5LQNA

Crystal structure of comt in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1h-pyrazol-5-yl)-1,3-thiazole
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title Crystal Structure of COMT in complex with 2-[(3-chlorophenoxy)methyl]-4-methyl-5-(1H-pyrazol-5-yl)-1,3-thiazole
rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 79
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lqnA00
3PVCA 5E1OA 4X61A 5CVVA 3A26A 3HA7A 5D1HA 3C0KA 1SKMA 3E8SA 3MCTA 3HA5A 5EKUA 3EMDA 3UJ8A 5BXYA 2JH8A 4O29A 1XJ5A 2ZW9A 2GAFA 2I6GA 4C07A 4QQKA 3QOXA 2ZTHA 4MWZA 2PWYA 3EVBA 1ZG3A 1YFJA 1SVUA 3UJ9A 2XBMA 3B3JA 5DM2A 1SG9A 2AOVA 2CKDA 2NXJA 4FGZA 3M33A 2AS0A 2PX4A 3KQQA 2E5WA 2P7HA 2P1DA 4IV8A 4PCLA 4RVHA 1I1NA 2GH1A 5K0LA 4CTJA 3GWZA 1VL5A 2ZZKA 3DTNA 1R6AA 3M6XA 4GOMD 4PCAA 5CVUA 1H1DA 4UOEA 1WZNA 3G2OA 2AVNA 3MHTA 2XYVA 3JWGA 1EIZA 1XDUA 2H00A 5DX0A 3AWIA 3R3HA 5IH3A 2B9EA 4XUDA 4JXJA 3U81A 1JTEA 5E1MA 3G89A 2Q41A 4XUCA 4YUZA 3TRKA 4EKIA 2C7RA 3RIEA 4QPPA 3GNLA 2JHCA 3GIWA 5JR3A 2OB1A 3TM4A 2IIPA 1BOOA 2O07A 4FS8A 3EVZA 3FUTA 3DXYA 4M37A 1KPIA 4PINA 3VSEA 1NW8A 3A4TA 3K6RA 3M4XA 1EAMA 3KHKA 5GM1A 3S68A 1N7JA 3T7RA 2JJQA 2NYUA 4GOND 3OU2A 1DUSA 2ZWAA 5DTQA 3UJCA 5ICEA 4PGHA 4PYLA 1VIDA 1YFLA 5FWDA 2Z6UA 1O9HA 2K4MA 2O05A 3IYLW 1MJFA 2PBFA 2WA2A 2JH9A 3NDIA 3AJDA 3UWPA 3DOUA 4HRAA 4BLWA 1JG3A 1L3BA 3GRRA 3FZGA 3FYCA 3NWBA 3KQTA 5FUBA 1ZHFA 3OZTA 4ER3A 1JQ3A 2PT6A 3E23A 1F38A 1G55A 4RV9A 3SX0A 3CJRA 1BHJA 3TR6A 2PV0A 4MQ4A 4PYOA 2IH2A 3C3PA 3DULA 3LKZA 1IXKA 3GRZA 3NJRA 4Y30A 3SGLA 3D2LA 4QTUB 2VZ9A 3SSMA 1NW5A 1YZ3A 2H1RA 1NBIA 4F86A 3ME5A 4KIGA 1DCTA 3I58A 3P9NA 4AZSA 1WXXA 2EG5A 3ELYA 2EFJA 2ORED 2EJTA 3FPGA 3HCCA 3JWJA 5FCDA 2C7QA 2NXNA 3VYWA 2PT9A 3G88A 4E2WA 2YX1A 4H0NA 4ZTBA 2B2CA 3ER9A 1X19A 4QVGA 5E1DA 5HIKA 2YXLA 4E70A 1JG1A 1TPYA 3WSTA 5B1SA 2PX5A 4RSRA 3AY0A 4C06A 2OB2A 3GO4A 5EQJB 5CCXA 2QY6A 1VPTA 1XCLA 3KQYA 4DM3A 4DQ0A 1NV9A 3PFGA 4XCXA 5FHRA 5DM4A 5ICCA 2PX8A 1O9GA 1TW3A 1HNNA 5E2BA 1UFKA 5KS2A 3DMHA 3TLJA 1KP9A 1IY9A 1N7IA 3MERA 3LSTA 2ERCA 3KQPA 1VQ1A 4IKPA 5FQOA 4C08A 5D1NA 5T64A 1Z3CA 3BWCA 3HCEA 4CWAA 7MHTA 2GPYA 3NMUF 1D2CA 3KQWA 5EHGA 4E2ZA 5CUQA 3P97A 5K0CA 1G8AA 1XCJA 2XYRA 2IBTA 2B78A 2Z6AA 2I62A 1QAOA 5DXAA 2G8NA 3NVKI 1IM8A 2P7IA 3M6VA 3EVAA 2AR0A 3C3YA 3TPZA 2R3SA 3GDHA 2DPMA 5EC8A 3C6KA 2CMHA 3BXOA 1NW3A 5MHTA 2IP2A 1NV8A 2Y1XA 4HTFB 2IDJA 4KDCA 3GCZA 5EEHA 5C1IA 1WXWA 5LSAA 3DP7A 1AQIA 5DX8A 3LECA 3R6TA 4E2YA 3GRUA 4OA8A 1M6YA 2Y1WA 4CXMA 2WA1A 3BT7A 3UA4A 1RI3A 2B3TA 2ESRA 2PLWA 4R6XA 2GS9A 4HGYA 4G56A 4KVZA 1AQJA 2IBSA 1VP3A 4L7VA 3VC2A 4DKJA 4GEKA 5LQCA 1KYWA 5DX1A 1FBNA 3ELWA 4AUKA 2G1PA 2ZBPA 3EEOA 3MTIA 4RYLA 1QYRA 5HILA 4FP9A 4YUWA 4P7FA 1KPHA 3KKZA 5HFJA 1UWVA 3ANXA 5CVJA 3FTEA 2OZVA 3EVGA 3HVHA 4ATNA 1EQAA 3GJYA 3M70A 3CGGA 5FA8A 3O31A 4PNEA 2HR1A 4LWPA 3LDFA 1XDSA 1QAQA 4GUAA 3KR2A 4E33A 3I9FA 2VDVE 4C03A 1FJXA 3G7UA 4PIMA 5DM1A 1TW2A 4P7JA 3BGIA 1QAMA 1G8SA 2AOTA 2ADMA 5LQNA 4HSGA 5K09A 4RTOA 3OU7A 5BW5A 3UFBA 2AOWA 5GIPE 5K01A 4A6EA 5CVDA 1L1EA 3NTVA 2ZIFA 2YTZA 2GA9A 3CCFA 4F84A 3I64A 2GB4A 3MQ2A 5EPEA 4CTKA 4HG2A 2BR3A 2XYQA 5EEGA 3HCAA 2PXCA 3MTEA 3VC1A 3FUXA 5HOQA 1P1BA 5CCBA 3P71T 3FTFA 2ZSUA 5K8VA 1R8XA 4MTLA 3FYDA 4PYJA 2H11A 1RI2A 2QRVA 3BKXA 2PVCA 2VDWA 3PX2A 3OE5A 4YV1A 3QV2A 3HNRA 3HVJA 1FPQA 5EMMA 3T7SA 3KU1A 3UJ7A 1N2XA 2GLUA 3NW9A 5EGSA 3UBTA 2I9KA 1INLA 4FR0A 3LKDA 4GC5A 1JR4A 2EJUA 2IDKA 4POOA 5K0GA 4CKCA 3ELUA 3HCDA 5GM2A 5LQKA 3G2QA 4BLVA 1XVAA 3CC8A 3AXTA 3M6UA 3HA3A 4M36A 4NECA 2BR5A 4R8SA 1B42A 5EG5A 5EKXA 1P39A 4EVIA 5F2NA 10MHA 1OR8A 2R6ZA 2BM8A 2PXAA 4ER6A 1D2GA 2HTEA 3FTCA 2VP3A 3CKKA 3QOWA 4GQBA 1NBHA 4KRGA 2ZULA 5DT2A 3TKAA 1WG8A 3BWYA 4PYMA 4V0RA 1ORHA 4X63A 2IH5A 3MAGA 4KWCA 5G02A 1SQFA 1SQGA 3LX6A 1L9KA 1QANA 3ELDA 3M6WA 3SXJA 1ORIA 2ZBQA 4PONA 2G70A 3DUWA 2JHAA 4R6WA 3X0DA 2ZZMA 1BKYA 1D2HA 1FP2A 2ZBRA 3KQMA 3LDGA 2UYOA 1EJ6A 2OPBA 2NXCA 3B89A 3FPEA 5HIMA 5GIOE 5DTMA 3RODA 1AF7A 5LQUA 2F8LA 5EVJA 3OE4A 5DRTA 1ZKDA 3Q87B 2P41A 3DMFA 1EG2A 1RJFA 5K05A 2O06A 2CMGA 3MGGA 3GGDA 3FTDA 1T43A 4RTJA 4X60A 5E9QA 2JG3A 1FP1D 3F4KA 4E31A 3CJTA 3E7PA 2HV9A 3DR5A 3A7EA 3JWIA 4HH4A 1L3IA 3GRYA 4P7GA 5K0FA 2AOTB 2PWPA 3ER8A 5CD1A 5U4XA 2PX2A 3A7DA 2YXEA 4DCGA 3KPUA 1VBFA 3LBYA 1UIRA 4RTRA 1R8YA 5E8RA 5HIIA 1YB2A 3LCCA 4X1OA 2QM3A 3SMQA 3PS9A 2PXXA 2N47A 5FQNA 3EMBA 2ZCJA 4C4AA 1M6EX 4KW7A 3T7TA 4ER7A 2NP7A 2AN3A 2FRXA 3G8BA 5FULA 5EIFA 3HVKA 4RTNA 2CL5A 1JSXA 2ZIGA 1RI1A 1VE3A 4LWOA 5C0OE 4YUVA 2OYRA 3TM5A 4U7PB 4KIFA 5BP7A 2ZLBA 4AZTA 4IWNA 1PJZA 4E30A 2QRVB 3B7PA 3KPJA 2UYQA 2OXTA 3OFJA 2Z6QA 1JQEA 2BH2A 1U2ZA 2ZIEA 5GP1A 2HNKA 2PY6A 3KQSA 4BP1A 4HC4A 4QTTB 2BR4A 5DTRA 3B5IA 3R0QA 5KYGA 3P2IA 4RTQA 1QZZA 4R8RA 3P9IA 2AN5A 4FZVA 4AZWA 2HMYB 3UJBA 3KPWA 1SUIA 3LCUA 5H02A 3OFKA 3OPNA 2YR0A 3MB5A 3UJAA 3OU6A 3BKWA 4QDJA 4FSXA 4LECA 1ZQ9A 4PYQA 4RTPA 1JG4A 4GF5A 3PT9A 1BC5A 1KYZA 4B17A 3BWBA 3PLAE 3I5UA 5DM0A 4ER5A 4PYKA 4EK9A 1I4WA 2CWWA 2FPOA 3A25A 4QPNA 4F85A 