5LQSA

Structure of quinolinate synthase y21f mutant in complex with substrate-derived quinolinate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
303
structure length
303
Chain Sequence
HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAMELSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREYREKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDRNLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPECPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDREFVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFELMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinolinate synthase A
publication title Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
pubmed doi rcsb
source organism Thermotoga maritima msb8
molecule tags Transferase
total genus 117
structure length 303
sequence length 303
ec nomenclature ec 2.5.1.72: Quinolinate synthase.
pdb deposition date 2016-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02445 NadA Quinolinate synthetase A protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA02
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA03
3.40.50.10800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NadA-like 5lqsA01
5KTRA 1WZUA 5F3DA 5LQSA 5KTMA 4HHEA 5KTNA 5KTOA 5KTSA 5LQMA 4ZK6A 5F33A 5F35A 5KTPA 5KTTA 4P3XA
chains in the Genus database with same CATH superfamily
3GLHB 4L5CA 2HGSA 1CJCA 2NSLA 4D74A 4LUCA 4JA0A 2JA1A 2AKAB 2NUPB 3GGCA 3EVNA 4O4JA 4CMKA 1KDOA 3PXGA 3OMLA 1TW2A 2K87A 2WAMA 3HWRA 3R3UA 4BEBA 5JI3E 2VTBA 1USIA 3LP6A 4UTNA 4MQLA 2DY1A 1LDYA 2IP2A 2QLMA 1R4MA 3HLKA 5EUQB 4CFZA 3F3YA 2FW1A 3HYCA 3OO1A 4LWOA 3MT0A 2VT7A 2ZS7A 1E3WA 1Q3HA 4Q1AA 4EEKA 1NVBA 3DMTA 3AERA 3U48A 1DKMA 2AEJA 4NJEB 4H4EA 1XDWA 4RD4A 3W2EA 3NDPA 4LOKA 1FP6A 3DZ8A 3T3DA 3AW8A 4LE1A 5MN5A 1T26A 2PXXA 4KXLA 1R9JA 3GF4A 5B1SA 2YQ4A 2DVMA 2IV7A 4FEGA 3DA8A 1QVZA 3KL4A 3ZWMA 3ZE0B 4BFCA 1ZGJA 2YZGA 3CF6R 2BISA 3V1YA 1IEWA 3PQ3A 1PX2A 2PR7A 1DZIA 1L8LA 3I5UA 3U3KA 1KQ3A 3VVBA 1ZK4A 2PWPA 1T3SA 1SVIA 3WDKA 2PMWB 3KLPX 3EFOA 1KZYC 2H7YA 4UFNA 1VRCA 4QA9A 5BN4B 4JLAA 4EH1A 1Z8HA 5EEHA 2IRWA 1DC6A 3QVGB 2HD4A 5IAGA 4TVSA 4CM1A 1Z4OA 4H16A 3SQMA 3HI6A 5CLLA 4OVKA 1W8DA 4P81A 4AC9A 1PL0A 4CMCA 1SG0A 1CUSA 2GHTA 2RIPA 1FBNA 4PYKA 2IUFA 5E8RA 2XNCA 4NBLA 5LB4A 3TPCA 1KI4A 2AXNA 3DO5A 1QIGA 4JD5A 1M83A 4OQLA 4Y9RA 5B4UA 1UMDB 4KAFA 4QJBA 4ALJA 4EF6A 3ZLVA 3PC8A 3D6AA 4DT1B 1QFMA 1XVVA 3HJNA 4QYIB 4EW1A 3W2FA 4BE7B 3LS2A 4JLSA 4I6JA 1MEJA 2V4MA 3OT1B 4HNQA 3CZ5A 4RZQA 5LYJB 4MDFA 2X1LA 1PJSA 3C4JA 1ZWLA 3PUVA 3I37X 4DSAA 4D79A 1NVKA 4L74A 1K6JA 1SM4A 3L7AA 1R15A 1XD2B 1A95A 2VG8A 2NT4A 3IJ5A 3ILYA 4PYRA 4CU2A 4DY6A 3B1JA 1VJRA 1I5EA 1B1CA 1XTVA 3GEBA 2DR3A 1H42A 4PCUA 3E5RA 4KBFA 3U9LA 3A28A 1T4CA 3GROA 4BIMA 4X62B 3HJFA 3IAFA 3E05A 2EHJA 5JLAA 2GM3A 2P9TA 4HATA 4LF6B 1BEUB 5K8LA 4GI5A 2JJQA 4G5HA 4HGQA 4FW9A 3HABA 4UXJA 1S02A 4COOA 2AOTB 4HPWA 1BEZA 2R2AA 4KO2S 2UXDB 1XHFA 3ZWQA 4INAA 3T5TA 1I13A 3D7KA 1JR3E 5KX5B 2AF3C 1YDHA 1BRTA 3LY5A 4F4CA 1IAVA 3IESA 1IEVA 2DH6A 3AVOA 3EJWA 3CX4A 3OPQA 4YRAA 1GZ3A 4RHUA 1G8HA 5MHTA 4EAAA 3QKRA 5CPBA 3VAYA 1ZXBA 1EK2A 4H7EA 3GEPA 1UXJA 3H6HA 1A4RA 3I6YA 2Q46A 4F91B 3OJLA 4J75A 1QXSA 2WJWA 4I50B 4QUAA 2IEAA 4JJZA 1FRQA 1J42A 1I3OA 2PD3A 5HWSA 3OX2A 3QA9A 4XSGA 1PT8A 4R8KA 3N3AC 1MOSA 1WVGA 3GJ3A 9LDTA 1JXAA 3B3JA 1P3JA 5G0VA 5G4KB 4XEUA 4JSTA 4IX9A 3UMVA 3VDMA 4UTPA 1H3EA 5EWMA 3I23A 2WRZA 2B4RO 2GAAA 1NI5A 3R7LA 3AR2A 5HZMA 3TTSA 3Q9NA 3OPVA 5FWXB 2IIQA 1BKYA 1MVLA 4Z4HA 1PW5A 3EVTA 3QXXA 1N9GA 2WOOA 4RLFA 2IPXA 2WIDA 3K4HA 2P2LA 1E69A 4PSCA 4PZZA 4DIUA 2H85A 4UFPA 1K63A 4GLBA 3E9QA 4Q00A 3I92A 1YDGA 4U7PB 1M1YB 4UHEA 4M7RA 1WW2A 1CQXA 2L69A 2X77A 3DD1A 4HF7A 4L95C 4JJGA 4ND4A 2PU5A 1ZXLA 3OJOA 1DO0A 1F0NA 2DBVO 4RM2A 3ROTA 4P4UA 5CDGA 2WM8A 4CODB 3LGAA 2PQ2A 2G09A 4S1VA 2XITA 1QDEA 4ZRNA 1RVV1 2IWRA 1NF8A 2O3QA 4UEJA 5L3SA 2O5EA 1D2AA 3HO6A 1Z4NA 2CMGA 4NATA 1GLVA 4WLFA 4TTRA 5IKEA 2GEKA 4BAUA 5JCJD 3CG0A 3AP1A 3ESYA 1AMOA 2GAOA 3K5IA 1K7SN 4Y2UA 4BNGA 1GL6A 1V8ZA 4EJSA 4Z4GA 1P61B 3A6JA 3CF4G 2Q7DA 2GBGA 4G5RA 5IAJA 2F4VB 3FYHA 3D9QX 1V35A 5EE1A 4F6CA 4DARA 2N42A 1QOQB 3GCWA 3X1ZA 4OHVA 3L77A 5I5GA 5LUBA 1RI2A 4ED9A 2R8YA 1J4AA 3EIUA 2OXTA 1UMBA 3LUKA 2PWYA 4KLRA 3I0MA 4LJ7A 4TTTS 4D8YA 4MDEA 4M0FA 1F8FA 4JC0A 2X8JA 3IX7A 3OZVA 5BRNA 4CI0B 5JALA 1E5TA 1S9HA 1Z3IX 2H9AA 3E4CA 2VNHA 1M33A 2A84A 3DYIA 3JYNA 1ETUA 5H3HA 2O2JA 3SZLA 4B47A 3HXLA 4HWKA 3RFTA 4BZZA 4F97A 5HILA 3LX8A 3E61A 4P4LA 3UT5A 3OQBA 4RU1A 3C70A 4RAQA 5J2UB 2Q6TA 1C9YA 4UD2A 2GESA 4NQRA 3ZHQA 1X7XB 4MK4A 1QO9A 4OL0A 4J0GA 4DCNA 5LYJF 2XXAB 1T5BA 4PM4A 3TQCA 1G20A 1OWOA 1X1TA 1T8YA 2J5RA 2WF7A 3N6XA 1XCJA 5JARA 1JXMA 4U7WA 3E9CA 1JH9A 1FQOA 1DUIA 4FC6A 3EA5A 1UKEA 2PT6A 3LBAA 3N07A 1P5HA 3KB1A 2H4JA 3LKZA 3PXXA 3LPAA 2R4TA 4FLFA 1L6IA 4X6LA 2UYCA 3TL6A 1XLVA 1T8WA 2QZSA 3M5PA 3SZOA 4TYNA 5IBRA 4M1MA 4EB8A 4UPVA 2XT0A 3RVSA 1CY4A 1NW5A 2FQ1A 3MXTA 4ODIA 2IHUA 4B7CA 1FRVA 3C3EA 1KOLA 1T3HA 2FSIA 4CIYA 3RK0A 3SD7A 3IEPA 4WD3A 4C6TB 3EN0A 3MOGA 4IRMA 1MT0A 2JGFA 1E3TA 2R44A 1GRNA 