 3PSHA 2EX0A 2H31A 4K86A 4MV1A 3K9FC 3DM5A 2VJMA 5IJ0B 2P62A 3RYIB 3D6UA 4DA0A 3N0WA 5EQTA 1TA4A 5JE8A 2CFTA 2PS3A 5I51A 4LXQA 4NF2A 5DU2A 3U7GA 2ZUCA 3K0HA 2GB4A 1PV1A 1WF3A 2ERCA 2JRLA 3CRMA 4RLHA 1KH2A 3CZPA 1JR2A 1Z88A 3OX1A 3OZGA 4WHMA 5EERA 1FJGB 1KFKB 5A4IS 1H94A 3B20A 1NFFA 1F0KA 1ETHA 1DQSA 4HEA6 2ONKA 4IKEA 4P4GA 4WCFB 4V1CB 4XAQA 5ALZA 1VKNA 5I4CA 1JWBB 1MTOA 3VXKA 4EGJA 4D9JA 3EXHB 3GUZA 3L4EA 1F8FA 3P0HA 2QQGA 5CRIA 2V3CC 2G67A 1XCJA 3RWMB 1YB1A 3JD2A 1P81A 3H9BA 1AO0A 4KFCA 3HVJA 4FSXA 2XE7A 1D2AA 2K7ZA 1B00A 3DZFA 3M0EA 3NP9A 1O9HA 3AEUB 3MUFA 3PNOA 3QKTA 1ZD5A 1ZOSA 2HF7A 3BE5A 3GFFA 3GN1A 1DDIA 4MCHA 3UJ6A 5EJ8A 4YCBA 1P7PA 1PT6A 3ADBA 4ARZB 1GQQA 4OX9Y 4BLUA 1J8VA 4LF6B 3DW1X 3LRPA 2NGRA 4IRUB 2ZJAA 1EWVA 1RQGA 1JNXX 1SBTA 3MJEA 1XIVA 4UW9A 5G1OA 2DLCX 4D9EA 2JD1A 1J2YA 5ADVA 2XHEA 4FCWA 2V7QD 1IUKA 1C81A 1HRDA 4NZMA 4O4LA 5DFAA 1Z2PX 2IS1A 1B8PA 4QARA 1NQVA 4FYVA 4ER3A 2POQX 5FFNA 3SJBA 3G9QA 5AXAA 5LYYA 3JVEA 4HDMB 1JDBB 4EW1A 3VKGA 3EULA 5B7GA 3OFJA 1Z8NA 4X8MA 4BQEA 3KP1A 4GX5A 3JZIA 2VTKA 2JASA 1E6UA 1A2OA 2ORIA 5FLEX 1T1RA 2XZTA 1KKMA 5A05A 3RJ9A 4DLZA 2CV2A 1BVHA 3DUWA 1BXGA 1IBKB 3NR2A 3N59A 5E7QA 5JXJA 2GTHA 5B6PA 1V3TA 1V48A 5FIUA 4U3JA 1RAGA 2TMDA 3H42B 3KQKA 2WVAA 2CNNA 4Q9NA 2VK8A 3B7PA 4LNUA 1LEHA 1M6HA 1YBHA 2YIVX 4D9HA 2BFFB 1KWGA 4MARA 2FFHA 4X1IA 3AYXB 2W2PA 2H06A 1IDN1 4DLAA 1A8PA 4UDYX 3GJ0A 3OPQA 2ZULA 3HO1A 3HUEA 1NU8A 4XUEA 3KYCA 1E7RA 1B74A 4K1LA 5AVVA 1V5GA 4TX1A 4BJ6A 3M9XA 1AGYA 4QPJC 1DCKA 1DKQA 3OKAA 4UM9D 1GZ6A 1IRIA 4XFJA 2W8ZA 3LX6A 3NBYC 2GWHA 3IOMA 4I4NA 3GG2A 2OHOA 3FIJA 4N65A 2QLJA 3UJAA 1XR3A 4QRHA 3IV7A 1EINA 3K0BA 4L07A 4O2AA 1YOVB 1GL7A 2WC1A 2IXFA 4BKOA 3LUDA 3EG9A 4XX0B 1KMHB 1U2QA 2RGWA 1GFWA 1IMJA 1U1CA 1E9AA 4EJ6A 3PC3A 5BN3A 1E2KA 1Z4JA 3OJFA 4BQFA 1PK9A 2XF2A 2BHTA 2ZR0A 1K5DA 3WWOA 1Z8DA 5CFOA 2QD1A 2BMVA 3CUYA 3NTUA 2PJDA 1TZJA 1ULZA 2Y1GA 3O2QB 1EDEA 2TS1A 3IFSA 3R9KA 3K32A 3IUSA 3ANMA 3TZBA 3CG0A 3EZ7A 3W05A 3WWDA 2M1ZA 1XVIA 3UWOA 4BMSA 3KK0A 2VF7A 3B3FA 4GPZA 3K1AB 3OTQA 4UVEA 3IT2A 3ZCRA 3G2PA 3PNKA 4ND8B 1Z25A 1NNSA 4K0KB 5ELXA 1PGQA 4HAUA 2X1VA 5CCDA 2XDQA 2O2YA 5MN6A 3MINB 4NE7A 4BNVA 2AA3A 2ZSKA 4U7HA 3E4DA 3ZG6A 1PTJC 4QFBA 1RM4A 3RV3A 2FG5A 4OJMX 1T8PA 1V39A 4HX2A 3OJWA 1V2GA 4KQHA 4XJTA 5ANRB 1KEPA 5FA8A 5IYZA 1N5MA 3V97A 5A2GA 4MIEA 3ZJ4A 4C14A 1TQ6A 3INRA 5A5DA 3VPXA 2B6HA 2R751 3IQWA 3G2IA 4YJ3F 1SUIA 1PWYE 2C2WA 2ZE8A 3BCUA 3JAKA 3OE7A 3U4QA 2D62A 1PV4A 3KNZA 3MWFA 1N8TA 3FCSB 2WTAA 4E88A 1VRWA 3CLRD 4HHEA 3E3MA 3USCS 5E3HA 1WL8A 1S0UA 3KUXA 2C00A 1X70A 1NBME 2ZRNA 1DZIA 1L4GA 2C3YA 4W5WA 3WMEA 4RJIA 4LDZA 3E5NA 4YRBA 3NASA 2VQDA 4ITUA 4E5KA 2NYVA 1EZZA 1GGKA 1UMDA 1ULHA 2B1JA 2CVHA 2H9YA 3CXUA 3DKKA 5DT2A 4URYR 4AQYB 2EKBA 3NDJA 1ULTA 1KARA 1JKIA 3DMRA 3E9ZA 3PNQA 4A6DA 3CRNA 4Q01A 4U7TB 3VOBA 4FGKA 4U1RA 1OXXK 1WJGA 2ZI5A 3G9ZA 4PC1A 