5LR6A

Crystal structure of comt in complex with [3-(2,4-dimethyl-1,3-thiazol-5-yl)-1h-pyrazol-5-yl]-(4-phenylpiperazin-1-yl)methanone
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
215
structure length
212
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of COMT in complex with [3-(2,4-dimethyl-1,3-thiazol-5-yl)-1H-pyrazol-5-yl]-(4-phenylpiperazin-1-yl)methanone
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 77
structure length 212
sequence length 215
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lr6A00
4HC4A 3BGIA 3MCZA 3TM4A 3FTEA 1WS6A 3G7UA 5B1SA 4RV9A 3G2QA 3GWZA 2PX5A 5C9ZA 4PONA 3KPUA 3P97A 3UJ9A 5DX8A 2OB2A 3DMFA 2CWWA 3DXXA 3IV6A 5GP1A 1M0EA 4EQZA 3PLAE 3FYCA 4GEKA 4Y2HA 3REOA 1XJ5A 3UWPA 5ERGB 3U81A 3A4TA 4DF3A 2YXDA 1RI2A 5T67A 5K09A 3LX6A 3B5IA 1OR8A 3BUSA 3SX0A 1JG3A 4YUWA 3TPZA 3UJ6A 2PGXA 2R3SA 1NV8A 3OPNA 1U2ZA 4LWOA 4H0NA 3DXYA 3E23A 1DUSA 4EKIA 5BXYA 4KDCA 1ZGJA 2PJDA 3TR6A 1X1BA 2K4MA 3P9KA 4RYLA 4MHTA 1R74A 2BM9A 1XDSA 5GM2A 3HCDA 3EVFA 3C0KA 5F2OA 4ATNA 3MCTA 1KPIA 3FUTA 3AXSA 2IP2A 5FHQA 3EPPA 3ELUA 5DTRA 3TLJA 1VBFA 4FR0A 2CKDA 1YZ3A 1EAMA 1X1CA 3A27A 2ZWAA 5K0NA 3T7SA 3TFWA 4POOA 3SMQA 2YVLA 3EVAA 5FCDA 3A7EA 3SR4A 3BGVA 1H1DA 2UYQA 3EVDA 2GPYA 3DLIA 3GRUA 4E2WA 2P1DA 4R8SA 3RIEA 1R00A 3E7PA 3M70A 2IPXA 2G8NA 1RI4A 3KR0A 2H1RA 3O31A 3UFBA 4C04A 5CCXA 1EG2A 2C7RA 1DCTA 1PRYA 8MHTA 4PYNA 1JG1A 3CGGA 3KPVA 5K0CA 4LWPA 4RTMA 2OB1A 3PFGA 2O06A 1RJGA 2HTEA 2HNKA 2Y1WA 2F8LA 1ZKDA 1I9GA 2NXCA 3KQYA 3M4XA 3FTDA 4X1OA 1JG4A 4XUCA 5DT2A 3C6MA 3B89A 2AN5A 5HOQA 4HSGA 5K01A 2QRVB 5C0OE 3VC1A 3M6VA 5HIJA 4OA8A 1YZHA 5HIKA 3D2LA 5GIOE 4P7FA 1F3LA 1NW8A 5U4XA 3KR2A 3UJBA 2QYOA 2IGTA 1R18A 2PV0A 5JUWA 2AOUA 4GC9A 3UBTA 3CC8A 2XYQA 5FHRA 1NV9A 5ICCA 1XDUA 3GIWA 2ZULA 5E9JA 5CCBA 2P3LA 3FUWA 4IV8A 2AOTB 1ORHA 2CL5A 3FPEA 2BM8A 3FUXA 3GDHA 4LECA 4E30A 3DULA 4YV2A 5IKMA 2DULA 2IH4A 1D2CA 1RJFA 3CJTA 2PBFA 1AQIA 4BLWA 3VYWA 3BZBA 1NKVA 2PXXA 3UA4A 5DLYA 4HGZA 5GWXA 3GCZA 5DRYA 3UJ7A 1KP9A 5E8RA 3EVEA 3K6RA 2UYOA 5FQNA 5DPMA 3RW9A 5H02A 2V7EA 4P58A 5BP7A 2ZWVA 3NVMB 4GOND 5DXAA 4ER3A 