5LQSA

Structure of quinolinate synthase y21f mutant in complex with substrate-derived quinolinate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
303
structure length
303
Chain Sequence
b'HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 117
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA01
5KTSA 5KTMA 5LQSA 5F33A 5KTNA 5KTOA 1WZUA 5KTTA 5LQMA 5F35A 5F3DA 4ZK6A 5KTPA 4HHEA 5KTRA 4P3XA
chains in the Genus database with same CATH superfamily
2ACVA 4A2QA 3B9BA 2LBPA 4H35A 3BE4A 1QH1B 4DYHA 4JJ6A 4MQLA 3LT4A 5DISB 4B74A 3UJPA 4DADA 3NHJA 5CEFA 3VNSA 1Z4QA 3HR4A 1BO6A 5AK5A 5GZ6A 2JZOA 3EIUA 4RD4A 3U1TA 4WXMA 3X44A 3E8MA 3I6ZA 4FMDB 3U5ZB 2XDWA 4A03A 2VPWA 2D74A 1EX1A 2H7YA 3CR8A 1JXAA 2QMHA 2IXDA 2GPNA 1Z47A 1D2CA 3QA3E 4UU8A 2F17A 4WIAA 1W1WA 2HQOA 3U80A 5SZIA 3W5HA 4KVGA 4MROA 2Z9BA 4C05A 4NCBA 3CW9A 4EMUA 3DPUA 4DG8A 4E5PA 2Q1XA 2PR7A 4MI9A 1L5MA 2WDZA 1BRTA 1Z28A 2BWJA 3MGAA 4PQFA 5DNWA 4YY3B 2DRIA 1KHTA 3GARA 1UAGA 2E4WA 2BVNA 1SUAA 2DGDA 3MMNA 1TU3A 2PX4A 4KFSA 3HBNA 5TDHA 4LY3A 1U3FA 1IMOA 5TY0A 1JEQA 1ZXLA 2UXCB 1JFRA 3EODA 3PNSA 2QNBA 1ZOOA 4FFOA 2BLLA 4CFSA 1HETA 3USCS 5BYJA 2BZ0A 5FPKA 4DLLA 2Z6UA 5EZYF 4OHBA 1BDBA 2B37A 2A58A 4XX0B 4AN0A 3R0ZA 3VR6A 5FOVA 3EZ7A 1M54A 2Y1GA 3N3AC 1BX1A 3SD7A 3RBZA 4EGFA 4ERXA 4HGNA 2IEIA 5B4UA 3DLPX 3K1AB 1H3FA 1TXGA 3K0EA 4IZOA 4MRNA 4YJDA 5HCNA 2F3UA 2WOJA 2CF6A 4LHYA 1V7PC 1U9IC 1K8YB 3G1UA 1B16A 2AV6A 5CHEA 5JVDF 2WAMA 3P0EA 2E55A 5F1YA 5EMMA 3VC2A 5ESXA 1PQ4A 1DRWA 4IBOA 3B9RA 1SUCA 5JQWA 2GESA 3KDSE 3WWZA 3CWZA 1OFTA 3V48A 3H2HA 4E1VA 2Q99A 1M72A 1JFFB 1Q19A 2AK2A 4PYOA 3RI3A 5DSTA 4JFAA 2CUTA 3BH0A 2R0QC 3DNPA 3U3ZA 1KMHB 1U99A 1E7QA 3HNOA 2A3RA 4QGHA 3MJTA 4BE4A 1NM5A 4ZT3A 4XIIA 3CRNA 4AP9A 3IS3A 3OT1A 3OZTA 1QYCA 4N65A 4FYMA 1P33A 2GCOB 4LQDA 2GVZC 2E87A 4D8VA 5B4TA 5I7VA 2XBUA 3KKOA 3L8ZA 2DG2A 2WB4A 5AVWA 1UP6A 1H0HA 4NAUA 4ND4A 3TZQA 2UXDB 3Q1LA 3TF5A 2X6TA 2ZUCA 4YT4A 3HB4X 4FC7A 5THXA 4DL9A 3V8NA 4B76A 2PXAA 1D2MA 3OSUA 1WX1A 1UMKA 3F9IA 4L2IB 2HIAA 5BV7A 2ADMA 2FPUA 2R48A 3K35A 5I5EA 5M3BA 2IS1A 2I91A 3U37A 4FCWA 3T41A 3OE7A 4MDEA 1TM2A 4LHSA 1ZN2A 3AUXA 1SRQA 4FYJA 3UAZA 4B2LA 3WBKA 4YJ2F 1MTOA 5I8PA 3TJMA 3N7TA 3IP7A 4X90A 5I9NA 4N03A 4P81A 4GM0A 3DXXA 1N2ZA 2CMHA 3KLMX 3LOQA 3GWZA 1EUCB 3H5IA 4XCVA 3U7EB 4OX9Y 3H9BA 2PMWB 2Y0EA 4N8DA 4PC3A 4LQCA 2YWJA 3ZC3A 3N74A 3ZBPA 3X1ZA 5D00A 3K71B 4EEZA 5IBRA 2WDPA 4Q39A 4FDUA 1W25A 1KEVA 2ZXUA 1VYVA 2AW3A 4QSHA 4ETWA 5F5LA 2ICAA 3ILVA 1JF8A 3KV3O 3K0CC 1MRZA 3GNTA 1FNMA 3UXYA 2QZZA 3X1KA 4DCPA 1CW2B 3VR2D 1ONBA 1UJ2A 5ARBA 3KJQA 3A4NA 2VSYA 2FMHA 4I9NA 2R751 4OM7A 5AO9A 3AIIA 2CEAA 4D3SA 4JEHA 1CZNA 2Q4DA 1W52X 4CT0A 3LVFO 4DIFA 3MILA 2YZGA 4JU9A 5DW0A 3QWFA 3AVOA 3H2GA 4B4WA 5CGQB 4PLYA 4IH9A 5KNDH 1R8XA 3Q3JB 1CP2A 3O8BA 1W581 2H65A 2ZJYA 1ECGA 3L07A 3Q15C 1LS1A 2X3FA 1N3BA 4LF8B 5ICSA 3SR3A 3BRSA 2XT0A 3EASA 3Q7EA 4IEIA 3NTLA 1RBQA 2MWMA 4C21A 1SR8A 4Q9HA 1HTBA 3T52A 3OICA 5KYNA 5DNVA 2V7UA 2FF7A 5GP1A 4B8ZA 4DHWA 2ID7A 3AHDA 4Q5IA 1Y8AA 2WYWA 3ZKWA 1YRWA 4B6SA 1WCIB 4DR3B 1FSFA 4QDUA 1R8SA 1FS5A 2CNNA 3WGUA 1ISHA 3WL6A 2H29A 2WPDD 2WF6A 3GPDG 4UXJA 1RWQA 3AUYA 3L1HA 4F5WA 3CZAA 4PNHA 4RVFA 4XB2A 5G0VA 5JAOA 3PB3A 4DIMA 1VE6A 4L5YA 3FJYA 4DZTA 1U0FA 1O87A 5IT5A 4W1PA 2A92A 2BKEA 1U7ZA 2XVZA 3LYLA 4XASA 4XIGS 3RUPA 5IZCC 5JXHA 2W7TA 5D7BA 1N5DA 1GPYA 3ILSA 4BBZA 2GBGA 2BM9A 2XIJA 1JJVA 3FUXA 5AK6A 3ML1A 4O33A 1YB6A 1PTKA 1WHSB 2G1UA 3DMDA 3KVRA 3DZFA 3BB1A 4G5XA 1IPFA 3AV3A 2X1LA 2B4KA 1P61B 4YK7A 3QEJA 2P6RA 2ID4A 3OETA 3VH1A 2ZTMA 1K2VN 1X7HA 3LP5A 3LPCA 3OE5A 5CU7A 3M9XA 4YT5A 1Q22A 1U6IA 4Y2YA 3LPNA 3V4OA 3K6KA 1ECCA 4ZC8A 4QYIA 1NXPA 2G09A 1WG8A 2X1VA 3HGTA 5EP4A 1G8HA 2CNBA 3TKLA 1JHQA 4BFLA 3UOAB 5AHRA 2BE7A 2O48X 5AK3A 2WTMA 3D0QA 4TRJA 3M4ZA 3BN3A 3RDPA 1QRTA 4OJTA 1KAOA 1IXRC 5DFAA 2DKFA 4ZVPA 3O8CA 1BS9A 5T41A 5A71A 3NHYA 2RG7A 2A33A 1YC2A 4LKOA 4DV6B 1TQHA 4P54A 1FLVA 1N5MA 1ODLA 2Q49A 4DVJA 3ICCA 4MPPA 3MT8A 4XYMA 4YCJA 1T43A 2JD2A 2XB4A 2Q46A 2ZI3A 3BXZA 3EHDA 2HQBA 1QCCA 3ERCA 1UODA 1JHDA 3AI3A 4BQPA 5LXTA 5IM5A 3WRYA 2Q21A 1D6NA 1VOTA 2J6CA 3E35A 4JELA 1S6YA 1YUBA 2QSUA 4ENWA 3KQNA 4HMOA 2RHGB 3N2KA 3K16A 3AY3A 1NQTA 2BR3A 4HH0A 5DULA 5C0OE 3USZA 1CUSA 3VU9A 3MCVA 1BIFA 3L0CA 1XYGA 4UPVA 1CV2A 1UMCB 2BFWA 3G9QA 4YYZA 2WSSD 4B0PA 2I7TA 1NMEA 3PV0A 3DGEC 3SOZA 5HS6A 1SC1A 2JFPA 3V1UA 4OP2A 4PPGA 4U3JB 3L6DA 3AONB 2PQ2A 3RC2A 2IKSA 4YAWA 5A6SB 4KSYA 2F3RA 4EMBA 1QHYA 1E2UA 5EPEA 1QANA 3WNCA 5T7BA 1PK8A 3B1VA 3PHJA 3NC0C 1WW2A 1RR6A 4WH0A 5G0SA 1FYDA 1YRHA 3PXUA 4ZVTA 2HLDD 2PQ6A 4JKIA 4DBZA 4M0CA 1FFDA 3IV7A 3JV7A 4PAOA 1YCFA 5FQOA 1FQJA 3LDGA 1G7CA 3RGWS 4G85A 3P0IA 1M7BA 1E2DA 3C2QA 3BIFA 4IOKA 4DLWA 4OQPA 1GTG1 1RW4A 3I76A 2OL4A 1FLAA 1HFEL 3AKCA 3WE7A 4DSTA 5C1IA 1BD4A 1C9JA 1IEXA 1RLTA 3FIUA 4FUTA 1M1XB 4RH0A 3KNZA 1IY2A 2ZRPA 3H7IA 3VPGA 1JWBB 1T5DX 3ACBA 4GOKA 2WMOB 5L6LB 3T12A 5HZMA 5CDGA 3H17A 2FSPA 2NYVA 1SU8A 2JJ2D 4U7FA 3H65A 3HN2A 4K9DA 3KJHA 2F9LA 