1ONSA 5IT9A 3ICWA 1OPRA 3L1IA 2H8GA 3ESAA 2XYQA 2H16A 2HJWA 1C9KA 4XZ3A 2YRFA 3CGGA 4Z7NB 1MJHA 2R8RA 5CA1B 1E9FA 5KWEA 1BFDA 3R0QA 3H9GA 3PU6A 3VGJA 2ZDQA 4DA9A 4Q82A 4EECA 4YV7A 5BR4A 3ZE7A 3KX2A 4ZKEA 5C5CA 1QIFA 3E2PA 5DZSA 5BSKA 1TTQB 2G88A 3BXGA 2WWVD 4LDQA 3GRRA 3N8HA 3QV1A 3U09A 4DY6A 4OHCA 3OZIA 3EIHA 4TL9A 3A32A 1Z0FA 4J2OA 4G3XA 4JFRA 2VUSA 4Q4JA 5HMLA 1KO8A 2I6UA 4J03A 1T0JB 4OYRA 1G20E 1QU3A 2DHDA 3P4UA 1E1QD 1Z7YA 1OH6A 4KQKA 4R2WA 4TVBA 4X85A 2ZT5A 2CEAA 3WFJA 1C0PA 4UHDA 3ENVA 3NVDA 3VI3B 1F6BA 1XVUA 3OZCA 3UBTA 4LSWA 4WCDA 1Q0TA 4Q21A 2D4HA 4RCZA 3NUGA 2Y4OA 5EP3A 1N3IA 4MKRA 4ID3A 4MKZA 4CLRB 2E4AA 3QV2A 4PIVA 2CMGA 2XSZA 3FGNA 3M4JA 2AR0A 3LNTA 4NU6A 4XSHA 5B2ZA 1N0IA 5B7PA 5EJEA 4TWIA 2X0IA 5F4BA 3SFZA 4NE2A 3VAZA 2DQKA 2H0QA 4D44A 5KJ6A 3IXQA 4RDIA 4X91A 3EVNA 4ZKDA 2C97A 5L7YA 3I0ZA 1PL8A 2JIZD 1REQA 4QNMA 2QZJA 3F6SA 1UC5B 4JC4A 4M0EA 2G1JA 4EQ6A 4IF4A 4BC0A 5KSYA 1AQYA 2GDZA 2CT8A 5I7SA 1A69A 1RRVA 4C4YA 1T3GA 3KOYA 3DCNA 3A3OA 1O2DA 1R6DA 4X6LA 2QP3A 3VR2D 3UPTA 3KSMA 3NVKI 2YBDA 3WGGA 1ZUWA 1USUA 1Z47A 2DHEA 4HX5A 2F1RA 3K1ZA 2NACA 4DLBA 2V6JA 1NLMA 1WY5A 3K9NA 1RQLA 2HF8A 3RJ5A 1OUMA 5BV2P 1FTGA 3B2NA 4XYGA 1UFVA 1W5SA 1EWQA 1V0JA 2Y0DA 5H3HA 3MRXA 4GE3A 1QVZA 3FJYA 1BN7A 1XMQB 4LHWA 3EGXB 3EVGA 1AQNA 4BLRA 5C37A 3SEZA 1XHLA 1F2DA 3LOUA 4HTFB 4Y9SA 4YDQA 4IQ8A 2X23A 4U9HS 4WINA 1MV8A 3FUVA 3ZUPA 4DMCA 3NW9A 1U2GC 4DUZB 2RONA 3FE2A 3JQFA 4FT2A 3HDYA 3RIHA 1DAMA 2A84A 2YWHA 2DWPA 4Q7KA 5FPSA 1E1LA 3O74A 4RH0A 4H6WA 3OCCA 4LI3X 5CA1F 3OY7A 1J2EA 3P2IA 2HJSA 1NX6A 3Q8MA 2ERYA 4Z8XA 3IP1A 5M7EA 1QRRA 1NGSA 4NNPA 3IVAA 3N2LA 1V37A 2BJWA 5K09A 1PUJA 2WMOB 3HRKA 4MA0A 1KWKA 1ST3A 4CCYA 3JQGA 2WYUA 1N5LA 1E1CB 2Z8YM 2W11A 5D3MB 5EUBA 3V9PA 4ALMA 4EPXA 3CW2A 4R1LA 4E2FA 1O97D 2Y1WA 3R7DA 4BQPA 4I1PA 1NXQA 2I4TA 3U4HA 2VQ6A 3OJEA 3UT5B 2O14A 1NUAA 4RJLA 3JD1A 4B44A 3H8WA 2QV0A 4MUIA 2PWAA 4IJWA 4YAJA 4TYQA 5CB8A 4TMFA 2ET6A 3O8OB 4LYJA 4HF7A 1BWSA 4YREA 3ZDBA 1EWTA 1SA0A 3BBLA 4W5TA 5K51A 2P5UA 1ADYA 4R83A 1OVGA 3DLIA 4MO2A 4CT4B 1E1RD 1WZNA 4PSUA 2IEAA 2DPGA 4M87A 5HVNA 3N07A 1MOSA 1DHTA 2CE7A 3IUBA 1J9EA 2IOYA 3MF4A 1H8HD 2HK8A 5IDVA 3SBEA 1NHWA 3DEHA 4C88A 5C4IA 4RELA 2X7XA 1TJNA 4BMZA 6AT1A 2F4VB 2ZJ1A 2NQTA 1Q44A 5A5GA 1DXQA 5AW0A 1DAEA 3H0KA 4KE6A 5LMNB 4PBSA 3WS7A 2HA5A 1L8XA 2ACWA 4F21A 2NSYA 1PJ3A 4M9ZA 3KL2A 2IYRA 4WNIA 5B1YA 1KIMA 2QVBA 3VBCA 2GXUA 3PF8A 4JSTA 3VPBA 3BFVA 4RKWA 3LKDA 1E6MA 1KP2A 1RWWA 2PLAA 3ENKA 3P52A 5U4XA 4LJ7A 2CHUA 1E9RA 2P65A 4ND5A 1Z4MA 3INNA 3C24A 4BZXA 1U8CB 1AHPA 2ZYRA 3S8YA 4LGVA 1Y80A 4MXDA 2BP7A 2E4UA 4WBXC 3ND5A 4DXHA 5HSGA 1QP0A 3EXFA 3DTYA 3O1HB 5JD4A 3M1AA 4IJVA 1ZSYA 4JOCA 4OI0A 1RXWA 5A5VA 1ZLYA 3RRFA 3OWXA 2YYSA 3RNOA 3LLVA 1EVIA 3BFJA 3KBOA 3MTJA 3AM3A 4WRRA 3ZIUA 3EH2A 2A35A 2QF7A 5KQPA 2HC9A 1SG9A 1RCFA 1T4CA 4K2HA 5GQSA 8MHTA 2EDCA 3CUEF 3QZUA 