2P3OA 4M38A 3OU6A 1RI1A 1IM8A 4QPNA 1D2HA 3DUWA 2AVNA 4YV1A 3TRKA 2NXEA 2JG3A 5E1OA 4RVFA 3G2MA 4X61A 4U7TB 4PYLA 3PTAA 3AY0A 2FHPA 5LQKA 4GOOD 1KPGA 2HMYB 4PYKA 4YMGA 2UZ4A 3BWCA 3QOXA 3HVIA 5D1NA 4ER7A 2G1PA 3TKYA 4OQEA 3M6WA 1WXXA 3FRIA 4IKPA 4GOMD 2ZIEA 3MHTA 1G6Q1 4CKEA 2EJUA 3ELWA 5EOVA 2H11A 3NDJA 3LCCA 3GRRA 4GOLD 4B17A 4EVIA 2AOUB 3FPHA 3R6TA 1XDZA 3MQ2A 4KVZA 3R0QA 5EGSA 2ZLBA 3MGGA 5GOZA 1QZZA 1NBIA 2G72A 2IFTA 3LBYA 4IV0A 5HILA 4E2XA 2PT6A 3FZGA 1YUBA 2GAFA 3UJ8A 1NW7A 2CMHA 4QPPA 2P35A 4DMGA 1HNNA 2CMGA 3KQQA 2FCAA 3BKXA 3HCAA 4PYMA 2IDKA 1JSXA 4XUDA 3K0BA 3T0IA 1FJXA 3R3HA 1WZNA 5ICGA 4RSRA 5FA5A 5K8VA 3JWHA 3GRVA 3G2OA 4C06A 1ZGAA 3HNRA 4PNEA 5CVJA 1XCJA 2AZTA 2VDUE 1N2XA 3OZSA 3ELYA 1KYWA 3BT7A 3KQTA 2QE6A 2EJTA 3M6UA 3SSMA 3ME5A 2AOXA 2C7OA 5FA8A 4RVGA 5HIMA 2AN4A 3THSA 4DCMA 3UJAA 4CXMA 3I5UA 4M7RA 2NP6A 3G88A 3G5TA 2PVCA 3PB3A 4FT2A 1UWVA 5KS2A 1WY7A 4C4AA 1F38A 1JQDA 3KPWA 5K05A 3QOWA 2I62A 4KRGA 4CWAA 2EFJA 4MQ4A 3VC2A 5CIYA 2B9EA 4R6WA 4KIGA 3RODA 4AX8A 1KHHA 1O9HA 5M5BA 4QQNA 3PS9A 5DSXA 3GU3A 1HMYA 1ORIA 3THRA 1G60A 4E70A 2PXAA 1DL5A 2FYTA 4V0QA 1N7IA 1VP9A 3M33A 4KDRA 2OZVA 3DMGA 4ER6A 3EVZA 3EVBA 1MHTA 1P1BA 1YB2A 1X1AA 3CJRA 3HA5A 3HVKA 4PIPA 1QYRA 1VLMA 3DLCA 3KR9A 4QVGA 4BLUA 1P1CA 3OCJA 5BW5A 2ORED 3LL7A 2PY6A 3I64A 2R6ZA 2ZZKA 3QV2A 5BW4A 4ZTBA 3P71T 3BWYA 4A6DA 3OZTA 4GUAA 2O0LA 1XCLA 4HG2A 4CKCA 2PX4A 5EVJA 3EEYA 5LR6A 2FRXA 4YV0A 2O05A 1R8YA 1R6AA 3MAGA 1RJEA 5EG5A 3T7TA 1JQ3A 1G55A 1N7JA 2IDJA 4ER0A 3KPJA 4RTRA 1G8SA 3PX3A 3Q87B 3O7WA 4DQ0A 2ZZMA 2ESRA 5LSAA 1EIZA 4DCGA 4PWYA 2HWKA 1NW6A 1RI3A 2P8JA 5CVVA 3TQSA 2AVDA 2AR0A 1L3BA 3KPYA 4C05A 5DTQA 5DM1A 1KR5A 3UJCA 3ERCA 1JQEA 4OX9Y 3T7RA 2JHPA 3B7PA 2UYHA 4DKJA 2IH2A 3IYLW 4PYQA 1MJFA 4PIMA 5E2BA 4PINA 4YUYA 5KQSA 2PX2A 3A25A 4O29A 4OA5A 4U7PB 5DWQA 3FTCA 3LSTA 2I7CA 3EGVA 5K0JA 2PKWA 2FK8A 2JJQA 5DTMA 3FPJA 5LQJA 3LGAA 2AOTA 2ZIGA 3CJQA 3HA3A 3P2EA 3NJRA 3P2KA 3UZUA 3GGDA 2B25A 2WA2A 2O57A 2ZBQA 3BKWA 3TMAA 2BR3A 5EEHA 1FBNA 5JR3A 2OKCA 1P39A 2YXEA 2GLUA 2PLWA 1SUIA 2XVAA 5EIFA 4E32A 5EMLA 4RTQA 4PYOA 1VIDA 2NXJA 2A14A 4GQBA 