3DR3A 3HSYA 3ZNOA 1JR3E 2ZREA 1TFRA 5JDCA 4YUWA 2LV8A 3T9FA 4JU8A 4JJ8A 4TWZA 4WZAB 1BHQ1 1S5PA 2BFAA 4O2BB 1TVKA 2ZRAA 4TN1A 4GX2A 5AW7A 1JFTA 3DWEX 1EWTA 4YX9A 4L8LA 1WZNA 1O97D 3GOQA 4ZOBA 1U8ZA 4Z4EA 1EFKA 3V3TA 4MEJA 4EAAA 4XD7D 3HVKA 1L5FA 5IJ0A 1PLLA 4IL5A 5TGDA 2EBUA 2AEJA 3H5OA 4JLOA 2RAVA 4XWOA 1CDZA 1GTVA 4BDSA 3C45A 2O8EA 1OZGA 4H77A 2RHDA 1OWLA 4UBLA 4PRYA 4Y30A 4F3YA 5JI2E 4PPFA 4EG4A 3I0ZA 3N6RA 5TS3A 4HG2A 3AUKA 1U11A 2TYSB 1I3MA 1UZMA 1ZN8A 3HCPA 3R6LA 3LHFA 4OHZA 3U3OA 4BJ6A 1DWPA 4KZKA 3TKYA 2CFSA 4K9SA 4UTRA 4FTWA 1L4HA 1VSBA 3DAFA 1V25A 5ERXA 3DDNA 3P0FA 4BO4A 4Z53A 1GP2A 2VPZA 1J0CA 4QXRA 3OZGA 2WJAA 4JBHA 2R4UA 3DE4X 1WU7A 1R5JA 4HEHA 1MH9A 2WJ4A 3B7PA 1DTSA 4M98A 5DXJA 4GMGA 8LDHA 4B3TB 4RIGA 3V4RA 3TEMA 3R20A 2CDCA 4ND1A 2BBOA 5AHKA 2VK4A 1QIGA 4YO8A 3AR7A 3LJKA 1JEQB 3B70A 3WNBA 4UBNA 2BMFA 1CIVA 2JLRA 4JLMA 1MTZA 1ZD9A 3LLMA 4LSZA 2V1UA 1JH9A 2FXIA 2XUDA 3A6PC 5KC8A 4UCFA 1MQ8B 1JIIA 5LZ5A 1GNLA 5CXUA 3FOFC 3N8IA 3JX9A 5ESRA 1S7CA 3P2EA 4MV5A 2I5PO 1DP4A 3IAAA 3MWDA 3VUEA 4D98A 4IXTA 1CY2A 3HJTA 2NQ2C 2JEYA 2UZ0A 1PQPA 3IUPA 1N57A 3UQYS 4ABTA 5C8XA 5F3WB 4TZ0A 3WV5A 5J4VA 1XZBA 3WNVA 5I8ZA 3AI1A 2LDBA 3FAKA 2PM8A 1N0VC 3D2AA 4TOIA 3ZEAA 3WQBA 3JWEA 5CCXA 4FCVA 1XHLA 3QH4A 4O4HF 2QJRA 2ABWA 4G5OA 1ZRMA 4KAXA 3BFJA 2AOVA 4MQFA 4QIHA 4FR2A 3X2SA 1C8KA 2ZBVA 3I32A 2E48A 3DHVA 4F12A 5KYUA 4XUDA 1TTQB 4NABA 2DWQA 3OT1B 4RIHA 1MABA 3ISTA 4NICA 2QUKA 4PU0A 3DCIA 3I83A 5THKA 1PYOA 2J1LA 3GIWA 4WLFA 3NWBA 1RYNA 2GZAA 3A9CA 2B1JA 3CUYA 3NBFA 2DQZA 1ZH0A 3A4IA 4GXNA 4IHAA 4X91A 5F4BA 4KR6A 4AXXA 4C3UA 1V5FA 5L9AA 3GZJA 3ES9A 4PLFA 1LI7A 2FEKA 4TXJA 2A30A 1T9BA 2GK3A 2KE5A 4DNQA 3C6BA 3A3YA 1X42A 1MJFA 2HV9A 5EMJA 3BGWA 2HT6A 5C7YA 4OLAA 3UWKA 3VR5D 5JYCA 4NCIA 3P9PA 1G20A 1SD5A 2G1AA 2BEKA 2W0MA 4UEQA 5FPSA 3UY4A 3MWFA 3VFDA 4YFYA 4Z49A 3VDMA 2E49A 1K1EA 3GJ7A 1V7CA 3R75A 2YZ7A 3DYIA 2ZUUA 3PBKA 3OI7A 4RZQA 2NV6A 4IMIB 2C2YA 3LA8A 3PEEA 1F12A 1OREA 4N9QA 2IU3A 1SBTA 3COVA 4HZGA 1QDEA 1G3QA 4HDAA 1NLMA 1Y81A 4HZIA 4UATA 5JYDA 1FOEB 3B36A 2VQFB 4KFUA 5A5FA 4QA9A 1ZD5A 3B20A 3T9AA 1E2JA 2N47A 3W5VA 1G8AA 4BZQA 5KNCD 2XX3A 2ZROA 4RF2A 1H4SA 1LBTA 4E5VA 4KIJA 1HYBA 2JLVA 1E9FA 2AR9A 5AJYA 3C0KA 1MP0A 1DU4A 1K9VF 2X2PA 3BXHA 3TLMA 2V6FA 2RE8A 1R4MA 2QR2A 3K9CA 5C1BA 1NATA 1K3FA 3TDNA 3L1KA 3RHSA 5ALNA 3SP1A 4ZCIA 3NH9A 4JQCA 4MI1A 1CYEA 1IEQA 2ZAYA 4MP6A 1GNSA 3AU8A 3HA7A 3A1NA 1VPWA 4CGZA 2ID9A 1D1TA 4L08A 2FDXA 3Q12A 1K8XB 2VP0A 4X63A 2VAWA 4QRIA 5KCMA 2BR5A 4CBVA 3VZRA 4CIWA 1TTTA 1L7DA 1XZEA 1KFJB 4AD8A 2EZTA 3SQXA 2Y05A 3B78A 5FV4A 2YJTD 3AKZA 4CQMA 1RM5A 1I13A 4DSZA 3CRMA 1ESZA 5I51A 4Y6OA 1PZHA 1KU0A 3KYDA 3GXOA 1L3IA 2Q50A 2QI9F 2P67A 4R4JA 5DGIA 1F6WA 2A1TS 3DOUA 3LMKA 2DSTA 4S1NA 3ZKWB 4BLQA 4EYGA 4B1FA 3PEVA 5AXDA 2OEPA 3DBVO 4GX5A 3CCBA 4EO7A 2O57A 1Z6AA 1FFHA 3R9XA 2XOKD 4UBIA 4V0RA 2IBSA 2IHVA 3TM5A 2IXAA 3A6DA 3IBSA 4QX6A 4MVCA 2E6KA 3LSYA 4XJXA 2CLEB 2OV2A 3C6QA 2DLDA 5DYGA 1XRRA 3UJNA 4MRVA 1VLZA 2KX7A 2QNRA 3W7AA 2X9VA 3KEFA 2ZANA 4ZHSA 3C7KA 1CRZA 5T8KC 3AB3A 3TO5A 2Q6VA 4LKRA 4PO9A 2ACEA 1E20A 1PS8A 3W2FA 5IAJA 1PGNA 3JATA 1ZD3A 1I24A 4M83A 3U81A 3WO1A 3AVXA 4DR7B 1GADO 5A0TA 3ROTA 3GR6A 2K2WA 5D1HA 1CUCA 1EVKA 2C88A 3PUYA 4TGLA 5CT8A 5E4YA 1OGJA 2XECA 3WV4A 1D9ZA 2JK0A 2C07A 1X1TA 1THTA 1DSSG 1W85A 1NLUA 1Q7EA 2DX7A 1U0HC 4QYIB 2EEZA 4NPHA 2RCYA 2YXNA 3WK6A 3RHFA 3TAUA 5IAEA 5L3ZA 2Q2WA 3PFFA 4H0NA 1POWA 1LF0A 3W2EA 1T9KA 5HJ5A 1T3HA 4PX9A 1YIAA 2A5JA 1Q0PA 4J75A 3V1KA 4MW0A 3HY3A 4X94A 1Y7HA 2AX4A 2BR4A 1FFWA 1X87A 1RFGE 1Q3TA 2VWGA 4IDHA 2PT5A 2PGNA 1J9ZA 1Y3DE 2DUJA 3DE7X 1NVDA 2WB2A 1J06A 2CW5A 4HK4A 4EVIA 4DMHA 3SDZA 3W4JA 1P4HA 3ENVA 4HOYA 3G6WA 4KDFA 1WB9A 2GVDC 5FOQA 2PQMA 1SWWA 3PDCA 3VYUB 5C46F 5LMZA 1R27A 2DQ4A 3OPYI 2CHFA 5JJLA 2FXVA 3ANMA 4IFIA 1PW5A 2HJ9A 4C0LA 3H2YA 3N2KB 1SFRA 4HXGA 4RZIA 2HPVA 1CJTC 1SIWA 3PGJA 4WJKB 2VO1A 5GIOE 3F4LA 3HO1A 2BFBA 2HF7A 1NP3A 3EBPA 5EE5B 4XYBA 3VU9B 3WOHA 5A4AA 1C1DA 1KAGA 3BT7A 1L8LA 4DUPA 4YN3A 4DZZA 4H18A 4QD3A 1TF7A 5B2ZA 2W6CX 4DSOA 1PK7A 1TAUA 2C42A 3I37X 2COKA 3OEEA 1SC9A 4HWGA 4IR7A 3UTDA 2WSLA 1RRGA 1DWUA 3ZWVA 3F3KA 1KO8A 4AX4A 1J49A 1IZ0A 2AG1A 5LJLA 2I99A 2C77A 2VQDA 1VQ1A 2JLCA 2LP4Y 2OGZA 2HU8A 5CG2A 1JG4A 1LGYA 4PWZA 3SJZA 4BNLA 2EFDB 3O84A 3NV7A 2H08A 4LRQA 1JN0A 4Q00A 3Q5GA 4PG4A 4B84A 1QPZA 1Z25A 4QKQA 1UXGA 4G25A 5FADA 1SQ0A 3GFFA 5HM8A 3IQZA 1VYUA 2RHTA 2RAPA 1KQGA 1IHYA 1P7WA 4PO3X 1KYVA 2J87A 3ZE9A 1VL6A 4KOEC 4JSRA 4JP5A 3QXCA 3CKLA 4IAOA 3FYCA 3MUNA 3K8YA 4AJLA 1PK9A 1VPVA 4YBRA 4FFRA 4MGYR 3U0BA 3A0UA 3EIWA 2J33A 1QLHA 2W2MA 2ZKLA 1PJSA 3A4MA 3HJGA 4FGZA 5FTNA 3OKFA 3PLAE 2B92A 2HF9A 3O9ZA 2VJAA 2JJ8A 4JP2A 4R81A 1U3UA 4OIMA 3R9KA 3OMLA 5FL7D 1W8IA 3A4TA 3PNKA 4JITA 2P9TA 3C1OA 3JQ7A 1TVKB 3L92A 2DY1A 1P17A 3G2IA 4Z5XA 2CVPA 1PZGA 3X2FA 5FEMA 2B7BA 1ZEMA 2LKCA 5F5XA 4S04A 3OCYA 3RRNA 1MB3A 4QDOA 2W93A 5IJ0B 4WADA 1XDWA 1O6CA 1P73A 1CF9A 4P0TA 3PC8C 5AOAA 5JADA 3E05A 4TMKA 1OE0A 2QLTA 3RSZA 