3BTVA 1UT8A 3NC1C 3W5VA 4L6CA 4E94A 1DO8A 3B2EA 2IFTA 4X95A 1HFKA 2O3QA 1X1BA 1QYRA 3M4XA 3GARA 1RI2A 3V9AA 1EWRA 4AD8A 1G21E 1AC5A 4MV7A 3IOYA 3RYTC 1JU3A 2HLDD 3GVHA 4HRXA 1JEYA 4R8RA 4JMLA 3TLGB 2IYXA 1BZYA 1NBWB 4H15A 5F1PA 5BV8A 5FWYA 2BGUA 3DTNA 3PIRA 3UYKA 1TVKA 5C80A 3AGPA 2ATIA 4QPZA 5LB4A 1JX6A 1G2IA 3L8MA 4O59O 4YP6A 1QZ3A 3EBLA 1FB5A 1A50B 1QRDA 2PZJA 3K6RA 4OQEA 3TLJA 3BG5A 2R96A 4JLVA 1YA8A 4BMCA 4QUEA 4D26A 1D04A 1K9SA 4FDUA 4J1SA 3VKVA 3D54D 5KC9A 1SPXA 2Q6TA 4FMBB 4GKJB 1D5WA 4CN8A 3WY9A 5L3SA 5F51A 1XZPA 5LC1A 2VYVD 3WGUA 4LWOA 5CLJA 3G3EA 3IBYA 1WD7A 4LWPA 1YONA 1QRTA 3UPUA 3FWPA 2F1HA 3DWGA 3EXEA 3MYYA 1WBDA 2XWQA 3PHJA 4G63A 2JCSA 3KC2A 3OHMA 2HU2A 3KLMX 1TYDE 5K7SA 3OH8A 4QX6A 2HYIC 2OQIA 1HEUA 1V7QA 2IYZA 3B9QA 1MQSA 1VE1A 3E7XA 3N05A 4XM1A 2PGOA 3IQGX 1PR1A 1S2OA 3NAZA 3VHXB 4RVOA 4EI2A 1QAMA 1UBNA 1C3JA 2Z2ZA 1C1DB 2BGMA 1ABEA 1VBNA 3GNLA 1W76A 3R0IA 1SVKA 3SM3A 2JHFA 1DAFA 3D7NA 1DT3A 2Q3BA 3NM6B 4JJIA 3WGJA 4C1BA 3ZHUA 4DYVA 2A0YA 5F2EA 2ZUSA 4MYUA 4EH1A 5FOQA 3MWEA 5EHQA 2QJTA 1G8KA 3ZWWA 3D3EA 3OU6A 2YWEA 4LBVA 3RLFA 4ZOQI 4YP9A 5HIMA 4Z4IA 1UMCB 3U31A 1FJHA 3W3AD 2JFBA 3SOPA 1GDTA 4ENRA 2GNPA 1E59A 1HYHA 1UQRA 3U13A 4B7UA 1HQYE 4I46A 2HI0A 5FNVB 5KJ1A 2JI7A 4IFIA 3QTTA 1COWA 1Y4UA 1Y8QA 1GAEO 4BVAA 2B69A 4I1RA 4DYHA 2JH8A 4NV0A 3VR3A 1E9DA 2NO6A 3OKCA 3GBVA 4XSVA 4DQUA 3RGWS 1K75A 4CTJA 3S70A 1K7CA 3CNHA 1PBNA 4Q4AA 5T8KC 4BNXA 1ZWLA 4C0SA 3ZH2A 4QJ3A 5JV5A 4C1NA 3ZHBA 1FQOA 1ZGJA 4PYOA 2WFLB 1ZGGA 3GGPA 3MJCA 3UMFA 4NXNB 1ZEMA 4BO2A 1E2BA 4KFTA 3OO1A 1TVCA 4UEKA 1MAVA 2WLSA 1VMEA 4EUFA 3GEEA 4FD2A 4WEQA 4I4TA 5DW0A 1X1SA 1M5TA 3VU8A 4KSYA 4RAQA 4I50B 3VGPA 5IMSA 1IEQA 1AMUA 5LU9A 3RCBA 1U2PA 3WB1A 4PXYA 2DKFA 4U2EA 1A2KC 4NJEA 1XDDA 3O26A 3L7JA 5K0BA 1TTTA 1ZESA 1Z6GA 4MKFA 3GP3A 3ABIA 1WZEA 2V0CA 3AUTA 3H17A 4QDXA 4ZAZA 2CXSA 2Q0HA 4G85A 1HYEA 4GLLA 3WNZA 1FTYA 1JSXA 2FN3A 5BXQC 1PG5A 2QD5A 2PO7A 3DWIA 4ZI7B 2WD7B 4DDVA 1QSGA 1D7OA 5FL3A 3ONDA 1P1IA 3V7NA 3FPKA 3USES 2ZJ8A 1L5QA 3KQLA 4QATA 3ICVA 3UUGA 1OZFA 2A0WA 1ZUIA 4H7FA 5FA5A 2O23A 3AR2A 1Y81A 1E3JA 1MBZA 5BMVA 1D8AA 2FETA 2YX1A 1LU9A 4N7RA 4ZEWA 4E5UA 2OHIA 1B76A 3H97A 3IRUA 1CNEA 2G9UA 3C3CA 2I8CA 5K0SA 4ZGBA 4DLSA 2GJSA 2AD5A 1VIDA 2Y66A 1OAKA 2RAPA 4HGYA 2JZNA 3RC2A 4F3YA 4QLBA 1NBEA 4DCSA 2JHAA 4C7JA 5TS2A 3PQ2A 3DL4A 2Z43A 3UGKA 4RBNA 3A26A 2J4CA 2NOAA 4EHNA 2QTCA 4US0R 3HJRA 2PKQP 4MRSA 1GT6A 5DHRA 5JFGA 3E6AA 2XBLA 4DB4A 5CH3A 1ACJA 1KBOA 2WJYA 2X8AA 1IZ0A 3V33A 3NIGB 4BAZA 5A4JA 1RE0A 2ZR7A 3B13B 1PJZA 2W9XA 4PLVA 4Z3KA 3OIWA 3HP1A 1E6KA 2EVWX 2J0QA 1L5HB 2CJFA 2JAHA 2PRKA 1WQ3A 3F73A 3KR9A 1C9NA 5LJIA 2H65A 4IQFA 4OK6A 4BLOA 2IPXA 1CY1A 1I5EA 1V1MB 1SRQA 2VXOA 3JQAD 3MXOA 3T4EA 4BWVA 1WG8A 1LZKA 3TRHA 1KQGA 4MIKA 1ENOA 1I3LA 1ISMA 4AZTA 5A3JA 1BD4A 2HPVA 3UG6A 1T5BA 5ALGA 3K92A 4D4GA 2XB2A 2EKPA 5ETJA 1HI9A 1G21B 2ZYWX 