3M6XA 5F2KA 1SQFA 2ZBRA 3HCCA 1KYZA 3FPFA 2ZSUA 3GRZA 3GJYA 3P8ZA 3OE5A 3P9CA 4HTFA 1SQGA 2FK7A 2GH1A 3P9IA 4M36A 2ZBPA 4QTTB 5HFJA 3G8AA 2P40A 5EEGA 5F2NA 4HH4A 3WSTA 5E9WA 4RTKA 3KR1A 5E2AA 3X0DA 4CTJA 5DM0A 1BHJA 3I58A 1FP2A 3OU2A 3ER8A 4C03A 4BY9E 4GC5A 5K0LA 1Z3CA 3EGEA 5K0FA 3OE4A 5HEKA 2IIPA 3HCBA 4L7VA 1SVUA 2V74B 2YR0A 1M6YA 4PGGA 5GINE 9MHTA 2Y1XA 3O4FA 2AN3A 1AQJA 4QDKA 4YUZA 1TW2A 1G38A 5CM2Z 2OYRA 5T64A 5LQRA 4RTOA 2Z6UA 3LBFA 3EEOA 3KQWA 2EX4A 3ER9A 1IXKA 2DPMA 2ZCJA 4QVKA 3B3FA 5DSTA 3KHKA 2I6GA 4F85A 4YUXA 4FS8A 2B78A 1P91A 4YMHA 1TPYA 3BGDA 3FUVA 3LKDA 2BH2A 3LECA 3DH0A 1VP3A 5E8JA 3C3PA 5EKXA 1B42A 1QANA 5K0BA 3ID6C 1XTPA 4MTLA 3I9FA 5HZMA 4NECA 1QAOA 1BC5A 4LG1A 2P7HA 2P41A 3EVCA 3L8DA 4PYIA 5DM2A 1WG8A 5FWAA 4F86A 1JTEA 3PX2A 4P7GA 3G8BA 3EMBA 2QRVA 3E05A 4Y30A 1IY9A 3GXOA 4K6MA 4RWZA 4BLVA 3HVJA 3LDFA 5EMMA 5E1DA 5K0GA 3DXZA 3DP7A 5HIIA 3H2BA 5EIWA 3SSOA 1X1DA 2PX8A 2JHAA 4R05A 4YUVA 1JG2A 3AXTA 3CBGA 4BP3A 1NT2A 1V39A 3FPGA 1TW3A 2ADMA 3SXJA 1EJ0A 5E1MA 4AZSA 1ZHFA 1RJDA 3KKZA 3LCVB 5IH3A 1UFKA 1Q0SA 2H00A 3UJDA 4RTNA 3GNLA 4RTPA 3HEMA 2GA9A 5CUQA 3JWIA 1PJZA 3SGLA 3KQVA 2ERCA 2IBSA 3G5LA 3SSNA 3NWEA 4JXJA 3SVZA 3KQMA 1WXWA 5E1BA 4DM3A 5EHGA 3SM3A 2NYUA 2B3TA 5C1IA 5ICEA 2Z6AA 2IH5A 5CVUA 2YX1A 1SG9A 2B2CA 3KQSA 3UA3A 5LQUA 1X19A 3CCFA 1SKMA 2QM3A 3B3GA 1XVAA 1XXLA 2BR4A 5K0EA 1KIAA 3DMHA 3R24A 5FUBA 3G2PA 4RVHA 2OO3A 4X60A 4RTJA 1G8AA 3A7DA 4FT4A 2AS0A 1EJ6A 2XYVA 2YUIA 4HRAA 2FPOA 4MIKA 3OFKA 1QAQA 3LDUA 3OU7A 4A6EA 1YFJA 3S68A 3P2IA 4XCXA 4ISCA 3PT9A 4EK9A 3EGIA 4UOEA 4RTLA 3A26A 4DA4A 3B3JA 2ZTHA 4OBWA 1D2GA 3TM5A 3ANXA 2UYCA 2ZFUA 1BKYA 2PXCA 3DOUA 4EMSA 3HP7A 3ORHA 5T6BA 3MTEA 2AOWA 1VE3A 3FYDA 4RTSA 5KVAA 5FULA 2O07A 2ZW9A 2NP7A 2PT9A 3V8VA 3VSEA 2QY6A 4AZVA 2PWPA 4OBXA 4E31A 3V97A 3BWBA 3CVOA 4RVDA 3HCEA 5EHIA 5GIPE 2JH8A 3FRHA 2ZVJA 5KYGA 5K03A 1YF3A 5EMJA 2ONZA 1T43A 4QQKA 4CKBA 2XBMA 5DX0A 2NNWB 4FP9A 4BP1A 5CD1A 2KW5A 3FUUA 2AOVA 2ZIFA 1L1EA 3NTVA 1SUSA 1KXZA 2OBFA 4P7KA 4R8RA 2NXNA 2HR1A 3PVCA 3NW9A 5EQJB 3ELDA 3OFJA 1JTFA 4FSDA 4IWNA 5D1HA 3PFHA 4ER5A 3JWJA 3BXOA 3G89A 2WA1A 