2ONYA 5LQAA 8MHTA 3C6MA 4EKGA 2P40A 2PSSA 5EHIA 1VLMA 5E1BA 4PGGA 5LQJA 2O0LA 2P3QA 4RTMA 4K6MA 3SM3A 2LD4A 3HM2A 3REOA 3P9CA 3SVZA 3UZUA 2AOXA 4FT2A 4R05A 5LQRA 2ONZA 3K0BA 5DXJA 2OKCA 2HWKA 1X1CA 1R00A 3H2BA 2G72A 1P91A 1O54A 3RW9A 4YUXA 3TQSA 1VP9A 4YUYA 4LG1A 2IGTA 4RX1A 5DWQA 2NP6A 5CM2Z 1JSZA 5DSTA 5FADA 5HIJA 4YMGA 5C9ZA 2BM9A 4WVLA 5ICGA 1ZGAA 1KPGA 1XXLA 4E32A 2P35A 3V97A 4PYIA 5E9JA 4OBWA 5EOVA 3O4FA 5E8JA 1YUBA 5KVAA 3R9XB 3THRA 1WY7A 3GRVA 3ERCA 4GOLD 2A14A 4FT4A 3DXXA 3Q7EA 2PJDA 2VS1A 3B3GA 3PB3A 2ZVJA 2FYTA 3MCZA 1G6Q1 2WK1A 3PFHA 3G2MA 1X1BA 4OQEA 1AV6A 4RVDA 5F2KA 3G5LA 3KQOA 3NVMB 3UJ6A 3FUUA 5FTWA 3LHDA 4PWYA 3EVFA 5K0NA 4RWZA 4ER0A 4IV0A 4OA5A 4RVGA 3HP7A 1NE2A 5K0BA 4P7KA 3P2EA 1JTFA 3TOSA 4BLUA 4C04A 5KQSA 2P3OA 2YQZA 3HCBA 2C7PA 2UYCA 2FCAA 1XDZA 5DRYA 2AOUA 5EMJA 3HEMA 1EJ0A 3EVDA 3KQVA 4V0QA 2JHPA 5BW4A 3EEYA 5JUWA 1PRYA 5M5BA 3EPPA 5GWXA 3TKYA 4DF3A 5EZSA 4OX9Y 3G8AA 5HEKA 3SSOA 1Q0SA 2B25A 2YXDA 1NW7A 4HGZA 4QQNA 4DCMA 3B3FA 3A27A 1G60A 5EMKA 3G2PA 4HTFA 4RVFA 1XTPA 4DA4A 5EMLA 4P58A 5ICFA 5HZMA 5IKMA 5KQRA 3FPJA 3EGEA 5ERGB 3ID6C 1G38A 4AZVA 3LBFA 1JG2A 3PX3A 5K0JA 3P8ZA 3BGDA 5DSXA 2G71A 1YZHA 4XUEA 3IHTA 4YV2A 3EVCA 3BUSA 1ZGJA 2V74B 2P8JA 4A6DA 4BP3A 1RI4A 3DH0A 4OBXA 1RJDA 3E05A 3KR9A 1KXZA 3O7WA 3UJDA 2OBFA 4WXHA 2XVMA 4Z2YA 5DPMA 3DMGA 1SUSA 2VDUE 3CJQA 5CIYA 3GXOA 4U7TB 5EIWA 3L8DA 3P2KA 3BGVA 3OCJA 3DLIA 2QE6A 2PKWA 4PYNA 3V8VA 4QVKA 1KHHA 1JQDA 3CVOA 3LPMA 1NT2A 3GU3A 3OZRA 3OZSA 3DLCA 1L3CA 4KDRA 2C7OA 2IFTA 1X1AA 1NKVA 3P9KA 3LCVB 3IV6A 3SSNA 2QYOA 3NWEA 3CBGA 5GINE 5GOZA 3FUWA 2FK8A 4AX8A 4M7RA 1KR5A 2V7EA 2AZTA 3LGAA 3EGVA 3JWHA 3KR0A 1Q0TA 2EX4A 5K03A 3HTXA 2ZWVA 3EGIA 1V39A 2XVAA 4CKEA 4OQDA 3UA3A 3TFWA 4QDKA 5CVEA 3LL7A 4GBED 2BZGA 2FK7A 4BY9E 3EVEA 1RI5A 2DULA 3BWMA 4FSDA 1Y8CA 3LDUA 4ISCA 4M38A 1P1CA 3HVIA 3ORHA 1M0EA 1MHTA 1HMYA 2I7CA 3FPHA 5P8WA 5T6BA 4EQZA 2NXEA 5DLYA 2IH4A 2FHPA 2IPXA 2PGXA 4MIKA 2OO3A 1DL5A 3THSA 2UYHA 3KPYA 5E9WA 1F3LA 3FPFA 3TMAA 3SR4A 2ZZNA 1KIAA 3R24A 2P3LA 3FRIA 4Y2HA 2AN4A 3HCFA 5EZQA 5T67A 3AXSA 4CKBA 5LR6A 2AOUB 5FWAA 1YF3A 4EMSA 3KPVA 4C05A 1RJGA 3IEIA 1WS6A 4YV0A 3I53A 3PTAA 4YMHA 2O57A 2OY0A 2AVDA 4DZRA 3BZBA 1NW6A 3DXZA 4RTLA 4MHTA 2NNWB 3G5TA 2YVLA 4GC9A 5FA5A 1I9GA 3KR1A 9MHTA 4RTKA 3FRHA 1RJEA 4E2XA 2UZ4A 3NDJA 2ZFUA 3FUVA 4X41A 2YUIA 4DMGA 2KW5A 5F2OA 3T0IA 4RTSA 4GOOD 1R74A 1R18A 5E2AA 5K0EA 5FHQA 4PIPA 1X1DA
chains in the Genus database with same CATH superfamily
3JRNA 2HQRA 3PF9A 5CVVA 2VP4A 3VZRA 2VRCA 1SKBA 3ZDAA 2CHVA 4PANA 1DI0A 1HEIA 4WA8A 3BD8A 1JN0A 4XI9A 5EE0A 4UE6A 2FDCA 4QBHA 4FEYA 1FFXA 3RVNA 5EGNA 3ETHA 3U4CA 2V5UA 2WLTA 4AJ1A 2L82A 1E98A 1XZAA 2E9SA 4QQFA 2OE2A 4UAUA 3QIAA 4KACA 4NMMA 4XM2A 4P4SB 4OI0A 3O4JA 4QU9A 3UJ9A 3RFTA 3KYIB 3NNNA 4NZYA 2ACKA 4BU1A 1D4OA 5BSVA 4GPIB 2CZGA 2CKDA 1TD9A 3QU2A 1S0UA 4OU4A 5FLYA 2X0FA 3S2SA 4KLNA 4E03A 1EQ2A 1KKLA 4L5BA 4ZRNA 3UOGA 2RGUA 5TF0A 1K88A 2C5SA 3IEPA 4H2DA 1SVLA 3JWGA 2YFHA 3DUFA 5LN1A 4CF5A 3A28A 1PZXA 4TRJA 4Y6GB 5BRNA 1XUOA 4RCZA 5AM4A 4WI1A 1LSSA 3LQQA 3WBKA 3ZXYA 7MDHA 3DTYA 4JC5A 3O8QA 1QGZA 2HNAA 4MI1A 4NJEA 4BJ5A 1ZM7A 2JLAA 2XRFA 4QLOA 4QPPA 5HHTA 5JR3A 3PE4A 5BO5A 2Q27A 3OX3A 1JBKA 4NONA 4P81A 2UZ3A 5JH7F 1L6IA 5LM3A 1N0HA 4WKOA 1ZA2A 2C0PA 4FS3A 1GZHB 1OAOA 2D0OB 3EHDA 5HX7A 2O2DA 3K8ZA 1COZA 3N2EA 4P3OA 4MUHA 4PYLA 2H4YA 1HEUA 2BBOA 1FL9A 2D59A 4WZBE 5IBCA 4WT7A 1GPYA 2PCJA 2VYNA 2C7BA 3ZHQA 4JUDX 1KQFA 2QIPA 3QEJA 5LP6C 5KREA 1E6WA 4HRAA 3HDTA 4E88A 2ON6A 3FZGA 5D3ZA 3EWSA 3F1KA 5DNWA 1G55A 1NQUA 1X7ZB 2FPPA 2NT4A 1FMJA 3ORRA 4AICA 1V16A 3TE6A 1SZCA 3VBCA 1AV7A 2BUCA 3THYA 1MPXA 2GN9A 1UEJA 3FBWA 4TMXA 1F0PA 1A7KA 4URWR 3GQBB 2HF8A 2VYCA 5IYZB 6PFKA 3QPAA 4BIIA 1XF9A 4DGSA 1JHMA 4YRKA 2EFDB 2ORED 1XPJA 1VBKA 3DFKA 2QTTA 1L7EA 4RHFA 1R6VA 4RKWA 3I6BA 5GVRA 4OK6A 2YXLA 4E70A 5JMWA 2PUAA 2KYRA 2Q4RA 3LYAA 3S27A 3ZCTA 4B71A 4JB8A 2W0SA 5CCXA 3IQZA 1PZNA 3EEBA 3KQYA 2BFEB 3BXEA 2ZJ0A 3EQ2A 1NV9A 3K8YA 3D6NB 5LWHA 1KI3A 3D3WA 3W8NA 3OC0A 3WDMA 2AEFA 2BKUA 2WFLB 3DEJA 2GK7A 4GVLA 4ERNA 2GN1A 2YWRA 3GZNA 4H7KA 1YVPA 1Y1TA 1OGYA 2J7KA 4UHBA 3UFXB 1YFZA 4IKPA 1SVWA 5FQOA 2JLUA 4DN6A 2CSUA 3ER6A 1Z0AA 1PWYE 3H2YA 4LFBB 1FUYB 1GHTA 1U2TA 1V37A 2A1UA 3ZXIA 3DZIA 2BT4A 1PR2A 2NN3C 4H08A 3I9NA 2I7VA 4WVFA 3K0CA 3TNJA 4CLOB 1U1CA 2CXTA 1YIAA 1PKEA 1XMSA 2WSSA 2XQJA 2EVWX 2FFRA 3NGXA 4P53A 2RBKA 5CUQA 1RWBA 5DOZA 2HQSA 1ADGA 2XYRA 4K9NA 2XUIA 4TMTA 3HBJA 2I62A 4N5LA 2IU0A 3S2YA 1ZLYA 3L06A 1S5PA 4UHEA 2QSUA 1PTKA 1A9XB 1U2GA 3DGEC 3GDHA 4M3NA 1IBSA 4TKVB 4X3CA 4IQGA 5KYYA 2BKVA 5D3KA 2J0UB 4S12A 3ZQJA 3INNA 4Z0NA 1AUVA 1PJ3A 2CL6X 1A27A 4ND4A 1BDHA 4Q3NA 3GFSA 3UG7A 1DAFA 5CA1B 4BX8A 3C3XA 2Z09A 3F0TA 3C87A 3GUUA 4R51A 1MX1A 2WF6A 4BXOA 1MAWA 4AECA 3MWDA 4DXDA 4RV4A 1M76A 1U2RA 4JA0A 3K6KA 1E3QA 1RI3A 2WYOA 3I2IA 1J99A 4I4TA 4KWHA 3RK1A 1FJ2A 5IAKA 1BGVA 3IXLA 3OZGA 3STXA 2A9QA 2ZVPX 3IFSA 3VNQA 2PUEA 3USZA 1KYWA 1FYVA 3KLPX 3M3DA 2VNJA 1Z6YA 4MPPA 2Q2NA 1IVYA 3CMMA 3UQYS 