1E92A 2XA9A 4XH9B 3WC4A 1CE8A 3ZD6A 3DEYX 4IOKA 4L7VA 5FWNA 1EX7A 4I50F 3K9BA 2DBVO 2D54A 4PEVA 3ONVA 4KE7A 4GOJA 4I7EA 2IOFA 4Q4DA 2F9FA 2Q4BA 1GUBA 1KS9A 3NAGA 4DM3A 2GK3A 2JS7A 1TDJA 3FB1A 1GTL1 2HLPA 4HDKA 4P4SB 4Q6BA 1P0CA 4RZ2A 4AZ3B 4MV5A 3TLBA 1THTA 1A0OA 1TEHA 4GMXA 2I4NA 4CG0A 4BFTA 1JDNA 3QITA 4ZI7F 4M1EA 2BUAA 2HTEA 3N70A 2ST1A 4NJMB 5DXFA 4X0EA 1Q1NA 1PJLA 4N12A 1FSSA 4NBLA 4MYCA 1I8TA 2VPZA 4RO0A 4Z4EA 2MINB 3RNLA 2OQ2A 1UP6A 2QORA 1RRPA 4HQFA 3UJ3X 1G6HA 1JJBA 3F4KA 2CVFA 1TO6A 2V9CA 4BE9A 2BFDA 2HV8A 5HS6A 1E69A 3EF3A 1YR9A 2UZ3A 3HJFA 3VKWA 2YNMC 2NTVA 1HMPA 3AIMA 2CJPA 5CURA 2F62A 2YXEA 3BQMB 4J0FA 5JNUA 3Q12A 1N78A 2J9GA 4EGCB 3EZLA 3LX4A 3CBGA 1H5NA 4QWWA 4LE0A 3VR1A 3EIFA 3ZWPA 4BKRA 1LRLA 4S3MA 5B1SA 3R9XB 3NDPA 2OAEA 1XVTA 1OT3A 2VOEA 3CRVA 2EFYA 2OXCA 4LSGA 4BDTA 4FKMA 5D00A 3NHLA 3N86A 4CJXA 2VA8A 3TKLA 1TEZA 3TKAA 1T35A 1XWFA 2WAYA 1OAAA 3DO8A 1W59A 3FFBA 4P4LA 4OP3A 5CDYA 1DOZA 1ZINA 1NWCA 2J32A 4PNZA 2ISCA 3IDAA 3IAHA 4UTOA 4YACA 1ORWA 1G5QA 1KBQA 4Q4HB 1II8B 5TY0A 4Y9DA 4QDJA 2ZTLA 3MQ4A 4DPMA 4NPAA 3BHIA 4QBIA 3UHPA 3WMXA 3TKYA 5CIYA 3COVA 3LGXA 4WJKB 3U26A 4URUR 3PI7A 5TS3A 2I62A 3AY0A 1YQTA 3IE2A 4OHWA 421PA 4IUCS 3CN7A 1M6YA 3DZCA 1WXFA 4OFWA 1A9RA 2R79A 1A2BA 4IR7A 1YT5A 2DCUA 3AYZB 3BCSA 3LUBA 2R85A 4G5HA 1AN0A 2W4QA 3ZTYA 4KR7A 4Y9UA 1IY1A 1X1DA 2QMZA 3JAWA 4YDSA 4ZOLF 4W9RA 1LY1A 3SKYA 2X8JA 3PI6A 2O19A 4KNWA 4PYIA 4X94A 2XGGA 3VTAA 1BCSB 2BHSA 1IZZA 2EYQA 2Q29A 3BORA 3OP4A 4JVSB 4K1XA 4V0QA 3OF5A 1M2GA 3VZCA 4BNFA 3HKCB 5U4QA 3LCJA 1PWHA 5FI1B 1CR6A 3E1GA 1AKMA 4HXYA 1EYZA 4PQYA 4J3NA 1XTRA 4X00A 1NX9A 2GA9A 3D1JA 3NOXA 2PGIA 2YMQA 1ZGZA 3TZEA 4C76A 2B4RO 4B48A 1UKCA 2GAAA 5C9ZA 3I9LA 3W2GA 1YZ3A 3GA0A 3VO1A 1J49A 3V8VA 3O83A 2A14A 2EJBA 3IPXA 2JDID 4E5VA 4ZI5A 1FMJA 1NN5A 1SUAA 1MR3F 1SHTX 4Q1VA 1YHYA 3MJRA 1L2TA 3TSYA 1EHIA 4RPLA 3F5DA 4ZEOA 2R4UA 4YRQA 4QSHA 1JMKC 2IQ5A 4OVKA 1Z56C 5ALPA 1DKOA 1GNPA 1GLVA 1ZUD1 2GNOA 3CYFA 1W4RA 4KR0A 3VH2A 1L5VA 3HFSA 5TGZA 1T0HB 1GYQA 2QR3A 2BKEA 2OZLB 4Y2SA 4OHKA 5FLYA 5FV4A 3PNBA 3ZWXA 3MUEA 2C31A 1GGEA 1ECCA 2QR5A 1E32A 4OHVA 3PNVA 1T9KA 5G0UA 2VHXA 3AQ4A 1UH5A 2HIAA 3PPIA 2D00A 2GJAA 5JMOA 1RJ9A 3MCZA 5FL7D 4CZ2A 2NVUB 3EGVA 4DV3B 3R77A 3AR7A 1ULAA 2Z57A 4E03A 3LY9A 1D0IA 3O75A 4QQ8A 2ATEA 1RRMA 1IEXA 2JIPA 4LRTB 4MUEA 4XTRA 5A7FA 4DBZA 3QXJA 3RSSA 3L49A 3HB1A 2IEGA 1ZL2A 3E2MA 1GDHA 4L5BA 1GO2A 5B53A 4ZAXA 2J5QA 3AESB 4B4DA 3MMPA 2XAAA 4CL3A 4Y67A 3KYDA 3WLIA 7ABPA 3OFNA 1C14A 3GFOA 5CVUA 5G0WA 2GLXA 4ZCLA 1HRKA 2P8SA 3PLAE 4Q1BA 4QYIA 2QRZA 4EHHA 1PVOA 4L78A 3RODA 1EFTA 5FTJA 5ULLA 2H1SA 4MQFA 4C5AA 3EIUA 2G1UA 4N3BA 1DVRA 3F9CA 4ZAYA 5KWVA 3KQHA 4DSNA 3PHHA 3GYBA 5JNVA 1T9ZA 3EEIA 5EMNA 4ZT3A 1TYBE 3FN4A 1TAQA 1SCUB 2Q1WA 1KOJA 1WLYA 1KYZA 5K3FB 3SC2A 2P0AA 4BS9A 3MRVA 5CT5A 2DHCA 3KEFA 5E9WA 2BJVA 3ESCA 4DLVA 4WFKA 1U2DA 4KHZA 3AVPA 