4G56A 5EZSA 1O54A 4E2YA 3P9NA 3BWMA 1NE2A 1NW3A 3GRYA 3KU1A 2VDWA 4R6XA 1VQ1A 1FP1D 5EMKA 4KW7A 5LQAA 2BZGA 1JSZA 1VPTA 3LHDA 4AUKA 3R9XB 2I9KA 4WVLA 5FADA 3MERA 4KWCA 4X41A 4MWZA 3JWGA 5DM4A 1O9GA 3C3YA 4QDJA 5LQNA 2ONYA 4GBED 3CKKA 3IEIA 5P8WA 3NMUF 5EPEA 4PCAA 5FWDA 3LPMA 1Q0TA 3MTIA 4Z2YA 3TKAA 5GM1A 4RX1A 1VL5A 1FPQA 3E8SA 2OPBA 4P7JA 2ZZNA 3DTNA 2E5WA 1KPHA 4C07A 3HTXA 1I1NA 5EKUA 2HV9A 3HA7A 2N47A 3NWBA 5FQOA 3LKZA 5G02A 1ZG3A 4M37A 2Z6QA 4PCLA 2OY0A 2XYRA 4WXHA 5FTWA 1NBHA 3KQPA 3KQOA 1L3IA 5E9QA 3FTFA 1EQAA 3NVKI 1L9KA 4E33A 4FSXA 3F4KA 5MHTA 5ICFA 2WK1A 1JR4A 3EVGA 4HTFB 1AV6A 3I53A 2PSSA 4PGHA 4E2ZA 4XUEA 4HGYA 1BOOA 2GS9A 5EC8A 3TOSA 3NDIA 2C7PA 2C7QA 2GB4A 4KIFA 4DZRA 3LDGA 4X63A 5DRTA 4AZWA 1ZQ9A 4EKGA 3HCFA 10MHA 1I4WA 5KQRA 2LD4A 1M6EX 2G71A 1INLA 2Q41A 2PWYA 4FZVA 2P7IA 4C08A 4PYJA 3AJDA 3OZRA 1Y8CA 1L3CA 4F84A 2VZ9A 1UIRA 3Q7EA 4QTUB 2VP3A 1RI5A 2EG5A 5DX1A 2JH9A 2YTZA 1QAMA 3LCUA 5CVEA 3MB5A 4OQDA 1NW5A 3IHTA 5CVDA 4AZTA 2IBTA 3C6KA 3HM2A 2G70A 5EZQA 2VDVE 4V0RA 2JHCA 2YXLA 3EMDA 3AWIA 1R8XA 3DR5A 3GO4A 4FGZA 5LQCA 5DXJA 7MHTA 2YQZA 2P3QA 2OXTA 2BR5A 3HVHA 2XVMA 1AF7A 4CTKA 1YFLA 4GF5A 2VS1A
chains in the Genus database with same CATH superfamily
4I9UA 1TA4A 3EHDA 2HK7A 5CB4F 2XNHA 3GFGA 3NHWA 4O5AA 1LPAB 2QJTA 3IIKA 2F43A 2A78A 3IR5A 5KYYA 3NHKA 2WIBA 3D2BA 4JLNA 2H4XA 3W5UA 2QTFA 4I46A 1D8AA 3T5TA 4I50F 1R0CA 1T5TA 2WZDA 3ESAA 5DLPA 3KZVA 3I01A 1MR3F 3N9IA 5EJ8A 3OP4A 4QDOA 3AUSA 4DF3A 1SA0B 4KC0A 3UQYS 1JP7A 3IO3A 3EK2A 3OSUA 4MP8A 1BHO1 1THGA 1TK9A 5BR4A 1E4VA 2R3SA 3IBFA 4BX8A 3T1TA 3PC7A 3E23A 5AJZA 2OM2A 4EMBA 1MJGA 1O6FA 5GJBA 2J3DA 1W36B 3ZGZA 3CE9A 2UVDA 4MW2A 5C1PA 3RC7A 5MF6A 4Y2TA 1XTTA 1OI3A 3BM5A 3EVFA 1HDIA 5I7WA 3VR5H 3LHFA 4HAZA 3IO5A 1PR9A 4GWKA 3AB8A 4O29A 4Y0AA 4BO8A 1LK7A 2J9FB 2ZWAA 4M87A 4PLGA 3RHZA 5HF6A 3WBFA 2QVBA 5KHLB 4LYJA 4NQZA 4CLHA 5FBVB 3E7FA 1OX5A 1A82A 2VATA 3H13A 4RIEA 2Q1XA 4BL5A 5KYTA 1U2DA 3GDFA 5ABPA 1OIVA 4ZVOA 4Y18A 4MJ3A 3FHTA 3QELA 3L05A 1JLLA 1EG2A 9GPBA 1BCRA 1QHEA 3IERA 2NTEA 1G6KA 4FKMA 5K0CA 2FAXA 1NQAO 3JU3A 1WNTA 2XWSA 2Y1WA 3M4XA 2NV2B 