3E9QA 3I61A 3KT8A 2IYYA 2JAQA 1R7RA 2ZUCA 1SIBE 5EJAA 3GBPA 4J91A 2D7CA 3EVGA 2Y6VA 3JASA 3U0BA 1T10A 4O4JA 4GNKA 3BOSA 1SVOA 2ZS9A 4G8JA 2HT6A 1BFDA 4IZIA 1ZHHA 4NJOA 2QL5A 1XTRA 4W9RA 4IW3B 1U3WA 2D7JA 2ZSKA 4XDGA 5CDFE 1T8WA 2CXHA 3BGIA 1Z4LA 2G82A 2DUUA 3C6ZA 4HXFB 2SKEA 1URPA 2WM2A 3KJNA 4CE6A 5KEIA 1YH3A 3S2UA 1Y9DA 1XTSA 5HSGA 4FD3A 4LBZA 4YFVA 5F3RA 3HN6A 2WAOA 3AR4A 3ON5A 2I99A 2I29A 1XVUA 2YZMA 3PWZA 4O33A 1T1IA 3QLJA 2W6JD 1AXGA 2YXBA 4OH7A 4NPCA 3WGZA 4CCWA 4F8JA 4KGDA 3PGMA 1JPNA 1MB9A 5HOQA 5K3CA 3RRYA 3D4BA 3T95A 3TW6A 5FFNA 4XWAA 3UANA 3LU1A 4Y0NA 4NHOA 1BMDA 1KZ1A 1ZD5A 4MRMA 1WLYA 4KWTA 4AMZA 1YHYA 4R2LA 2Q5OA 1UFRA 1QIMA 3T7SA 1V95A 1JMVA 2PUDA 1U3UA 2J8ZA 4ZV4A 1YC5A 3V8NA 2OK7A 2PZJA 4YP1A 4ZU3A 1W2GA 3DEHA 3G2QA 1UODA 1XD9A 2WTBA 4JNCA 1NRXA 3EIUA 2AN9A 3RRFA 4ROSA 2MINA 4J07A 4Q1AA 5EG5A 2FX3A 4F6RB 4ER6A 3ZCVA 2EEZA 1K89A 4RKRA 2Y1OA 4EUSA 3B1VA 3HQ4O 4DMUB 4DJJA 1RXCA 2PT5A 3TZHA 4KWCA 4CW7A 1KZ9A 1VDMA 3HMKA 1FX1A 4BO7A 1CS0A 3A36A 1MB2A 4FGUA 3K5PA 1KMHA 4QIHA 2GCOB 3H1BA 3A4VA 1ZRMA 3EC2A 1ZKMA 1PFKA 4FHGA 1RQXA 4J2OA 4NH0A 4CEJA 3H83A 2I3DA 4HNUA 4B76A 4AY3A 3RODA 2C42A 4EPYA 2EGUA 4KTVE 3VSCA 1JHAA 4BAZA 3NOQA 5KJCA 1EXVA 5AT1A 2WHXA 2WQZA 3RAGA 4AWXA 3ENZA 4LTMA 2P9HA 3RWMB 4OHXA 2B98A 1NQ5A 2NYVA 3BGOS 4MINA 5BMVA 2ROQA 4KXYA 3STWA 2E4YA 2NACA 3SX2A 4LNUB 3RANA 3IP9A 1L5HB 1SU8A 2PS1A 1NVKA 4YGXB 3DR5A 4CIWA 4DNFA 1YR8A 3C70A 3G82C 2AG8A 1L3IA 3ZE9A 1T15A 1ECBA 3EEFA 1M72A 3GRYA 1KU0A 3SAJA 1QS0A 2XTNA 1DOZA 2YXEA 4DT1A 1NBEA 3KAQA 2E89A 3O2SB 1T9GS 4V38A 4OYHA 3RAPR 5C4MA 1D2EA 2GCEA 4TVKA 1S9HA 7ABPA 4FE3A 2JKYA 1NMEA 3WNVA 3KOUA 3RRMA 3WYDA 5F4BA 4S05A 3W2IA 3FMFA 1M6VA 1OWPA 3D6VA 3L1UA 2X3YA 3NJ8A 4JC4A 4M9ZA 3AF0A 5FPHA 4AF8A 3ZBUA 5CFOA 2MDTA 2WT9A 2R6GA 1JSXA 4Q18A 5DI3A 5B1EA 3S1SA 1SQ6A 1GPH1 3ET5A 1XTJA 3JQ7A 3TRFA 4U2CA 2I76A 1PJZA 3X1YA 3CVUA 3L8HA 4ZYWA 2AA3A 4CMHA 3MTDA 3IBTA 5HS6A 4RF3A 1C41A 2MJLA 1A9RA 3CU5A 3ICVA 2ZSHA 2XCLA 5D00A 3ORFA 3AYXB 1S4QA 3S81A 1OT5A 4R1SA 1Z2DA 3ONNA 5CNKA 3TQTA 5E6RB 2BM1A 5ILQA 3MD9A 3NPAA 3ZE2B 4YMTA 4V1CI 2IP4A 1GV0A 2H2FA 2PX3A 3ORQA 3MUNA 1QRTA 4G8CA 2YWBA 3OO0A 3WRXC 4A0QA 3ZHTA 1Z6PA 3EK2A 4HNSA 4L1KA 1ESCA 2ZB8A 4YAJA 4JYZA 2QJWA 5C52B 3BWBA 3PEVA 3HJNA 1K3UB 1TEXA 3I5UA 3DFMA 4PYKA 5DM0A 4EB6A 4NZPA 2ERYA 4YROA 3NBFA 4F85A 1CUDA 2CK3D 3CVVA 5HKBA 2F64A 4RKQA 4HX2A 3O9MA 4TKZA 2K87A 4O1HA 5E1BA 1SK9A 1O6GA 2XB4A 4MGIR 3BHMA 1K63A 5LQJA 2F1KA 3C1AA 3CH7A 4NWIA 4OU5A 4XOIA 1AS3A 2Q4EA 4QYIB 3MJ4A 1KEZA 1A1SA 1D1QA 1T8UA 5HP4A 1XZKA 1F8FA 1QDLB 1YI8A 2QR5A 1E7WA 2VK1A 2YJNA 4FINA 4MQEA 5FI0B 1PQYA 3PUJA 1O54A 3LPAA 4CTNA 4E0BA 2IGTA 2FRDC 4EJSA 4W8HA 1D1PA 4WNCA 1UM9A 2HL6A 5LNK6 1HNWB 1XMPA 4OK3A 2GMWA 3PD7A 1UCFA 3PUVA 5ICGA 4CMBA 1KPGA 2AZDA 3HBMA 4WZ6A 3WZLA 1QC5A 4HP8A 4HZIA 1T0IA 4M4SA 4O2AA 1FYFA 1I51A 5DYNA 4OHWA 4Y9SA 5LU8A 2FWRA 2QLBA 1Z0UA 2P27A 4S1OA 1W36D 3PJFA 4Y2SA 4GWLA 2I54A 4FT4A 1ZOIA 3W3AA 5B58C 2ZTMA 3MJCA 3VNRA 2QRQA 1VA5A 3LVQE 1PL0A 4QYTA 5EJ6A 2HREA 2EP8A 4KFRA 2JLXA 3ILHA 3E5NA 1L4EA 3EX7C 1IQUA 2W43A 4DRXA 1YRWA 4AM8A 3VFDA 4ZJPA 3G0GA 2BOVA 3EIWA 3ZWWA 1BSVA 1E1RA 1Y1QA 2I4IA 4IUBS 4RVGA 4JU8A 4LHEA 1Q15A 1F2DA 2HMTA 4B44A 5FWNA 1TKAA 4M8SA 5TMPA 3MIIA 3KOZA 4GZ3A 4GW3A 2C7PA 5IXYA 4FYKA 4QUGA 4W4TA 5DCLA 3IOYA 4QO7A 4ZCMA 1QUEA 1J00A 3LX5A 1FZQA 4P4TA 3ONFA 4HPWA 2XH8A 1N8NA 2SCUB 1NAIA 2WF9A 1OMOA 3G8AA 5HEKA 4FDVA 4C0BA 2QRHA 4B5KA 4DCMA 5LPNA 4KIUA 1ES9A 3DV0A 2XDAA 1J8DA 4IO1A 4FB4A 3REFA 1Q3KA 4I5DA 3RFVA 3UV7A 2XEXA 3F6SA 4KR3A 1JEOA 4B4UA 1JHOA 1NJ6A 2DPGA 1L4BA 1K8YB 2BISA 1EVJA 3L4BC 3P8ZA 3VH1A 4YI5A 3HWWA 3TDKA 3H6KA 3LS2A 1SG6A 1L8QA 4GI1A 2BZ1A 4QQRA 4J1NA 4AJNA 2CJXA 2FG6C 1OZHA 2PUVA 1RI4A 4UXHA 4TROA 4C4XA 4OBXA 2DVMA 3E05A 1VOTA 4ZVLA 4NS4A 1ZNZA 4XWWA 4FHEA 2BGTA 1IONA 2QTFA 4EHDA 1SUSA 4CIBA 3DLHA 1JW9B 1H4VB 1Y8QB 2Y1CA 2OCKA 5TC4A 3ZCXA 4F0JA 4BNNA 2B2XA 4E1VA 1MB3A 1QVZA 1RLJA 4HN2A 4BKQA 5DNVA 4M86A 4EZBA 1EWTA 3PI6A 1AOXA 5DZSA 1OH8A 3FMVA 4JBYA 2RGGA 4H7DA 4G36A 4HQOA 4B3JA 5KYWB 4JLKA 1LLUA 3H9JA 1QH8A 1BN7A 5A04A 1JHYA 1U6KA 4ZEOA 4LQDA 4UOZA 2HM7A 3FUWA 3HU1A 4GRIA 3O5AA 4LRTB 4ZI5A 3KR0A 3FYUC 3S3TA 3DWGA 1CUYA 4AQYB 3KXLA 1KS9A 4D02A 2FSSA 2AF4C 3CNOA 4DWJA 3T3NA 1TECE 4ISCA 2PU7A 5HUHA 2GAJA 1XZGA 4MVCA 1TA0A 3NH6A 1YTLA 4DXAA 1GL6A 2IYZA 3E22A 1D0SA 1NI5A 1XMVA 4UVHA 1CUAA 1VBNA 2D3WA 2GRUA 1A5AB 4UDOA 5IJAA 1M1XB 3WYEA 4NCNA 1KOLA 1WPXA 1UMDB 4BEJA 2Y2VA 1GN8A 4INJA 4V2UA 2HU5A 3DEAA 3JQGB 2QJFA 1EZ4A 3E5HA 4LS3A 4Q9LA 1YI1A 2O57A 1ZL0A 3ENWA 4GH5A 1AUOA 1VLJA 1KAMA 4U7FA 4W1QA 4AP9A 2P77A 4TMWA 2BIFA 2RGNC 4LFAB 2YMLA 2IF0A 3OLXA 1G2IA 2HPVA 4RTKA 4MRPA 2JCYA 2A9FA 4PYRA 2DPLA 1RWKA 1RYFA 3EUWA 2V7QD 3A32A 5SICE 2I4LA 1NF9A 1IK4A 2JBHA 2ZS7A 5CB0A 3FXAA 2J09A 4RTSA 6REQB 1EFVB 2PPVA 3OWOA 3LFTA 4MB2A 3RUDA 2ISCA 1VJCA 2VFAA 3BXGA 3L0ZA 4DR3B 1UT8A 3MB8A 1MBZA 2RAFA 5L40A 2CB0A 2IEAA 2Q1TA 2WF8A 3AR8A 4P31A 4PBSA 1AGPA 1YE3A 2HCBA 1G3UA 2X86A 5BYJA 2I80A 2ZE5A 1ZUNB 