1JHOA 2O8EB 2SHKA 3NVAA 3SICE 2NN3C 1J09A 1NAIA 5A4DA 4P5EA 2MR5A 1K7FB 1XD8A 1RKQA 3SQOA 2OA0A 4EY7A 4EG7A 3AF5A 4OFZA 5FORA 1SO8A 2IF2A 3HXPA 4HDNA 3ZNQA 3RAEC 1Z5UA 2CXSA 2OZPA 3RKRA 4DDKA 3ZDEA 3BIXA 4LF7B 4LHXA 2UUOA 2O8FA 3UPDA 1EX6A 3RO7A 3TXAA 3UMBA 4D25A 4G0WA 1YDFA 5GM1A 3WISA 1V8FA 3KJEA 4HBGA 3R4VA 1Q0RA 2H2HA 2YJ3A 1Z8FA 4S1OA 4AO6A 4LVUA 4J0QA 5EERA 3O9VA 4MUAA 1BQEA 5DLYA 1B42A 5FFFA 4EITA 1HYEA 3JWHA 3VZPA 1FCJA 2FZ5A 3HDQA 1GVHA 3OCCA 4PZ9A 2H4YA 4U2CA 4LRUA 4MP8A 1YZKA 1L5OA 1AKQA 4ENUA 5THQA 1KJWA 1U8TA 3QI2A 5IWCA 2GDZA 1FMLA 1DDIA 2W6OA 4PWYA 2VLIA 5AESA 4DS3A 1I6WA 3R9WA 5BSMA 1Z4OA 3GRRA 3GYBA 4M86A 2JKVA 4A5OA 2P9CA 1PZFA 2L69A 3EW9A 3TLKA 4JGIA 4DCCA 2FRDA 4DBVO 3HBLA 2L0XA 2LDXA 3F2IA 3MWDB 3PDHA 3O1LA 4PINA 4JLDA 4JI6B 4I1PA 3PQ8A 1VMIA 3HEBA 1YVPA 1H2RS 3R3JA 1TRHA 1O4WA 3BSSA 3VH3A 4RTPA 1F60A 3CF4G 3LX4A 3EZLA 4QPDA 4CG2A 3G2HA 4MGZR 2XB2A 2GPAA 2MYUA 1IM2A 2GHIA 2EIXA 4OL0A 3UKOA 2WJJA 2GVNA 4HO1X 3TZHA 1UR5A 1CLUA 4I9GA 3T95A 4KBGA 3ADBA 4DZRA 1L8AA 3NBAA 3DB2A 4MQFB 5A2GA 2FFAA 5FEUA 3DFMA 3DOOA 3SR4A 4Z1MD 5KYUB 1WVMA 1N7JA 4LQ4A 5E9WA 3MWLA 5T67A 4OH7A 5DNAA 3L6BA 5KTMA 1MABB 3QK7A 2R5FA 1AGXA 2R87A 4LYYA 3W90A 3JQDA 4HTFA 4WCFC 3I61A 2YCLA 2RB4A 1S01A 1GSIA 2XB8A 3HCDA 1OAKA 4PYKA 3OZVA 1QSGA 4L8WB 1SXJD 1FYXA 1PYDA 2KS6A 3OECA 5K2MA 4H1WA 1BHO1 1YQGA 2H07A 4JX9A 2LUOA 1NXQA 3T38A 5CDSA 3KOOA 5BPFA 1C81A 2YZNA 2K7FA 1DAEA 4O3MA 3LRXA 3NM5A 1YTUA 3A2KA 1K9SA 2YR0A 1QBKC 1PWEA 4CIYA 3AVTA 4OXRA 2I6QA 1I14A 1V6CA 4JK3A 4IMJB 3SMQA 3ADOA 2ZXFA 1G20B 4DJJA 4DLBA 4RVUA 2ZYVX 3GU3A 2ZYAA 2AC4A 1XQWA 2K87A 4X8MA 1XK6A 4H9GA 1MPTA 3VSBA 3AKEA 4PSKA 4E5MA 1VHLA 4TZTA 6Q21A 1KYWA 1H2YA 3I9V1 4ZO9A 1CJUC 1SBIA 1JU4A 1JDSA 1Z39A 4FPXA 4WOCA 2YHUA 4JGGA 1NI3A 3CUKA 1ZW6A 4L15A 4LCJA 4CM3A 4Y9TA 2GR9A 1RLOA 4IG9A 5HIKA 3KQSA 4ZKDA 2NYAA 4O29A 3DAGA 2JLAA 2CZGA 2OV1A 3RNLA 1OQAA 4GDFA 4O25A 5E9JA 3NONA 4QRDA 3CVYA 3W2IA 1WZEA 3N58A 4MQUA 5EQTA 1PGPA 3ZDYB 3HMKA 1YUMA 1OXUA 1EM6A 2CYCA 1XQXA 2Z3ZA 3FDFA 1R4MB 5A6VA 3WWDA 3BXEA 4PBTA 1NN1A 3QELA 1CUIA 4MB0A 3ZD8A 4AL4A 2AFHE 3LCJA 1Q0ZA 3RUIA 5IW8A 4ARVA 4ZMSA 3OCWA 2ZPTX 5I7HA 5J2UA 5TQVA 3ZJTA 1YHNA 2P6OA 4OQDA 1ZESA 3QENA 4UMFA 1W9HA 1U81A 3U4IA 2WZCA 4G0NA 3FGOA 1KEZA 2Q2VA 2R79A 4EY8A 4CQMB 3BWMA 5JY6A 5IBQA 5LQJA 3C14C 3OE1A 1Z5NA 1FDWA 2A94A 2F90A 2QGNA 2ZJOA 3SS9X 4KXYA 3VRHA 3KYDB 2ST1A 4C01A 1YZHA 4WNAA 1QU2A 3DPIA 1YTLA 2PGJA 4UEKA 4INJA 1XKTA 1YL7A 2AKYA 3WSWA 1XPOA 1XCOA 2VF8A 3EJ6A 3OQ1A 5CH5A 5K3AA 3EPKA 3FOEC 1IH8A 3NLLA 5LU8A 4DC1A 2EJUA 4AJNA 2QVGA 4KRGA 1IOLA 4UHEA 3GRAA 3INRA 3R9XB 1XMIA 1ZNXA 3K70B 5AW2A 3E3MA 3OP1A 4BFZA 3AP2A 4KV9A 2DMRA 2OFPA 4MQ5A 4HUTA 2PH3A 1FQWA 4OGKA 4Q15A 4YECA 1Z3CA 3QYFA 4LMRA 4RSMA 4FX2A 4Q03A 2CMFA 3KB1A 1JZQA 4MIEA 4C6SA 3D6AA 4UXIA 3RV4A 5KAPA 5CCBA 4OPMA 1KK0A 3NRBA 4QELA 1GQFA 1WMAA 5FJIA 3M83A 3EIFA 3QBEA 3JATB 4DVGA 2VWQA 1DPFA 2GT1A 2Q6KA 4QAJA 3UIEA 4AK9A 4B48A 3O95A 1JVNA 5C9ZA 2RH5A 4MV7A 2YV2A 4FQ7A 2L19A 1A9PA 1YHZA 3A3KA 2XVXA 3MQFA 3HJAA 2AN4A 3BXOA 2JZNA 1UKYA 2EHDA 4K81B 4X71A 4CIVA 2QX6A 2FW1A 3BFKA 3OPMA 5CA0F 4DMGA 1W85B 2AH5A 3IUJA 3NEYA 2QR5A 4IHQA 5GIPE 1NOIA 5HZHA 1TPYA 3OLQA 3OC6A 4ER6A 1Z68A 4DLPA 5CXQA 2YV1A 3IOCA 4TRRA 1Z8NA 1PR3A 1GEGA 3Q3VA 4OHCA 3SZ3A 1NNSA 3MCTA 3UQZA 4UFPA 3T5GA 5JD3A 5FV7A 4AWAA 3DOFA 5JHGB 1EKXA 1D07A 3ZQUA 4KPYA 4XGIA 3GC6A 4MRMA 1FSSA 4TUYA 4QM6A 5EIBC 3C5HA 4KQWA 2XMSA 3WB9A 2YOHA 2PRYA 1P4AA 1Z0SA 2ZT8A 3HGQA 1IY8A 1QIMA 3IP9A 3G9XA 5CLHA 3S2FA 4W9MC 3COPA 3KSBC 1A8HA 3A1CA 2DJ5A 5DHRA 5FBQB 4I9UA 1SVLA 1H69A 1GPBA 1WVIA 3LT2A 1Z38A 3H9QA 2HX1A 2EW8A 3KVNA 4IIXA 4K05A 1XZKA 1QPGA 2P1RA 4C04A 4HX9A 3HA3A 2PMFA 3W9YA 2BFBB 5CM2Z 4ZOAA 1L1RA 5IS2A 1HEYA 1BDJA 2B0JA 1MHPA 1C1DB 2DFLA 5EXDA 2OFFA 3W1VA 4F72A 2R8EA 2WMNB 3ESCA 3HS3A 1TK3A 3KO8A 3AG5A 2GN6A 5AUOB 1KI8A 1SQ6A 3LHSA 3TTXA 2GJ9A 1XQ9A 2FOLA 3N3BC 2WWHA 3WDKA 2IODA 5JXWA 3EX7C 1DJMA 1THMA 3NX4A 3AR5A 2IXTA 3MUEA 4TXNA 5E9AA 4DYVA 4KRYA 4Q4CA 3BAFA 1P6QA 1JPUA 2EZ9A 2FG7C 2FF5A 4I99A 4W9RA 2WTNA 1Y4AE 4PONA 4X3OA 4LXGA 4QBGB 1SGWA 3WLQA 4OSPA 5AVJA 2C7PA 1C1XA 2O07A 4EYEA 1AKUA 2YZ2A 1BG6A 4BS9A 3FPJA 1FTNA 3H5LA 5EEGA 2C59A 3UXMA 1PJBA 2BSAA 4WINA 4RIEA 3CNBA 3QMWA 1UBMS 3RFTA 5DCYA 1F0NA 2QD2A 3CEJA 3RIMA 1UBHS 4UAJA 1IN5A 1TI7A 2ZI7A 1J2EA 4D9IA 2QBYA 4JIMA 3EVZA 2D13A 3JYQA 1RHJA 3UGKA 1WLYA 2IZ1A 1NKTA 2POQX 4W5HA 4M38A 1QS0A 5A5DA 4WUTA 5EJ8A 3PLNA 5CB6A 3UJ6A 3JAKB 5CM8B 4C76A 4LBYA 5EXEA 3OIFA 1KMQA 2F8LA 1SUBA 1BKSB 1DAHA 5AQ1A 2Q27A 4DQVA 2QVBA 1RYZA 3JQ7B 2WAOA 4G89A 5J5VA 1JS1X 4JBGA 1FUUA 3RSGA 5ITZA 3UJBA 5K6TA 1SVSA 1HG1A 1SKMA 1ECFA 3FR7A 4DQ0A 2XY4A 1IXYA 5GJWC 1WQ4A 2HJRA 1J39A 2NW6A 4Q3OA 3IAM6 3ZVNA 2F3TA 5C3UA 1C7QA 1EUYA 5LQSA 3KXPA 4J0HA 1EVZA 5BSWA 3QFSA 2ZRMA 1H2XA 2SKCA 2Y0BA 3P9RA 4J16C 4MGHA 2AOTA 1P29A 1UKBA 4RF4A 1N5LA 4JWTA 1JKFA 1U28C 4HWOA 3OCVA 5AW5A 2J09A 2EXXA 3FZNA 4OJKA 3KYIB 4LW8A 4NL4H 4KGVA 3ZIAD 2GBLA 1NF8A 2AC7A 3B48A 3QXGA 4I36A 