4MVJE 1M8JA 3NHJA 4I5FA 1OHHD 2QLMA 3L7AA 4PX9A 5CA1A 1FQJA 4WK6A 1CJBA 1G59A 1TGYA 2AN5A 3MJDA 4HEA6 2C4MA 5FUQA 2OE2A 3MUOA 1TQ6A 1WQ4A 2JD0A 1CUZA 4HX5A 4JT9A 4DLAA 4MI3A 4DANA 1GM5A 3HJFA 3D2LA 3DG9A 3IS3A 1Q1GA 1U8CB 2B8EA 4WRRA 4YAIA 2ZE7A 1PP4A 3NHZA 4AG5A 3NATA 5BWNA 4JCCA 3EZFA 3PKIA 4ZAGA 3I2HA 1R4MB 2WHPB 1LRJA 2FGKA 3K4PA 2R87A 1P7YA 4OJMX 1YA6A 1NV9A 1Q0QA 1B3RA 3QA9A 4JOSA 1USGA 2IYTA 3QMMA 4B7CA 2RGGA 4ECAA 1ADJA 1JZSA 3NBQA 4DLPA 1BYUA 1NOJA 4NZNA 2IHVA 3ED1A 3VHQA 3VO9A 5M29A 3FSGD 3B36A 3HB9A 3QPBA 1HQDA 3NHUA 2GTHA 3KYJB 4HGZA 2XZDA 4XR4A 1XZLA 4MH0R 3RG8A 3K9NA 1XGKA 2FZVA 3H3XA 1B6SA 5KTYA 3D4BA 4TWAA 3CY6A 5CA1F 3WGHA 4BX9A 3CLUD 4D82A 1R27A 4RDHA 3WX0A 3WGMA 5KYWB 3SJBA 2RKOA 2RK6A 3VR5A 2R85A 3TMYA 2Z5GA 4IHJF 2UXDB 1P6UA 1NA5A 5F1YA 4KBGA 5JS2A 4ASUA 4JYPA 4KMRA 1FRVA 3H2HA 1ODLA 2E4YA 4PYLA 4C7BA 1KPGA 3BGSA 3CF6R 1GDHA 2AN1A 3R9KA 1X39A 4DCNA 2GM9A 3C5EA 4YR7A 4RD3A 4FE3A 1VL6A 5B6PA 5GONF 4CI9A 2C97A 2CBZA 3OJOA 1Q0LA 4V03A 5EOVA 3EH1A 1U7DA 3PR2B 2AOUB 5EGSA 3MQ2A 5KHAA 1SKUA 3LC0A 5GOZA 4Q1DA 5HKKA 4UCXA 1C9YA 1JXQA 2M32A 3EFOA 4MA5A 1MOQA 1ORRA 3GJZA 3LHKA 3GLFB 5CBPA 4NBRA 3IP1A 1JA1A 2QZZA 3EOZA 4TTVA 1R3DA 2RHTA 4EFMA 2CDCA 1V7PC 1CUUA 1CHNA 2XNKA 3FIUA 4TYMA 4EECA 3W9SA 1L4EA 3WBBA 1OASA 4JELA 3RYIB 3H1EA 4ZYTA 2IEIA 4NH4A 1IOLA 3PL5A 4LF6B 4F3TA 1CIPA 1QHHB 1DKPA 1WJGA 2HQ1A 4ZALA 3CHYA 2DM6A 4ZQGA 2ZT8A 2FR0A 1BJTA 2EV9A 2QRNA 2AWNA 3OZSA 1FMFA 3JAWA 3SDBA 5HVNA 2DBZA 3K53A 4L5AA 1B2LA 4YP9A 4JQOA 1GR0A 4GZMA 2ZJBA 3NUGA 1ISJA 4G4SP 2PRYA 3QOYA 3ZOZA 1JEOA 4UHKA 3D3WA 3I5UA 2BMWA 3VOAA 3FWKA 1JMVA 2N75A 2NNLD 3OF3A 1QUFA 2JFOA 5L3SA 1F0KA 2CMKA 3CNNA 4MRVA 1AE1A 3WMGA 4G1CA 2FXVA 1KJQA 1R0YA 1CETA 1OZ0A 3JD2A 1L4LA 2QX6A 1E7MA 1XCGB 1V3UA 3GU3A 4J43A 4R9NA 5ALJA 3UB3A 4DCVA 1M73E 4YI5A 3CUUA 1P1RA 3E3AA 4QYSA 4JBLA 1I2MA 3DWGA 4LFBB 2Q2VA 3DGFC 3I6ZA 1M76A 4N5NA 2XE7A 4UHCA 4CMBA 2QPLA 2QDXA 1Y3FE 2BTQB 3PGXA 1IRXA 4QVGA 3UFXB 1FQOA 3OCJA 3E7WA 4H1UA 4WA7A 5KPJA 2QYHA 3U3RA 1TCVA 3L7DA 3E9MA 3HB4X 4JUAA 3R2JA 4CKCB 5LUAA 1RXVA 3UJNA 2FOIA 4MYSA 1PUJA 4KSCA 4AYXA 3DZKA 2CGEA 