4DS3A 1PJLA 1OYVA 3H1FA 3MTGA 2BMEA 2BFOA 3K72B 3EZFA 4H1TA 4WAUA 4OI2A 2WT4A 1U0JA 1RWMA 3I37X 3ZZTA 4DC0A 5A03A 3WFIA 3VH3A 1NLUA 3DKVA 5JYDA 2PE5A 1U0NA 2AYZA 2J33A 1SXHA 4FYYA 1C8KA 3B13B 3KKLA 4MWSA 4CKWA 5BQ3A 2WWFA 2ZYVX 3H5AA 4URHA 2G07A 2OR3A 1U7HA 1Y1LA 4QOHA 4D96A 1YHZA 1H5NA 1K06A 4LOIA 4OBEA 3FOAA 3AEKA 4L5CA 4TRNA 1HNZB 1NASA 1HT3A 2FPIA 4BGEA 4Y6SA 4DWWA 1NHWA 2IA5A 3MSCA 3TLKA 1I94B 1U0BB 3ZX5A 3UQZA 3BE6A 1U2DC 4JCOA 1A96A 1W5BA 1KS2A 3TMYA 2C2WA 3C6XA 2GKOA 3GJQA 3TIGA 4XQGA 2XY4A 3WIUA 3G89A 2DH5A 4CKZA 3M5WA 4ZXFA 3L93A 3RIEA 1I3LA 1LX6A 1HLGA 1Z83A 3BSYA 4MRVA 4FS8A 3UH1A 3V8BA 2G0TA 1IVSA 5CAEB 2QRNA 4O4HF 4OX9B 1BWPA 2HN9A 2JGRA 4FNAA 4TV9A 2FEAA 4I5GA 1H2HA 2BFMA 2FEMA 3CONA 4PAMA 4Q21A 5AVTA 4EI8A 5KTYA 4P32A 3HB0A 1Z33A 1BTOA 2VUIB 3R3JA 5IW8A 4HV4A 5B57C 4Q37A 1ZIDA 4PGHA 4XLLA 5JSFA 1U2PA 5MFPA 1E9EA 4F3RA 4UMDA 3NCTA 1U3TA 1V1RA 4AKEA 3AU9A 2HQ1A 2IYOA 4BNHA 2W70A 3WDKA 4PQFA 1USKA 2X6QA 3TB4A 2QENA 2A0UA 4CT0A 3BMOA 5GZ1A 2WP8J 3ZC3A 1KO1A 2IZOA 3WL5A 1MIOB 2XQIA 3B36A 4PW0A 4BDSA 1AXEA 3Q7RA 1TZ2A 3KBOA 4BAGA 2OQ2A 1L5YA 2F48A 1AZLA 2G9UA 2XD4A 1QH0A 1VE1A 1XRRA 3KBBA 1SXPA 3UXYA 1I3KA 3OKAA 4XFKA 4I46A 5EIHA 4EARA 1QQ7A 1UBRS 5CVCA 1FNNA 3AX6A 1RLMA 1IOWA 2PZLA 4WWHA 3UENA 4ARCA 4PYJA 4L73A 4WUVA 1H8EA 2GAAA 5ER9A 3RTAA 4QFCA 2GHTA 4Q3DA 2PT9A 2D3TA 3G88A 2BGRA 4IQFA 4Y1RB 4HDRB 1SXJE 4XYBA 2Q6LA 1VRWA 2RH4A 5LXTF 4BNDA 3RAFC 1PR3A 4K2HA 2FSIA 4DPMA 5B6IA 4EYOA 3OA0A 2RAUA 4LYFA 4PO1A 4XVRA 4FDUA 4DUGA 2OZKA 4RK0A 1XVTA 2W2QA 2X7HA 3UB4A 3W8RA 2PA0A 3PIRA 4BJHB 1P5RA 4NDZA 2EQBA 4KQWA 5L4SA 1K97A 1L4HA 2JFXA 4URYR 2DQ4A 4I81A 4ZAZA 4N48A 5TR9A 5EE1A 3PR2B 3KEQA 4DB4A 4ML3A 1WD7A 4I9UA 3ZJTA 4L6CA 2WTNA 4FGLA 3VAAA 1A9ZA 1QPGA 1V8ZA 2EKQA 3UW1A 4AYXA 3SEAA 5B1DA 5C4GB 5J3JA 1QYWA 1RKUA 2CVFA 4EWLA 4C78A 2GBLA 1OIVA 4RZSA 4DDTA 2J3MA 3B2NA 5BSKA 2C1ZA 1TT7A 2AJLI 3CLVA 3D0QA 1OYOA 3DTVB 3FH0A 3P97A 2VJMA 4NEHB 4Q1BA 2HHHB 2Z6AA 1IM8A 3KYDA 5CU7A 2JASA 1MW8X 2FN7A 4KGVA 2NU7A 1YZLA 5MHTA 3BXOA 4CMEA 3OZEA 1KFBB 1YZUA 2AUMA 1H5UA 3HFSA 5IAJA 1NV8A 4HQNA 1ZD1A 5HCNA 5LVAA 3LXXA 3E0XA 3G68A 4KRXA 1RBMA 4MWOA 3ZDZB 3BTSA 4MQFA 1ULTA 4YRMA 5LSAA 3BMNA 3IAS1 4QUBA 3RSOA 4TXLA 3AOEA 3CINA 3NPMA 3R6TA 2G1KA 2ZJ8A 3ZWNA 3L8MA 5AKKA 2W2KB 4KMSA 4QZVA 4Y0AA 2QQEA 2ESRA 1JMYA 2JL1A 1ZBQA 3H13A 1RPTA 1VDZA 4JI3B 4G56A 4I3GA 1CULC 1DJMA 2G3YA 2A1TS 2I2BA 2PQ2A 5HZGA 1C5KA 1VMIA 1YB4A 5DX1A 2CHQA 1W5EA 1YA6A 3MTIA 7GPBA 1J0XO 4OH1A 5FBQB 3OWXA 4UC0A 3ITEA 3TTXA 3D6FA 4MW0A 4DQVA 4RD1A 5ED0A 4EECA 2GXAA 4BWYA 1ZS9A 2Y67A 2Z8ZA 3IHKA 1BH2A 1F4VA 5G0SA 2JLVA 2DX7A 1X6VA 4QHTA 4N7BA 4UJ5A 4DNXA 5IM5A 4E33A 1UT6A 1JHUA 1GNLA 2O8CB 3LFHA 5C35A 3I05A 1G8SA 1I2ZA 1W9HA 2XHEA 1Y1PA 3MINB 1XYYA 2HA2A 1G16A 1GL7A 2OHHA 1XD2A 3SZRA 1XO1A 4B3BA 4ECEA 4RLHA 3GNTA 1F8XA 5A6SB 5GIPE 2GKGA 4FCTA 4J9VA 3VVLA 2CZCA 2ZIFA 2CHEA 3A1UA 3F6EX 3OZDA 4S1PA 5LA6B 1APBA 5DK4A 1KWKA 4IDNA 2HA0A 5EWMA 5C46F 1HZZC 1UBHS 2V9PA 4Z53A 4BMCA 2KSQA 4F2PA 5JYEA 3R23A 1G21B 4I50B 1E2NA 1SUFA 4NFLA 5F73A 3ZDYB 1QG4A 1N6LA 5F1OA 3EEQA 2XXAA 2YMMA 3DEKA 2KQUA 3HUEA 3IV7A 4MQ6A 3N0XA 4YRNA 3LK7A 1TEZA 2OV1A 4US1R 2PUWA 3NWOA 4FW8A 5EGSA 4POOA 3V2IA 3DMTC 2CDAA 4NFSA 2K7FA 3D2AA 5JSZA 4F5DA 4QM6A 1UZLA 2KLBA 1GAJA 3M6UA 2BUBA 3NHSA 4R8SA 3HA3A 5FUYA 4WBSA 4AULA 5EHXA 4EVIA 1P39A 1SB9A 1NSTA 2G36A 2HO5A 3COVA 1OR8A 4LWZA 3FCUB 2HTEA 1DO8A 1VKOA 3CKKA 3CR7A 4MRRA 5FBWB 5FOXA 3ZLUA 3ZZNA 1A72A 1DC6A 2QX9A 3BWYA 4PYMA 2VTEA 1UK7A 3CZ5A 3AIOA 2WILA 4OHMA 1ORHA 4KQHA 2NTEA 2WBLC 4WFIA 3T99A 2P65A 3M6WA 2H4JA 3K0HA 3B5JA 1WHSB 2JHAA 3DO6A 3G9TA 3II6X 4JGGA 3PE3A 1PFYA 2WSBA 4Q0MA 1KZ6A 2IHYA 1NVXQ 2ZBRA 2LIPA 2ZR0A 3C3JA 3KWMA 3LDGA 3M3HA 3RE1A 4ESHA 4ZMSA 3WNCA 4M88A 4I66A 1J09A 1RW4A 4PFKA 2E2WA 1AKTA 2UAGA 4LC0A 1TK9A 3OE4A 5TGDA 1L5LA 1NNI1 1K7SN 5AM2A 4I1IA 4CU5A 4J9UE 1Z6XA 1QHGA 3ISVA 2FMHA 4DV4B 3I9KA 1GQOA 2RHDA 1ORTA 5ESDA 4X94A 3CE6A 4LN1A 4L6AA 4ARAA 2ZRBA 3IC5A 5DASA 4D9GA 1RADA 2JG3A 2X3UA 4E31A 3AI7A 4MPDA 4OXQA 3GBVA 4NE9A 4N41A 4JCCA 5CH8A 4N6OA 1XP8A 4KZPA 5FBRB 4P7GA 3DVSX 1MCZA 3U39A 2KM1A 1W75A 3UMJA 2GD6A 3E9MA 4BX0A 3GLFA 3KPUA 2UVQA 2C3PA 1UIRA 5E8RA 2PGJA 3EXHB 5EJMA 4DQKA 2B92A 1KTIA 1C30B 3A14A 2AN1A 3KKEA 3OIWA 3PQFA 1TMGE 1N3BA 4PV7A 4WN9A 1Q3TA 1AKYA 5I4CA 1REQB 3H2GA 4MAMA 4A8JB 2WMOB 2VZ8A 2QTHA 3F7OA 3H9CA 4Q3CA 4Q3EA 4W6QA 1YR9A 5A05A 4JK3A 1TUGA 1JU4A 3SF8A 1R4AA 2XGOA 4JD5A 4Y18A 1D2MA 4OG2A 2V7VA 1BHSA 3U7JA 2OXTA 1U5BA 4C14A 2OEPA 1PT7A 3JS5A 3IBCA 4CM8A 3SLRA 3AVQA 4HC4A 2BR4A 2Q5EA 1U8AA 2BFCB 3GLRA 3W2TA 2FUNB 5HQ3B 4JV5B 1EAYA 4MEJA 5EJGA 3Q7TA 5ALMA 5KYGA 2R48A 3QEBZ 1GG8A 5L3RA 3SJAA 3RVBA 2YVUA 3EB9A 3D4PA 5EESA 5AICA 3L79A 4ES6A 5B2EA 5CB6A 3OFKA 1IIRA 5FOWA 3T7DA 2FR8A 1OX4B 3OY7A 3UJAA 1ZMXA 1U1IA 2QLMA 6AT1A 4P4GA 1VYUA 3OURA 3IKTA 1I7NA 3C7KA 4Q19A 2OD2A 2H65A 4ITVA 4AB1A 1U0LA 3FSJX 3KEFA 1OB2A 2ZTUA 2HUNA 1VFNA 4IDEA 3A1NA 4PGFA 5AKYA 4PGGA 1E0JA 1KOGA 1JPUA 2PUFA 1JPJA 1RRCA 1Q2UA 1CIVA 5ULLA 3T3MB 