4X84A 5FPYA 4BCDA 2VTKA 1X74A 2IV3A 1NJ8A 2PSDA 2TRSB 3HDHA 2AQ8A 1FP1D 4G0QA 4OQFA 2PN1A 4HDNB 3BGVA 4R16A 4IF6A 5AKZA 2DWOA 2SKEA 2NSLA 3H8VA 3O4IA 4IEEA 4RXTA 5CTJA 5C3MA 3GBPA 1BQ3A 5MGBA 4A5SA 5ALKA 3EVBA 4G1CA 5CVCA 2O8FB 1V9SA 4EUKA 4PZZA 5C80A 1LLQA 2YOGA 4B9EA 4CQLA 4X7BA 3BD7A 3DDWA 3ZXUB 5KWEA 4WJLA 4E08A 2C7BA 2EFYA 3ND9A 3OUZA 4MIYA 5DYTA 3LU1A 5ECWA 2W6JD 4BBAA 1LJLA 4DDVA 5K8IA 1QYVA 1MBZA 4GR4A 5ALHA 3TL3A 5M2QA 4LDQA 3H5TA 2C04A 3CRRA 4J8PA 2VDOB 1UUFA 1HPLA 4B4VA 2J45A 5L4LA 4JP8A 3I5YA 3ADKA 1MX3A 5EI5A 4EHIA 4G56A 5FD8A 2Q3JA 4GP7A 4MXDA 5K2OA 4JI7B 4YCAA 2WVGA 3DL0A 2WICA 2OHFA 3EMKA 4OUDA 1KDTA 3EQ2A 4QGBA 4BLRA 1AS2A 3UT5A 1RE0A 2RHHA 2EKBA 2V58A 3ZTTA 1MUUA 2HMWA 5F7JA 3DVLA 4CIDA 2QLJA 5KKNB 3KWJA 1ZUD1 4MQBA 1ZI8A 5CTAA 5BQPA 1KKUA 4BCBA 2VHTA 4TM8A 1P39A 1DVRA 1JX6A 2QE7D 2RK3A 2YHBA 5L3SA 3D6HA 4GX0A 1HQDA 2GF9A 1WZIA 4YMIA 3Q7SA 4MV8A 4WESA 5IK2D 4QDZA 3PR2B 1KYQA 4I1OA 1FNCA 5BW6B 4KBYA 4YJ2A 1DIBA 1BXGA 1MENA 3ZKAA 2FH5B 2R11A 5AK4A 5ALMA 4P22A 4DIUA 1AKVA 2QM3A 1TIKA 5HJ2A 5JNSA 2OPBA 3FPKA 4Q1VA 1N9GA 1TZ2A 2ZRJA 2H2GA 4Z4QA 4F3RA 2GN9A 4HTFB 3LI2A 3AJ8A 3UJ7A 3CVWA 4Y9RA 4FINA 2G07A 3KV1A 1U2DA 2I2WA 4LZWA 2AJBA 3DKPA 4M36A 4QFCA 4IS3A 4ZAFA 3UMRA 4WGFA 1MZPA 3QLVA 3EZNA 3QA9A 1T4MA 4FFSA 4TS1A 4MDYA 4XWAA 4AKSA 2YWCA 5K6AC 3I2YX 1H2ZA 1PX2A 1XP8A 3GLTA 2DXIA 4JXZA 1HL3A 3ASUA 3C5VA 4U1RA 5ITSA 4LGYA 2RI0A 2YY5A 1G66A 5JY1A 4TSRA 1U0NA 2HK7A 3OKAA 3IJ5A 1ZNYA 1JHPA 2PWBA 3PXGA 4ARAA 4ER3A 2Q4EA 3VR4D 2XI4A 5A5EA 1ADJA 1GSOA 3EMDA 3B53X 4JP1A 4OXQA 2OYRA 2PAFA 3IP3A 3ROQA 4YO7A 3VTFA 3ZYCA 3WQSB 4CMEA 5KZMB 2OOSA 3FLBA 1H1TA 4PCUA 3A4VA 1DCKA 4LJKA 4BKOA 2QW1A 3W3AA 2DH5A 1WY7A 2CWWA 4V3CA 2F4VB 1EFUA 3OQJA 1T26A 2C96A 4BECA 3JARA 4L5CA 4D4LA 1XCLA 2GM5A 1E5LA 2QGZA 2LCQA 3H19A 1YZ3A 3TTSA 2DOKA 3K2QA 2YY7A 3T54A 5CEEA 4L1KA 1HEIA 5AOVA 4RPJA 4F4HA 2QF7A 1RNLA 5EVJA 1NF9A 4MCJA 4JUBA 1IHXA 3QELB 2QUJA 1AUOA 2F4NA 4YROA 3EH1A 2VYFA 4JBXA 5M04A 3PKZA 3BCSA 4YP9A 1PL8A 2V6MA 3ESBA 3LCRA 2PV0A 3FLAA 3GXBA 2GEUA 1WZUA 5J2UB 2HAEA 3NUGA 2Q5HA 5CCDA 2YXBA 4EOGA 2JIPA 1R0CA 3HYSA 5JLAA 2H9YA 4MKHA 3V8MA 1S3IA 2BBTA 3OFND 2EBHX 3MCWA 4CV2A 1U0TA 1E7MA 3C7DB 1CZUA 1MOPA 3E03A 5JE8A 4DIKA 1CUDA 5CFPA 1QX4A 4A0QA 4MS4A 2B0CA 4MW2A 1G5TA 4LY0A 3UMFA 3J7AC 1J7JA 2QLFA 3K1ZA 1VLJA 3PE6A 4RE6A 4WNAB 5IJAA 5EJ2A 5JAIA 1TMGE 1EFTA 4UJ3A 5HDQA 5K20A 2EWVA 1A9RA 3TTTA 4E5SA 1Z9BA 3MTJA 1GGEA 1SOUA 1Y4UA 2CCKA 5AUNB 5KU7A 4TWAA 3L4JA 3ZOKA 2ZCUA 2WZQA 3U3JA 5L6MB 3SSOA 5HA5A 1DRVA 3DZKA 1ZJWA 1OTXA 2Y1KA 3GEMA 4LZOA 2BMJA 4M88A 1PYGA 3F7NA 4J7AA 3WKEA 4ZCRA 4MARA 3FOZA 1TYBE 1DI0A 1U3VA 4FSXA 2ZRFA 3ZNNA 2FB9A 1RIIA 5F9MA 3RG2A 3BWDD 3VMMA 1FDSA 1T3GA 5BV1A 1GPUA 1Y9AA 4FCTA 3RYIA 2BGMA 2EJTA 2ZYIA 1NW6A 1HDXA 4TRMA 3HV0A 3U44A 3AHHA 2QUBA 2XWBF 3ZHCA 1VC2A 2OD7A 2VKQA 4A7PA 1HSOA 4GRDA 1L6RA 2CNKA 1J20A 4RKQA 2BH9A 4WK6A 5BUQA 3MM4A 3PWTA 1ZINA 3BD8A 3DWIA 2O5VA 4IOLA 3D7LA 2HIMA 4INAA 1XU4A 5JZVA 4L8FA 4ER7A 1OYVA 2ZIGA 2BMEA 4NBLA 1F6BA 2PGXA 3DGFC 1JHVA 3ONFA 2JIZA 1NJ5A 2I6FA 3DULA 3T0GA 3U4CA 2JBAA 2ATIA 2HB6A 2Y92A 1X39A 4GLBA 2OBBA 4HAXA 4RPGA 1JHXA 3T7KA 5ECYA 4ZZ1A 1K7YA 1GYPA 4ZT4A 5G0WA 3M33A 1AY0A 2P6PA 3TCNA 4MRMB 3ZVRA 4TUYB 5DTMA 1IQ0A 5JC1A 5KPDA 4U63A 1Q91A 1QM5A 3PQ5A 4CEJA 2IU0A 2XTZA 1X0XA 5IVIA 4FFNA 3C74A 2PDAA 3OZAA 3EMVA 3E5HA 1L7QA 1QYIA 1ACJA 2P41A 2ATCA 1C7ZA 3C1UA 4DSNA 4KB5A 1HOXA 3DZHA 4ZYLA 4E6EA 3WZ2A 16PKA 2GJ8A 2QY9A 2X4LA 3WLTA 2W43A 1TC1A 3HV2A 5FBZA 4HJRA 2ZJ1A 1RAAA 4QQKA 3RRFA 1LKZA 5IABA 5KO2A 3FYTA 1QTQA 1I3CA 2P9JA 1SU4A 1N8KA 2YVKA 2DETA 1PU2A 5KVSA 3LM8A 1XRJA 3E3OA 1FP2A 1L3BA 3QVVA 2BTOA 4NYIR 1ZDMA 2RC6A 2PLAA 4ISBA 3WK7A 4F2HA 5IH7A 5MDHA 1U0BB 1A4XA 4QE3A 3BMQA 2UYYA 3HCCA 3OCZA 2ONJA 3C87A 3KZCA 1DDOA 1QKKA 4IDCA 1YGYA 1JHZA 4BMSA 1Z6TA 3P97A 1OILA 1O89A 1M6WA 1O4VA 1U3TA 4M0PA 3V34A 3ZCQA 4LRYA 4XWYA 4WXPA 5DEIA 1E2GA 1C1XB 5DIZA 2W9XA 4MUMA 1IMJA 3N2EA 2RAFA 4YRGA 3SN6A 1P0PA 1QQ7A 2EGUA 3AM4A 1JI0A 3UXEA 3VA7A 3PGLA 4LHZA 4QG7A 5JMWA 4KIFA 1OYWA 1BGVA 1F8GA 1P9OA 2QBYB 1P4RA 4WZ6A 4XVQA 5D7NA 1SKQA 1KH3A 2QENA 2NNWB 3DXFA 4YGYA 3TNLA 4D0RA 2AJDA 3D6UA 3SBEA 1J6UA 1V3VA 4FNMA 1IEVA 4L76A 4OMUA 1QS0B 1D7AA 5B1DA 1YULA 1IPEA 2Q5JA 5DPMA 4E2ZA 1T3TA 3OP4A 1OD6A 2HN9A 1Y34E 3EDMA 3KTDA 1NXWA 1VB5A 2I3BA 3SGLA 3VR3D 2W42A 3QYJA 2CJYA 4M0DA 4F60A 2HW8A 2Y4OA 3WGYA 2IPMA 4G4JA 4BMXA 1EWKA 2IYSA 1NKVA 4NYJR 4BTEA 2QN2A 1SVUA 2RMKA 2O5CA 5ITZB 2G1JA 3HACA 2I6TA 4DB2A 2O7VA 1T5HX 1D2RA 1JIXA 4AULA 3K8ZA 1YIDA 2EKLA 5AI6A 5ED4A 2B4RO 3TQFA 1I1HA 1PJ3A 4ALLA 2RH4A 1O58A 1A7UA 4WN3A 3WHPA 3KQTA 3WLAA 2HWUA 3LC7O 3O31A 3PFWO 3TD2A 3NNDA 3IPCA 3N87A 3I8XA 3AHJA 1S4MA 2BGLA 3HCNA 1NP6A 3LW7A 3PUVA 4BO7A 3G6KA 4Z7QB 5HMLA 2AOTB 3B5EA 3ABSB 5TQ0A 4UFNA 1UDAA 2VUIB 4U9UA 2J3MA 1SBZA 3QPVA 3L4KA 3EMBA 1RXSA 4L5IA 3DBOB 4FLFA 2AKEA 4YCLA 1XIVA 1XTQA 1X8JA 1E59A 3H87A 4KE9A 4QU8A 4Z4CA 3VKHA 4L0DA 3HUFA 4V0OA 2D0PB 3KZKA 1WB5A 3AZQA 3GBSA 3PF9A 1V3TA 