4I6JA 5B1HA 3W5JA 1QRSA 3U2QA 1QZUA 1P4RA 1R5NA 2ZYUX 3V1YA 1E3LA 2JAOA 2A84A 3JZIA 1QRAA 2VRBA 2IX3A 3GLGE 4LA4A 1DFIA 1JQ3A 1OTHA 1X15A 4ND4A 3F4LA 4NU6A 5LXTF 3D6VA 2QX8A 3VYSB 1KR2A 1VKRA 4D9IA 1RQ7A 4JEHA 5D7BA 2QV0A 3F67A 5LSAA 1D2RA 1TU4A 3JQQA 2JARA 3OO0A 1FOEB 5DI3A 4DCGA 4CEJA 3JAKA 1E6UA 3N0TA 3ND8A 3TNDA 4BZXA 2PUFA 5IN4A 3AHDA 5HCNA 1PG0A 1E6EA 1WSBA 5K3FB 3TE7A 1CJCA 2JCYA 4QXOA 3WISA 4IFBA 4U9IS 3DT6A 4NZZA 1Z2CA 3MJSA 2QQ5A 3VZQA 5HBGA 1RYHA 5J63A 2FE4A 1OIXA 1LWNA 2GQ0A 1KWKA 4KRFA 2BISA 2EW8A 2Z4RA 3ADPA 5AVKA 3K5WA 2GN8A 4NZ9A 1GJRA 4QAQA 2ETVA 2X5JO 4BNMA 1YJQA 3NJRA 3ZU5A 3GT0A 3GUCA 4MICA 3WKAA 1NC1A 3O73A 1L8LA 4QOHA 4ZQCB 3UGJA 2MR5A 2EXXA 3CUWA 1FU4A 3FOBA 5AJVB 2ZB3A 3LD9A 2IV3A 1UMDA 4WKGA 1GUBA 3CGWA 4RTQA 4IYRA 2JIPA 4CCWA 1ZGCA 1CBUA 5REQB 1NJGA 3M6XA 3F1LA 1HZZA 1ZCFA 3GRZA 2ZSUA 4HFNA 1MPTA 4D5EA 4TLAA 1W581 2A7QA 3NU1A 5HKOA 4ZXFA 1T3SA 1EWQA 4L73A 5EEGA 3HB1A 4KDEA 1W5BA 2R8PA 1VCNA 3IRUA 4DLRA 4MRSA 2X0KA 1GQYA 3H0KA 3UEOA 3W4KA 4HQ6A 2W2LA 5LYJA 4GVXA 1P6QA 2G9QA 4G8JA 2J3KA 3STUA 3IULA 1YGYA 5H59A 2QNIA 1JU4A 1LPSA 1Z36A 3WB0A 1JAYA 1GGMA 3GOHA 3DGEC 1T8PA 3MGKA 3Q5GA 1S1CA 3MT8A 1L5WA 5K0ZA 3UC9A 1JNXX 2WTMA 4YTEA 2Z6UA 2OAEA 1THZA 3PGMA 2AG0A 2OCBA 4OLFA 4DLXA 3U61B 1XKQA 3O4GA 2GYWA 3PXCX 4KRXA 3SIXA 5KJ1A 3DZBA 3U7FB 1XELA 1ZOIA 4CF4A 4XFJA 4F7DA 5ILQA 2JHGA 1N9ZA 4Q6WA 2R7AA 3AH8A 2P79A 3B9RA 3HCNA 4MR9B 5CDGA 1EESA 5CD9A 5JYCA 1ID8A 1MOPA 2JC3A 1TPYA 2COKA 4ZOAA 5CFLA 5I8WA 1EFAA 1Z2PX 3WFIA 1N0VC 1OC2A 3NHFA 2C5SA 1LC3A 4US0R 2RAVA 4EI8A 3SJZA 2AW5A 2ODQA 1SIWA 1OLSB 1RXWA 1FYVA 1QKKA 1G3MA 4B3DA 1DC8A 2Z9BA 4RHEA 5BNTA 4XWWA 1RPZA 3TOZA 4Y7CA 1L5VA 5KSOA 3R6DA 1U2SA 5FPKA 2DWQA 4RWZA 4N0EA 1M3SA 4ZYWA 3A36A 5G1OA 2XWJI 4JLOA 4XIJA 4JP2A 3QVKA 1QQTA 2FFJA 3H2BA 2YJ6A 2FSHA 5H1YA 3G9UA 4DARA 3BD7A 2DWOA 3SQLA 1KJWA 2BUBA 4KNYA 5EXXA 1CJMA 3L5KA 1JJBA 3F5DA 3WLEA 1CEEA 4PHFA 1ZUIA 1BDHA 1QGOA 1CPYA 2IEDA 4BCCA 4GI7A 1ONBA 1C4OA 1Z7WA 4KGZA 1Y6GA 2DUMA 2PWZA 4R69A 3VR4D 1FXWA 1UJ4A 2VOEA 4LHSA 4G8CA 1VSTA 3DKKA 2HL6A 3NNNA 5BVHB 2JBAB 1XMIA 1T2EA 3TEJA 3NYWA 2YYAA 1QP7A 