1YHNA 3FNQA 4DCUA 1ZR4A 1U9ZA 4FT2A 3D6AA 2XF8A 5EIBC 5ILOA 2RKOA 2I7DA 3K92A 1GSOA 3JYOA 4IDQA 4X71A 2R5NA 5SZIA 2IEYA 1Z5VA 1VP9A 4A8HA 4B3TB 1QG0A 1CVLA 2JD0A 4ECAA 3PHHA 2WRZA 1JALA 1KDOA 4COOA 2DGDA 1HDIA 4IIJA 5BVHB 3ONEA 5FBHA 3GCXA 4DIKA 5A5GA 3MYYA 5K8UA 3ZNOA 1XNQB 1CUFA 2RIPA 3RIYA 2F9LA 3HKCB 3F73A 1KVSA 4TTPA 2ZEJA 4UVIA 2ZT7A 2ATXA 3FA2A 1W2HA 4Y2QA 1UAGA 3A3KA 1EK5A 2FR1A 4X97A 1E7MA 2D1TA 1HE1C 3CH4B 4E5SA 3GLHB 2IWRA 1HFWA 2A88A 3MT0A 3R7NA 3FLEA 5AKXA 1YRHA 1PTJA 3R76A 3TG2A 3OJLA 4DWVA 3Q9UA 4ER0A 2QB5A 3H4MA 3WS7A 3AM5A 5CB4B 5GAJA 3DEFA 1WV0A 4IIXA 4LJKA 4OFWA 4UFOA 4Z9BA 1AQNA 1R0XA 3H5LA 4PLTA 4ZD6A 2WB2A 3A10A 4FHZA 3D3EA 1OBFO 4OHYA 1VYHA 3KDAA 3KQVA 1E9FA 2HD4A 1JL3A 1JFSA 3GP5A 3TKYA 3G7NA 1SA0A 4RC9A 2YXDA 3BRSA 5HG0A 2X5NA 1TM4E 1M8FA 2O7SA 3DZ8A 4IKEA 3UM9A 3G2PA 4RVFA 2C4NA 1J23A 3WK9A 2YIMA 4P58A 1Z13A 4V0KA 3ZEIA 4YAUA 4X5OA 2BKXA 2COKA 4TLEA 4TQ9A 4F92B 4ZVVA 4MW9A 1ESMA 1VI5A 5FNVB 1KZHA 5C1BA 3RVQA 4NCKA 4QJIA 3FSRA 3P9QA 4EW2A 3MS7A 3GFRA 1I9CA 4F1WA 3KKMA 3ESZA 2QJTA 3I6ZA 4A6DA 3SYNA 4Z7OB 2AB0A 3PHBE 1KXZA 2DKOA 3GD5A 3MC1A 5LU9A 1JAIA 5L3QA 3U16A 1BW9A 1XYVA 3D7MA 1W96A 3CLRD 1CY2A 4KCGA 4BWFB 5KU7A 5JAIA 4PPYA 1JP7A 5I7FA 3FB1A 1UMBA 2HIMA 3EXFA 4CJXA 1VJGA 2HO4A 3DDNA 1SD2A 2ZR7A 3GJXC 1CQXA 3GGJA 3KTAA 4K05A 3S1AA 3QPWA 5F7XA 1G20A 2GD1O 1EWVA 3R7FA 3P9KA 3V33A 5KHOC 2QYOA 1FQWA 1T1SA 2QM7A 4ZZ3A 1MFPA 2PTGA 4GPD1 1PQUA 1PL8A 4M7RA 5K3DA 2AZTA 3ZLVA 3L7AA 3ZVMA 3RFUA 3B51X 4NKRA 5TPWA 4CUJA 2H8KA 1YCDA 3K2EA 2XB2A 3LJKA 5KTPA 1K2WA 1S2LA 1YA4A 3DHVA 2PMBA 1CLUA 1MJHA 2JIBA 4PLZA 1GG5A 1T8YA 3PD0A 4X90A 1BE1A 4MW4A 3KEOA 1C1DA 3U3JA 5A3JA 1N8TA 1KL7A 3JR3A 2IH4A 1XL1A 1LDGA 3R20A 2PGXA 2VN8A 3OJOA 4IIDA 3VJLA 1EP3B 1TYEB 2QLJA 1GG2A 1NW4A 2PPLA 4FFMA 3M3PA 1T1JA 1F3LA 5ALZA 3VX3A 3ETCA 4L5IA 4O2BF 5H16A 5M29A 2ZZNA 2C78A 4B33A 3AVXA 1H69A 1ZISA 1H6BA 3NHAA 1UT5A 2ECPA 2B21A 4MUIA 1M33A 1V71A 2ZBVA 3QJYA 1Z63A 2HADA 1POWA 1RJGA 3IEIA 2WZBA 1OI7A 5E2IA 4ZYLA 3KUXA 1YC2A 4LISA 2J5XA 4HBZA 3ZGOA 1NUAA 2PO5A 2XAAA 3DXZA 3G8DA 3A1TA 1VL6A 5AK0A 4BEVA 1AF4A 4PR0A 3NYRA 3ZW7A 1I9GA 4RVOA 9MHTA 3FRHA 4L16A 1J5PA 2YS7A 4OAOA 1H1LA 2TYSB 2ZFUA 3BICA 3PXAA 4XW2A 1NPYA 3VUEA 4DMRA 4YAFA 3L4KA 4LRQA 1N2JA 1KO8A 1Y3AA 2QD2A 4UUQA 1N9KA 5CHEA 2NGRA 3Q2KA 4ONEA 2PSDA 2KLHA 3TD6A 1EK6A 2O2EA 2IPMA 3F5SA 4AN4A 5C1OA 2WI8A 2A78A 3O26A 5JJCA 2G5GX 2IZ7A 2QRUA 1UBLS 1O0SA 3R5HA 5HCUA 4DR4B 2H3EA 2QDXA 3PGVA 4KO4S 5DCYA 1MG0A 2H31A 3FDIA 4NEGA 1JH8A 4FPXA 3NUGA 2JH8A 3MTJA 4MV7A 4O29A 3QHPA 4GGPA 1WNTA 2VPIA 4OQMA 5TY0A 1U2GC 3VZBA 1TTQB 3ROZA 5K3OA 5EERA 3TYXA 4EGFA 4CVNA 2I2XB 3L04A 3DS8A 4WOBA 2BTEA 1WJGA 4Z99A 2VXCA 1NXXA 1QHEA 3B3JA 3B1JA 4J0KA 4L4UA 4MRSA 5D6OA 3U40A 3NKVA 3U5ZB 4BPBA 3WHLA 3LVBA 4LQCA 2P7HA 2IYSA 1I4EB 2H51A 5K0LA 1MD9A 3I2HA 1I4LD 3DL4A 4IGIA 2OXEA 3GWZA 3KNZA 1GUFA 3G79A 4PCAA 3D3QA 3LV8A 3HSYA 1ENZA 1K75A 1QLHA 4AC9A 4LDAA 1A4UA 2ZT6A 2IZZA 2PZKA 3BFPA 3CX6A 5BOVA 4CF4A 2XMZA 3FWPA 3JTMA 2O5VA 2W93A 1Y42X 3ZVLA 4G5YA 3GUVA 1WTCA 3QOFA 4GI7A 1JLMA 1PX2A 1IU9A 2JGAA 2OB1A 3H2HA 4X6UA 2O07A 5AQEA 5FBKA 3TAXA 3TM4A 1WSWA 2G9RA 3CRRA 3W9BA 1L5MA 1NW8A 3A4TA 4Z54A 4DIOA 5IAGA 3A3OA 2NZ8A 1DQRA 1WDMA 3CUEF 3K1ZA 4AJIA 4Y9RA 4CHGA 3FUCA 1CT9A 2YJ6A 4O8ZA 1X0XA 1U2SA 1V8PA 4UM7A 2QZPA 1SXJA 2QD1A 3AESA 1R0SA 1CIPA 1O9HA 2GYWA 2F17A 2IGBA 1HG1A 3LYLA 3QENA 5AJHA 4RF4A 1QO9A 4D3FA 2EF1A 2REXB 2VPTA 4IRUB 3CLSD 3G1UA 4OF4A 2QXYA 1P0QA 2RK6A 2DFTA 5D7NA 1TAGA 3V8QA 1KI7A 2UVPB 1XNRB 4LCJA 1EM8B 4OUKX 3A3PA 2IVFA 5H70A 5KNCA 1EVYA 3GCGA 3KQTA 5EUCA 2YV3A 2JIOA 3G8YA 4ND6A 4XTRA 4KUHA 1VE6A 3CISA 3R3XA 4EVQA 3GPCA 1F9AA 1LDMA 4Y1RA 4IH9A 2WKPA 3UWMA 3ITKA 3NJRA 1T0BA 4QTUB 5CFRA 1AMOA 2WICA 4IJ6A 2XCRB 3FCEA 3ME5A 4IM7A 4QARA 2HJWA 2ZK7A 2RGRA 3ENKA 1SCDA 3D4OA 5BPFA 3R1IA 3SY8A 3R74A 4MV6A 1B6SA 1G8FA 4L0MA 4R2XA 3T15A 2CJWA 3FIUA 3H0CA 3LKVA 3MN1A 4E2WA 4RIHA 1X19A 1L5NA 1YZQA 5EYPA 4ENPA 1ULUA 1U0TA 4ABYA 1MC5A 1VMEA 4O59O 5B1SA 1VSVA 4FLEA 4LY0A 2WQ6A 4JNKA 3EPJA 4K6HA 3HJRA 1VRVA 5GADl 4D4KA 4TTIA 1YCFA 1CDZA 4R98A 1E2KA 1X7DA 5JC1A 4KYTA 5ETJA 4B79A 1FTWA 1N7IA 4LJYA 2C5LA 2NPIA 3GA7A 1LW6E 3K1JA 3N70A 4NOLA 4R1QA 2RGYA 3JY6A 1ZESA 1XCGB 3LWNA 4FCCA 4IUCS 1JKXA 4PQGA 1GL9B 3DMNA 5BR8B 1JXQA 1Z3CA 3OKPA 2Q9UA 5I6DA 2JFYA 4F71A 5HPYB 1Q44A 4MP8A 1QFXA 1D2CA 3OZWA 3CKYA 3GFOA 4GWKA 3ZZMA 1XKXA 3AEQA 5JWOA 3AW8A 4QBKA 4AJLA 1RZRD 3FYSA 2M9MA 4D99A 3PQ4A 2VDJA 4HDQB 1ECLA 8ATCA 2OCPA 3AR7A 3NVKI 1NQTA 4MV5A 1JA0A 2HEIA 2ILTA 2V7QA 1JG7A 3V4FA 3ZTTA 2XLCA 1RXUA 4KE7A 3U4QB 2Z1NA 2J6HA 1QIHA 1YL5A 3C16C 4JWTA 3JVEA 2IU4A 2FPRA 4CF3A 4CDRA 3Q40A 3Q6NA 1IZZA 1X13A 1RLUA 2G1UA 2PGOA 1QX4A 3DBHB 3QYAA 4UOQA 2D1QA 2W9XA 4OA8A 1IZ0A 1YDFA 3SDSA 3JQDA 1GTL1 3AFGA 4Q1FA 1H4TA 3FVWA 2J9RA 2IX9A 4KSCA 5FUWA 1JIXA 1M5RA 4NARA 2VPYA 1D9XA 3JWEA 1GLGA 1GYRA 3JATA 5IDVA 3QVVA 4UZEA 2FETA 3NAMA 1GZ5A 1TUEA 2W5UA 3EXAA 4RKYA 4ZHQA 1IXYA 1QFSA 2VJKA 2AZXA 4CFSA 1BOFA 1RQ2A 3V42A 3SG0A 4UM8B 2FF5A 