4O1HA 1GG8A 2PUCA 2EGGA 1SBIA 4A0QA 3GMTA 3JQPA 4AG5A 2IVFA 3H0EA 1HLPA 4Q48A 2W37A 1RQ2A 8AT1A 2GCOB 3HV2A 4OXXA 5HJ5A 2F9LA 1O5TA 1PS0A 3IKTA 4Y6SA 4YP7A 4RLSA 2GPTA 4G0MA 5DK6A 1QORA 4AP5A 1HM5A 1Q17A 1TNDA 3HKBA 1WTAA 4FYPA 2P30A 621PA 1I4EB 1R15A 4L4XA 4LAFA 4X7BA 1IXKA 5B4TA 3L4BC 3I2KA 5DHQA 1K7XB 2Z2JA 3C5HA 2CD7A 2QQFA 3QPCA 1Q15A 4RMNA 1JR4A 3WL8A 2XD9A 3PHLA 4I9GA 1DQZA 2X8LA 2DRIA 3OWOA 3GLHA 4MOWA 5FULA 1KJ8A 2QSYA 5DWVA 4KPYA 2ONZA 3KE9A 1PSWA 2AEJA 3EZ9A 3G0BA 3KYBA 1BSVA 4UOZA 1CERA 4NYMR 1Y3CE 5KIAA 3ACDA 3VOAA 1U28C 2BEVA 1D6NA 1JXQA 3RK0A 5C1BA 5WRFA 1GXSA 4LYYA 5IUNC 1QOZA 2BMJA 3UG7A 2XF8A 4EX6A 1GAXA 1BQEA 4BFSA 1OQAA 3NNNA 1Z4IA 4RC9A 5KAPA 3RYHA 4ARUA 1L4HA 1XZ8A 4F84A 1BJTA 1FLVA 2HRCA 3N58A 4TS3A 1YUNA 4TVOA 3WK4A 4EUSA 5IWAB 4JI0B 4BNYA 5BUQA 1IVNA 3I39X 1V16B 4JHLA 1C1XB 5EHZA 3LBAA 2DY0A 10MHA 1YZGA 3UBMA 3ZZTA 4ZRDA 1K8YB 4LYGA 1JAXA 1ESCA 5FHRA 2QAGB 2XVXA 3NHKA 3PHCA 3PL5A 5B55A 4TKLA 4KH1A 1KS2A 4HN9A 4P3NA 3I04M 3M4YA 4P54A 2ZYHA 3BH0A 3PRJA 1NJ1A 5JANA 4D98A 4LF4B 3C7KA 2QMEA 1XVLA 2G06A 1AUQA 3CUVA 3G7SA 4NQRA 2PVCA 4D99A 1NPDA 4MRVA 3HO8A 3QBTA 2OKCA 2E55A 3EC7A 4ER0A 3NJ4A 4M9SA 5ICGA 1XMIA 2CUNA 3BOSA 1LVGA 5JS7A 2REXB 5GPBA 4F2HA 1EP1B 2YHSA 3KEMA 5ALOA 3HVKA 2IGTA 1K6XA 1VC2A 4BJ3A 1INLA 1Z6AA 3LUAA 3QUSA 1EFAA 3LK6A 1L7DA 4HNRA 1NSYA 1FDOA 3U49A 1J33A 2PXAA 4DNPA 2A9OA 4MR8A 1YOBA 4E5DA 1ZPDA 2R87A 1IPFA 4HNHA 3S2FA 3R7FA 5AP9A 3HCRA 3X1MA 1GNRA 4B32A 5DHAA 2O8BA 3TQIA 2AWNA 2R5FA 1ZN2A 5DI3B 3TTVA 1U1EA 2Q27A 1TQ4A 3RS7A 3T06B 3WRWA 5GVSA 3DXFA 5FEUA 4Z99A 5LZ9A 3MOIA 3TLXA 1K5PA 3ICCA 1WHSB 4PPYA 3STVA 3SQLA 5ALNA 4B3JA 2NSLA 2D7CA 1NJ6A 2UZ1B 4ZK6A 5C7LO 1K2VN 4DMKA 3JARA 3C5EA 1JKJA 3H8VA 2MSLA 4W7HA 3ZGNA 1AF7A 1F0YA 1PJRA 4J9VA 5IVHA 3BDVA 4N4AA 1NXTA 3W5CA 4PFQA 2VRNA 4GKBA 3GJ7A 4PW0A 2ZRDA 2PUJA 1HYGA 1M1NA 3NETA 4AKTA 4YH1A 5DYIA 3E9EA 2GD2A 3Q1LA 5LL6P 3RYFA 3QVMA 3WAGA 2VPIA 3DUFB 4K87A 4MYSA 1DSSG 2Z2IA 3G2HA 3IPLA 3CSUA 3JVDA 3M5CA 5EAIA 1CQPA 1LD3A 3O4VA 5AVSA 5ECDA 4DXAA 4DQ0A 1QZUA 2C82A 2I65A 2O4UX 5E4FA 2FF5A 1JXMA 4OBBA 1VSBA 4TTRA 3U56A 2CKMA 2WYWA 2ZP1A 4O63O 5DGDA 4LF5B 2ZSDA 3SJ7A 4Q1DA 3TGWA 4MV6A 4ZRMA 3FOCA 3O3MB 3OLVA 2EGUA 2PO5A 2DEUA 2SHKA 2HRBA 1X6VA 2PX8A 1XWWA 1G17A 4HJRA 3VA7A 1Y8ZA 5JBQA 3N2KB 5K99A 5L95A 1ISPA 3F8TA 2EDAA 5M04A 2ZWVA 4L85A 1BW9A 3VNUA 1E62A 4LK2A 5CPFA 3LUPA 3SP1A 4O3MA 2QTFA 1Y4AE 2P2LA 3MJSA 4QHYA 4AUMA 1ISHA 5G4KB 2Q5QA 2GLUA 3SQNA 1R74A 5K9ZA 3DDZX 1RHQA 4XIJA 4ESHA 1KEUA 5JVDA 3UKOA 2VHVA 1DUSA 2QZ4A 1R6TA 3L7CA 2VHCA 2RHCA 4IJMA 4ZVOA 4TMKA 3VVCA 5ITSA 2W6NA 4HWGA 3C15C 3D0QA 3QX3A 2VWQA 1JHRA 2FZEA 1I9GA 3D4LA 3W5SA 3BD9A 4US2R 3V4PB 1W87A 3EGOA 3AR5A 2YJ3A 2ZBDA 3FSRA 2HEIA 4LMBA 4NEQA 1ZICA 3Q6NA 2B4KA 3LXMA 3OURA 4RS4A 1GZHB 5A06A 4EFNA 3WV4A 1O58A 1U31A 2Z04A 3OPYI 1X8KA 4JVNA 5L4NA 2COKA 4FCVA 4NPCA 3T52A 1UDRA 