2HO4A 2BWJA 4FU0A 4UMEA 5DBFA 3H84A 3PJEA 2E0IA 3DOIA 2Q1UA 4ZTUB 1KMHA 1ZM2A 1LNQA 3GNSA 1JVBA 4U0JA 1SXQA 3PPXA 2P4HX 4W9NA 3HJNA 1JHQA 3ZYZA 2QSUA 1YS4A 3A4NA 4GNRA 4ESOA 3I9JA 4PTLA 1TMGE 1T91A 1V26A 3DDHA 3MB8A 2HC9A 3KJIA 4HEQA 1YR3A 4EY3A 1C0EA 4KI0A 2WABA 2BELA 4P08A 2PMCA 4RQBA 4IDPA 1NWHA 1QAQA 3OU7A 4PHTA 5FL7D 5TJ9A 1Z6ZA 1NLZA 2F62A 3UMGA 5EJ5A 5HMLA 3TUJC 4WLEA 2R97A 4FSHA 3I5MA 3DQPA 4KLCA 5I7FA 4HVAA 1USUA 1OOEA 4QGBA 4ZK6A 4A82A 1E66A 5H83A 3HP7A 3FF1A 2WUWE 3GVCA 3MTEA 4N6GA 2E4ZA 4KQGA 1WA5A 2ZYAA 4MRAA 2PT9A 4FYXA 2IYXA 4XYLA 2XQFA 4Q93A 4U2FA 1ILEA 2ZBGA 3GDWA 3ZI0A 5LM3A 3D4OA 3V97A 2PL1A 3R3JA 3SZOA 3R0JA 4YDRA 3NRBA 1E8MA 1UBOS 4AN0A 1I3MA 2WU3A 2ZETA 1ADBA 2VDRB 5L8VA 3F97A 5C3MA 4JI6B 4AU1A 2M6RA 2ZBFA 4A1OA 1CS0A 4MI6A 3VH3A 1SVNA 2ID4A 3KVOA 3NOVA 4GYYA 3L1IA 1JQ5A 2FLWA 1M8FA 3LUFA 4NNPA 1GGVA 5FX2A 3DDWA 3OFNA 4LJRA 4LDQA 3TVYA 2RB5A 4WBNF 2QIPA 4G0PA 3N2LA 5JNTA 1PJ8A 1RYMA 1T9DA 4NR0A 3DZGA 4CM9A 5HUQA 1KKLA 3MD9A 1XNHA 2BZGA 2PKQO 4FDMA 4I1SA 4NPCA 5F4ZA 4ZYUA 1P3JA 4AUKA 1ENPA 1PQUA 1RP1A 2R25B 1HLFA 2VJLA 4JAVC 3UAOA 5ES3A 4OYLA 1ISSA 1PEAA 4LRQA 2ONYA 2D1FA 1OVMA 1K27A 2FWMX 3BK2A 1YGPA 3ZE6A 1K08A 4L8FA 1GNTA 4Q9HA 4P7JA 5DHPA 3GCGA 4P4SA 4TPKA 1ZWLA 1VDZA 2OXEA 1JHMA 2X0NA 2Y6UA 3DVRX 2XUPA 4ML3A 5KHOC 1X7HA 3K6JA 1PO7A 1C30A 1ZG3A 2HWWA 3UCEA 5E95A 6GPBA 3ZQ4A 1QDLB 4P2BA 3QF4B 3MT9A 4PX2A 5DF1A 4UTVA 5FTWA 1IWOA 4ALKA 3NHLA 1F20A 1AIPA 1H0HA 3NJ4A 5CR9A 5TVGA 2BBWA 1KEZA 4FSXA 3B2EA 5MHTA 2EZTA 4GOKA 3PZBA 3OZBA 1JHRA 1FUEA 3LJKA 3PQ8A 1U04A 4PGHA 1I1HA 2BI7A 4ZU1X 4OI1A 3RT7A 3A4MA 2H5IA 4RK7A 3UANA 2W58A 1Y42X 2C7QA 2DPHA 4MEAA 2DHRA 1MJGM 3ONDA 3WK5A 3ABOB 4HYQA 4D56A 1AMNA 3BCRA 4OGWA 4B3CA 3IPRA 3NP7A 4FZVA 4K1XA 2FSUA 2EWVA 1A4UA 2NQTA 4BMNA 1Y8CA 4ZZ2A 3GLKA 5H9VA 1UIRA 4QDTA 2UUOA 4EJSA 1AXEA 3NKVA 2HPVA 1PEYA 2MMGA 2OZEA 3ETLA 2PGJA 5ECGC 3MB5A 3Q6IA 1RW4A 2BE7A 2V8BA 3C1AA 3WRWA 4BO3A 4CG0A 1ML4A 4NBSA 5U9CA 3L0BA 4JR2A 5LQDA 2UZAA 4DDWA 5TQ2A 3K0SA 1A8IA 2GAIA 2YQZA 3HFGA 5B7PA 2WJ3A 1P73A 1VIAA 3P0IA 4EY4A 3O93A 1DJNA 1ESCA 1SC1A 3KD3A 5AJTA 1Z18A 2G67A 5JAOA 