3E1KA 4DNPA 1WVIA 4TS3A 3HKDA 4REMA 4UDNA 2OP0A 4BNWA 2J59A 1KMNA 3MWJA 1RMQA 4JMLA 1OTHA 3HL0A 1T5BA 4P5DA 4P84A 3BPSA 1AQYA 5JAQA 1K4YA 2E82A 1JKJA 2GZ3A 3AHJA 4HWSA 3FDZA 2E49A 2J9GA 3OOJA 3UWSA 1ODSA 1IBCA 1PR5A 1OZ0A 1EM6A 3QPDA 4OQYA 1J5XA 3EH2A 3NTVA 4DYDA 3BL5A 4CGZA 1MX9A 5BY2A 4EI7A 1RBQA 5LMZA 2G6TA 2PKYX 3P71T 3ZI7A 4G2NA 3I62A 3BGSA 3D8SA 5K8VA 3M2TA 3F71A 1EX6A 4MTLA 1LTKA 3WGHA 4EOGA 5A6VA 5A9SA 1RI2A 2QRVA 1H93A 1ZNXA 3OCYA 5KNDH 1T2CA 1LRKA 1CHDA 2B9VA 2CF6A 3AF3A 1K4MA 2VJOA 1JWBB 4OHRA 2CCGA 4XD7A 5F33A 2IIBA 4ZVQA 1F6BA 1PT9A 2FMUA 1WCIA 1AZWA 5A7HA 1L4NA 3LO5A 4EJSC 2YWDA 4OL0A 2XMQA 1BJRE 2GBCA 2ZBUA 1Z22A 2FFQA 2WV7A 5EKDA 1TK3A 4EATA 1XNJA 4ILEA 2E21A 3G2LA 3IVAA 3N2KB 4BNUA 1R4MB 5AM5A 3MQFA 2LR0A 3A9VA 1GKYA 1WG8A 1WUTA 1NXVA 2NUTA 3A2NA 3BORA 1V4NA 3MUOA 4LX0A 4Q1CA 4ETWA 1RQLA 1ZWKA 2I87A 3VR5H 5BV7A 2HEGA 1YBMA 3X0DA 2WPNA 2VSYA 2WR8A 4FK8A 1USIA 2UVDA 3ASVA 2B7BA 4EFNA 3B2EA 2C58A 3GF4A 4EENA 2NXCA 1XX6A 3NHRA 2CV0A 4C5CA 2Z2ZA 4AG5A 3GJ4A 1R6DA 2XUFA 1G18A 2ST1A 4CL0A 5COAA 4K6KA 3JQ8B 2YHIB 4CTMA 3NI2A 5KX5B 1T43A 3LUFA 2ZETA 4LKOA 4N6GA 4JSYA 1VKRA 5IC4A 1QM5A 2RONA 3H2IA 4R3UC 1B23P 4M8NE 3ROGA 5AVSA 2HV9A 2H4ZA 3O84A 4DIMA 4WIAA 1TZJA 2WU1A 4QDXA 5M04A 3BF7A 4LF4B 3TI9A 4PLYA 4QJBA 1BXKA 5LP6B 3G8CA 4D0LB 4HLCA 4PR3A 1Y81A 1JI3A 5IM4A 2FWNA 4RK7A 2DQZA 3INTA 1P18A 4EVRA 3EMBA 5DP1A 3V00A 3SXUB 1XDDA 3IE0A 2E5LB 1Q7BA 4RYDA 2QORA 1IMOA 1PDOA 2RGDA 1NOJA 1OWNA 3PRJA 3UOWA 5HTOA 3IBFA 3RYIB 1X7HA 5L9AA 1RRGA 2ASEA 2PMFA 3DCYA 3I04A 4MA0A 3TSOA 4QKQA 3QX3A 1CUUA 2D1SA 1WSDA 3SNKA 1SBNE 1GNRA 1GU7A 2EBHX 1TYDE 5JDIA 3RU7A 2A33A 3RJ5A 3S8MA 1TFUA 5HF6A 1ZGBA 1KY2A 1SQ0A 2J9ZB 4BASA 2FFHA 2QUIA 4B4WA 1DP4A 2OMKA 1WRBA 5IYZF 4OLHA 1GYPA 1V7QA 4AAYA 3HM9A 2Y0BA 3SK0A 1DDIA 4IIEA 5JZBA 3HCNA 4TZ0A 4HZUB 4HDSB 4N8DA 5JALA 2HWYA 3B8HA 4IZOA 5TMEA 4RHTA 3KVVA 3ZDFA 4PQYA 5J2TB 4DLVA 4BHTA 3U60B 2AZMA 1PWZA 2HJHA 2LE0A 3AC0A 4AL4A 1GEGA 1QORA 1UK6A 1DPGA 3KXPA 4TXJA 1KJJA 3CRNA 5J63A 2OGZA 1F8UA 4EK9A 3VZDA 2OZEA 3VR6D 1I4WA 3DDZX 1P5JA 3FNIA 4KX3A 4CNQA 1D1TA 3ZHXA 1VLMA 3LPCA 2P91A 4YACA 3HKBB 1KYVA 2OCAA 4I3HA 3ORSA 1Z6QA 3RYFB 2PFGA 5K6AA 3Q1LA 2QVLA 2LD4A 3CEAA 1XI2A 4JT4A 4QGBA 5LQRA 1TO6A 2WDPA 1J8FA 2W98A 3E61A 3GQBA 3KQUA 1G8JA 1LRLA 1D1SA 3A6ZA 1TM7E 3MWGA 4I3FA 3H2BA 2H2GA 5D3MB 3WBBA 2QE7D 1ND5A 3FSGD 4GR5A 2C2KA 2ZJYA 1HM5A 5DULA 4FW9A 3LFUA 4NOJA 3Q1KA 3AF2A 3H8WA 4XLTA 1STOA 2IY7A 5E4JA 4C29A 3SVLA 1JMKC 3QVLA 3PFWO 3QKSB 2P35A 1G7CA 3PIDA 5CJPA 1JHXA 1Z7YA 4PZ0A 2V7BA 3AP3A 3QE0A 3G13A 1JS1X 4YMLA 3MGBA 3FNEA 4IXTA 4MVJE 5C1DA 1O3YA 1OXXK 1RRPA 3WI7A 2JATA 3HY6A 2CD7A 4BO8A 4TUYB 2WSYB 1HEYA 3AM1A 1BE8A 3IA2A 2UZ0A 3ROXA 3DLTA 5CA1F 5IABA 1FTGA 3ZPXA 4BMPB 3X1ZA 2Z43A 4J4HA 5TGTA 1XWFA 4GHWA 4S24A 2CLKB 1QTIA 2QPOA 3ZXXA 2AJCA 4I9GA 4FEGA 2ISQA 2ID7A 5FLEX 3ZY3A 1J7JA 1ML4A 3I2YX 3JRWA 1FFYA 2XXBA 1CVIA 4RWZA 3QVOA 3W6NA 4HZGA 3JWPA 2C5HA 3ZD6A 2QGNA 4YGYA 4E5MA 2GF2A 3DOOA 1Q0RA 1S2DA 5I8PA 1YJCA 2P3OA 2E3JA 4E5YA 3T7EA 3QVTA 4FJ1A 2RARA 1ONOA 4LJAA 4Q7QA 1Q77A 4GMDA 1WUHS 2R68A 3WJ2A 4EA8A 4EYSA 5FV4A 2W2VA 1DEKA 3QWAA 3SSOA 4LJ5A 2IZ1A 2FUG6 3ZY2A 1UFVA 3A27A 3WMEA 2QKYA 4I2VA 4CMIB 5EVCA 1YQGA 5IJ0B 2GCNA 5ERGB 3WX0A 1S2MA 1Z38A 3HKEB 4ZP1A 1LPAB 1Z82A 3OG9A 3BIXA 2DTEA 2G71A 1ABFA 2FW1A 2GJSA 2XB8A 1K6IA 1QHXA 3GDFA 5FTNA 4ZIRA 4KQ1A 2FQXA 1NIPA 1E8DA 4RENA 1P31A 1H8HD 1Q1QA 3N75A 1WB5A 1KSJA 2FZWA 5CLLA 5AVJA 4DLYA 3P2OA 2X0KA 3QKRB 4GZMA 3GY0A 2HXYA 3QVKA 1OLUB 2X14A 5EWJB 3ZK7A 4EW6A 4G9EA 1ZR2A 1K7FB 1W19A 3EG5A 4OGWA 2ZIWB 1F3OA 1FRNA 2IX3A 1PZFA 3I12A 2EX1A 3L43A 4UATA 2GVZC 4L9AA 1CPYA 4R5HA 1JRLA 2YW9A 1JJIA 1BXZA 3M4JA 4YCAA 3IP1A 4PX2A 1DRJA 1FX0A 4QE3A 4KDRA 1Y5LA 2MSNA 4MDHA 4NFHA 5FD8A 5TT1A 4C30A 2B4YA 2CNDA 4AJKA 4HD8A 2YRFA 3LYUA 1GLVA 1HYQA 1HXHA 3OE1A 3B38A 1FMFA 2IYNA 2XKKA 1RQNA 2JBAA 3E9DA 4ZCLA 3EGIA 1LNSA 1F8YA 5JSKA 2J3DA 4GPTA 4AMYA 5KWIA 2ZVQX 1PNRA 1GZDA 3Q7PA 3NHJA 5CVEA 3TXAA 3WJ7A 1BVHA 2BZGA 2PR2A 3N58A 4FFBA 2O1XA 1G17A 1YRQA 2VH2A 3Q10A 3OKCA 4DIFA 5AVQA 2HW8A 1P2BA 1G41A 3ZV5A 4WCVA 3WRVA 4C7BA 5I51A 1B8VA 2VWPA 1C3EA 1RHRA 3FPHA 3TW4A 3PI7A 5LJIA 4E5VA 3TL3A 1QQAA 3O9ZA 4HS9A 1S2IA 4YC7A 1ONBA 2RHTA 3T3OA 3SHWA 3U62A 1OVGA 3W05A 4BNXA 1KIAA 1JFTA 2GOYA 4CT5A 2FUCA 2IL1A 5T67A 3AUUA 1M1NB 1A5ZA 4GMGA 1BU5A 2ECQA 2AOUB 3AB7A 1U7TA 4ZT6A 3V4ZA 5EZ6B 1RSZA 1JDTA 3KPVA 2X41A 4CIXA 4M89A 3I53A 1PR1A 1PUJA 2WOOA 3BMQB 4F3CA 5K8CA 4PZLA 5AO9A 5EWLB 4BUJA 1E6KA 1UANA 2ALJA 2YIVX 3BMCA 5JOQA 1WBJB 3G5TA 4UASA 1GKKA 4D41A 4ZKDA 1HSZA 3QXJA 1BRMA 2H52A 3GEHA 4CMGA 5ADWA 1I1OA 1KZGB 2NUPB 4TL8A 5CR9A 2JZNA 5ENVA 5JAZA 3W5BA 4CMKA 2GPNA 2OG2A 3Q8WA 4YAOA 5GOTA 1G21E 3ZVRA 1CRLA 1TCBA 1WU8A 2Z6VA 3AI3A 2J5KA 2CL0X 1FNSA 1DKLA 4D0GA 3NBXX 5TEWA 2GBLC 4LDZA 5DNAA 4LXXA 3CKLA 3Q6MA 3Q8LA 1RWNA 1X8KA 4WESA 3FKSD 3LOPA 3B3AA 2D74A 2HV8A 2X7XA 2BGGA 3AHDA 3I4CA 1KDPA 3OUZA 2R751 2I6GA 1OGJA 4MV0A 3PEYA 1PG0A 2A5JA 2ZRDA 4XGNA 4ZYUA 4FGSA 4WA7A 5BUSA 1M6NA 3OF3A 