5AUPB 4LFAB 2EEPA 4WHMA 5IM5A 1BX0A 4RF4A 3BJEA 4QECA 4XDHA 3U44B 3D1VA 4XJSA 1RHJA 4DV4B 4ZZ0A 4ZZ3A 5FPKA 4JNKA 3T7RA 3CMCO 2RMKA 4ERXA 1OFUA 4UVDA 2P8SA 4X7BA 4ZVOA 3CEJA 3O4GA 2H16A 1IBKB 1K5DA 1P44A 2A5LA 1SUEA 4I50F 4OMDA 4ALKA 4IIJB 2IXEA 2VWPA 5SY9A 4F1KA 2ODWA 1GT6A 4ZGBA 1P80A 2QMUA 3O8CA 5AIBA 2NU7B 5DF1A 2JJYA 2ZP1A 3MWYW 4ZIRB 1N5KA 4KNYA 3RG2A 4ICIA 4GVXA 2SCUB 2WVAA 3JATB 4HAYA 3L8YA 4HRAA 3B5EA 1G18A 2WT9A 4RXTA 4PYLA 5HCUA 4D3ZA 1EX7A 4BJ1A 5BR4A 4BXOB 4GUDA 3AUKA 2POCA 2NVOA 4LCEA 2VEOA 2YDYA 5F64A 2VS1A 4X45A 5JC1A 1NM5C 1FJXA 2VHXA 3LSTA 4H4DA 4HN2A 4FWIB 3RIXA 4CEIA 1LA2A 2XF8A 2DRIA 3OTIA 3DOUA 1NVUQ 4O4LF 2PRIA 2P6MA 3GLGA 5A5GA 5T6MA 1E1MA 1QTIA 2D3WA 1UPXA 2IQ5A 3BWCA 1PEKE 3HKEA 2J45A 1EP3B 1O96A 2CFTA 1NDQA 4FYHA 4C0HA 3HB0A 3FNHA 2GPTA 2UZ3A 4ZI7B 1L4HA 4BZQA 3M6IA 4BX2A 1C30A 2EP8A 1X9IA 2C61A 4KO8A 2QTCA 2PS9A 1R4NB 4PV7A 4QQNA 4CL8A 2QUAA 3U7QB 2B1QA 5LWHA 4Q37A 4QYXA 4BMSA 4UULA 5MN6A 5JJBA 3E9RA 3ZX5A 1HUQA 4MJLA 1QG2A 1E9SA 2OGSA 3PR3A 4OUDA 4D0LB 2DECA 4GVPA 2JZNA 1SOVA 4BX9A 4RHYA 3EWNA 3QM1A 3KTFA 1BC5A 4RHCA 2FWBA 1ATZA 4E32A 1RTTA 4EABA 5CH5A 3PDJA 3E1GA 4HVLA 3L0BA 1B6SA 4JJFA 3BD9A 5CDTA 3L07A 5IDXA 2V7WA 1RYEA 2YJ4A 3ZHRA 3WNZA 5LZ5A 2G04A 3ROKA 4CT0A 1RXYA 1VE9A 4XGNA 2PUFA 4OMFG 1WZEA 1NT2A 1Z2PX 1BVRA 1IQUA 1DT5A 3HN2A 1G7CA 1VI6A 4MS1A 2ECQA 3FMPB 3ER9A 5IASA 2VHYA 3V7WA 4LXUA 3SXUB 5FUMA 3OQJA 2QQGA 1KIFA 4Z7JA 1NHGA 2ORVA 1FNSA 4D81A 3HM9A 4RENA 1U5BB 9ABPA 5TS2A 5CR9A 3K3PA 2GWRA 4BNVA 3PDIB 4MVJF 2HYDA 2H2WA 1AUQA 3A7EA 1PW7A 4MLZA 5A3VA 5EJ8A 4G4JA 3VTFA 4PLGA 5LD2B 5B2EA 3D3WB 2Z6UA 2A7QA 3BHMA 2H18A 3N0VA 4H6XA 1PK7A 4X1YA 4ZK2A 4ZAYA 621PA 3OPXA 3KL2A 4LZWA 1TCVA 1U28C 4PLVA 5JEDA 1Y3IA 2HJWA 3HVHA 5DXFA 4D9NA 2OHGA 1EUDB 3R6WA 3ND8A 4MQFB 4P7BA 3FUUA 5ERGB 4W5NA 4LMBA 1RWVA 3HU3A 3AG6A 4BN4A 3GRYA 2PMKA 4R8RA 4GKJB 5CIQA 1ZI8A 1EVLA 2NZ8A 4FOTA 3TS1A 3VDRA 1U7OA 3ENQA 3GJ8A 1LPOA 4RH0A 2XOKA 5GGXA 5FR2A 2IZ0A 1NVAA 4KZKA 3JYPA 4Q47A 3HY6A 1Z35A 3KSMA 2HJSA 2NXCA 3PXBA 4H7IA 4KXNA 5AM3A 3WL5A 4M1TA 3GHYA 3LUFA 3I8SA 3P94A 5JSZA 1E1RA 2JHCA 1T9KA 2JIOA 5AW7A 3LC7O 4DLLA 1P7ZA 4K88A 3KVYA 2W00A 3PV0A 4Y9SA 4XLTA 2Q29A 1JVSA 2H1CA 1CR0A 2BKVA 4IIJF 1GGVA 2NO1A 1W75A 3NXSA 4YNBA 3LXRA 5LXTF 4DUPA 5BRAA 3CVUA 1H8HD 1K7FB 1RPTA 3NC0C 1E5QA 5JZBA 4BNYA 3OMWA 4HKTA 1KKUA 3OEEA 3P9ZA 3DWEX 4HFNA 4WZZA 4FINA 5KNBD 1A8QA 4IIFA 5THKA 1NY5A 1T3GA 5A9TA 2C8VA 3NGLA 4DRZA 2CL7X 3X0DA 1KYXA 5BO5A 4CWAA 1FRFS 5HKLA 5A5VA 2G77B 3FMOB 3FZQA 2CV2A 2FJUA 2CVPA 1E94E 2DGDA 1UMCB 1P1KA 2J5XA 4CKEB 4ATNA 1U2GA 1HYGA 5J4LA 1TEXA 4M21A 1C7EA 1KEVA 4OLHA 2CLLB 3ZWPA 2H4ZA 4K2HA 3V7YA 1V11A 2OESA 4NFHA 1RRKA 4K28A 1B6RA 3I2FA 3QE2A 2H1OA 4ZI7F 4RW0A 3FWZA 3ZI0A 4LZAA 2CKMA 1DKUA 2A0KA 4AP6A 4RY8A 4I9NA 3R3WA 2GEVA 3K2EA 3MAJA 1GYRA 3QI2A 2R6DA 3A9WA 5E6SA 2AJBA 2WV7A 1V45E 3BJIC 1RT9A 2HKIA 4ABTA 1X7DA 1T9CA 3HR8A 2NUTB 4JLPA 3CVOA 1P9LA 3CM0A 2Z08A 1JLRA 3EWIA 2HIHA 3PQCA 2M6RA 3ZGXA 3AKCA 3R0VA 4EL5A 2ZUSA 4N7MA 4TKMA 3ZQ6A 1UM9A 4BTEA 1W4ZA 1XEXB 4IDDA 5KDOA 3G17A 4GSLA 4CM4B 5NULA 1XZGA 3NBFA 1TK2A 3RIGA 2ZQYA 4RFVA 1KK2A 2CXSA 1KDRA 1KXZA 1HYBA 2QRLA 2WF5A 2D5BA 3FAZA 3O2QB 3OURA 1YJXA 4HAUA 4IGEA 4TYPA 4BMVA 4F2HA 3GLHE 1DFHA 1KJYA 4D46A 1E3DA 1DRWA 2QVYX 4IWNA 4A92A 3CXRA 2P6OA 1AQIA 1ZR2A 1TMGE 1TO1E 3P0IA 3P19A 2WWWA 3DTYA 4A5SA 1SGWA 1K3FA 1PSWA 4N0QA 5TGTA 5IDQA 1CNFA 1OUMA 5JR3A 1OU0A 2QE7D 4NMXB 2J3KA 3FPKA 2VLBA 1QWOA 3GVCA 3OIFA 4HDAA 1D3AA 4OQDA 3SJBA 1YB5A 1UBUS 2R5NA 4TWIA 3RHZA 3DOFA 4B0PA 3AIOA 5JS7A 5JQGF 2RBEA 1OFIA 4L4ZA 1KWGA 1HI9A 1Q1GA 2Q62A 1YF3A 4EQ6A 2Q1TA 4DILA 3OQ1A 1SJ9A 4O25A 3SGLA 1C8BA 1QSGA 4O4HB 4ER3A 3TW4A 2XB2A 4K3VA 4E70A 1HL3A 2XZLA 1ULSA 2ZSIA 3DTVB 4R8VA 2VPYA 4BWVA 1L8OA 3CT4A 1KYIA 1ZI6A 5F2KA 2IDZA 4IFTA 5BYBA 4YMTA 2OCDA 3OECA 3S2UA 4BLWA 2P75A 4H1TA 2AHRA 2WSYB 3VNQA 3AEYA 4ZYXA 5ESDA 1C3JA 1XMJA 5I3CA 1OTYA 5DASA 2QZJA 1A77A 1T13A 1T1GA 1TZMA 4BKOA 3OLWA 1DTWA 1XQVA 4HH0A 1E2MA 3RC8A 5A5EA 2A9KA 3BMCA 4RD6A 5LLSA 1XU4A 2PA0A 4G0NA 3SX2A 4NOLA 1XQWA 3FM9A 3PC3A 1SZDA 4N65A 1TQ4A 1TPZA 4XFKA 1PJRA 1ND6A 3AESB 3KAQA 3W5AA 2XQVA 4IEEA 5LSAA 1LTKA 1L4UA 1G8SA 3PYLA 2ID8A 3CZPA 1R5NA 1G5IA 4KIWA 1WEHA 1MHPA 2CUTA 2H8GA 4OI1A 2O8CA 1GQRA 4AG3A 4JFRA 3LI2A 3L2OB 3UK2A 3I2HA 5IW8A 2D06A 1NLMA 1KHTA 4NARA 4RPLA 2FN4A 1ISMA 2GASA 2LCFA 2B6NA 2WIGA 2H4XA 3R6LA 2PTGA 2Q3HA 4OH7A 4MI3A 4XJTA 4XLZA 4YJGA 3KZXA 3SKXA 5C51B 3NATA 3AB3A 1K4KA 1JR4A 1Z0FA 4ZV7A 3UB3A 2OBYA 5TF4A 4QOEA 1EQAA 3R7WA 1XTSA 3FH0A 3QFRA 3FUXA 5TDHA 1A82A 5ALNA 3RRJA 3HZOA 4A2CA 4LXQA 3RYCA 2Q2OA 3A6EA 3CH7A 2VRBA 3CNOA 4G0PA 1HMPA 1HXHA 2HW8A 1OHHA 4MRMB 3TSWA 1X39A 1BH2A 4PC2A 4I4CA 2CT8A 1E62A 2JLWA 1NBMD 4AYXA 3LZCA 2VSQA 3KKOA 4XASA 3ER6A 4LSGA 1UPFA 5A0VA 3AM4A 2O7SA 4GGMX 4PONA 3MG9A 3GK3A 5K4AA 5G1PA 5IYZB 3MW8A 2IZOA 3GI1A 1CUIA 1XDUA 5K3FA 4V3BA 1DV2A 3O1HB 1D9ZA 4MTLA 4G2TA 3E0QA 1YDMA 1Z2OX 5ULLA 4CQMB 1EWQA 5C4MA 3C41J 3GAFA 2QLNA 1C9EA 4YDHB 4YH1A 4BO8A 1YFKA 2UZ1B 3Q4GA 4YB8A 3OLZA 4CN9A 1NNI1 1OZHA 4DVGA 5MFZA 2YJZA 1VLLA 3HVKA 3LYLA 2HCFA 4GUAA 4G86A 