2QM7A 4P0TA 1CC1S 4FEAA 3ZHVA 3AIIA 3KQSA 1J90A 2D4AA 3RW9A 3BWEA 3SQXA 4M1TA 2OLKA 3LLSA 2CNDA 3G9XA 5DGIA 1R4AA 1VJTA 1ZRHA 5MN4A 3RAFC 1DXHA 2AK3A 3DFFA 2FRXA 1O9GA 2W70A 1U3FA 1AGRA 1FK8A 3J7TA 3LC1O 4DJJA 3AERA 3KIPA 2ZI9A 3L1UA 4UULA 4LKOA 1P1RA 1SHUX 2D1TA 4GXTA 1Q74A 2CHGA 4RKQA 3T7SA 3MWDA 3HM9A 2CNKA 2QGFA 2X6RA 1AZTA 1YRAA 2R84A 2H4XA 3DE6X 3G9UA 3ENZA 2CLKB 3O31A 3ZE8A 1U9YA 4JR0A 5C8ZA 3DAOA 3L1KA 4LXHA 4CM4A 1QK3A 1SCIA 4EY4A 1EUQA 1JKXA 2DECA 5D86A 3VZPA 1R66A 3DBLA 3FTPA 1OKKA 3HP7A 4J91A 1U3UA 3S2ZA 1ITZA 1BOOA 4EYQA 3ORRA 2VAMA 5JPDA 4BKPA 1SXHA 2BMFA 3LQ4A 3NFRA 3L9WA 4DV7B 4F6LA 4ACAA 1VCIA 3HS3A 3NYRA 1TZ2A 4NP6A 1WXHA 1ORRA 3AFIA 3TO5A 1GDDA 4XQCA 4EFMA 2ANCA 5ECWA 1C5KA 1O5IA 1JTVA 2CLOB 2QUHA 4N7MA 1BX3A 1FMCA 4X7PA 1F20A 3ST7A 4R1MA 3T9EA 2NN3C 1CQWA 1MT3A 4QNNA 1FU8A 4PPQA 2O9JA 4ZC1A 4Z1OA 3MS4A 3LT1A 4LV5B 1SCAA 2R9VA 3RC3A 1JIUA 2P7IA 3CNEA 3FY4A 4KYIB 1U7ZA 3H0CA 3SBDA 4B35A 2ZKIA 4HNTA 3UHFA 5I3ZA 5K0GA 1TTHA 2PK3A 3K5HA 4R9NA 2BFEA 2XAUA 5ALKA 2XUZA 4CG2A 1DQRA 2UVDA 4FYKA 2NP6A 3GPLA 2B2NA 5HRUA 3MTBA 2I55A 4R0VA 3MWJA 2AKEA 3AEZA 1NURA 3ILHA 3GEGA 1OCEA 4Q1AA 5CP8A 4JL8A 3TUZC 4MVJD 3UHJA 1VJCA 3AWDA 4YBRA 2FWIA 3AUYA 1MIOB 3AEKA 4HNAA 1T8RA 5TE9A 3B85A 1R0BA 4WI1A 4EG6A 4NV3A 5JJCA 5BWBA 2YJ5A 1F51E 2O5VA 4UHCA 4XEUA 3OEWA 5EXTA 2ZXUA 3D2LA 1KXJA 5DOVA 1E3SA 2LTAA 2Q8PA 5JZ9A 2XXAB 5G40A 1QONA 1RYNA 3GFVA 4KVFA 1WV1A 1IONA 4CF3A 5MGNA 3SF8A 4RCVA 4R7ZA 2D1FA 4WH0A 4PG5A 1IQ0A 1NNUA 1JR3E 4E4YA 3EX7C 3R20A 3G82C 3QKWA 1CNFA 3GEMA 1NW8A 1QLWA 2AQHA 2PX4A 2WTUA 2XDYA 3V2UA 1G5PA 2ZWAA 3UAVA 1GKKA 4B3XA 3M3HA 1WCWA 1XPUA 1UKEA 2A9JA 2J67A 1CJVC 1KL7A 2JNWA 1CW2B 1RYDA 3EZYA 3MMXA 5E4TA 2I29A 2P75A 5EE1A 3WMFA 1DCFA 1E98A 1M7GA 1OFUA 3K2BA 4R8VA 1N3LA 2QT9A 5H02A 3WR5A 3L1HA 3OJ0A 5KS2A 1UDCA 1U2GA 1ZM3A 3TTWA 3LAWA 2Z5LA 5LLTA 1ULUA 4HI0E 2A4KA 4KX3A 5J4KA 3PR2B 3RVLA 4HDQB 1LDBA 3BHJA 3IV6A 3JWEA 3UJ8A 2W6ZA 4PSAA 3H1FA 5ALJA 2KLHA 5L3RA 3VR6D 4JJKA 2EZ4A 1I7PA 3F5SA 3GD7A 3PG5A 2XTZA 3RJTA 2A92A 4LZNA 5DM1A 5LBUA 1JLMA 3F4LA 2HX1A 1NQTA 4TSKA 1MJFA 1WR8A 3KLPX 2O7SA 3FVWA 3WTBA 2PT7A 1RXUA 1E2UA 1LDEA 3M49A 3FZYA 4WUTA 1MLDA 3ORYA 1ZM2A 3L8CA 4N01A 4UQOA 1NVDA 2XR1A 4CEIB 4V38A 3H3XA 1FFHA 3B3AA 4EABA 1N6HA 1NLYA 4IP0A 3VU9A 5K0JA 1M8GA 3M5WA 3M4NA 2BM0A 3O8BA 4RTKA 1GGNA 4FDMA 4B45A 3JPWA 5BN5B 3LQRA 4M1WA 2JATA 1FFXB 5JLAA 2O59A 1FVFA 4KXWA 1Q19A 4ISCA 3MPUA 3NRJA 4MUNA 3DDWA 3TW6A 3V4LA 3SBOA 4DL9A 4GKKB 2DGDA 2XMZA 3M6XA 1DFHA 2AW3A 4RK1A 5E3IA 1Z74A 3QY0A 5TQJA 1BDMA 4RD2A 4MS1A 4IDHA 4O4HA 3SHQA 3M9LA 4JU8A 4LZOA 1RCTE 2UZ0A 2E2WA 2IXGA 2KW5A 2QLLA 2WHYA 5FORA 4ZJZA 1GG5A 1AMOA 3H2GA 4PLYA 3H4TA 1UC4B 1WSAA 4WIAA 5EEHA 4HGRA 1T9GS 4MW9A 3HWRA 3OLQA 3PICA 4NYIQ 2EG5A 5F35A 3UT6A 1RJDA 3UW1A 4BAUA 5CDSA 4F3NA 1GSHA 1IY8A 1IC6A 1MB9A 3FCYA 4JS0A 4AXBA 1WCXA 5I5EA 4HWPA 1K6IA 