2BF4A 3E9NA 1QF6A 4R05A 3EEIA 3ED1A 2X5JO 2QLNA 2GTIA 2WT4A 1VLVA 1ZP6A 2Q6TA 2IEAA 3QVJA 1X9GA 4L0CA 4BN4A 4FS3A 4CQLB 4LFAB 2NGRA 2PZMA 4MV3A 3WWEA 1NW5A 2QRMA 3I28A 1TAHA 1XRPA 2ZEJA 4OFWA 2EG5A 5E1OA 4PS0A 3DLIA 1S9DA 4ICIA 2NTNA 4YGXB 4KXMA 2GYVA 3EH2A 3LDFA 1PWYE 5BSGA 2O1WA 4MVWA 1TUIA 5BVGA 3NHRA 3CWCA 2J07A 2MSLA 2NLOA 3CSDA 4H16A 1LB1B 1QO0D 3IYLW 4LOIA 5ALJA 4NF2A 5JYBA 2WSMA 5DKFA 1XKLA 3NWJA 4BNNA 5JSFA 5KTPA 4AC9A 5KVVA 2WZBA 3I8SA 1I7SB 3FN4A 4OUDB 2OCAA 5C4IA 3UT5B 2ZM6B 2BFDA 3A27A 1J8QA 5I8WA 3KZXA 4A82A 4F9TA 4CEJB 5HBGA 2PKQP 4DMFA 4LTDA 2B8EA 4YJ3F 5NLLA 5HHTA 3MT9A 4OGGA 1NONA 4RYLA 3B1XA 2MYTA 5L3SB 4M0MA 4IRXA 4RA9A 3R3VA 4KCGA 4TZKA 3UAXA 2GBIA 4OQ4A 3TDKA 1N33B 4WESB 3ABZA 3MGGA 4UEOA 1V9LA 4YJ2B 1ECPA 3EBOA 1XU7A 1ARZA 4P7GA 1BXGB 1PT8A 1VE1A 2VCYA 4U39A 3S8YA 3H5WA 3JZMA 4EELA 1KEPA 1X86B 1GUDA 1UM8A 2R47A 1N2XA 4TX1A 2NZXA 5J4YA 1YAJA 1GPH1 1QTIA 1SUDA 4O6VA 4O8ZA 1N9GB 4EJ0A 3O0DA 1HTTA 3R0QA 1JA1A 4WUVA 2XXBA 2Y99A 1UMBA 3L6OO 5DSZA 2Z98A 2K7ZA 1H8ED 1GQRA 1W75A 3ILYA 4ZEVA 3L6RA 1TW3A 2OHGA 1NRWA 3EGCA 4B46A 4HQKA 1JPVA 3FUWA 4TVSA 1LXCA 2CLDX 4ME6A 1IK6A 2GZMA 2P2CA 4KH1A 4BX2A 1RRFA 1PDVA 3L7KA 4L4ZA 4YV1A 1GNPA 4F92B 4QXQA 4IMRA 3OU7A 5JLJA 5B5SA 3K5PA 4H6PA 2ZI4A 2HKIA 3LLVA 1CYDA 3MUOA 5TR9A 2EHJA 5A5GA 1COZA 4F9EA 3F4KA 3WMXA 3AIKA 5DMXA 4CMJA 1RCTE 2DHQA 1P1IA 1TMOA 2Z3VA 2GETA 4JBLA 5AFSA 2HA5A 1M2WA 1J42A 4J43A 1C5KA 1TU0A 5LM3A 1EHCA 1JXQA 1QHGA 3ZI4A 3JARB 1NBHA 3R8CA 2MMCA 1NXXA 4J0FA 1ZL2A 3MOSA 4IJ5A 4JLUA 3LW8A 4U9HS 1V6AA 5H9VA 4CODB 1W5SA 2NACA 1XZFA 4D43A 1X1DA 4B7XA 4DWVA 2O5EA 3QE3A 2HQ1A 3NM6B 1Q3HA 5LMUB 3ZI0A 4EI9A 1YMUA 3RVNA 4PN7A 4GF5A 5EUMA 1R0BA 5SYNA 3I6BA 3JSAA 4EPRA 4Q3LA 3I9FA 1FXSA 4BQSA 2V96A 4HCJA 1DZIA 2DUUA 4W82A 1LLDA 1F6DA 3UJAA 1RI1A 2W2OA 3MVEA 2QS9A 4KMRA 2L2QA 4KQGA 4EUNA 1QQBA 4MYCA 2H9AA 2QTVA 3N2IA 3R7SA 3FGNA 5H9WA 2ODEA 5HKBA 3EUWA 3PRKE 1P3JA 2Y66A 3MTEA 4I6EA 3OEYA 2C78A 4JS0A 1M6EX 2I33A 2H6EA 2WHXA 4MS4B 5E7JA 4ZVQA 3SHOA 2PH1A 1KSHA 4KO8A 4EFNA 4EBFA 1PR5A 2C5FA 4TXHA 1WCYA 2ROQA 3IIIA 1GZ4A 5LQMA 2QT0A 4NMLA 2GPSA 1SKUA 1J0BA 3ZG6A 3OT4A 4HWTA 5FF9A 1JDVA 3EIXA 3U39A 4D9CA 1W5EA 1A5AB 1FTYA 3FFXA 4RK6A 3FNQA 3S68A 3Q8LA 1PS0A 1TFUA 5EIHA 3CA8A 5HUJA 2FX3A 3IUMA 1YVRA 3T8YA 4QFMA 1GG9A 3EVCA 5B3KA 2OE2A 3GLKA 3EQ6A 2B78A 1C0EA 4NE2A 1BXRA 3HXMA 1PJTA 3QFHA 3AL3A 4IF4A 3RYIB 3WQQA 3T6KA 1QFJA 3RVBA 1LX7A 3FVQA 4AU1A 4YAOA 1FMCA 1VJ0A 2AA3A 2BI7A 1QYXA 1WTCA 3CUEF 2AJTA 2FDRA 3RU2A 1A96A 1L7MA 1NF3A 4RO0A 4KO4S 3ESAA 5DP1A 3LLSA 2A9OA 3P26A 1ZCFA 5DBIA 1FBTA 4TLDA 2A5GA 1B2LA 1HZJA 2REOA 3IAFA 5K8UA 3ESDA 3F46A 3PE3A 3A6LA 3OZDA 4BHTA 2B6HA 3DWGA 3FMGA 2E37A 1BJRE 3PUZA 3IKJA 2XB6A 4HNTA 4FDLA 3OUTA 3GCGA 4UHDA 4ZRMA 2YDXA 1V43A 5FFMA 2VHQA 4JLBA 1TZMA 2JBAB 4LOHA 2WJPA 1CUJA 3GEIA 1D03A 1L5ZA 2FE1A 3GV0A 3TBHA 4FDMA 1DBPA 2BYTA 2AHRA 2G63A 3T5BA 1NQXA 1FTGA 1OKKD 2G5GX 3E9YA 2C1XA 1NBEA 3H16A 4HNAA 1XMSA 3AFNA 1WHTA 3M6XA 3KJNA 4PR0A 3WXMA 2F1HA 2Z1DA 1DBSA 1M34A 2J6HA 4RTNA 3RRZA 4XFKA 2HDHA 1IZZA 5AM5A 3G5UA 4JX8A 1Y7PA 1B74A 5LP6B 4I1RA 1GG8A 2VPQA 4RZXA 2HYDA 1T1JA 3NYWA 5AJXA 4QPNA 2D5IA 5KEIA 3RE1A 1ORIA 2OQIA 3HDTA 4JL6A 2HCJB 3OIGA 3H75A 1PFUA 4COKA 3LE8A 3FNGA 5KJCA 2O20A 2XMDA 5K99A 4DB4A 2P4UA 2IE0A 5CLQA 1GTZA 1A8UA 1I0ZA 3D8HA 3WK4A 3EXHA 3U19A 3HO8A 1P1KA 1Y1TA 3B3GA 3CQ9A 1U0RA 3IALA 2H5LA 4NEQA 4Q6BA 4TSFA 4XGQA 2CZCA 5AIBA 5JV5A 3BMQB 3FVTA 4DRXA 2MJLA 3B3JA 4CLRA 1Y48E 2HR1A 2ZATA 3O75A 1KSGA 2M9MA 3FKQA 2X19A 3WLIA 3KR1A 4PXAA 1RACA 5EUBA 3O2NA 2IW3A 4ARSA 1CY6A 1PJZA 4IGAA 5HGJA 1FDIA 1ONOA 5DN6A 1VSVA 1QGED 1XI2A 1F48A 4GOLD 3ZPXA 4M1TA 3IESA 4KAFA 4ZQBA 4FEYA 4OSEA 1LQ2A 1UIRA 1QVAA 1Q1EA 2ZIZA 3DKRA 4R51A 5LB2A 4DAEA 4CLXA 3W05A 4N6OA 3A26A 1QUEA 5GOTA 1PGJA 3PDIA 2YW2A 4OA5A 3RT9A 2J9XB 2X4GA 4XVCA 1SUPA 2ISCA 2VPPA 3WP0A 1GU7A 2H85A 3E23A 1NJSA 3DTVA 1WDMA 3F2VA 4WL0A 3JQCA 2C5SA 2IY9A 3ABOB 3JRNA 4P31A 3V1LA 1BWPA 3MOIA 4OA8A 3SMVA 1NHGA 7MHTA 1A88A 2Z2ZA 2JANA 7AT1A 2ZRDA 3RC7A 3MHTA 3FCSB 4BJHB 4D79A 2QUIA 1H5QA 1N2CA 4KE8A 3ULKA 3FKJA 4GL4A 2X6RA 2AUTA 3KBBA 5JU6A 4JP3A 1XDUA 2YMQA 2GZDA 4DV3B 2QUHA 3AUJB 2HSGA 4F1JA 5C18A 4IX1A 5FR1A 3QG5A 1UDXA 3T5AA 3EQ7A 5LKRA 2MSDB 1GNTA 3D2LA 2NP6A 2VPIA 5KAMA 1JG2A 1OI2A 2Q07A 3KC2A 5CW1A 5LOVA 1PG5A 4UPEA 3TOZA 1IUOA 1WUJS 1NUHA 4WNCA 3F6PA 4MLDA 5DLDA 3FVRA 1ISPA 2ZJ0A 3FOWA 3AH8A 4LJYA 2NXEA 2ZJ8A 5TQ0B 3L0OA 3IMEA 2I4IA 4H60A 5HF6A 3O8OA 1E89A 2ZRQA 4AWBA 5KQGA 4ZTBA 1XFAA 2XGJA 2FZEA 1GR0A 2DPMA 3ZGYA 2Z6AA 3OEHD 3B52X 1PTJC 1Y5RA 1CQXA 2C29D 5ILGA 4YJGA 4ECAA 1VP3A 3LBIA 4LNHA 1YFZA 4R1QA 2BISA 2J0EA 3AJAA 2ZB2A 3DEJA 2AMFA 2IV7A 3AM3A 5JIBA 5EJMA 3I9OA 4IX9A 4Q66C 5FL3A 2P7HA 3ZE2B 1QFYA 2VHXA 1E7RA 1K5PA 2JFYA 4FD3A 4C30A 1I1OA 1R37A 1XQVA 3GL9A 3IR5A 4HYTA 5ALDA 5LQCA 3KQQA 3W1WA 1E0SA 1T1EA 1Z18A 4ROTA 3OKPA 2B8TA 2PANA 3NHBA 4O4LA 1HX7A 1I01A 1AXGA 2G40A 2VXBA 4J4HA 3ZU4A 2GO7A 3N6VA 4TT3A 4YPVA 3ZLJA 3IEPA 4ND6A 5IDVA 3PGXA 3OJWA 