4H35A 5DCWA 2LRHA 1UZNA 3F74A 2JGNA 1E3WB 1AQ6A 4YV7A 2NXJA 2JI6A 2WD7A 2ZJOA 4JLJA 3E7DA 4CTJA 1UMCA 4IVNA 3AOEC 2XEDA 5A4KA 3L3BA 4LTDA 1TUIA 2VHJA 3B9QA 4LXUA 4WACA 4XM1A 5I7WA 4MYTA 1GGKA 1T2UA 3F9IA 5L45A 4LJLA 3GVIA 4QUJA 1Z73A 2E87A 4R81A 1NE7A 3H9UA 1RPAA 4KSYA 4II3A 5IH3A 4IMIB 4H9GA 3AETA 2W83A 3KAPA 1N75A 1KMIY 4A1FA 4EKIA 2GJ8A 2C7RA 5LDDC 2J0SA 2J3EA 1IN6A 1PQPA 4HWKA 2DBZA 4YFYA 3WWCA 1T8RA 4OJMX 4II2A 1X80B 3UV6A 4V0ME 3PPIA 2AEJA 1XRPA 5JS6A 3RVLA 2HQOA 3ZWBA 3WK6A 1SAYA 1QOQB 3W5JA 5HJ7A 1GQ2A 1H22A 4JUBA 2IC5A 3GLSA 5H4HA 4UHHA 1QH1A 1JLKA 3BMXA 3NRBA 3NR2A 1Z0FA 121PA 1C0KA 3MJVA 1MHPA 4XEUA 3I5XA 5E6RA 1IXSB 3USES 2X9GA 4OTZA 4YRTA 1IN4A 1XALA 2WD8A 3OT1A 1FPMA 1XYGA 4QU8A 3OZTA 4R2JA 5GONB 1GGHA 1RHKA 4HFJA 4F9TA 1M3SA 1P7VA 5BYKA 1RDFA 4R9UC 2BGIA 3NFYA 1HLFA 2I4TA 3I8OA 5EI5A 3UKJA 1GNVA 3LKZA 3SGLA 4XARA 1THGA 1JVNA 2VF8A 3C8ZA 5DMHA 3SEQA 4LA4A 1NW5A 3VTFA 3QWIA 5BRJA 4E21A 4XR4A 3R9KA 3TH5A 2O8DB 3PHCA 2RGXA 5A0VA 3UUWA 2C7QA 3OD5A 4QYIA 2XZDA 1E6MA 3IOCA 1RMTA 4C2AA 4JT8A 1QG6A 4QECA 2XUAA 4I8XA 4V03A 1HE3A 4P36A 4HGQA 1RHQA 4LCBA 3AF4A 1POXA 4WZAB 4BV8A 4C06A 3GJ0A 2IXEA 2Z0MA 1EFLA 1NF3A 1XCLA 4X0EA 1D4AA 4M8LA 1CU1A 2QQ0A 3MRXA 5DSZA 1GSIA 4C5BA 2PAAA 1TUBA 2HAEA 4DAOA 5IDXA 4D98A 3RU9A 1NMZA 2ORWA 1ADJA 4A2WA 5JCXA 1IY9A 2XA2A 1JXMA 3E5RA 3NKFA 4N0QA 5HGXA 2NUBA 3SXPA 4FONA 4HDMB 2HRQA 4ZT4A 1BD4A 4WBNA 2ZRKA 2BGUA 3AR3A 3A2LA 3FLAA 5IUKC 4KNVA 4Y0VA 1DKRA 3ONDA 5TS2A 5DM60 1U5AA 1K8ZB 3HCEA 2B8WA 1E5QA 4JEMA 4YCLA 1CETA 2EV9A 1P73A 3IKMB 4GXNA 5EHGA 3Q5EA 1NBAA 3OIYA 1GUYA 1UBJS 3A37A 4RXMA 3CG4A 3PEFA 4TKMA 5DEOA 2BKEA 1IDN1 2CFOA 3TE7A 3WNBA 3FBTA 3BJEA 3AQIA 3BXHA 1ORWA 2VVTA 2IEBA 5BN5A 5HDQA 2X23A 4PX5A 4BKUA 5JASA 1E79D 1UKVY 3D59A 2VYQA 3NETA 4LJ6A 3K0EA 4CG0A 5LD2C 2QGZA 2QMYA 2JRLA 4YN3A 1TVKB 3W8EA 2JA1A 3FIJA 2JIZD 2C92A 4FZJA 4TOIA 4BFCA 1YKFA 4GP9A 4UBNA 3CA8A 3C4VA 4IS3A 1H2XA 5TSDA 1NYRA 2QV7A 2HCFA 3EDQA 1GCUA 4UEKA 3IPLA 1SBTA 3OCCA 1M2JA 3DZKA 4B8WA 4LBWA 4I8IA 2IELA 2R97A 1TF2A 2WJYA 3FYUB 3GN1A 3QQPA 4XSGA 4EYKA 4EHLA 3KQKA 4R6XA 2YVAA 3DLBA 1OGIA 2OHJA 2O14A 5DTEA 3GLHE 2H4XA 2L18A 4KREA 3P0JA 3CNBA 4IQ0A 3V5NA 1KQ3A 3ZKWB 3IP3A 4AUKA 3IPYA 2VBCA 1NNEA 2OM6A 4KMOA 4CMAA 4NDNE 2BI7A 4O5AA 3RRZA 5AOCA 2I6XA 2P5UA 2ZSDA 1WB9A 2GAIA 3NH9A 1EQAA 4B6JA 5J4YA 1J2EA 2WIJA 5HQJA 3SHQA 1QP4A 2C31A 4EYQA 1L8OA 5DIFA 1A0OA 3AJ9A 2WIFA 4GUAA 1QAQA 4LJ8A 3RBVA 1GKLA 2LUOA 4G4IA 3TRIA 4F3KA 5DM1A 4RGYA 5EE5B 1EZZA 1QAMA 1X8XA 2RKBA 4ZCSA 3F97A 3I3OA 1AK1A 1QK4A 1MW9X 4LY6A 5DJ5A 2FR8C 3QMWA 4IIYA 3AUXA 2PS3A 1OLSB 2EFHB 1K98A 4HL6A 3O1JC 4CKWB 1SIOA 2DMRA 2RGCA 4DMMA 1OFUX 1PDWA 4HB4A 4B6EA 4XX1A 1TRHA 4Z3DA 3VPFA 3ZIUA 4LEIA 2TMDA 2VDRB 1DB3A 5DHTA 5K51A 2OZLA 1VIVA 3TCKA 1P60A 3O4IA 5JD3A 1K9SA 4JEIA 4OO3A 3MWEB 3ZD9A 4YLGA 1JEYB 5HM8A 1MJNA 3AU8A 3RUEA 3MILA 4JJ8A 3I2FA 5EMMA 1ZM2A 1BQ4A 4NYMR 2D54A 3L07A 2QYHA 4BB5A 5YASA 3RV3A 4CDMA 2GLUA 2WNIA 1MC1A 3AHCA 3HYCA 2FVYA 1INLA 1H2EA 3N6VA 2PBRA 4JYMA 4K03A 3UGTA 4BQPA 1V8BA 2VI5A 5B3LA 4EFDA 3DHNA 3GC6A 3CZ4A 2V1UA 1V48A 1H6AA 2P9ZA 4B87A 5E6UA 3AXTA 4BLVA 3NALA 4G5XA 1L1FA 1FJXA 4DBZA 2ZSAA 2BM8A 1R0KA 2XVXA 2X15A 4U6QA 1ZCZA 1ISJA 2RGEA 2QDKA 4P82A 1BFUA 2ES4A 4PC6A 1WKCA 2X8WA 4YAIA 2ZVDA 8ADHA 1FTYA 4IOJA 3P2JA 3U13A 1KSGA 3ZHCA 4CQMD 2GLTA 5EHQA 1N3IA 3MT9A 3UC9A 2O8FA 2IDMA 5FL7D 4F56A 3SXJA 1ORIA 2X9QA 5AK4A 3ILXA 1EK2A 4OP3A 1RZVA 4YJFA 2QTLA 3TDNA 1NVUQ 1OC4A 1UC8A 2Y4OA 4Q6BA 4RPLA 4X45A 3O8RA 2C1XA 3P9ZA 1WHTB 2FZKA 1MABB 1SCJA 3EYWA 1BYUA 1PTJC 3WK4A 6REQA 1RWXA 3FAKA 3QKUA 5KQGA 4PY2A 1G4AE 5L3VA 2FDXA 4RADA 4DV3B 3T3DA 1L8LA 2OCBA 1V43A 4HADA 4NU6A 3G17A 4QULA 5K05A 3DVQX 4EY3A 3LP8A 3MGGA 1WMDA 5H0IA 3SKYA 5JXIA 3NBYC 3V7YA 1V0JA 1KFCB 1LGYA 3KYCB 1XRMA 1AXRA 3MPOA 4R0NA 4YJGB 4DAEA 4GSYA 2GXUA 4LPSA 2QT1A 1S3GA 1V2HE 2AOTB 3LDHA 5AUPB 4O4IB 3RM3A 2Y05A 3KOWA 2P11A 5DBGA 4JB3A 2A57A 1YB2A 4GWGA 2RHLA 3ZDEA 5JI2E 2UXBB 3UBMA 1NQAO 4JKIA 5FTMA 1YDHA 3TTSA 3G8BA 4O1MA 5JI3E 4MVJF 1NJ5A 3A31A 3N0TA 2KB0A 1RI1A 1BROA 4L9WA 1Q20A 3DKRA 3KE9A 1QIIA 1QV6A 3PR1A 4HMPA 4XIFA 3CPHA 1UJNA 3TQRA 1UQUA 4IHJB 3O73A 5JWRA 4UD2A 2KHZA 2IF2A 4JP2A 3I5YA 3FROA 5EY5B 4KOAA 2TS1A 1YASA 5C2JB 3C6YA 3DOEA 4G1UC 4KSBA 2HI0A 2O8EB 5JFTA 5TE9A 1WZ2A 2ZUSA 5ITSA 1G6HA 5JU6A 4OMUA 3ZK9A 5BN1A 1L7NA 1FP7A 3G0BA 1VG9B 3HHEA 1XGKA 4Q9DA 2FSVA 4HNTA 3A3NA 2Y4NA 5FUMA 4F5YA 3IT3A 4P3KA 2XWPA 3TL2A 3EDMA 3PXEA 5I8WA 2JFHA 1N8SA 2AFHA 2H57A 3BHNA 3M9WA 2FPOA 4MVJA 1HURA 1A9SA 4TLBA 3OOHA 1OXKB 4C0JA 1N2OA 4W5HA 1GQSA 2HRRA 4I1OA 2M6LA 3WLMA 3C74A 3I3SR 2HHJA 1U7DA 1W29A 1F1JA 1MT3A 2H9YA 3K9WA 5ARBA 1YMVA 1YR6A 3H5NA 5B37A 4LZZA 1ZXLA 1O77A 2IITA 5CMLA 1CP3A 1FSFA 4HYYA 4JBNA 4JY7A 3JAMA 1CE8B 4YK7A 3RHSA 5FP0A 1NULA 1FDIA 3E4CA 4ENWA 1K5GA 3GV0A 3WYCA 3CV3A 2VDPB 2E4XA 2QZ9A 4RABA 3T5MA 2I1VB 1BJTA 3E2MA 4CEIB 3BERA 2VKQA 3G7SA 2RHBA 2CNKA 2NO6A 3AI2A 4KDEA 1GT91 4Q7KA 1RZUA 4ZYZA 1KETA 3WLFA 1YOBA 1RKXA 2QA5A 3H6GA 1N57A 1PZGA 3RSFA 1U4NA 