2C4KA 5JCJA 1AN9A 1SKAA 3EXFB 4IG4A 4QPPA 3RSFA 2EERA 1ENZA 5D6NA 3R75A 2RAPA 3OZAA 3S4YA 3DDUA 1AQUA 3H9EO 3NTXA 3M1AA 4POAA 4B4UA 3RRNA 4PR0A 2BKLA 4TMXA 3VU0A 3WHKA 2BDTA 3K6SA 2LWIA 3MEQA 4MUJA 5FO0A 1R8SA 2NXWA 2OEPA 4RC9A 3ZJYA 4J6EA 2MINA 5AJHA 4B09A 1M1YE 4FLMA 2C8JA 4Y9DA 2P41A 1ZS9A 4TKUB 1RPZA 2EX1A 1V5EA 1Z2CA 3DVAA 3P0JA 1NRWA 1P7YA 3GVHA 3KQSA 4M76B 4RQTA 4YCJA 5H80A 3TKYA 3RE1A 5I7FA 1PR5A 4BAGA 1ABEA 4X60A 3TN7A 4AD8A 3K1TA 1EB8A 3GNTA 4BP1A 3IHLA 2XCLA 1ZIDA 4OXXA 4MJXA 2VZ0A 3M4NA 1P62B 2JD2A 5FWYA 1FNDA 1WZ2A 2R6ZA 1KKMA 1KAGA 3CR7A 4B3HA 1JIKA 1HE8B 1HDGO 2EKLA 2PNFA 1VPVA 1D0VA 4HS9A 3SVTA 1HYHA 3OC0A 2QZPA 2VSYA 5IEJA 3T0GA 1J0DA 3UC5A 1W46A 3R5TA 1XZPA 3SLKA 3D8BA 4V1CA 2C2BA 3PCTA 4ER6A 5CDSA 4B3RB 2NAFA 2FEPA 3OZTA 2V03A 2C5EA 1OFHA 4QUKA 2H9YA 3QLUA 2X4DA 4FDTA 3UGQA 2WTBA 4JYZA 2OKCA 1E2BA 1CQPA 1T9HA 2JCGA 3KM0A 5KI6A 5H81A 2I2CA 1M7BA 1HNNA 1GXSB 1CRWG 4YP9A 1E7MA 5KPJA 4YY3B 3OPYA 4UW9A 3F4BA 4XX1A 3V5NA 2VHJA 4CRWB 3ND9A 1JJIA 1JQ3A 2XWBF 3TX2A 4NEHB 4QIHA 4BWFB 4F9TA 5KYWA 3KBBA 4PPQA 2WZBA 1SUBA 1H0SA 4HG2A 3U7FB 1Z17A 1B3BA 1C5KA 1U3TA 4N8SA 4WBSA 3GLFB 3V1KA 1SCIA 4OQNA 4R7TA 3QG5A 5J9FA 3X2FA 3U09A 3C1UA 4CMBA 1E1QD 4FOPA 4X20B 4RTOA 4MVJE 1IHPA 4MW6A 4BGEA 3RRBA 1JQEA 5BVGB 2PKQP 4P7JA 3HDGA 2QBYB 1XSEA 3GJ0A 3S1AA 5CAEB 3PFHA 1U8ZA 2R7LA 2P2NA 2VNAA 4LAFA 4EVRA 3HEBA 4QD3A 5A7GA 3ZC3A 5KHOC 2J0UA 3VX3A 3CB2A 5T7BA 2RC5A 4AKIA 1PQUA 2H8KA 1I3NA 3EZGA 3QI7A 1KGSA 2JGJA 3K4QA 3QKSB 2KLBA 1JFTA 4QTUB 3ESZA 2ZJ8A 2JIZD 1L1EA 4QNRA 4CKCB 3IXMA 3OOEA 5ELLA 1AG9A 2G88A 3AZOA 4F6RA 2BR4A 1X70A 3AW9A 2YC2C 4X8HA 4BNMA 1XT6A 3E6AA 2YZKA 2PT9A 4XGKA 4LYHA 4Y7CA 3IXLA 4DQ0A 1EBBA 5IYZF 1KWKA 1U0JA 2J6IA 5CHYA 5H3LA 4NH0A 2ZEJA 3VFDA 4RVUA 2NNWB 4NU6A 4PQRA 1ZN8A 4AWXA 4FZJA 5BMOA 4TMKA 3DE1X 2IITA 1CIJA 3T5BA 1EHCA 1D1SA 4REQA 4UBNA 1KY3A 2FVYA 4HQOA 2PYIA 1J0CA 3DBHA 4HRYA 3UAWA 4AJ2A 3L84A 3SY8A 3P0FA 1WB5A 4C0AC 4Y0NA 2FFQA 3FN4A 4WUVA 1WLYA 3JQ8A 3AUXA 1L0BA 3EDCA 5FOUA 3IHTA 3WV5A 3N05A 1ZNZA 3UJ6A 1SPBS 2BMWA 2PEZA 3KJIA 1SBYA 3QVOA 4Z0PA 4UQLA 3JAWA 3NEAA 5L8VA 2F55A 4LHWA 4EOGA 5IANA 2H1VA 3WLKX 3BBPA 4GXTA 3HP1A 3AF2A 3FOZA 4A15A 2HZ7A 4OXYA 2HEGA 5T4BA 1UJMA 2GARA 1U0OC 2G08A 2Q3MA 4L8VA 4AO8A 1YZTA 1JYSA 4QNNA 4DJJA 3HLTA 3IR7A 3EOBI 4IKOA 1E5VA 3WGYA 3WLPA 1C1DA 1N3IA 4PN3A 1MB9A 5I7SA 2ZJOA 3KV1A 2YHAA 5AVRA 4CXMA 4RELA 2OV4A 4RK1A 3VI3B 3KAJA 1ZNXA 3HO8A 4EARA 3JQFC 4LMAA 4TQAA 3GNSA 1CRPA 4EKYA 1TLLA 1ZAYA 1O54A 1OLUA 1R6UA 2Z1MA 3GZ4A 4CF3A 1AUVA 2P7IA 4MP8A 1XLTC 1GYQA 1BWRA 5I51A 6YASA 3MT9A 2WEKA 3VU3A 4MIYA 5J3JA 3PQ2A 1OX4A 2C5AA 1MPXA 1C3XA 4C7MA 2BTQA 5KCMA 3AY7A 1LI5A 4KWHA 4MI9A 2BDEA 4QOIA 2OZLB 1UBKS 4Z8XA 5AVSA 5JMWA 2HI0A 1AQLA 2BJVA 3MCWA 1S2DA 1PTJC 2FE4A 3EQ9A 2Y77A 2VA8A 1RWOA 3EJ6A 4A0GA 2ADOA 1XVAA 2PJDA 3GAMA 1IJBA 4BQOA 1AUPA 4UCQA 5B64A 4Y6SA 3W5CA 2WJJA 3SYLA 3ZNOA 1GCOA 2NX2A 4FUQA 2PFSA 4JUIA 1RHQA 3QVLA 3JX9A 4O2LA 5T3UA 4BY9E 4AAYA 4FQ7A 3UAXA 5A03A 1ZD3A 1THMA 1LI4A 5FYDA 4FSHA 4E22A 5CDFA 4UDOA 1V7QA 3WIBA 1ZPDA 2FB9A 5I8WA 5KKAA 1T2CA 1U3VA 3VPGA 2ONCA 1XKLA 4D9IA 1YQGA 1Q21A 2ZW9A 1SXJD 3DXFA 4BJHB 2OCGA 4PTZA 2WD7B 5JDCA 2G28A 4LY0A 1H8HA 4PLPA 4L4RA 1Q74A 2R7AA 4M7PA 4K6CA 5ERXA 5BOVA 2WWVD 3ZZ0A 3G2OA 2C7PA 2D0PB 2GPSA 4V03A 3ROEA 2PGNA 5EP2A 1K75A 1PZHA 2XVXA 2VDQB 3H2ZA 3LXMA 3QPWA 2QVBA 4PC7A 4BPRA 4LHYA 5KNBA 1QANA 1X2BA 2Q5HA 2IW3A 4G5SA 3L8FA 5IC4A 3ISVA 2HT6A 1A69A 4YUVA 5T3YA 2H7XA 2HJGA 4GG1A 2ZE7A 5IP5A 2IELA 3ANLA 2HNKA 4FR0A 5A62A 3DEZA 5B1YA 3EPRA 3H87A 5GTDA 5EMMA 5AVJA 3WA6A 3TRFA 5EP1A 1ECJA 3DM5A 4MGHA 1QQ5A 3W5BA 1BXZA 5D3MA 2HR1A 1EVYA 1KJWA 3PLRA 4DLVA 3GEEA 4ZXPA 4ZI2A 3TRJA 1A9SA 4TYYA 1U0NA 2HDWA 2ZAIA 4MDHA 3PLAE 1L4BA 3RSLA 1XA0A 4N5DA 5LNK1 4BQQA 4S1OA 1JDBC 1D4AA 1Z68A 1DOAA 3DONA 4N0EA 4MLPA 3ZY5A 4C4TA 3WIEA 2HHJA 3RS5A 1FUUA 4QJ3A 4CCYB 1ABBA 4RH3A 4BVHA 2G9VA 3U4CA 5M5BA 2W42A 4WT7A 2BP7B 1OXTA 3PRHA 5K01A 3OMXA 1DQPA 5KTRA 1II9A 3KYBA 3P0RA 3HZRA 3KT6A 4WKOA 4GPZA 3A9SA 1Z07A 3H5WA 1PGNA 4Y2GA 3RVMA 2AQHA 5AKZA 4HPJB 2RHTA 3KTOA 4YMVA 1EJ0A 2VJMB 4IHJB 4EUEA 2JJ8A 3DQQA 3FTEA 4ZCQA 3DBLB 2FQYA 5E6RB 2VDJA 3KZCA 1DXYA 4BKPA 2FUG6 4WZAE 4NHOA 1H5UA 3V34A 3QUTA 3V4SA 1FNBA 1FVOA 1SCQA 1WKCA 2YN2A 5HBGA 2J9RA 3WXMA 3ZXUB 1IWOA 4DM4A 2H3HA 2O3SA 1CY0A 3CEPB 5TEVA 3SS8A 5C1OA 3UXEA 3A9UA 2R6FA 2JC3A 2B7LA 1V1RB 2UKDA 4RL4A 4MKHA 1H4TA 2JFNA 5AXDA 4I3HA 4U9IS 3SI7A 4O59O 1SKMA 4OHCA 1BHQ1 4IIXA 3WLAA 1QGED 1ORRA 2QE7A 3ZWOA 1EDOA 3C4VA 3E5HA 4NF2A 5A71A 2B8JA 2JAHA 3FBTA 1Q1QA 1WUJS 4YCBA 1BN7A 1RAAA 4AY5A 3GOQA 2FF7A 4A6EA 5HIIA 1SQ6A 4YMSA 4QU0A 1ZA1A 4P35A 2VZ9A 5CFOA 3T7SA 3L7LA 4DLSA 3WMWA 4DB2A 1VOTA 3O5AA 4KO3S 3AI1A 1JQDA 2VJQA 1D07A 4HDKA 4TYMA 5FL7D 3TWOA 2W6QA 2HPVA 3X2SA 4DBVO 2I1WA 3OKPA 3TUJC 1M6HA 3R9XA 1JHQA 3TUZC 1CEEA 4Y2VA 5BXYA 4CCSA 2Z5VA 4ZRMA 1V5WA 1Z5PA 4OHUA 3EIOA 4BFZA 3N28A 4I1SA 4NICA 4IGIA 2FW9A 2QJRA 1YZFA 2ZJ7A 3G3EA 4NOJA 5COAA 4ZEOA 2C3MA 4DDVA 1OR8A 2ZJAA 3K6JA 3QJYA 1LQTA 5J5CA 4RKRA 1IYZA 1M0SA 1M1NA 2C00A 3SJZA 3ZGZA 2IK8A 3MCTA 1I1OA 3OZSA 1SMKA 2BFFA 4Q1DA 5GAJA 4EHIA 