3GLVA 1R3UA 5K45A 4PX5A 5CK4A 1H5UA 1XSEA 4IICA 5I7AA 3AXTA 3UPTA 2H1LA 5BVGB 1A8IA 1YMQA 1DG3A 4GNRA 3M82A 2PBRA 5AKKA 1TYZA 3FJOA 3RYHA 1FC0A 1T15A 2PKYX 1A82A 3FDJA 1ZHFA 1H5NA 3G2KA 3IPYA 4HJXA 4V1CA 4RPCA 4WJZA 4R2HA 2ZTLA 3D54D 3DHNA 4HDKA 2BFDB 3K31A 4HWPA 3SFTA 4G3XA 4G1MB 2V8BA 4Q9KA 3UENA 2HFKA 1F4PA 5I9BA 2O8DA 4OXYA 1IWBB 3M6UA 1JLMA 5HILA 4AMBA 4DG5A 1Y1PA 3VC7A 5IKXA 4BP1A 1FBNA 3D31A 3HEMA 4RA9B 5EE1A 5EINA 5HEKA 3SYMA 1Z4KA 3WKDA 4EJSC 5IFLA 3OZXA 1YU9A 4ARBA 2AG0A 1IUKA 2I2DA 2XZTA 1V16A 3L7DA 4I5DA 2HHHB 3CNEA 3ECSA 4ZDWA 1K2WA 3B2NA 1KBZA 1U02A 3DEIA 1WJGA 3I0MA 4DGSA 4EKEA 3VKGA 1IFXA 2FKNA 1SMKA 4HQFA 1JBEA 1LC0A 4KFTA 3KKLA 4F4FA 3EZ9A 5K8TA 4Q3CA 4BVGA 4BO3A 2HGSA 4O2LA 5AT1A 1UMBB 4D8WA 3OJLA 1IL0A 3DS8A 4WZBA 2KBEA 3EPHA 1TM7E 5TPZD 1NSYA 3I3OA 4YA6A 2CWDA 1WB4A 5ADWA 5LYJF 1Z4LA 1YO6A 3IVRA 3JQPA 2FPGA 3PL5A 5T6BA 1P2TA 4IFTA 2V9CA 1HNZB 2C5LA 4G5SA 4OCZA 5T57A 4C78A 2H0RA 2XUIA 2QRVA 3CKYA 2FEPA 4I3GA 4A8JC 5F2OA 1O0BA 1IUPA 2DR0A 3LBHA 821PA 4BO0A 2B1QA 2ZT5A 4WVFA 5DM2A 3CLUC 4J49A 4P8RA 1NXOA 4R0NA 1R12A 1Q1GA 3IJEB 4E2FA 3KQLA 2NZYA 2NVUB 4YRFA 2C5BA 3V7FA 1ODSA 1Z2NX 3VI4B 1JTEA 3G0CA 3WB0A 4DCMA 1UL1X 1Z16A 1C0LA 3SK0A 3GLFE 1C7RA 2CVZA 3G2MA 2XH8A 4JXKA 1C8BA 1Y4DE 5C35A 4BNWA 3IL2A 3MS7A 3ZWAA 4AJPA 4PGMA 2C2HA 2QVLA 4NFHA 2PX2A 1AD2A 1RBMA 1W47A 3FHOA 1N8TA 3AB8A 3L7MA 3CO5A 2BC9A 1W87A 5JJIA 3G8YA 3IVCA 3ZY2A 5ERGB 1H65A 2PLNA 2R84A 4DNOA 2O1EA 2ZSFA 4EW2A 5M29A 2X42A 1IY9A 1MGOA 4FMPA 4KWCA 4R5HA 4XDZA 5D2CA 2FW6A 3TSZA 1A5SB 2IYNA 5I01A 3U3RA 1VBMA 4CCYA 4NONA 1Y98A 4CL0A 5BOSA 1IN7A 2F9FA 3VR6H 2HQSA 3OWHA 2P2GA 2RFLA 3PNOA 2P2DA 4S24A 1VJDA 3KFXA 2QTCA 1U3CA 2IEDA 3OCUA 2V4UA 5H7XA 4GBMA 3VI3B 3EFHA 1E6WA 1P7YA 4CCSA 2QTVB 3OQPA 3EEBA 2G4LA 3GHHA 4R68A 2V9ZA 4PZCA 2OD9A 1NYQA 4ZN6A 3PQDA 5A4KA 4CUJA 2ONKA 1LZLA 1A50B 1STOA 3PZBA 4RH1A 1LC3A 1MPXA 1P8AA 3P94A 1G3UA 1FVOA 2HDNB 2G9QA 4NDAA 4Q7EA 5A06A 3U5TA 2OFWA 3PPVA 3QTLA 4LJ6A 3GP3A 4NG4A 2EFGA 4EJFA 3A28A 2HCBA 2EAUA 1B7GO 1Y4SA 4FFPA 4IVPA 3CVXA 1GTRA 4LG1A 3UGTA 3C3WA 1E4VA 1LUAA 3GIDA 3QNWA 4KZPA 3LQ4A 3NDBB 4PVDA 1W36D 5LLSA 4K9LA 5AKEA 4HFMA 5B3JA 4YDSA 5LL6P 4ILKA 4LY9A 4ZICA 2NV2B 1AKTA 1SD1A 1W30A 2Y4NA 3E81A 4IWXA 1HRKA 1HYHA 4L75A 3L8GA 5JAUA 4RM3A 2J3HA 2GCGA 1XJCA 1BXRB 1EHYA 2WKQA 1XTSA 4TYPA 2XQVA 1U7UA 4AM8A 3FW1A 5IX8A 3PTLA 2F7SA 3LWDA 1A9QA 1IJBA 4B3RB 1W2WB 1KO5A 1YAHA 3RK4A 3RKSA 1ZAYA 1XG5A 1JEDA 1OLUA 4KW7A 3G5TA 3PTZA 1E1RD 1ZD4A 3DLCA 4GYKA 4NECA 4B75A 5CLJA 4JJEA 3KR0A 2FVXA 1MFZA 2A9VA 1VJTA 1DXHA 2HSDA 2X77A 3IXQA 4BO5A 4DDWA 4KR3A 3W6UA 2TMGA 3JYNA 5DHAA 2QUAA 5ESDA 3TZKA 2FEXA 3SBXA 5CYGA 2H52A 5D5QA 3U49A 3C6ZA 3WRWA 1PJRA 3TLAA 2WMYA 3EXG2 2NTYC 1ZCJA 4Y1GA 4B3DA 3RD5A 3REQA 3VX4A 4GM1A 3NTOA 3MS2A 3WADA 1A69A 2NPFA 1QYDA 3JVVA 2ZIVB 1ZSNA 3OTWA 1JECA 1ODIA 2O2XA 4M1EA 4A6XA 4BNHA 4EYQA 4HNAB 1WHTB 1XMVA 3STUA 4RPHA 1MLDA 4RY0A 1M34B 1GILA 1VB3A 2VYND 2CXRA 2ISSD 1HLDA 3DOIA 4PIVA 4RF5A 3TCKA 4JYBA 5E7QA 4F04A 3NDPA 1X7GA 1I4WA 4MQMA 2DEUA 4NOLA 3WGOA 3E22A 3PD0A 4KKXB 1RTKA 2HDWA 1TM3E 5CVDA 3WDLA 3LY7A 5EIWA 1P62B 2D3TA 4J1SA 1BU8A 4KSBA 5KWSA 1SOVA 1QIHA 4TTRA 4EF5A 2WYHA 2GEBA 4G07A 3OQBA 4DMUB 5A0VA 5JBQA 2YVQA 2C0CA 1IN1A 3QVOA 4QJ3A 3HA5A 2DBYA 2WD9A 3EXHB 5IEBA 1MDBA 2P1ZA 1XC7A 2JH9A 5CDTA 1D2NA 2QIPA 3L05A 1HLGA 2ECKA 4AG6A 4B3XA 1KFBB 3S4YA 2BGNA 2C9YA 4CLRB 4MV9A 4A27A 4MX8A 1A9ZA 1P2GA 4ENTA 4YRRA 3G0IA 2D3WA 5E6UA 3V4SA 3S2YA 1VPTA 4AIIA 1XTVA 4ENPA 4DR6B 1K4MA 3CRZA 3QUQA 1ZWLA 2QVXX 3ZZUA 2FPPA 5CNKA 1KTIA 2MSNA 3DFIA 2IZ5A 3M2PA 1NIJA 3QVGA 4LHEA 4IOMA 4LV6A 4QASA 5TJHA 5KWJA 1OBHA 1FFCA 5K6RA 3U9LA 4Y7DA 3PD7A 3SIWA 3UHPA 3DA8A 3GVXA 3PDIB 2C7QA 4G86A 5FOWA 5HZKA 3CLRC 4PNZA 1PUJA 2Y6VA 3DTVB 3LY9A 1HA3A 2IIBA 3I01A 1GY8A 1Q7BA 1J97A 4RV4A 4AFNA 3T7AA 4B71A 3WHKA 5HTOA 1O9BA 2OBNA 4A2WA 3DZJA 1NJ1A 3Q6IA 4ZODA 5L4SA 4HB0A 2WT9A 4MVXA 1XYYA 4YCNA 4Q18A 2ODQA 3DYBA 4TL9A 3OJFA 1N2CB 2P9EA 5CXSA 2DT5A 4DQLA 3T3OA 1V8ZA 5KYTA 3QNMA 4C1NA 3KXIA 1NVKA 3EARA 3I09A 1VGVA 3OM9A 4GZLA 4N12A 4YP1A 4Z0PA 1AK2A 1CR1A 5DVZA 5KTTA 3R24A 4QXAA 1MQ9A 2BE9A 2X58A 4RFVA 3HKDA 3GLQA 1JB1A 4ZZ0A 3ZWPA 3PC3A 1MXHA 4WRRA 4Y6LA 3HN7A 1T4GA 3RGGA 2ISQA 2KSQA 4M46A 4WFKA 1XA3A 1ZH6A 3NJRA 4P7FA 3TL6A 4DRYA 5H16A 1BJKA 4YMTA 3KQMA 5LOVB 1DEHA 2PGDA 1OZAA 3K09C 1OXBB 1GCUA 1O57A 1NQVA 1QF7A 1YRLA 2FR1A 2GA9A 2N0SA 2NT3A 3GCWA 4RY8A 2RHOA 5K51A 4MVJA 2WFAA 1NXTA 3S2ZA 2EVWX 3JVEA 4PLPA 1FJGB 5FCDA 2ZBGA 3FPHA 5F76A 3O8OB 3HGMA 5INTA 1B8PA 3G8AA 4JBWA 4D9MA 4F1KA 2P3SA 1FFGA 2JI4A 3H4IA 1WULS 1FE8A 1RRVA 1E92A 4YJGB 1KEKA 2EP7A 3F97A 3HH8A 1TZJA 4Q1EA 4F8JA 5FIUA 1P7PA 5H3CA 4GI1A 1C8VB 4L5JA 1XZIA 4X92A 2P0YA 2VZLA 5IF3A 3V6LA 5CX1A 1RP7A 4EY3A 2ZVDA 4P9NA 1QGUA 2CJPA 1I4DD 2HO5A 3NTQA 1ZU5A 5AK0A 3QJGA 2ZJZA 2HWXA 1XTRA 1R8YA 4L9AA 4O4LB 3H4VA 5DCLA 2DFKB 2CVQA 4P86A 3TD9A 1JIJA 3BHNA 1TF2A 3ZJ5A 1Y33E 2C4NA 3FNEA 3L01A 3UB4A 2NUAA 3IUEA 1JDPA 3OTHA 1RPZA 1DINA 2CV1A 3TSWA 2ZU0C 