4MHOA 3C15C 3Q7EA 1KFJB 2GTHA 1RAHA 2C2YA 1I1QB 1TZKA 3I1IA 2PA3A 2BEWB 1G66A 4HDAA 4MYUA 1ISRA 2CT8A 1VKJA 5KBYA 1G6Q1 1JV2B 4CCYB 5BPHA 3HHPA 3H42B 5J1SB 1P2DA 2JAWA 1B4DA 1NN0A 1BCSB 4Z1MD 2KWIA 1WVGA 2VJYA 2XIJA 2QROA 3LDAA 3OF5A 2CDRA 3SFTA 2GERA 5DHPA 5IJXA 3P2MA 3ESQA 5IF3A 2Q1UA 2RHJA 5KTMA 3QOYA 3QUSA 4UPEA 5CT4A 5EJFA 4WCFA 4BLUA 1COWD 4JJZA 5KWSA 4P98A 1YJ5A 1Z8DA 4HLNA 2NQ2C 4BFSA 3LGSA 1N2ZA 5A5EA 1OC2A 4UMVA 3DZFA 1EJ0A 3VPBA 5HRUA 1DC5A 5BN3B 3EEYA 4LE2A 5KYUA 1OREA 3GGSA 5JCJA 3MWLA 3QUAA 3M6FA 1GD1O 1XZCA 3B6JA 3VA7A 4C0WA 3IXMA 4L3OA 4FKBA 3CPJB 4PIVA 4MI6A 4Q3AA 4D9EA 1QYDA 5D85A 5C8ZA 5K3SA 3IJ5A 4HQRA 1G38A 4LZOA 3D5QA 4AZVA 1NVMB 3BJMA 5I7EA 4KAAA 1T3ZA 1WU7A 1KRHA 1YZHA 2I55A 2XUZA 4EABA 3C98A 3ROKA 1ULHA 2JA2A 4B3IA 4DZTA 1YOVB 1ZGJA 1Y3FE 2QZZA 2P8JA 3QY0A 1V7PC 5LA6F 3VTKA 2R6JA 4CQLB 1ZGZA 3UJDA 1OKKA 1C0LA 2DHRA 1ZNYA 3UTDA 3VPDA 1JHPA 3FVQA 3OSZA 3TDMA 3QZUA 4OQFA 3AKDA 2QRPA 3LUAA 4XH9B 5AJVB 3IQEA 1Z0ZA 4L51A 5CXUA 1GQYA 4I50F 2DB3A 4D8UA 4XR9A 2R4TA 2BFWA 4MWTA 3PNBA 3W4IA 4R2HA 3OLVA 3K32A 1G2OA 4LJ9A 5J5CA 3T7JA 2L69A 5LMCA 1ZONA 3AUYA 3RGWS 1SFRA 2B6HA 3S99A 4E46A 1UM8A 1H0SA 2WM8A 1DQPA 2BPOA 2YWCA 3AMVA 4UBIA 3AUSA 1GZ6A 3NWEA 3C85A 1N2EA 3PPVA 3D8HA 3GEMA 3IVCA 3GVPA 1KR5A 1N2CA 1KJZA 1Q0TA 2ATVA 1Z2OX 5FUXA 2ZUTA 4QPDA 3TZLA 1GTG1 3A2MA 3PICA 1FBTA 2KBFA 1JPVA 1M8PA 3J80A 5K8IA 4K9QA 3JSAA 3BE5A 1BHO1 1MG5A 1NYLA 2Q9BA 3GDGA 4QGAA 1BDJA 2MSCB 5DLYA 2B61A 2Z08A 4RLSA 3RREA 5LZ4A 1KQPA 1QV7A 2HKIA 3GJ3A 4PRYA 3RVOA 3WVNA 3B85A 4KP7A 2IEIA 3KPYA 1EZ1A 5TMBA 3RC2A 5T3UA 4XOUA 2ANBA 3UEOA 4D92A 2H3HA 1ZL2A 4MUGA 2B94A 1JAYA 4NCHA 4PZYA 4EMSA 3PTAA 1E6LA 4RFSA 2DECA 3VAYA 1PFQA 4U2BA 3KZCA 3S2ZA 4WJKB 4DZRA 2W37A 4M21A 5HZKA 3DCJA 2NNWB 4Y2TA 2YVLA 3KHSA 4TWBA 3JV7A 5BW4A 3KP1A 4JC8A 2WIKA 3T3HA 2QE7A 1Z29A 3RR2A 5B4VA 3DSRA 3ABOB 5ITZB 3NIFB 1FRZA 3ST7A 4BQNA 4E2FA 2O0KA 2B99A 2XNDA 4NV3A 4QASA 5DH9A 1PV2A 5A9RA 1O0BA 1DDOA 2PO7A 5AKJA 1ZJ5A 3TLEA 2GZHA 3TZQA 1DNPA 5JVDA 2C3UA 1SHUX 4C2BA 2C9YA 3ZN2A 1M9NA 4ZOLA 3ZHBA 3LTNC 5EKUA 1U7ZA 2KPOA 3ZHYA 4QG7A 4YIKA 3WC4A 3EOAI 2QTVA 5KOIA 1VL0A 3ASZA 3SDBA 1P4SA 3CN7A 5J9FA 4XVQA 4WSOA 2FOXA 4MWZA 5HKOA 1H6CA 1UBEA 4NYMQ 5JPDA 3LW8A 1QP7A 1PR6A 4V0MA 1M34A 4II7A 4CEHA 4HLQB 4MYRA 4G0PA 4MMXB 1E5LA 4PCLA 1A98A 1DJLA 1J90A 3AV0B 5E7IA 4CGYA 4INPA 3FBGA 1VL5A 5FEMA 1ADCA 2BWJA 2IU6A 2PIDA 3F9RA 2XYVA 3EA4A 3P5SA 4IIVA 2ZIXA 4FHFA 3TVYA 4QUEA 1C30A 2Q2QA 4WEQA 1YWGO 2HMVA 1IYZA 2DKNA 3UKDA 1OFUA 1Z45A 3L02A 5J2UA 1REQA 3NGMA 4FBMA 4UD6A 1ACMA 3EIOA 2FGKA 1L7AA 1P1HA 3D1JA 3D5TA 4ZQFA 3TUJC 5KOJA 1HDEA 4C6RA 1T34A 1VIAA 2JEYA 1GM5A 4UTRA 1G291 1RWWA 1C0PA 3PC7A 2O0HA 1SXGA 1GG9A 5GZ6A 3JYHA 4JI4B 1ZJYA 2NU6B 1MEJA 3VKHA 2QSZA 5HQ3A 1QF6A 1YFLA 3HLKA 4TS4A 1UPXA 2YNMD 1MUUA 1SBHA 2GF0A 3ITNA 3NC4A 4G41A 1KK2A 5KJEA 5JHGB 4ZVPA 1L3BA 3SLKA 2G83A 1EUCA 2WZDA 2HFJA 4JP5A 1NJGA 3W2HA 3H5WA 4B9AA 3B7WA 1L5OA 1FXSA 7AT1A 1HE8B 4PLWA 3QPUA 1NR7A 3T54A 3WTBA 2Q5LA 3JQQA 1UUFA 1IJKA 1ZIYA 1CY7A 4HH3C 1W87A 3CF0A 4YT5A 4WV3A 5ELLA 3TRJA 1I7SB 3H8JA 1N6KA 2PUGA 3VU9B 3WP0A 1D04A 3OOEA 1S96A 2A0KA 3WWZA 1NDUA 3LZDA 4WLVA 2GEFA 2ZJFA 3JWJA 3OP4A 4CUKA 4PWZA 1VLVA 1GARA 1JI0A 1MMFB 4DA6A 3OJWA 2D5IA 1AH2A 1AHPA 5HIKA 3AVOA 4MQBA 1TPYA 1R0LA 4LHWA 2AG5A 4HT3B 5CB4F 1W0JD 5KSWB 2NO0A 3OF2A 2NU8A 3GO4A 3H5RA 1NLYA 4YB8A 5DMXA 4XB2A 4DM3A 4MVJP 1AK2A 4GOKA 2IHBA 4ZDJA 1XQYA 4ANFA 1O9GA 1P4AA 1ENYA 1X9GA 4FGWA 2R85A 1WDTA 2XTJA 2QNBA 4BC0A 4JZYA 4UUMA 4FBLA 4RVNA 2FZ5A 4MITA 1JGTA 5JANA 4MV1A 1JEQA 4GFDA 1VC2A 3DUFB 2PZGA 4OJQA 3NIBA 4JBLA 1CZLA 2EYQA 3C24A 4HCJA 3H05A 1YDWA 1MB4A 2PZAA 3N86A 5JARA 4BVGA 4Y9TA 1P77A 3O8QB 2I66A 1GGMA 4NJEB 2H16A 2QRLA 1GTMA 3RVDA 1RFLA 1UP6A 3INRA 4WQMA 5FNVF 1DMRA 5CLFA 3O47A 4W5JA 3R8CA 3AEUA 1E96A 4BLTA 1F7VA 2QW8A 4J0HA 2JDID 3PNPA 5CX1B 1Y7LA 2B36A 2RB4A 3FR8A 2EIXA 5DYWA 3WR5A 2PRZA 5IULC 2QVZX 4EG5A 5AW0A 3WGQA 3ZJ5A 1A9TA 1I36A 3KZMA 4BQQA 4AKTA 4CBVA 4QEKA 3WGMA 1EP9A 4KXLA 3LY7A 1AQIA 3OQVA 2J9YB 3AM3A 1SPXA 1VA4A 4MMYB 3FKSA 1TJ3A 2HK7A 2WT8A 1L4UA 2INGX 5EN4A 4CXMA 1V5FA 2WA1A 3KUDA 4D1YA 2R0QC 4XB6B 2J41A 2F1HA 2RK3A 4H0FA 2FPPB 4QYXA 2Z9CA 3DNPA 1G5FA 4P38A 1QIFA 2DR2A 1GLNA 1CZUA 2OPHA 5IS2A 4KI7A 4Q4JA 4MHSA 4A92A 4MIOA 4QM7A 4UNIA 3FFAA 3CVYA 3DAHA 1OV4A 1ID1A 4ZWNA 3ZOZA 3PR3A 3DW1X 1WWKA 5JDIC 1O4WA 4MJXA 4PS0A 4F4FA 4MUAA 3BTVA 4MDEA 1V5WA 1FUUA 4BQRA 4PNEA 5DNDA 1MU0A 3L1IA 5JO9A 1JR3E 4DARA 2MHCA 1JAZA 4G1BA 2M6KA 1WDKA 1GOTA 2XHZA 1PU2A 1BDMA 2AKAB 2P9JA 2VTDA 3IUBA 3MQ4A 3HUDA 2VEOA 2G5TA 4YAEA 3BD9A 4QREA 4A73A 4ZYYA 1KRWA 3WL6A 2Z57A 3F3KA 5ITVA 3AJRA 2IPNA 1FSGA 3GAZA 4RCVA 3W04A 2ZRPA 3JYLA 3KIPA 5ALXA 1T1RA 5BW5A 3DZGA 3ISTA 3K6SA 2G63A 2VOEA 2Y1FA 2A35A 1WE2A 3CB2A 2O3SA 1U1GA 4L9RA 1WZCA 3GZNB 4KR6A 1U8ZA 1YI0A 2C8KA 3MQ2A 1ST3A 3ACCA 2Y3IA 3A6HA 1QYVA 3GRFA 1YL7A 1Z6ZA 3MTEA 4DMLA 2XMPA 1CJKC 5J5AA 3VV2A 4F9EA 3SQDA 3FNHA 2QAIA 3MLEA 1EE9A 4ZOBA 4YS6A 2FP3A 4GLOA 3K9HA 2A1UB 5K6AC 2VQFB 3WADA 5JSQA