3GH1A 1YGYA 3F1LA 2VDMB 2CUKA 4L51A 2BSQA 3E2MA 3OFVA 3EH1A 4HTAA 1ZMXA 4LX8A 1A9XB 2BGTA 1V8FA 1EGQA 2R2GA 2BI7A 3C8ZA 2APJA 4AN0A 4MRAA 3YASA 3LQ4A 2F1OA 3IE0A 2X7HA 4R3NA 5FT9A 1FFEA 2GKSA 2XMZA 2JKYA 1TYEB 4FD3A 2O1WA 1TM4E 4AB1A 4UTRA 3B89A 3CU5A 3PJEA 2HU7A 4UVEA 3KQLA 1CWUA 2W2OA 4H0CA 1CV2A 3UJBA 2B37A 4BQIA 2I71A 4C7BA 1QP0A 2BL4A 2QMZA 3NDRA 4PAQA 2YFYA 3JRNA 3LY9A 5LXTA 1G38A 3ZWBA 2OBBA 2B82A 2OOKA 2FH5B 4Q4CA 5KYNA 4H7JA 5KTNA 4LCBA 2J3EA 2YWEA 1OASA 3S8MA 1GA4A 1V7PC 1V1JA 2PUJA 3A2LA 4OSPA 4U3JB 3RNLA 3WOHA 4YPOA 1DG1G 3BZWA 4M9QA 3VH2A 5GMOA 1P77A 1BX3A 1GITA 2AJLI 4ZEXA 3SOZA 2VJKA 3KAKA 4HYEA 2B8EA 5ES4B 1JECA 3AU8A 3NKFA 5DCWA 2EHDA 1NBMA 2ISSD 3LMKA 1E6UA 2E87A 2K7ZA 2WFMA 5A4KA 3A4NA 4OHKA 2EW1A 1N2CB 3TBHA 4P5PA 2O14A 1BX1A 3K9NA 4IILA 5DM1A 1P0MA 1SXJE 1U2ZA 1A04A 3ZH2A 3LF2A 4E1VA 2DQZA 4DAOA 1MOZA 3GGSA 4CEHB 2WINI 2QENA 1N5DA 3PT9A 4IHJF 3GPDG 1MN6A 1NQAO 4JEIA 1HLPA 4CT5A 1CUWA 5T4FA 2WFLB 1E18A 2OLKA 1RI1A 5G2OA 5HM6A 2C9ZA 5KYUA 1IVYA 1GSOA 1KI1A 1CK4A 4JN6B 4RKEA 3QELB 4N3BA 4J2TA 2E6UX 3FDJA 3ASZA 1IQ0A 2PBFA 1AY0A 2G0AA 4LI3X 4RGYA 1YFLA 2Z5LA 5CTAA 3RVPA 4MRRA 2X5KO 5CFLA 1L8AA 3EZNA 1A4IA 1ODTC 4R83A 1Z25A 4A8HA 3KUXA 4HR7A 2I9KA 1V8PA 3CKMA 3D8HA 3DMNA 4P3KA 4EG7A 2WFZA 1FLNA 1YZVA 4EVSA 1PBNA 3MYYA 1M1XB 2PNJA 1QS0A 2BT4A 4AM8A 2Q28A 5B7NA 4GI7A 2VN8A 5K0GA 1E6MA 1NOIA 1Z4KA 2XE6A 3M6AA 4ZO7A 4XCXA 5EWLB 2XDQB 4V2UA 4M6WA 4KN5A 3RABA 1I6LA 3L9WA 3I9JA 1W2WB 2AD5A 3NM5A 2QW1A 4RLHA 2YTZA 3UXHA 5A5FA 1NNEA 1OZ0A 4YASA 1XUOA 2AS0A 4ND8B 3ZX4A 3VJRA 1E1KA 4OP1A 4A73A 5JBNA 3G1WA 4NFSA 4EJ0A 2DKOA 1V3QE 3A3PA 4D8VA 1QP4A 2O8VA 3R7FA 3TZHA 3BXGA 4D3YA 2Z8XA 5LR6A 2I65A 1ACMA 1JU4A 1O5TA 2EQBA 2A14A 1YVUA 2YYSA 4BO2A 3K20A 2ZWMA 4EVIA 5A4AA 4OHZA 1E6EA 2YWBA 3AJ8A 3FFXA 3T3OA 3ANTA 1II8B 4XA8A 4OI2A 2VAPA 2Z6QA 3K71B 1QGDA 3W6OA 3N5CA 4XPZA 2GXQA 2WFAA 5EVJA 2BMAA 2VYNA 3LQ2A 4HNHA 3FNBA 3HCNA 1A72A 1FFDA 2VBCA 4AK9A 1M2GA 3BMOB 2HIMA 4UTZA 5T64A 3AUAA 5A5DA 3NIGB 1D4OA 2ZAYA 2FX3A 4ZVRA 1YE5A 3IP3A 3C7CB 3GJRA 5F77A 3KSAC 2B4YA 3HKBB 3RKUA 4B76A 1S7CA 3BSYA 1S6YA 4RIIA 1QG6A 5HX7A 4WGFA 3JW8A 3O83A 4MQ5A 1BE6A 1WTAA 1WIWA 5JEEA 5JZSA 4LMRA 3F8SA 4OHWA 3K9WA 4K3UA 1VIMA 1PNQA 4B6OA 2XOXA 1GU7A 4QKQA 1JSLA 1IN1A 1U63A 5FNZA 2Y2VA 1OGIA 1QIDA 2GJSA 4QFCA 3V33A 1M2OA 1Y48E 1XZAA 5AJVB 4ZQCB 2BGMA 2P79A 3NHRA 2FWAA 1NG1A 2E7ZA 4J8PA 1AGNA 1DAKA 2G7MC 3FE2A 1X8KA 4FE3A 2ONZA 4NYJQ 2ZBPA 4LOHA 4PWZA 4WCFB 1GTL1 2OK7A 3OY7A 4Q3EA 5BMVA 3CIOA 3IEIA 4KAJA 3GPIA 2JI6A 3HDYA 3I5AA 4WZAA 4D56A 1F3OA 2RGDA 4L6IA 3S40A 3SHOA 5LQNA 2P65A 3J81A 1Z7WA 1MJNA 2HJRA 4JJKA 4JENA 1XIVA 4RDHA 3M81A 4CGYA 3TINA 4E09A 2O4UX 4P82A 1TLTA 4C4SA 2X9NA 4R05A 1Y8CA 4C7OB 4B3MB 5F98A 1FMTA 3IT1A 5D7NA 1KNXA 5AXBA 2DOKA 4J07A 2ORWA 1OBOA 3O84A 3MGCA 4GI3A 3JR3A 4RK0A 3V3KA 3GN2A 2P27A 3I28A 1I3MA 5A9SB 4ZEWA 1TQHA 4G89A 1R6VA 1EVEA 4N3CA 2Q8QA 1WHTA 3BH7A 4NDAA 1OWNA 3IMCA 5D3KA 4HUQA 2R8RA 4K5QA 3BWDD 2O8FB 3D3EA 3D0KA 2WMYA 2WZCA 3WLTA 5B3KA 3A3YA 4HWGA 4UJ3A 1XCMA 5GOZA 2VHUA 2MR6A 3FVRA 5DGXA 2B0JA 4TWBA 3VKFA 4DJDC 3EF3A 3HU2A 2GZHA 1DAPA 3DHYA 1ADCA 2DC1A 1NW6A 2P35A 4NYMR 1UBFA 5FBRB 5JRJA 2A5DA 4NENA 1B41A 1C3LA 4MA4A 4UM9D 4IQGA 5U4QA 3COZA 4PRYA 1Y6FA 2FP4A 1P4HA 1X8JA 2P0YA 3IBSA 4P7GA 3TEJA 1S01A 2JFGA 4MEBA 3DEAA 4KX5A 5B7GA 4FFOA 5CFMA 4NESA 3MAGA 3R77A 3ZDXB 1E3MA 4GHWA 2WDPA 4KQKA 4HQNA 1LDBA 3TLMA 3VJKA 5ABPA 1BGWA 1G6KA 3LH5A 2I33A 5FFMA 5H9WA 5E2AA 3EH2A 2KWIA 2CLMB 2GF9A 2HQRA 2I1LA 5K4GA 4ZO4A 3BF8A 2R97A 4RIFA 4DNPA 3LWBA 3OKAA 2I6FA 5D85A 3LC1O 3VTAA 4EX6A 5C8XA 2AUMA 1MJGM 1JEDA 2X0RA 2YMLA 3D2CA 3HUEA 1L5HA 2K5UA 1X77A 4URZR 4RKFA 1SHTX 1NMQA 2CK3A 2PZJA 1T8TA 4G1UC 4IYRA 2YWCA 1VFPA 3LVBA 4WDQA 3C85A 3WKAA 1SR8A 3EY4A 5IZCA 4J90A 1PWXA 3MXOA 1XC7A 1R37A 3FGPA 4P80A 1RKUA 4UHDA 2HWXA 3DAPA 3IB3A 1LPNA 2BHTA 4HGNA 5ADUS 4MUXA 4D3SA 3PXCX 3EDYA 4EYEA 4LSZA 1KDPA 3GUZA 3MWJA 4G4GA 4PQGA 4BHTA 3L05A 1TJ3A 3FCXA 3QPBA 1FTYA 1B74A 1XZCA 4RTSA 1D5WA 4GC5A 5JC8A 3C6YA 3A70A 1ZGAA 3B1YA 3NBQA 2C92A 4TN1A 1M0WA 5AW1A 2ZRLA 1UBJS 3FJ1A 2BAGA 1QU2A 1Y4DE 3DGEC 4OP2A 1M0EA 2IXBA 5EP3A 3A2KA 1MTZA 3MQFA 3ZPXA 3KP1A 1I51A 5DLDA 1X0VA 1ONOA 1T9DA 2G82A 2O9JA 2AXEA 1MBZA 2D2FA 3D6UA 4PCVA 1SXJA 2CFIA 5ALIA 2I76A 2WE7A 2JRLA 3EK2A 3PQ5A 2GM5A 3EBLA 2XLCA 4EI9A 3VHXA 3WLNA 1F3LA 2ZSAA 3OU2A 2NMVA 3KEQA 5LLTA 5ARDA 4OK5A 5KNCA 3PEWA 2Q1XA 3ORHA 1ONSA 5AW4A 2YCBA 4CLRB 1Z4PX 2D1TA 2EFYA 2VDUE 1ZM7A 1K9SA 3SFTA 3ZCSA 3Q3CA 3HXQA 2Q6OA 5BNWA 2P1RA 4OATA 3AVXA 1ZW6A 1ONNA 2NP6A 3PHLA 3AEXA 4QELA 2JAWA 1Z06A 3W04A 4JI0B 2JLVA 3OIYA 4BU1A 2Q5EA 1E7SA 2PPLA 2NOAA 5CDUA 1WBJB 2PYDA 4JU9A 1GUBA 1SBCA 2BRUC 2JLAA 2NO5A 3M6LA 4LYDA 3GQBA 1RP7A 2C7OA 4B3SB 1JKXA 2DFKB 1KL7A 2G0TA 3CSUA 3GUCA 1E79D 1PL7A 3OM8A 4NU0A 4U4AA 3X3HA 1O5OA 1RP1A 1NLFA 4LF8B 3F6BX 4HBGA 2RH5A 1JV2B 3A0RB 5KJCA 2NO7A 2I3GA 3RYIA 3IMFA 3UK0A 5LOVB 3RU9A 2XB8A 1DC4A 2Y6VA 3DKKA 3V97A 1ZOPA 2X8BA 4Y8VA 1SAYA 2QQEA 4HQ0A 3UO8B 2H08A 4CMIB 2I2XB 3FFWA 1A2QA 3TSYA 3ZVLA 1AZWA 4DAEA 2Y66A 1DKQA 4MARA 2HJ9A 1KIAA 4MULA 5B1HA 1AZTA 2CXTA 3KKLA 