2PUAA 4IXWA 4XYEA 4FHDA 3OOSA 2PJZA 3AQ4A 4HR7A 1I7QB 2FFQA 3E18A 5IVDA 1BXKA 3X1DA 1J33A 3DEZA 3RYHB 4EPXA 1PZMA 5BRNA 3QMPA 1WXDA 1GFSA 2YVUA 4V1CB 3VNQA 1RC0A 1XF9A 3MUFA 1S2NA 3V7WA 4HDKB 5FOSA 3VKFA 1FDVA 3H8JA 4CF4A 2B36A 4J0DA 4FHFA 1P4GA 2ZYTX 2WJ6A 2P79A 1USVA 4RGQA 3AU9A 2QRUA 4ALNA 2O8DB 2EYQA 3H4TA 4IYRA 4CF7A 3DNFA 3I6YA 1PHPA 2GERA 2YUTA 2FSVA 5ICFA 3EVFA 4BB6A 4BFUA 5CHYA 1E32A 3ICEA 1Z29A 5CNJA 3CF6R 1V16B 3IAXA 3GVCA 2RG1A 2CNWA 4G1UC 3S40A 3C48A 2VNIA 4E07A 3ENNA 4LY6A 3KJXA 3AFHA 4URHA 1ONNA 2PZBA 1KY4A 1AOXA 2JARA 2Q45A 1M5RA 3A7DA 3A3PA 1ZNZA 2Q3FA 4QNNA 4BFYA 2VDRB 3F8TA 4BGVA 2CVFA 4I1IA 1UBUS 4MGKR 4WZBB 3ZHYA 2ZR0A 4LVNA 4GRAA 3TOCA 1UT8A 1WM1A 3H0KA 4JNCA 1NX9A 4C0QC 1B0UA 4R2JA 4TKZA 2FPGB 121PA 4DG9A 3KSDO 3WICA 5A4FS 3CR3C 1TJYA 1HYQA 2HEGA 2QRVB 2J5BA 1DMRA 1GPKA 2YH2A 1PSZA 2OORC 3KE9A 3U4HA 4W8HA 1D1SA 2MR6A 3WIEA 1E3QA 4G0VA 3R74A 3QUAA 5A3QA 2GXUA 2ARKA 3CFYA 3LT1A 2IS4A 2VNSA 2D2XA 4CTMA 1LLUA 3YASA 1PV4A 3C1AA 3VZDA 4D8UA 1KZ6A 5CA1A 3WIDA 2PV7A 1N7HA 3LFTA 3ACDA 4ZREA 1DCFA 1YDMA 3H97A 1U2GC 2LCIA 2HHAA 2V03A 3B6EA 3M2TA 2Q5IA 2AI3A 1WXXA 2WG1A 4OBXA 5HJ7A 1IZ9A 1G5RA 4FK8A 4OU4A 4S0XA 2VT2A 4RD3A 5TSDA 2FUNB 5LR6A 3O3OB 4MJXA 4FT2A 3CNHA 4JI3B 1KPIA 1B3BA 2G7MC 3FI9A 2C99A 3H8SA 4IINA 1GAEO 1L5SA 3W7VA 4NJOA 4GGOA 4C29A 1GYQA 5JPDA 5AMXA 1O96A 4F56A 3BJMA 4CCYB 3CUTA 1NA5A 1EIZA 3C3KA 3LHIA 4RJJA 2IP1A 2VRCD 2OQ2A 1XT6A 4BE9A 1JRLA 4L02A 2C7RA 1UXOA 3TRIA 1K7EB 4MNTA 4QTYA 4FYPA 1IE3A 3MJ4A 3HBAA 5HF9A 4DREA 3T1NA 1WDTA 3R09A 3TSCA 2IYWA 3R3UA 4KGXA 3H1GA 2J85A 5AVKA 2YN0A 1JQ3A 2VJDA 1XZQA 2ATEA 2BCEA 3K5HA 4RQUA 3AVWA 1M2FA 4MWDA 2YYYA 5IVHA 4HEA6 1N1EA 1UANA 4OM8A 3RPEA 1R5NA 3BULA 4A8PA 1FMFA 3V6MA 4S1TA 3M6AA 1A9TA 3CE9A 1OHHD 1FSPA 3EUEA 3PKJA 2X9LA 4KPGA 4EGCB 5CFOA 5AVVA 3WAGA 1J4AA 4ZYZA 2CLHB 4O59O 1LVGA 1QVRA 2QV7A 4L3VA 4ZVUA 3VR2A 2C03A 1SK8A 1SZCA 1YR3A 1SIBE 5ICCA 5KYGA 1WLSA 2C2GA 1NQOA 2OY0A 2R7MA 4JBYA 4P80A 5IAGA 1N0IA 1XDZA 4F3NA 5AH0A 1UOPA 4TV8F 5FA8A 5TC4A 3FLEA 1W2HA 3ZS8A 1L1QA 1E1KA 2XBLA 3OTGA 1TYDE 2QB5A 2VDQB 4PC7A 4NATA 1E1DA 1JQDA 1JXMA 2PS1A 2ZJ7A 1P1FA 1PL6A 2IBMA 1YK1A 1N36B 4IIHA 4IO1A 4QTZA 4E2XA 5IDQA 1WSBA 3G68A 2KQUA 2AMYA 5IAAA 4M0FA 2NIPA 4HNGA 1U4NA 1OLUB 2KW5A 3GGCA 5MN5A 3RCBA 1FU8A 1IG0A 2I55A 1KDVA 1Y80A 3ZWWA 1EFLA 1ABEA 1RP1A 1JQLB 2F64A 5LCXA 3DCNA 3WWCA 2QU7A 3F0TA 4RETA 4Z2YA 1JA9A 2XF8A 3LCUA 3MWGA 3ETCA 1PT6A 4IDFA 1IHDA 2QRLA 2VP6A 4GHWA 3TLYA 2WWFA 3VU3A 1GFIA 1G17A 3I01M 4HB4A 3REQB 5EZ6B 4N7JA 1NKSA 4W5QA 4BGDA 2XDYA 1TGYA 1X9IA 2NZ8A 3KSMA 4OKIA 3WYFA 1YQWA 1OFGA 2IK8A 1ZCZA 1QXSA 3M81A 5EIEA 2H0AA 2JFXA 4TSKA 4J6FA 1MW9X 1JJFA 2Z8YA 3HE3A 1GG2A 4WBSA 3AR2A 4TMZA 5FYQA 1KZ4A 1AB5A 1SC4A 4P5DA 3PICA 4LMBA 5JWHA 4HLDA 3UKJA 3ANTA 1GGJA 4JQOA 1PJ4A 3VOTA 3E22B 4W1QA 4C0AC 4ZXPA 1E9AA 2QYTA 4PG8A 4Q7QA 1FVFA 3OFVA 2WF5A 4KWEA 5KTNA 2PJDA 5LDGA 2ZQZA 4LDZA 3W8NA 3P9IA 2XQKA 4JB3A 4MRRA 5AUQA 3OJEA 1XZPA 3JZAA 4KX5A 4J0GA 3HUTA 4MVJM 1E2FA 1XRMA 1ID8A 2WIBA 1X8LA 3QUSA 3E7XA 4EA9A 2GWHA 5JMTA 5K4GA 1EP9A 1NSTA 1LS6A 4AJEA 5E6UB 3TIGA 5CM9C 1PSWA 2D2FA 2C57A 1R5BA 4D2IA 1EU1A 2FPPB 1WXIA 3MJRA 4ZU6X 5KJEA 1KZHA 4HT3B 3RLFA 2OZKA 3QVGB 3R6WA 4U0JA 5E8RA 4EGSA 5I9IA 4YRTA 2OAEA 3RJMA 1F4LA 4V3BA 1I9GA 4LYGA 4IVRA 3SXPA 3ADDA 4HLUA 4MUGA 2O7QA 3V42A 4KFRA 5A4MS 1PUIA 3RW9A 4M60A 2RHMA 2WIJA 3T0FA 1NLYA 1QDLB 4WLVA 1TB4A 2JJ1D 4X64B 4PHFA 2WNSA 1LBHA 4UU1A 2XMRA 4ZDJA 3LZDA 2G9NA 4OQEA 3EFOA 1W48A 3E3NA 3AILA 1Y9JA 2IU6A 1JG1A 3QTTA 4HPWA 2OO5C 2PS0A 2VDLB 4LYJA 4W8OA 3ZK8A 4EZBA 4D3ZA 2NU8A 2DPYA 1FMTA 4OMDA 3AIOA 2WSSA 4N1AA 2FJPA 3SX2A 3UH0A 3TS1A 4E3WA 4Y98A 1N5JA 1Z5VA 3JPYA 2ZE6A 5KB3A 1TKRA 1Q74A 3AIMA 4GI5A 1OPRA 1LU9A 2WFZA 4HRAA 1ND5A 3TXYA 2XPCA 3TK1A 3WBFA 1X1BA 1NC3A 2DSNA 4DMMA 1XEWY 4LZZA 1CUWA 4EPYA 5LWQA 4RTMA 1AJEA 1EH5A 4C20A 1JPNA 2WTEA 3AJRA 3C16C 3IDOA 4HPJB 4JNKA 2FYTA 1HEUA 4Q37A 4RCZA 4V38A 2D00A 1X2BA 3S70A 3HABA 5EFOA 3AKYA 1W8DA 4UULA 3HKDB 2BHNA 3EPLA 4JJFA 3N86A 3ZGXA 2OV3A 2A6PA 1ETHA 1PSDA 3QU5A 3GDWA 4V24A 2HLDA 1HQYE 1T9HA 1U2QA 1Z36A 3M70A 3COSA 3TAHA 4CM5A 5ALEA 3KKEA 4DJAA 4LZJA 3HCAA 4RZ2A 3VPDA 1AQNA 1WE2A 2Z9DA 2VJMA 3P2KA 2VZEA 4TMVA 3ZU2A 1V1JA 1VCIA 4EY5A 3MWEA 2W83A 3ZJ4A 4PYJA 3HL4A 2FLKA 4O5OA 4B0OA 5I7SA 3LKZA 4FZ5A 5H68A 5EIFA 1ZMRA 1NW8A 3SXJA 3ER6A 1U7OA 1SQSA 1ZGAA 2Q9BA 4BLTA 5AICA 5HF8A 1T2NA 4Z3DA 1E64A 2C1ZA 5KCZA 1SKYE 1RQ7A 2JJ2A 2PT7A 3F7OA 2E4VA 3GJ6A 2R8ZA 3LFHA 3MMSA 5FPHA 5FI3A 1G2OA 2D1SA 2HK6A 2Q9CA 2EYUA 5BV0A 3KYCA 5KWIA 3ZD6A 1GT91 2VS1A 4CETA 1J7KA 1YMVA 5DTJA 5FWNA 1DBVO 4JT8A 1LK0A 5CX1B 2GD2A 4JOQA 3LIIA 3MSCA 1QGUB 1XGKA 2J0VA 1G2PA 4PSAA 5BUZA 4MI3A 1AO3A 1TO6A 1Z7YA 2LXNA 2OCPA 1XNGA 2OILA 2X1HA 1YT5A 2IOQA 3QLUC 3QU4A 4YUVA 1IBKB 3DOEA 3WGIA 1SQ5A 2YCBA 1NVVQ 2R25B 2X1MA 3C43A 4LEIA 4ZQFA 5H1YA 3VU0A 2J0SA 1A8QA 1W34A 1E7WA 2BELA 4XD7A 4R41A 2NUAB 2OENG 4EPWA 4LXTA 4K26A 4RMJA 1MA3A 1G7TA 3HP4A 1N2JA 4E6PA 2W2XA 2WYIA 4HHEA 4OI0A 3PVZA 1JJ7A 