3PJGA 5LBIA 3ZGOA 4U6SA 1RWBA 3DVAA 1THMA 5GIPE 1PR2A 2Z1NA 4GHWA 2NPFA 2VDKB 2JJ2A 5DLYA 2Q3LA 4NTZA 1KQ3A 1Q77A 1YQXA 1TAGA 3RSOA 1ZK1A 3CPHA 3PFBA 4RE6A 2G9QA 4DLKA 1IQUA 4AURA 1S96A 5AM1A 4BO5A 3LLMA 1XELA 4R8MA 2V4UA 3WOHA 1F38A 3L7MA 1SCNE 2B8WA 3E03A 3MD0A 3FI9A 3ZHSA 2D7JA 2Z5FA 3EMDA 5DNWA 5JAIA 3LU1A 4G5XA 5AD1A 4H4DA 3TL2A 2GPSA 4FHFA 5DN9A 2OOKA 3D6NB 3L6CA 4I9UA 2DC1A 3FFTA 3CIFA 4E1BA 1BCRA 5G2OA 1A9TA 2IY7A 1E9VA 5A71A 4Y7CA 3AHHA 3O8CA 1JS1X 4RORA 1FF9A 1G4UR 4Z7JA 2XRYA 3ZUGA 2W6JA 1E0AA 3Q15C 4JIMA 1PKXA 1GCIA 1X13A 3NVMB 1M2FA 3OP1A 3PQFA 3Q7IA 4FI3C 3EWIA 4IYRA 2G36A 1QBGA 1JAZA 2RI1A 3E3AA 2WAOA 5D7NA 1XNQB 2NO0A 3CT4A 5HK8A 4FR5A 1TCVA 3OU2A 3NDIA 5FLKA 4D4LA 1SEVA 1R18A 2ZI3A 3ML1A 3ONEA 3WA6A 5KJCA 5K03A 4FE4A 4OHRA 3OI7A 2GQ0A 1UJ5A 4OHBA 4BNZA 2C2BA 4IJ6A 4UTPA 3VOTA 2WJGA 4EUHA 3RO7A 1P1CA 1V11B 2Y92A 4RK0A 3U3MA 3W4JA 2JFYA 4J7AA 4B5LA 3QUCA 1JHUA 4O4JA 2Z83A 3Q3CA 2IPNA 3EPPA 5LA6A 4UBNA 3SPXA 3QW4B 2BM1A 2PV0A 3HP4A 1VLVA 4G5QA 4L0MA 4UAJA 2P78A 4Q03A 4Q9LA 3L7NA 4CTKA 1RADA 1FUYB 5K8LA 2IYPA 1PCXA 5BWMA 3HCNA 1G1AA 4LS3A 1FS4A 4LZLA 1JYEA 4QOGA 2PBZA 2TRSB 3IXMA 3K15A 4I81A 1QX4A 3UGJA 5IJ9B 3WLTA 1NL3A 3GDGA 1C4OA 4R1QA 2PA0A 4LN1A 5KUTA 3QE2A 1PLLA 2RKOA 4LTNA 1WMBA 1V9CA 1JDJA 3W5IA 4O25A 1GUDA 3RFVA 4R5MA 3G8YA 4CV0A 2MHCA 1QDEA 5FTLA 4I5FA 2CJWA 4XCVA 4WEOA 1T5OA 4M9RA 1V9SA 1CQXA 4N3NA 1ZY2A 2DUWA 2VLIA 3V48A 2C8JA 3GBPA 1YASA 2I4RA 4ZA2A 3SFVA 4UM5A 1K3UB 1U9ZA 5JCOC 4FZ3A 1Y5LA 2ZWIA 1OASA 2GAOA 3SYKA 1R9MA 2FR8C 3GPBA 4JVMA 4CUKA 4J7CA 1M34E 1P5FA 3MGBA 1RLIA 5D5QA 1K68A 3BK1A 4CM3A 2IUFA 2JFUA 2ZDHA 1HE1C 3EVEA 2CZCA 1ZR4A 1SHKA 5CMLA 3ZCVA 5BMOA 4Q39A 2HU7A 1MAUA 3AB8A 2VP5A 1T9AA 3MCVA 2Z2YA 1OMOA 1C3VA 3DZDA 4H3VA 3WQBA 3TINA 3VZQA 2D13A 3E7WA 2V9ZA 4RPGA 4O4LB 2V7TA 4UOQA 4ZVSA 3KCQA 3QE9Y 3GMSA 5KDDA 4MW0A 3WNVA 2AZMA 1Y48E 2VTBA 3R7LA 1AKUA 4Y2GA 3VHLB 5AJTA 1P45A 5AUQA 3VDMA 2G77B 2PUBA 2ZI6A 3RVKA 3X43A 1DXYA 2RGCA 2QRPA 1KQOA 1QVVA 1SCJA 1YZFA 2EIHA 3CCBA 3DDNA 3F6BX 3MRTA 1NOJA 3OQHA 1BXGB 3WBFA 3EYAA 2AWOA 2Q4EA 5IBQA 2Y76A 4FYIA 4BV2A 5KTOA 1CY2A 3EQ7A 1KE2A 2SNIE 4JJ4A 4U3JB 2JLWA 5EJ4A 3L82B 1QCDA 4Q4LA 3K8ZA 1AK1A 1B4DA 4TTPA 1QO0A 1NONA 1JHXA 2P0EA 3L7BA 1U3DA 4K8OA 4LNUB 4UDNA 4WTOA 5LLSA 3V7UA 4KVZA 4AKEA 4WSOA 1Y8CA 3FNIA 3LDFA 2XCLA 4X1IB 1QIDA 4J16A 4P93A 4XPZA 3K31A 4RD1A 4M83A 2J6BA 2J3LA 1C7RA 1SUSA 5AI4A 5A03A 1PWZA 2FFRA 3KYCB 4ZZ1A 4GOKA 1NNLA 4OPMA 4K26A 5CUQA 3RAJA 3ZYZA 5ALYA 3WOVA 2CJYA 3HGMA 1CR1A 1F8UA 4XJXA 5P8WA 4EMUA 1N2XA 2M32A 4Z7QB 1L1FA 3VR5D 4L73A 1J6UA 4GL2A 2Q3CA 1WXXA 4BY9E 1ND5A 5DN6A 3ZDQA 1Y1LA 2CVPA 4M7PA 1P5RA 1Z6XA 2ZIZA 4O2AB 4V2IA 3WHKA 4A16A 4PNHA 5T4BA 1V5FA 3EG9B 3P9YA 1AB6A 4N03A 2OA0A 5THQA 1R88A 1E4YA 4PX3A 3ZJTA 1UJCA 3GRPA 3AY3A 3H99A 5TXGA 1Q50A 4RF3A 2GM4A 4P3YA 5KOJA 1CZOA 2R8XA 3OWHA 1L7XA 2AE1A 2ZR9A 3MTQA 5K3DA 