4P3OA 2F1KA 4W8HA 5DXAA 1T4DA 5EJ9A 1AKMA 5DDIP 3LCVB 2W37A 4E5DA 1S89A 5K6TA 1KBOA 3E9YA 4MJ7A 2NP7A 1OV6A 2BFOA 4JBGA 2IYNA 1GD1O 3IRUA 4L4XA 2VFAA 1XU7A 3NPAA 3HCFA 1L8QA 1YRYE 4MV7A 5AHRA 2JPDA 3NPMA 4CR8A 4NE7A 3VZQA 3PE4A 3QFTA 4WOPA 1QQ6A 1SBNE 5JNSA 2OBLA 1AHIA 2Y05A 4AO7A 3BGOS 3I8OA 4G1MB 2YY7A 2FWPA 1SKQA 3OAAA 4PLHA 1B8VA 2DYKA 3MSCA 1HPLA 4PIVA 1SKBA 4JP8A 3CEAA 3IT3A 3JQBC 3B8EA 2QEQA 4HNRA 5DYIA 1L6RA 3QE4A 5JBQA 3FLBA 4M87A 4M0PA 4M1KA 4R51A 3SXPA 1ZOSA 4PO3X 4F5YA 1ZK3A 3VC7A 3NV9A 4BEWA 1H5NA 3O4HA 3LV8A 4MWDA 3TTXA 1Z36A 1ZJ5A 3EZYA 4MPJA 4YAFA 4C89A 3WA7A 1M75A 4IIDA 4MEAA 1C0PA 5DM4A 3MJ4A 4IVNA 5TNXA 4HYQA 3T06B 1FQJA 3MJRA 1L5GB 4PHCA 4B81A 3MLEA 1U3WA 2QPAA 3CLSC 4LOJA 1AK2A 1ZDMA 3RSZA 5DK4A 1UZAA 3JQCA 4UE3S 3V8VA 4BNJA 3QPDA 5B4VA 1AB6A 1M2KA 4CEJB 4XB2A 1KYQA 1TAHA 1TGYA 4ZCTA 4FDUA 2D74A 6Q21A 1AKQA 2X4GA 4BFUA 5KREA 1CLEA 2CNWD 4LW8A 2K2WA 5AP9A 4MVYA 1G41A 2PYZA 2EBHX 4ITRC 2AMVA 3Q5GA 3L6UA 1A7UA 2VDPB 1FF9A 4A10A 2I22A 3C74A 5FIUA 3WK5A 2E49A 3ONWA 3PENA 5FOVA 4HAIA 3TBFA 1W85A 3ORQA 2QIPA 2C3UA 1WXXA 3DUWA 5HQ3B 3D8RA 3B51X 5TMPA 4KH1A 4K8RB 5H4GA 3UKOA 4KKXB 2KM1A 4R9RA 3F6RA 1H2BA 5REQB 2XNKA 5C35A 1Z7BA 2XVYA 3I6MA 1BU8A 5A7HA 1MB2A 3V8QA 1KSGA 3GARA 1NWCA 4TSFD 5ALDA 2FXVA 2RAFA 4CT4B 1ODJA 5ALMA 1A9OA 1ZMTA 4UU8A 2P1ZA 4MV4A 4CV2A 5CLJA 2ENWA 1MG0A 2AQ8A 3C97A 5CK4A 4QBKA 1AN0A 4EF4A 4GWKA 3DB2A 3K0FA 1Y6RA 4FQ8A 1KJIA 2BEUB 1J06A 1A5AB 2UV8A 4FT4A 1Y1TA 1Y4ZA 2ZU0C 2IGBA 3AKDA 3I34X 4GS5A 5LA6F 3T4XA 1POWA 2OVBA 3OEYA 1ADFA 4HRXA 5JYBA 1VJTA 3Q7PA 3Q8MA 3OA2A 4C01A 2XX3A 4MV5A 1X19A 3SMVA 4AJLA 5I01A 2GHQA 2FMIA 5LOVF 4IO1A 4PO9A 3AK4A 1YXMA 4QFMA 3K72B 4J7AA 4UHJA 2F1HA 2JIMA 4KI7A 4XWOA 5JNLA 2VZ8A 3OCUA 3T9FA 1YB1A 2PSSA 4QFBA 3HCOA 4ZWNA 3VC1A 3A0UA 5KMGA 1QH8A 2J3HA 2BJHA 2W48A 1QHHA 1I4EB 1VPLA 1ZX1A 3B60A 1BKSB 4H08A 5GP1A 1GTSA 3KD3A 3LRPA 3PQEA 4MIKA 3S2YA 2QN7A 4EJMA 1R8JA 3NORA 3BTOA 4HNVA 4R2KA 2GETA 3UJPA 1GU0A 5LBUA 1ZINA 2QLFA 3L7KA 1TF7A 5FBLB 4B6SA 3C5HA 1FSSA 3BM5A 4MWCA 3UGJA 2BGLA 3DDNA 4KV7A 4IINA 4O2AA 5FNVA 4AZSA 2ZBGA 1ORHA 3PJFA 4Y1RA 3WRXC 5JFGA 1QTRA 1MO4A 3T6KA 3VZCA 4TKVA 1NV9A 1T29A 3ZCVA 3LA8A 1PHPA 4ZAFA 1K1EA 4MUYA 2YFHA 3KO8A 2P9QA 3DW3X 4RA6A 4BRSA 4C2AA 4LIPD 3DVRX 3M89A 1REQA 4DSNA 4BNLA 1FUYB 1OT3A 2GZSA 2PL9A 1US8B 1V25A 4U9HS 3KT0A 4DIBA 1KDTA 5EJ4A 4DV5B 1ZR4A 2QR2A 3L0IB 2UYGA 3HWX1 3FTCA 4RA9A 4LFCB 4B44A 3MFYA 4L6AA 5KVCA 2G1KA 2R84A 1GNVA 2XDWA 3C24A 1E1CB 1F2TA 2JK1A 4MO2A 1M6WA 5ALKA 1U1EA 4UATA 4XLLA 5JAMA 4QWMA 2GN9A 3U4AA 2FWNA 1XDGA 5CGZA 1TU0A 1W5SA 4OJQA 5TPWB 1TEHA 2FEKA 4JLMA 3QOXA 2H3EA 4GX5A 5KNDD 3ZWCA 1H5QA 5HE8A 1HO3A 1RE0A 1OC4A 1WF6A 1DP4A 3IUBA 4Z53A 3PYMA 1O03A 4EYSA 2NXNA 4ZQHA 1TYAE 3DV9A 3LUBA 4FOSA 1F8GA 1XRNA 4N76A 2YV3A 3TO5A 1B26A 2VDLB 2ZROA 2P78A 2Q1YA 2XI4A 3EASA 3GWZA 4G3XA 2V7XA 3RC3A 1OTXA 2IYEA 1VL0A 4Q3KA 3VBCA 4RFSB 1ISHA 1L7QA 2XQJA 2B4QA 4MPPA 3BS4A 4B6JA 2Z98A 2AI3A 4MW2A 1TCUA 2ZTLA 4DCTA 4CMEC 1CZRA 2HLDA 2GF0A 2OO5A 3DL2A 1LD3A 3OJFA 4QICA 3WLMA 2CXHA 2WWRA 1HA3A 3NH6A 5JE8A 5IS2A 2O7RA 1C9NA 3NRCA 1N2ZA 1CIPA 1P5FA 2FPLA 2QG6A 3DEKA 4MV3A 4MX8A 1PJ8A 5E0OA 4ZU3A 1BXRB 1E6LA 1JF8A 4JB3A 1VYTA 4ZALA 5L4LA 1TT5A 4WFIA 1K97A 1CKEA 4B1FA 4NV0A 4CETA 1AV6A 3D7MA 1PWEA 2ZB4A 2ZRMA 1SN7A 2C04A 4K9PA 1C50A 4PGGA 4AKSA 2P3SA 3KELA 1XEWY 2CZGA 4PIMA 4YR7A 1RM4A 1VIVA 3A1EA 3QXJA 5CLHA 1K7EB 1KI6B 2VBFA 4OSOA 3RSSA 1PJLA 4URVR 3OP1A 3KYDA 5CB4A 2GBLA 2QD2A 2XT9A 3HSYA 4UUQA 1A8SA 3EF1A 5EP4A 1U8EA 2QTTA 4TWZA 1JP7A 2AJ8A 3BHNA 4EMBA 3IUEA 1NVFA 4U1RA 1P19A 3O0TA 1UDRA 3AI3A 4JKOA 1GPDG 1DC5A 3N2LA 3O8DA 1RZUA 2J3IA 5LMNB 5FP0A 5CM9C 3UV7A 3T1TA 3JVDA 5C7IO 3KSZO 2XYHA 2XYRA 2CMFA 5C8YB 2IH4A 5F9MA 3NJ8A 4RVGA 5AOCA 5A6SA 3N1UA 4F92B 1EE2A 1V95A 2OILA 4OHRA 1J1ZA 2NTJA 3DT6A 3MQ2A 4LRSB 1ZCAA 2EW8A 3BMNB 3GFSA 4DREA 4ZTZB 1IBSA 2LR0A 4GM0A 2WIJA 5EJFA 1W581 5CYPA 3H1GA 4GBMA 1YACA 4KUHA 2OLEA 3BWYA 3F3KA 4LECA 1FTQA 1U02A 2V7TA 3CNNA 5B1EA 5B37A 4AJ1A 2Q3DA 1HOTA 3H8JA 3FPBA 4G5FA 2CJPA 5E4YA 3VDXA 3KQUA 2VJNA 4BMPB 2OQRA 2KQUA 2FSSA 4ZDKA 2FSHA 2H57A 4JL5A 2G63A 1VKHA 3BTUA 4X6YA 4LYFA 3AHFA 1YJCA 3TW0A 1DFIA 2GJ9A 5CNJA 3H3XA 3JD1A 1Q6YA 3TB6A 3QSYA 1JX6A 1X1BA 2Z57A 4A1FA 1L7OA 2CDNA 2O8EA 1XTPA 1DQNA 4EG3A 3PWSA 4LTNA 4IDNA 1B93A 1IPEA 1CYDA 2EKZA 4PVDA 4D9MA 4G0MA 4KIJA 4NYIQ 4JQCA 4YDRA 4PICA 1PGOA 3WJAA 3FDFA 3I9NA 5AI5A 2LP4Y 2ZFUA 4BIIA 4D45A 1I01A 3TXAA 4Z2AA 3ZU6A 3G2NA 3P5SA 2TS1A 3LT2A 4M36A 2PUTA 4ZK6A 5KEIA 3DBVO 4CUZA 1E2JA 1L1FA 1FNMA 4UC0A 5LNK6 5AR1A 4AY4A 3BKXA 1A5TA 3HRHA 3SC4A 1Q0QA 2IL1A 2YVUA 2WA2A 2FCRA 4ETMA 4LRTB 3I73A 4DADA 3KKQA 4I3FA 3IKTA 4L78A 5HK9A 5E3JA 4YJDA 2J7KA 4EX7A 1GTG1 1QIEA 3KDSE 4HAXA 4DJ5X 1M7GA 1BDBA 2FAXA 1MA0A 3FLEA 4R69A 5FD8A 5PNTA 3TNJA 4QLOA 2AN5A 4N41A 2YXNA 2H7CA 2CB0A 1EFUA 3C4QA 4ZZIA 1JQAA 2I3ZA 3A06A 1I3KA 1XGKA 2X2FA 3D5QA 4HMOA 4P34A 1OB2A 1MZPA 2FPRA 3PRJA 4B6GA 3NP9A 1MGOA 4MOWA 2IYUA 3NUGA 4V0MA 5ALFA 5BSHA 2HYIC 5F1YA 3ZJTA 5EJ5A 3G8DA 4QUDA 3NIBA 2JJ1D 5CGQB 3DC7A 4GZMA 2AR7A 3T3MB 3HYNA 5IJ9B 2UVPB 2IDJA 4Q4HA 2VAVA 2AG6A 3CF4A 