4YV2A 2H59A 1A71A 5BY2A 4B6QA 5B37A 4BLOA 4MS1A 1NBME 1ZVKA 1MVOA 1KQPA 2GZHA 1SC6A 4QOFA 4UBOA 1W2GA 3FWKA 3FHJA 1PNTA 4B4OA 1E6EA 1W49A 2XD4A 1CQPA 4IIJF 3SE7A 4HVLA 5F64A 3B2QA 4FIZA 4CU2A 2OCGA 2YHIA 3DXZA 4GICA 3WJ7A 1V37A 2H4XA 2PBFA 5C1OA 4KXXA 5DCWA 1XPUA 2APJA 4LSGA 1UCFA 4P6VF 1JHYA 4D9GA 3S2UA 3CKKA 3JD1A 5JJKA 4RA6A 3I0NA 5H59A 1F20A 4ZVNA 1U2ZA 2YASA 4FNAA 3QW2A 1QK3A 3F5QA 3PITA 4WSOA 3SAJA 3ONNA 1ZVVA 2HA2A 3DQPA 1O0SA 1Z0FA 1Q11A 3DMNA 3FDIA 1WOYA 4KDRA 4LXYA 4XWGA 4PCAA 3CLHA 3UB2A 1H1DA 3ORFA 5C8YA 1H2BA 2Q5EA 4JAVC 2V5VA 1N8NA 4NBSA 1FVHA 4BLVA 3MFYA 4KQXA 4YACA 3DW3X 4ZAXA 1MGPA 1TYAE 2I1LA 1K6EA 1UOQA 4Q1BA 3FMFA 3O2QB 1ZGZA 3EZFA 3GW8A 3RARA 3L0YA 2V9PA 3WIOA 1YR1A 4II2A 2FCAA 4EX7A 4E5YA 1GUZA 4K88A 4W5JA 1FTWA 2FR0A 3ETEA 1A8SA 3FM9A 2QM0A 3GMIA 4A2CA 4K3VA 4XYGA 1WOMA 5DYYA 4CKBA 5ECGC 1YQUA 1AKYA 3HXKA 2B6NA 4Z4IA 2QMEA 3VVLA 2JFBA 1Y9DA 2MDTA 3AGPA 2UVPA 2XDAA 5CA1B 1WBJB 1MOSA 3H6HA 4XQCA 1AUVA 2HC9A 3F1LA 4RVHA 3F78A 3HCFA 1KTVA 2XGMA 2YMPA 5CBPA 3T34A 1KO4A 1IVSA 2GN1A 1ZD8A 2W5UA 4C0JA 4TPKA 3NB0A 1CU1A 1X7XA 1W0JA 4IDBA 4NBKA 1MRSA 1B93A 4HLNA 2QOEA 4U2KA 5CD1A 5AUPB 1ADYA 4GKJB 2O05A 1JYSA 2JASA 2JCSA 1GGNA 2II6A 2ON6A 2AG5A 4NG5A 1JTFA 3T9BA 4DEVA 5IKEA 5JO0A 1O96B 1NJ6A 2QL7A 2R7KA 1L4BA 2B5WA 1YR7A 3M6VA 1UZAA 1IBCA 1W4AA 3ON5A 1LA2A 2OO7A 3PFIA 3QEMA 4DDTA 2QQ0A 1HFWA 1CNFA 3L6EA 3VR5A 1IWPB 3CXUA 4QGSA 1EWVA 3SF0A 1UK6A 1TK2A 3G7UA 4BEBA 3OF2A 4TKLA 3WDMA 2ZZMA 3W6ZA 4ILEA 1G9SA 3I9JA 4GXQA 4CN9A 5EZSA 4NBWA 1GQOA 4MIOA 3ZLTA 4DCJA 3TIIA 1U5BA 1E7SA 4TMYA 2Z8YM 2XCOA 2ZJ4A 4MUKA 2PMBA 4YRBA 2IYUA 3V2GA 5IMBA 621PA 1O54A 3U4AA 4DBLE 2YKGA 3H84A 5HQJA 2X0RA 2SNIE 4G4SO 2DU8A 2V55B 3N0VA 4DR2B 5KNCA 1SCJA 4OHVA 2E0IA 4PLHA 1E2IA 2O5RA 2QMYA 4R01A 5J43A 3DLHA 2AN3A 4FSDA 2AD1A 1R7RA 1QWSA 2Q6LA 4YXWD 2B8NA 2JGLA 2QJWA 4BJ1A 2PLWA 2RGWA 4KKVA 3UA4A 4PAGA 4LWPA 3KPWA 3VSDA 4BMVA 1UJ4A 2FK8A 1NJFA 2FMXA 3P4UA 4YP6A 5CJJA 1PEAA 2G4CA 2I4OA 4PC1A 2R60A 1WQ3A 1Y9ZA 3K94A 4NV3A 1H4VB 2PFKA 4P92A 3JQ6A 3OQVA 4F97A 2AOUA 4JASB 5DRTA 4L85A 2EZUA 1ZH4A 4V0MA 5DGCA 3PUXA 2FPKA 1DKNA 1XEFA 1J8MF 2BL4A 2NTJA 1KVSA 5LPNA 3V00A 2HQRA 2XMPA 4DPMA 3WRVA 2AHOA 5COBA 2ZIFA 4UTOA 1ISSA 4JROA 2XMCA 4M9UA 1UC8A 2Q6IA 3L8FA 1I2DA 4MWSA 1WUYA 3AEYA 4P36A 3BDVA 3K30A 2ZAIA 3DOJA 2BJHA 1XK7A 3A9SA 1R15A 2QPOA 1E63A 4DAOA 1CWUA 3L4BC 1WW3A 2JB9A 3U62A 1Q0QA 3CJQA 4QGAA 3ZX5A 3IT0A 4QLOA 4C5CA 1J2RA 3PQ3A 5DWVA 2YJGA 4ANFA 1CJCA 1SQFA 3D8RA 4Q4LA 4F5EA 1IATA 4ATNA 3BTUA 3Q3CA 4MR8A 3RT1A 4HFRA 3ROGA 4D97A 5B3AA 3ZX4A 3ROKA 2QORA 4OSOA 4DHEA 3N0XA 4KLZA 3HYNA 2GNPA 1WP4A 4ZD6A 4EGQA 3ZGOA 1ZEJA 1MFPA 3MPOA 1QRSA 3NGLA 1G59A 1P4SA 2ERCA 5KOIA 2A0KA 1OXMA 1JG3A 2SCUA 3AR8A 1M0SA 5L95A 4H0FA 5EYPA 3WMWA 3Q85A 4JEIA 4AMYA 5KQLA 3D7SA 1AK1A 3UK1A 2NPOA 4K3UA 5C31A 4CT4B 2QPAA 5KOHA 3M49A 2V7PA 1SBNE 2GCNA 3QV1A 1Z2DA 1BGWA 1JNXX 3ED5A 4OVKA 2B30A 3VHLB 1EVIA 2QDKA 3NTUA 2QTTA 4EKYA 2UZ4A 1OBCA 2WVJA 2V7WA 1XHEA 2XOXA 3M9LA 2MYNA 3UV3A 1JDBC 2QIOA 2GM3A 4QARA 1LY1A 1OASA 1M2NA 2VBFA 1T9DA 1YIOA 3KYJB 4I5EA 5BSHA 3TVTA 1ZIYA 2Q4OA 3CW8X 2IPNA 1HNXB 4FWTA 5IBPA 2FZGA 2A88A 2HHJA 3CPJB 2IOHA 3GFRA 3HU5A 4FGWA 1N75A 2DR2A 1J23A 4I0WB 1YDWA 1UDCA 3ROPA 1NF2A 1G8KA 3JQBA 3ENQA 1J2UA 2IDZA 2CL7X 2NV0A 2QQGA 4YC7A 1VHQA 1PIWA 5DSXA 3UW3A 4R7GA 5BYKA 1RKBA 2O3QA 1V5GA 1O94C 5I7OA 3LUFA 4E7OA 2B2XA 5H0IA 2YY6A 1UDBA 4WKNA 1MVLA 2Y9PB 2ZUVA 3CVJA 4J0CA 6LDHA 1Q2UA 2R5NA 3EFOB 3I4FA 3I58A 1P2VA 3PXCX 1QQ5A 1Y1SA 5EESA 3ZBTA 3LZCA 3VSCA 1P5ZB 1U8EA 3KKZA 2NU8B 1UBFA 3E1GA 4R40A 3P2IA 1JIQA 2X2EA 1KJJA 2CUNA 4KXWA 3RS4A 5K0GA 1CVLA 5CFLA 3QIAA 3QBTA 1G19A 1OFHA 2BKAA 2ZYUX 5KQMA 2GARA 3ZHXA 1TIBA 2CLSA 4XQEA 3ROZA 5FBKA 1SIOA 4IDEA 4HS4A 3WNQA 4H6XA 4WKBA 1H0SA 1DO2A 2EWMA 2P30A 1CIJA 3UMMA 2VUTA 1KXJA 5LU9A 2H3EA 3D1LA 4P3XA 4C2TA 1OGYA 3KZ1E 4RESA 3GLSA 3KAJA 5B7QA 5HWSA 2GD6A 5JXIA 1L5WA 2VJMB 3A8TA 3KB6A 3MWEB 3FZQA 2CC2A 3OCXA 1PG2A 3NHAA 3K9FC 5CB0A 1AUXA 5HS4A 3BORA 3NV9A 1FP6A 4C5AA 3OJXA 9ATCA 4GMDA 2BUCA 1E5QA 4R9NA 4HSEA 1M6HA 5EJGA 3QYAA 4BJ5A 4IIGA 3SSNA 1FP4A 3KYCB 2PSSA 4Z86A 2WJYA 5KYKA 2OXCA 2ZTHA 3RYCA 2FSUA 1ZOPA 4A0SA 2W4IA 5FL7A 5LD2C 1T5BA 3LUKA 4TWRA 4IJVA 4Q4JA 3EB9A 1U65A 2ZRGA 1F2UA 1C3LA 1QNFA 2AI1A 2BEWA 1SCUA 1P0MA 1PNQA 4X62B 3K9HA 1DS6A 1RU3A 3NHFA 3W2GA 521PA 2NZJA 1V3UA 1GARA 2GFQA 3SZUA 1Q2XA 4MWTA 1SH7A 1KXZA 1VHJA 4L78A 4RACA 4TXLA 5EKSA 1E2BA 4WK2B 4F85A 2XAAA 5HOEA 2FFHA 1Z0ZA 3DL4A 2WV9A 4JR2A 3DC7A 2WWWA 2FPXA 5IDXA 3ZDZB 4YAUA 3FUCA 5AW8A 4E09A 1N78A 4MS1B 1ZUIA 3S2GA 1PS9A 4FN4A 5ITWA 2XUQA 2Y2VA 5JATA 1J2JA 3B3FA 4P4GA 5LYJA 2P3OA 3CB4A 2KWIA 2V59A 1L5VA 4YJFA 2FSFA 1V11A 5BWLA 5FNVA 5TE9A 4IQ8A 4MPJA 2YHIB 3FXAA 2BFPA 3O2JA 4U5XA 3HXTA 3IMKA 4PRZA 3UCXA 4EI7A 3KSAC 4GMXA 2B8WA 4L72A 2DECA 2ZYWX 2JS7A 4ALKA 4JJIA 4GQIA 5DYWA 4RA6B 3UEOA 1FF9A 4UBMA 5A04A 1REQA 2PCLA 1TA4A 4Q34A 3O7MA 4U5QA 5J59A 1YQTA 5I7RA 2H1RA 3QBJA 3LUHA 5AKIA 5FHQA 2CXOA 3RHTA 2MT9A 3KKQA 5G3YA