1BWQA 3KEOA 2DM6A 4WFQA 4J9UE 1I3NA 2GILA 1GPMA 2XTAA 1F6WA 4DNFA 5K8CA 1VGVA 2XIQA 1BFKA 3KAPA 1JTFA 3T5TA 9LDBA 3WA7A 1ZRNA 1HNNA 1QKKA 4D45A 1E3TA 2PA3A 3AJDA 5FNZA 3EAFA 3HB0A 3HEBA 3NBMA 2XGMA 3ABSB 1PQYA 3EQ8A 2OGZA 2FXIA 3PDWA 3LFHA 4ROSA 2PKYX 5FCDA 3ZDXB 4YMHA 3Q8XB 4QJ4A 2KJQA 3ZJYA 3R3VA 2D6FA 3AF0A 3NYIA 4GPD1 3UM9A 1QO7A 2ACKA 1Y5IA 3I9OA 4G8DA 3T0GA 1MO3A 4W5OA 3KOOA 4KIFA 5IYZB 4PIMA 1RPAA 4WVLA 1IHOA 1IU9A 2FWJA 3PQCA 3TQCA 1A7JA 1W35A 2WQ6A 2RHGB 3AI3A 3DOOA 3E3LA 3JQ7A 2ZUWA 4YMSA 3B5EA 3NOQA 3ACBA 2V7QA 1AY0A 3FUXA 3LPNA 4JOBA 4ZOEA 2DHRA 1IN7A 2I9KA 3OFVA 2XEXA 4EAQA 4GM0A 4HB3A 4A9AA 2C2YA 2YNMA 2WILA 4BECA 3NIWA 2FPXA 1U7OA 1J1IA 3OTGA 5C31A 2NUTA 3PXCX 1F7VA 1BRMA 1HG1A 4LF9B 4IDEA 1JBQA 2NV6A 4QYTA 1FOEB 4O2LA 1SIWA 5C2JB 1EQAA 4EA7A 1UMDB 1QX3A 2WJ3A 3OIUA 5EZQA 2FMFA 3RVOA 1PR3A 2VP4A 1VFNA 1ZNZA 4UMEA 1BG6A 2JGNA 3DL0A 3OEEA 1ZK4A 5MGBA 1Y7LA 5JYEA 4Q3DA 2QN1A 4B7XA 1GUYA 4HMQA 1J2RA 1PR6A 3WZMA 3AQIA 4W5NA 1KC1A 2X13A 3TE7A 2Z6UA 5FADA 3ASZA 4HB4A 1P7WA 2KMLA 3LVQE 4FU0A 3WK7A 4EVSA 1YBMA 3T1TA 4YAGA 1SC9A 3D0OA 2O05A 5A3QA 3SWWA 1G5IA 3MK31 2AW5A 2GA8A 2NU6B 1NKSA 2E49A 3UOAB 3EJ6A 2VUHB 2HWYA 2W0MA 1V9LA 2BEKA 4I3FA 3HGQA 2BBOA 3DR3A 2OD9A 1D2CA 2QMUA 1RCUA 2ECQA 2HZ7A 3T5DA 4ECAA 2ECKA 4EKGA 3LD9A 3UXHA 3KHTA 4OAQA 1J8FA 1TECE 3CMMA 2WV9A 1T91A 1XJ0A 3DE0X 3C16C 1EFRA 4Z1MD 3NV9A 4Q4JB 5A6SA 3H9UA 4OXYA 4DNQA 2V0GA 2CXRA 3GF4A 1WMDA 2VNHA 1K5GA 4QJ5A 3VX3A 4LE2A 3DV0A 1RWVA 1UXOA 2PKEA 2ZQ5A 3D0KA 4XCXA 4I3HA 2XKJE 3P9CA 3KELA 3PQ4A 1FNCA 4UEJA 3T3NA 4B6SA 1I5RA 5TLSA 2N1MA 1U7XA 2BUBA 5IYZF 2C2KA 4PN7A 4GVPA 3DCYA 3SJAA 4QT0A 4X45A 1U3VA 2WK1A 2ONYA 4MO9A 5J2TF 4BO7A 1G4AE 1QF7A 1UJ6A 4ZD6A 4QASA 1NBAA 1PGPA 3I09A 1REQB 1RYEA 3NOOA 1GU7A 4EQ6B 1EB8A 1BNCA 3GNSA 4DYDA 2QYSA 1ODSA 3X2EA 2QLFA 1GZ5A 4GU5A 5JATA 5JU6A 1VRCA 2GZAA 3TBHA 1AT1A 1X42A 4NAHA 3DZJA 1JVBA 1ZNXA 2WVGA 5EQFA 4GE0A 1ZR2A 4Q1FA 2ES4A 1S9HA 5EIBC 4XVRA 2C7QA 5B12A 5EIHA 1LK7A 5EXDA 2E4WA 4ZU6X 4ZREA 1LPNA 4JI4B 4EA6A 1KMMA 1XHFA 5HJ2A 2WJVA 1XN1A 4ARVA 5GADl 1KGSA 3FHCB 2JI9A 4I14A 2PXCA 4IOLA 2X15A 2XQGA 1SVNA 5ALDA 3M7IA 1O1YA 1YFZA 3LPAA 3MJVA 5AKYA 3H84A 2NADA 4P31A 4LGYA 3VSDA 4YCDA 5EE5B 4BNHA 2RGGA 1ATIA 2NAFA 3R0XA 5IFLA 1E94E 1XTTA 1J2TA 1MX3A 3FPJA 1QDLB 1PT5A 3H5IA 2E1RA 4KO8A 2PGJA 1AS2A 3EMBA 3UAGA 1ZLXA 2FZ4A 5DGHA 3KG2A 1TAHA 2JGEA 3RBVA 3BWYA 1SBCA 2QX9A 4L27A 2POCA 2G25A 4IIXA 4NSNA 1KZGB 3JQGB 4WCVA 4CCYB 3F71A 1ISJA 1UF9A 2QP9X 3PF9A 1YD7A 3I92A 3OECA 4GWKA 1NVXQ 3HUFA 4XUGB 3FETA 1K08A 5IC4A 3UKDA 3JQRA 3SIWA 6PFKA 2CK3D 4ZQGA 1EJ0A 1A9QA 2C4NA 4JYCA 5TT1A 2GJ8A 2PS1A 4GR4A 4R69A 3V4RA 3W04A 1MC4A 8ABPA 4W1RA 3GLIA 1FDWA 3C6ZA 3GRFA 3V1TC 2FVYA 3V4OA 3LDHA 1LTQA 3HYNA 4HKTA 1SA0B 2Q4DA 5D51S 2PUAA 3PGJA 4YDHB 4C03A 1N25A 3OZSA 2NPIA 3G0DA 1WF6A 3RIYA 4B17A 1LPOA 2IYEA 3D2BA 3LFUA 2H29A 2P6NA 1O95A