1C2TA 4NR0A 4OQYA 5H68A 2XUFA 4OGKA 1NBOA 2PMCA 5DZSA 1HKUA 2JZOA 1SCBA 3LRTA 3PJGA 4MUBA 3BDIA 1HEUA 5F2OA 2DFPA 3KVOA 4QHTA 4UU0A 2ERXA 2F8MA 1G19A 2DFDA 3QV2A 4IPTA 4URYR 4P93A 4BB0A 5BSRA 3C3CA 1TQ6A 4J3NA 3OSUA 1WVIA 2X8WA 2DETA 2HWUA 2RB5A 3UY4A 1PR9A 5FTLA 3QMPA 1OI7A 4YUYA 3TTTA 1PE0A 1TVMA 2FPPA 2YXLA 3S2SA 4PYNA 2VEDA 3BXEA 1TAQA 5EIBD 3I01A 3SG0A 3SBXA 5ADHA 5KB3A 3MNFA 4G07A 3KXIA 3VJLA 3UMGA 1B16A 1GFIA 3DWFA 1CJMA 3JD2A 3HCDA 3TLGB 2AMJA 4ZOAA 4ZQIA 1FPMA 4KYIB 3QWFA 1HDOA 1H85A 1M5UA 2HWKA 4Z0HO 4P92A 3QQPA 2IOFK 3J7TA 3MIZA 4Y2TA 1WU7A 2FLVA 5C8YF 3OZFA 4LY6A 1QTQA 2WWFA 1V8BA 3B6KA 4OXNA 3RB8A 4OL9A 2WUFA 5IHPA 3WLRA 4FKMA 4YECA 2YR0A 1KQNA 1BCRA 1EGVB 1FFBA 1GNQA 1LNSA 1JMYA 3B52X 3T3EA 2R68A 4IJMA 3CZ4A 1TUBB 3GPCA 1WSAA 4M8NE 5AHWA 2G83A 2GCOB 3S29A 1RYMA 4IHQA 4HGPA 3H1BA 3PQ7A 2AZTA 1P0QA 1WMEA 4MAMA 1M2HA 2JCVA 4XDGA 1OKKD 1E79A 1KMIY 4H7PA 3WWZA 3G1TA 5HRAA 1WR8A 1FXWA 2XR1A 3P2YA 2C97A 9LDBA 3ORYA 5B7QA 3OPMA 4X61A 2DE0X 3TGWA 3OTGA 4U5QA 3ZJUA 3KCNA 5E3IA 2QHXA 5EJ2A 1WCWA 4HI0E 3HJRA 2JIDA 4ZOLA 1Y3HA 5DBEX 3WAJA 3L41A 1MDFA 1S2IA 2RGNC 3DUFB 4KGDA 3W5UA 4CF5A 2QRZA 3G8AA 4HZIA 3GBSA 3LM8A 2CFSA 2IJGX 3R0QA 5GJVC 3RJ9A 3WRWA 3KWMA 5BN1A 1E9DA 1GHTA 3DOOA 2AGVA 4YRBA 1D2GA 3I76A 1SUIA 3DQZA 3HFSA 3QPVA 5JMTA 3RK4A 1AKVA 2Y71A 3Q12A 2NNLD 3X1JA 3QTTA 4IMJB 2CNLA 1PFYA 2OFOA 3FF1A 3P9KA 4X65B 3H2IA 2AV6A 1UXIA 1PR2A 4MHSA 2Z95A 4KRYA 4V0RA 5CYFA 1E4VA 2GILA 4XEHA 3TQQA 1JA9A 1IONA 1H2HA 1QIKA 1ECBA 2FRXA 5MDHA 3U1TA 4CM5A 4HX5A 3VV3A 1KDZA 13PKA 4EENA 4YRNA 4OM7A 2NADA 3RUPA 1ZM4A 2FGJA 3DAGA 2JAPA 2YYZA 2A9RA 4H6PA 1NR5A 3TOVA 1TMKA 2ZE6A 4Y6OA 3BWBA 1Q84A 4QL3A 1NJGA 3GYGA 3L7JA 3N2YA 1TTQB 3QFCA 2PQ0A 2XXJA 4TUYA 5D01A 3BWVA 3MMSA 1E58A 2BCGY 4I6EA 1JLHA 3GLKA 1YBFA 3EX7C 2OYSA 3R3JA 4H27A 1K08A 3V8MA 4OBEA 3FD8A 2BGIA 3UKDA 5KOIA 3N39C 4I08A 3Q7EA 3SS9X 3V8RA 4RIHA 2GZRA 2MSWA 1P31A 2ZVDA 4TKZA 2O7NA 3WGJA 3VPCA 4BVGA 2VZLA 2ACKA 4M98A 2CF5A 3C7DB 1FNCA 4Q3LA 4TLCA 4WUTA 4ZCPA 1PV1A 3UAZA 3Q10A 3GMIA 4BGIA 4CL2A 4A7PA 1E1NA 5H83A 3UYKA 4ALLA 2H59A 1BJRE 4D42A 2ZJFA 3RS3A 4OG2A 4B0OA 3JQ9A 5C1BA 4EQZA 3PNLA 2GFHA 3UBMA 4CL0A 2CNWA 1Z74A 4M1QA 3E3MA 4HQKA 3I39X 4DV0B 2CDRA 5DJ5A 4JLUA 5EINA 1LNZA 2VT2A 1TE2A 3T34A 4GBJA 2ZQ5A 2PBLA 2PKRA 3OJ0A 3DPSA 1QPBA 2VQSA 5HS6A 5KKNB 1FVXA 1HLFA 2I2BA 4EPVA 2LPMA 4IQ4A 4CLOB 1G21A 2XVMA 2ZBVA 4K9KA 4UHKA 1Q5PA 3I5YA 4JUCA 3UH1A 2IZ5A 4YRMA 1WCIA 2JB9A 3S6JA 3SN6A 4Z4IA 1SXHA 1HT2E 2HSWA 2Q3LA 3NWPA 4DLTA 1XXHA 4CJXA 1HQCA 3NBXX 4CKWA 2Z58A 4GLJA 5HCIA 4TSFA 5EOVA 5KNBH 4M60A 1Z5GA 3GMTA 1GO2A 2V7EA 4BO5A 2WBLC 4KITB 4ETIA 4MICA 1IY0A 3JASB 3HA2A 3GBPA 1DRVA 2VOJA 3P20A 4KQXA 2P9JA 3C48A 3GGJA 4IMRA 4PSKA 3DF9A 1EUYA 1CQJA 5JJCA 3VOSA 2ZVPX 3GRCA 2YOGA 4MIOA 4ZV9A 4UHBA 1NHWA 4MUMA 4S0ZA 4BUJA 5FQNA 2ZRGA 3KSBC 2BJWA 4MVWA 4QXMA 4ZTUB 5BR1A 3IUNA 4WE3A 3PNSA 2CZCA 3SQLA 4MYSA 1GRCA 4FIZA 5CFPA 3H86A 2QVXX 2B34A 1ZIPA 1K0UA 2OPBA 3QSGA 2G9ZA 5CJPA 3REQB 4QC2A 2VJYA 4YBRA 5I9MA 3W5IA 3GRRA 2BUCA 2IS4A 3B48A 2OHIA 1THTA 4EB6B 4H1UA 4YUWA 1T24A 2EG9A 2IKSA 2V5UA 3IKLA 1RI5A 4KYTA 3V46A 2W0SA 3D0RA 4IG9A 1C7IA 2QTWB 5TQ2A 2KBEA 3TVYA 3DE3X 3PPYA 1BS1A 3QX8A 5I9NA 3W2GA 2JLCA 4UAGA 4YUAA 1WP4A 1IULA 1T8UA 4AZ3B 1XZDA 1Y5NA 2CLOB 3FR7A 3HEMA 3T7KA 3RT1A 4CG2A 4IGAA 1RQRA 1SIOA 3DKVA 4RK6A 3FNGA 3KFLA 3VOAA 2QPOA 1DUSA 4K7JA 2DUMA 1XVUA 1Y8RB 3ECCA 1H93A 2PFGA 2JW5A 2GCIA 2IPAB 2H31A 4X66B 3GLIB 2AK3A 1KYWA 4JIMA 3QKUA 4NULA 3E81A 2YX1A 2VJLA 3OD5A 4G9GA 4LVNA 4P84A 4RTLA 4W8GA 3RTDA 4PLTA 4UNNA 1CUAA 1FLAA 3ZNNA 2WPDD 5EMNA 3TOZA 1LRJA 2RGGA 2JD1A 2YBDA 3O21A 7MHTA 1TB4A 5FEUA 1OROA 4G67A 3DW1X 2H52A 1KYZA 4EYKA 2QKYA 3B9RA 1UKAA 3GPBA 3MGBA 3AUYA 1Z62A 1WSWA 2YN0A 4G0ZA 5KWIA 1EB9A 1XKTA 4CN8A 3HZHA 3RVOA 2JLUA 4A91A 4MHTA 2GEFA 3PE6A 4JT4A 3R3XA 4W9NC 4Y1FA 3RVRA 2OMKA 3QF4B 4EITA 1L7XA 3JWJA 3OQIB 5FAKA 4NP6A 1M8KA 3EXHB 1KZ7B 2EIXA 2CLDX 1TD1A 3OICA 2B4AA 1DMSA 3PC4A 4L5IA 4PLFA 4Q9AA 5I7VA 5ICEA 3RBZA 2P1DA 1XTUA 1ICEA 2FUKA 2PX0A 3F46A 3OY2A 4A2PA 3E9EA 4ZVVA 4WL0A 5AKJA 3VPDA 5AW3A 1FUEA 3CPJB 3FUTA 3NCTA 3P9RA 3TR0A 1TK3A 1BYUA 3GH3A 3OCVA 3C3XA 4D6YA 1I2BA 2P9CA 2RGEA 3HV2A 4Y2HA 3VXKA 4PLZA 1RWXA 4CVNA 3ROZA 1Y1RA 4AUEA 4EW3A 3OTOB 4B8WA 1TYBE 2E18A 4CLHA 1IFXA 3ZCRA 4CCAA 2A0WA 3N2KA 2M1ZA 5M3BA 2IKQA 3CC8A 3RW9A 2OUKA 3N76A 1CUJA 5FAXA 1V3UA 1MQSA 2QRNA 1SCUA 4J0KA 4MR9B 1NBAA 2Q2VA 1KJ8A 2YXPX 2V54A 2ZYAA 3LA6A 3KJGA 1NVEA 1DBSA 3B6EA 5I9SA 4EF5A 1M7HA 4KWTA 2GYUA 4G8CA 2O8BB 4QM7A 1CUCA 3ZWKA 4RF5A 3ACCA 1N6KA 1SC4A 3CJQA 3P2IA 1ECGA 3DEYX 3AR6A 2A92A 1X87A 4D4LA 2GN0A 1P1IA 1HWYA 1LFAA 5LVAA 5F9FA 1Q7RA 1NBWB 1HM5A 4PFQA 5E3HA 2QNBA 1QGUA 4UREA 4BNDA 4TLEA 5L45A 5C53B 1RRFA 4OREX 1M6VB 1CZHA 5CEJA 4U7GA 1Z16A 1MAHA 4KDRA 2PA3A 4Q3BA 2R1TB 3F9RA 1YASA 4OK3A 2XEDA 3AETB 1U7UA 3H2BA 2I2FA 1ECLA 4AMVA 3UG6A 2ZYIA 1IK4A 3RTAA 4CUJA 2D1YA 4IDOA 4UU1A 4XX0B 3ETEA 3UT6A 3Q41A 1Z0DA 5TJ9A 3I04M 4F2GA 3QLJA 3JARB 2X9QA 5FDFA 1NYQA 2B1RA 4W5TA 4ALMA 1RYZA 5D5HA 5LD2C 2G25A 3V2HA 2GCGA 1V16B 1XZJA 5J2TA 1GSAA 5ALPA 3BRWA 4AU1A 3QFSA 1I0IA 1CQIB 3FTDA 3I2KA 1I2MA 3G2QA 1T36A 4KBYA 4LZJA 5HEKA 4W5QA 1O0BA 2AJDA 4UBKA 4LXTA 4PXAA 5CA1A 5ER6A 1CY2A 2JCBA 2J9GA 1JMVA 2CFRA 2W7TA 4ZCMA 4IZHA 2MSNA 3ZOZA 2W11A 3K0EA 5A1TA 3K0CC 4JQZA 3T9BA 5TMEA 3TCNA 1UMKA 2SKEA 3ROXA 2OP1A 3GRVA 4D92A 2ZWOA 3SLGA 3ZWWA 1G6Q1 2XWPA 4KXYA 1H0HA 4KPGA 4KIGA 3GEDA 4PGAA 2ZB7A 1YBAA 3OFJA 3WHPA 2WUWE 4BMDA 3FPSA 3LBYA 3RVNA 3A05A 3ZKWA 3RYTC 2F3SA 2C7VA 1DC8A 3DMRA 3KOYA 2P30A 1Q1BA 2RARA 3LQ1A 3G2HA 5DYTA 1EWVA 2Y27A 2OORC 3ZJVA 3MD0A 1Z56C 4NFYA 2O59A 4WZBA 2Y1WA 1SUCA 3OX1A 4Y0VA 3TSOA 1OH6A 3CB4A 3BMQA 3IULA 4JK3A 3VKWA 1G8AA 3ONFA 4HUJA 1CJSA 2FEAA 3IT2A 3NO4A 3RVBA 1KKLA 4KUEA 2QN2A 1NU6A 1RWMA 1T15A 1SC1A 4KWEA 5LKRA 3IL2A 4QE3A 3BFXA 2WSLA 4OX9Y 2X76A 3GFTA 4YGYA 1WDLA 2AQKA 1NJFA 5HIMA 4IIVA 4OX9B 2K4MA 1K86A 3WO0A 5FTMA 2RHWA 1XEWX 3CZCA 3PGKA 3GFFA 1KMHA 2G8NA 4RY2A 5FTWA 4MR7B 4RPGA 1IN7A 3ZXXA 1ISRA 5AJWA 3CKKA 3OC6A 3ELUA 3I1FA 1TAUA 3QOFA 4NJEA 4PZYA 3U3XA 5IJ0B 1I33A 3H7IA 2DX7A 3C14C 2D5LA 3IPYA 4DKXA 2XBUA 4J3JA 4S2EA 4LS3A 4INOA 4UDNA 2AMFA 5F7OA 2ATVA 1DINA 1YA8A 4K6GA 4ZAGA 1SBZA 1RYHA 1J1IA 3AEUA 3L1HA 3HSSA 3Q1KA 4FT2A 3P8ZA 4L2IB 2H2FA 2C5GA 5FI5A 1VIDA 2A35A 2VK1A 4OA5A 1XQ6A 1OF1A 2EKPA 4NJOA 3F8TA 1Y9EA 3PR2B 2G1PA 2P69A 4BO9A 4WOKA 4MH0R 5C1DA 5C2JB 1DKRA 2G6BA 1BS2A 2CL0X 2PLNA 2VLIA 2V6FA 4ZT4A 4EATA 4FYPA 2I6SA 1W1UA 1TEVA 2OCIA 2LCQA 1O9HA 3SU8A 5HJ5A 1QOZA 4GGPA 1LSJA 5CJJA 3CPSA 1IBMB 3QEAZ 2VNSA 2VP0A 2PIAA 4UUPA 1ZGHA 5ITSA 1X7WA 4GAEA 1GPJA 5EZ5A 3NUZA 4MUNA 1FC0A 4GNKA 1PX0A 4ZO8A 1LZKA 3S5UA 3D4NA 4IR7A 3MJCA 4R1TA 3E84A 5CYOA 2DWCA 1UMDA 4Q9HA 1UDAA 4BGDA 5LIPA 2WAOA 3TPZA 4KOEC 3WMXA 1JEYA 3NTUA 5JS1A 4K6FA 2CGEA 4YJHB 4FSXA 2YS7A 2HXSA 3R6TA 4HO1X 1C14A 1W5FA 1QK3A 2X13A 3ITNA 1V43A 2N46A 3GO4A 4JODA 4BAZA 4EI8A 2UU9B 3H4IA 1W4LA 3QVKA 4Q9KA 1NVVQ 1H94A 2WF9A 4I4TB 2X23A 2ZRIA 5EPOA 3Q8LA 2OUIA 5HJ7A 2JJ2D 4KSCA 3U3DA 5BWOA 2FPIB 1WKBA 4B40A 2EU8A 3IJPA 3C45A 5H1YA 4D8TA 1O0CA 3F47A 5KAMA 2O0HA 1LVUA 4D0GA 4J94A 4ZMRA 1E5LA 3HU5A 3SDBA 1R0YA 2JH3A 2WWTA 3V4LA 2RH8A 4YAUA 1OKKA 4PTYA 5DW0A 3TCKA 2HJVA 1KI2A 1QYIA 4NZYA 2BGUA 4QX6A 2X6QA 4HDSB 2Q9CA 4MWBA 5DOVA 1YO6A 3EMKA 3LYHA 1PJBA 3O9MA 3P4XA 1PJ2A 1ZY2A 2PMDA 4MWGA 2I55A 4Y1EA 2VYQA 2I78A 4Y7DA 5EUCA 2Y1XA 2O0MA 5KX5A 4MVJM 3HUTA 1JTVA 3H1PA 1WHSA 3NCHA 5LBTA 3D8UA 2B4KA 4CFSA 3V8BA 3PQ8A 5IN4A 2WKWA 1D9XA 5FLYA 4E33A 2GPWA 1MD9A 1I24A 2XADA 1HFWA 5EZSA 3E7WA 3B7PA 1RJEA 4I9HA 2YHSA 1Y63A 1QFYA 3AMVA 1DWOA 2RGYA 3P2OA 3UMRA 1YQXA 2WPNA 4ZJYA 3CKLA 1XAHA 2J9FB 3PTLA 1F38A 3SHVA 3TK1A 3DAOA 5C4IA 3CRZA 4PG7A 1F6WA 1IB0A 5EL0A 4B3TB 1TKBA 2VF2A 3TLXA 4B8YA 1FVHA 3S2EA 1I0ZA 1YHZA 4WBNF 2WJHA 4INPA 5ALUA 1EKXA 2DPGA 3V9PA 3VR1A 3UJ8A 2B78A 1OT5A 1UXHA 3K70D 5CW1A 1UBRS 1W9MA 3SZMA 2PLRA 3AR9A 1BE0A 3ZCQA 2QB5A 5CVCA 1KR2A 1K66A 2D0DA 3GDOA 5BVHB 3ZCUA 4ZN6A 2WC1A 2RC6A 3OTHA 4IJQA 5A3SA 3V32A 4CG0A 2PUVA 2R6R1 3FGOA 2WD9A 4GRAA 3TL3A 4HB2A 3NW9A 3KOZA 1E7QA 2FRDC 2YZ7A 4K26A 4CMHA 1QQ7A 4IEFB 1Y1SA 1TMOA 2PRZA 2BGGA 1UPTA 4DANA 5ECYA 3P9CA 4EY3A 1N7JA 1K9VF 3IP9A 4WLNA 5D1HA 2C4VA 2H2AA 3FMFA 3QJ5A 2ISCA 4EKDA 1V1MB 3HMQA 4I7EA 3IBGA 4I2VA 4KCGA 2WNIA 3MT7A 1JFVA 4NONA 4OI4A 1T9GS 4QNMA 3DLTA 4Q9IA 5GY7A 5HF9A 4N4AA 1JNXX 1WPGA 1KMNA 4R6XA 2AKYA 2E82A 2GCNA 1F1JA 1DX4A 1X13A 3NVAA 4WA7A 3SIXA 3VNUA 1JBKA 4HSEA 2D5CA 3JWPA 3ND5A 4LQDA 1IN6A 4BLQA 1SQFA 1UOPA 1Z6TA 2QWXA 1C3OA 1JPNA 3Q7TA 4UEQA 1RC8A 1GZVA 4Q39A 1GM5A 4ZFNA 1XTZA 5DHQA 4AWBA 1UBLS 4MV0A 4XUDA 5E9JA 1Z22A 4ARZB 4BS9A 4DC9A 1QFSA 1R0LA 5AHKA 3THXB 1NMYA 3H1AA 3H4MA 3RYFA 3UGKA 3ZHUA 5BWBA 1YJAA 1QCZA 4ZYVA 5AVZA 221PA 4WI1A 2NWQA 4JBIA 4HEQA 1N2OA 4KAAA 4E31A 4HWTA 3IOCA 4EP1A 2F8SA 1GZ5A 1U8CB 4MYUA 3ZV3A 2LIPA 3FYSA 1IJFA 1PD1A 2XJ9A 2YWHA 3MTIA 1DIHA 3WHIA 5J2UA 2GK6A 4LZLA 4A0RA 1X7HA 1YRAA 4AULA 1IBLB 5KNCH 4PHTA 1IM5A 3KLOA 3QMMA 4DRXA 5ED4A 2GK3A 2M98A 2JDID 2NV6A 4MUEA 3R20A 4K05A 3QTBA 3CCBA 3A6KA 1HE4A 4R1LA 3R0ZA 4QT0A 4X90A 5B6IA 4S1TA 5JCZA 1X86B 1ZOIA 2WA1A 3U40A 1ACJA 2WF6A 2Y1GA 5BSUA 2HO5A 1VHQA 5KTTA 3H99A 3NOVA 3UV6A 3MWDA 3PNMA 4KK3A 4YRDA 2IXGA 3WAGA 1DJLA 5LLDA 2WDZA 5BSVA 1GLNA 2EC5A 2ZAGA 3HDTA 1VJGA 2HBYA 4AJJA 3S2GA 3SZ3A 2FUCA 2GQ0A 5KTOA 1CBUA 4DUGD 4IGKA 2VQ6A 1HQDA 2FMXA 1G7RA 1MRZA 3IAAA 5HCNA 2HY7A 3TLYA 3VNBA 4D8WA 3ADDA 1H23A 3O8OB 3LFTA 3E35A 4LZPA 5JHHB 3H7AA 4GDMA 2HEIA 2UZ4A 3L46A 5CRIA 4EFNA 3A3OA 2CNKA 4DOMA 4CIDA 1VL2A 1GFZA 4UM5A 4BTVA 4B43A 4Q16A 3AX6A 2O2DA 3IQDB 2ATXA 4L02A 4UTXA 4XSVA 1ZK2A 2SECE 1A8UA 2PM8A 3V3TA 1W8IA 2BEVB 4B7ZA 1G7SA 1CUEA 4IVQA 1NFQA 1NW3A 3PI7A 1XDSA 2AMYA 4MKGA 5GM2A 4GXRA 2AWOA 1AC5A 1BSVA 4NYIR 5U1PA 4W9NA 4F45A 2CLSA 2ZWAA 1BDHA 3QEOA 4ZVNA 5K3AA 3AR7A 1D2RA 1ZUIA 3BVPA 3IVCA 4Q7JB 2HN9A 3SYMA 1X42A 1ZM9A 2Z2YA 4K03A 4HB0A 1CP3A 2AA3A 2G71A 1MOQA 3KR0A 3KOOA 4MUFA 4XQGA 2WPDA 3K94A 1SBHA 3GIWA 4PBTA 1I1NA 2B83A 5DHAA 4AG6A 4Q66C 1AHPA 1SXPA 5MGNA 1P7WA 2JH9A 5AYVA 3IQIX 1GZSA 4LWZA 4YAOA 2HMAA 3U4IA 3K1AB 4JH0A 5CP8A 1XWIA 4JJ8A 2RGRA 5HVNA 4OFBA 3JQAA 1VJCA 1AXGA 1NQOA 1WSBA 2ZRKA 1MX1A 3B3FA 3R2JA 4I5EA 4PZUA 5HGJA 1IM2A 1N6OA 2Y1KA 4GLOA 5FA8A 5HR5A 3IA7A 3VMFA 4F8EA 3QEMB 3KOUA 1R8XA 5IT4A 3DE2X 5FXMA 4QUIA 1JJAA 5CVDA 1AU9A 3IE1A 5D7BA 1GG2A 5AK0A 1KSFX 4WJZA 2G1JA 2FOIA 4TTSA 2A1IA 1MIOA 1CDDA 3M2PA 3RFFA 1NT4A 2VJAA 1GR0A 3TIGA 1T1SA 2QLLA 2W43A 3OG9A 3WMRA 2H5LA 1VFNA 4MW9A 5CK5A 3GJQA 1NFFA 4D96A 1XU9A 1W5AA 3JZIA 1EX9A 2EF0A 4FGZA 5BNFA 3GDGA 3SZRA 3K2QA 1MTOA 2FR8A 3VSAA 2PWZA 2W6JD 3EEQA 3JYOA 4LQCA 3Q8XB 5AKGA 2FSVC 3NTOA 5TVKA 2DAPA 5D84A 1W48A 1N5MA 2ASEA 3RS0A 1Z82A 3ED1A 3GIDA 2FJPA 4S1NA 3GA0A 3GDHA 1YR9A 1VE6A 4KPYA 3WOVA 4UEOA 3RIEA 2BF7A 5CBPB 1L5SA 2QAGB 1NXOA 3AONB 3BIWA 4HDRB 1P72A 2H4WA 1Q17A 2ZJ5A 4BO3A 4WJLA 1ZRNA 3L8ZA 3Q6IA 3KDAA 1Y98A 3PT5A 4IIGA 1DIOB 2BYTA 3AGPA 3ZLUA 5AOVA 1GUYA 3ZIAD 2IXDA 3I61A 3ICVA 3VR3D 2E4YA 3OCJA 1KU0A 3SKVA 3KQHA 2HRBA 1L7PA 1Z4LA 1NYLA 2J6BA 2NQ8A 1E92A 4IBOA 1CETA 3VU9B 1ISFA 4F4HA 3CE9A 5A4FS 1A9PA 1TQ2A 1WX1A 1SU7A 2Y9PB 1SQ0A 3HJTA 1E0SA 4XDYA 1ZUHA 1UBGA 3N74A 4KU4A 2QXYA 3NG1A 1M3SA 3EVEA 4GOOD 1X80A 2R751 1NI3A 3OZEA 2FMKA 5J4KA 2R3SA 1N0IA 1ZJYA 4GOKA 5KYYB 3JWHA 1ZHFA 3I09A 3NZEA 4JYMA 5EYPB 2GZ1A 1JIUA 4BQFA 4QO7A 4XR9A 2VP5A 2EG5A 3A25A 4HZUB 4RE6A 4E15A 1VB3A 4H18A 4UFOA 2SNIE 1RPNA 1SO8A 5JO0A 2PD4A 3J80A 4Q0MA 2VDKB 2R6HA 1V3VA 5HIKA 1GPAA 1PHRA 2I7DA 3MWEA 4V02A 1B14A 4U6QA 1FIUA 1H8ED 2PUBA 3ESXA 3GUVA 5L95A 1C7JA 3DGFC 3FZNA 1K7CA 5HF5A 1SOAA 3OTQA 3NH9A 5KWSA 1QH0A 2PU7A 2PGIA 4Q6BA 2FZCA 3E22B 2W6ID 4R1QA 4XIGS 3E18A 4PZCA 1QKIA 1NJ5A 3Q8WA 4LN1A 5BQXA 5KYVA 1CY8A 3WWOA 3IFSA 3LT1A 4FQ5A 4EHLA 3FY4A 5LFAA 3KUCA 2CWDA 1CUVA 5TPZD 1QBKC 3OEHD 3O8NA 4KEAA 1ZEMA 4ZZ2A 4MR8A 4BECA 4ZDWA 5DTIA 4KQWA 2M1XA 3G0HA 1NXSA 5K8VA 2CUNA 1XZBA 3BQMB 3U80A 2WLSA 1P60A 4YFYA 2XB6A 1UQUA 1ARZA 2DUWA 2XMQA 3R40A 3O95A 1O6CA 3FYTA 2DTEA 4GM4A 3NHYA 1D7OA 2A9FA 3K0BA 4E07A 4EB3A 4QDOA 3HADA 1PQWA 3I5XA 1EVQA 4PLYA 3A4VA 1LLCA 3UPUA 2I3DA 3AM1A 1INLA 3HFGA 4BV9A 4C3VA 5DCUA 1KO1A 3MGAA 1UQTA 3RO7A 3UOWA 1U3DA 2ZYGA 1EWKA 1U3FA 2ZYRA 3LUDA 1QVWA 3LYAA 4OQQA 4C0WA 3AFNA 2PIDA 4HK4A 2I2DA 4MW7A 4N5HX 5I7OA 2C03A 3J7AC 2QX6A 5F5XA 3KYCB 1UOOA 4KE9A 5GIOE 1V8OA 5ECDA 5ETJA 3HYTA 3H2HA 1UK9A 4L4SA 4NE2A 1T4BA 3U4HA 2UUPA 2VQ3A 3INGA 1NSTA 1UCFA 2ETXA 2OSVA 3KQYA 4I55A 5JVDB 4OTZA 1RDFA 1QTNA 2OCKA 3H4TA 4NCJA 4M89A 1B8UA 5CU7A 3RU7A 1P1CA 1XYGA 3PSAA 2OM2A 3C1AA 5J23A 4AQYB 1ISGA 3NMUF 1M6EX 1LJUA 3W5SA 3FHTA 5EIFA 3RGGA 2C9YA 2V0CA 3A31A 3ZWYA 3ZKAA 4X91A 3WLJA 1W36B 1YT5A 3NHBA 2QSYA 2NQTA 5JQWA 3PIIA 1P7PA 2BBOA 1IXKA 5F4BA 1L7NA 1TA0A 3S99A 4D4JA 2Z9CA 2ZT6A 3TNDA 1Y42X 1CYEA 3KNZA 4O2BB 2H5EA 1O6FA 1P81A 3EMVA 3IUYA 1MC5A 1TIPA 3CEMA 5JJKA 1L2TA 1HGXA 1U80A 4HNGA 5EG5A 3SZUA 4NCHA 5CVTA 3I58A 5ALYA 4BASA 4F72A 4YJFA 3REOA 5A9RA 3D6TB 3KYJB 4AMBA 5KOJA 1YCGA 2ET6A 1ZBDA 3NKLA 4F60A 2J07A 3E3NA 1GPH1 2AVNA 3A9RA 3RKSA 3JQGB 3HPQA 4IDEA 2VUHB 2C95A 3U5TA 3BCHA 4JI6B 3ILHA 2ZUDA 1J56A 1O58A 3ZCXA 2H5IA 1HQKA 1KBQA 1B00A 1L7DA 3JRXA 3GC6A 1WNFA 1G3QA 1UANA 2IA5A 2Y0EA 4GPTA 4MP6A 1UPUA 2EW2A 4LPSA 4DG9A 2VAWA 1E1LA 1QZTA 2JZCA 2Y9MB 2P6PA 3EDMA 1M9NA 3LLUA 3NT5A 5GZ6A 4BJ6A 2XCRB 4CI9A 4YRKA 4BEJA 3RADC 1BTOA 2CHGA 2PHZA 1EBUA 3MJSA 1SVWA 1YE8A 2WE8A 1DRJA 3RRYA 1R88A 2HSZA 4AXXA 2ZR8A 2ZRHA 4G1BA 2Y99A 1R5OA 1U5AA 1DO8A 2ZUUA 3AHIA 2JJ2A 4OAPA 4YJKA 4EO4A 2IEDA 5IX8A 4PFJA 2O2CA 2QD3A 4D43A 4ZEMA 2HMSA 5K3DA 3BOSA 2X9VA 3OQHA 1XAJA 3MHTA 1M2EA 4LDRA 4EPWA 3OKCA 2EQ5A 1UDWA 4AUMA 2J5KA 2TRSB 2RCNA 1RRCA 5EKXA 2VIIA 3AESA 1CT9A 2NTVA 2ZT7A 4ZZ1A 4HFMA 2H2DA 4FD2A 3I9KA 2JEOA 1RWWA 3EISA 2DPLA 4IZIA 4Q7LA 4CF6A 2ZSUA 4MLDA 4CBVA 1QONA 1Z3CA 3ST7A 3M6XA 2JAQA 4X1KA 5M34A 5AKHA 2C98A 3RM3A 3LO5A 4U7TB 4Y2QA 1FA9A 1YK1A 2QK4A 3GG2A 3OESA 4XQEA 4EA7A 5CFNA 4PXSA 1QYDA 1KYYA 1PBTA 2VH5R 3M3PA 4IWYA 2FPGA 1TIBA 3UW1A 2Y76A 1IZ7A 2J08A 3FAKA 1G291 3D59A 2X40A 1I1QB 2OAEA 3EZ2A 2AE2A 2CDBA 5BQ5A 4P33A 1V7CA 4YUZA 1QRUA 2HUNA 2F9FA 3VSDA 4BNKA 3LWDA 1DHRA 3LDAA 4BLRA 5EJ7A 2IOHA 4C4ZA 1BXKA 1U2DC 2HH9A 1WRBA 2RG7A 3OF5A 4HGRA 3SR3A 3EA0A 1J6UA 2EWVA 3JSAA 1Z26A 3PNYA 5BSMA 3QYPA 3FB4A 3HNOA 5JDIA 4KMMA 1J2UA 3OLVA 2R4UA 4EZEA 4DW8A 2EJCA 4RKWA 3WRVA 5HUJA 3A8TA 4I5IA 1EJBA 2G5GX 4O4IB 5TX7A 5TGZA 5FJIA 5B6JA 3ZLJA 2FN3A 5TQ0B 4MGZR 3ICQB 1WU8A 2BCEA 2OO7A 1ZG3A 5DRYA 1NC3A 2OV1A 4LJ4A 4DCOA 1RM3A 2E85A 1UT5A 4U6NA 1TECE 3AOEA 1JI3A 2ALJA 4HVCA 3CR8A 4LHVA 2RK6A 4O2BF 4AS3A 4BRWA 5EJEA 1PCXA 1FP4A 2LXNA 5ECWA 5JWHA 2YHUA 3VUFA 1PFKA 3ERCA 3F73A 1SXIA 3FPAA 4F0JA 3L49A 4JA2A 1ISIA 1NP7A 3EXFA 5BN3B 4HTFA 3EUWA 1O94A 1E7RA 2WM9B 1A71A 3AY0A 3LAWA 3KJXA 2PANA 4B8ZA 2IXTA 3IEUA 2IEBA 2QTVA 3STTA 3OQVA 2H9IA 2C2MA 1ADJA 3OJXA 5IKOA 2B2XA 1J97A 4B31A 3BGWA 4BU0A 4KQCA 4EUFA 2R8ZA 2W2QA 4IDQA 4LJ9A 1FJ2A 2QOEA 3ZBPA 3NNDA 5I4CA 1QHEA 1E1DA 2GZ2A 1JHOA 3PWKA 3BH6A 1OA0A 5EMHA 1LLUA 4RXUA 1U4SA 2ZWVA 4O4JB 3RRZA 1P4GA 2YXDA 2OFFA 3IEXA 3KZ1E 2VTBB 4BNTA 3R5SA 3N8KA 3F97A 1R4MB 4KDCA 5DCYA 5EHGA 2JDIA 2Q4OA 3MBKA 5TT0A 3BX1A 4LHXA 5HGXA 2JI4A 1E3WB 4QDKA 4XCQA 4L5AA 4AW9A 2FKAA 2YY5A 4EZIA 1FFWA 2X14A 1XD8A 3CNBA 1YQQA 4YCAA 5F12A 3VM6A 3WL6A 4C76A 5KVSA 3TM5A 2CYAA 5JD4A 1V9CA 4V0KA 4MQ4A 1ZEJA 3PJDA 3QUCA 3R0IA