4OM7A 1F8XA 1ST3A 3CR3C 1VRVA 5MN4A 3G2QA 3GWZA 2F3TA 1L4FA 2VA8A 3GFPA 3KDSE 4KHZA 3W6ZA 4D9BA 3ABIA 5LP6A 5GP1A 4HYEA 2ZIXB 1WXDA 1GWNA 2WVAA 3M1AA 3W1VA 1NI4B 2JI4A 4R5MA 4FR5A 3ZVRA 1BFKA 3RAFC 5AUPB 3AF4A 1OTYA 4KX3A 1G5PA 1VIYA 3VOSA 1UBCA 1NV8A 1T0BA 4GU5A 1U02A 3EYAA 4LWOA 3ZR4B 1SUDA 1WOMA 4O02B 3SC6A 2HJ9A 4Y2XA 2GEUA 2PJDA 3DM5A 1S8FA 4MWCA 2WVGA 4L72A 2HK6A 4UTOA 1CDZA 3LRPA 3P9KA 2IEAA 1Z6GA 4QNRA 4MCIA 2Q0HA 4TMXA 3AP1A 4ZJYA 3D1JA 4MHTA 2NO4A 3NTQA 4MUYA 4YRFA 3V42A 4CKWA 2JZCA 4H6PA 4IS3A 1BX0A 3FUTA 4Q05A 3L7YA 3NNSA 4JVMA 4MCHA 3MWLA 4JYAB 4KUHA 3C8ZA 1JYEA 2OCPA 2V9PA 2YBEA 3LT1A 4F1JA 2I91A 2AJ8A 3DNMA 1ID1A 4W1RA 5IVIA 1BHSA 1Q21A 1R16A 2XDAA 3SR4A 4M1TA 1MO2A 4N0MA 4DMLA 2A5YB 2I34A 5ELMA 1LW6E 2A1TR 4ESHA 4G5FA 4ESVA 3TRJA 1P2UA 3CVXA 1QFJA 3UFBA 3FPSA 2AFIE 3V32A 3DTVD 5L3ZA 3IAS6 4BDSA 1EHIA 4PLHA 1M2JA 2ANBA 3WGNA 5T4FA 2ZRCA 1M34B 2PFSA 3NTRA 1YBFA 1JQAA 1OU4A 2PZFA 1WKCA 1D07A 1KI7A 1AS2A 2DTEA 2GFIA 2GJ8A 2HOQA 2FPPB 2X4DA 3BH6A 3DS8A 5HOQA 4LISA 3C45A 1WUTA 4ND7A 2A33A 4Q1BA 1T0IA 3E3OA 1FMTA 2BFCB 2CE2X 2Q4OA 2CFTA 1RMTA 3PUKA 5AI6A 4YRDA 3CWCA 1NLYA 2IPNA 2VPQA 3HZRA 4S05A 1WHSA 1A9YA 1WAMA 2QYSA 2OA0A 3UMYA 1LX7A 3DEKA 3OBIA 4LEIA 2PFKA 4BASA 4OKNA 5JUWA 2HZBA 3WGQA 3UBTA 3QSGA 1Z39A 1LC0A 4QODA 5ICCA 1IZYA 1SM4A 1XDUA 4EX7A 1C14A 1UKAA 2E9SA 3EQ8A 1P9OA 1V35A 3LY9A 1DEOA 1PZEA 3FUWA 4PZYA 4BV2A 4ZKDA 3NEJA 1KRWA 2YICA 2BHLA 4PHHA 2QN3A 2MDTA 3F7TA 4OQZA 3NHYA 2CYCA 1KMCA 4UEWA 3E1SA 4NONA 3B82A 3BZBA 3UA4A 5TB5A 3TJZA 4EH1A 5JVDB 1AQJA 1M6NA 4TS1A 3RW9A 2V7EA 4LKRA 1YZTA 3T7EA 1B6GA 1NY6A 1OU0A 1ND6A 1UJ2A 4KKVA 4WASA 5KKAA 4YUZA 1HDOA 4IVPA 5K4HA 2GCOA 4QXMA 3OESA 1Y6FA 1YDMA 4HEJA 5A03A 5CDUA 1XYVA 4OYRA 5AXCA 3I8XA 2V7BA 3U1TA 3CLHA 3NLLA 3L3BA 5JXIA 3AY0A 1MVLA 3OJ0A 2PQ0A 5FT9A 1JILA 3L6RA 3ZIAD 1SC6A 3RT9A 1TADA 4CDRA 4AK9A 3FRIA 1E4EA 4YA6A 2IQ5A 4IEIA 3OMWA 2ENUA 4G01B 1JEJA 4YMIA 1CQIB 5F21A 4XIIA 5IC5A 3OOHA 2RI1A 1H6CA 2A9PA 1T0JB 3NDJA 4OTZA 4PC1A 4LJ4A 1SR8A 4ZC8A 3LOUA 1J20A 4NBNA 3RPEA 3Q0EA 1CQIA 1HORA 2REQA 3QFRA 4IG4A 1WD5A 4IXTA 1XD8A 4M98A 1RRVA 3FCAA 4UXIA 1UMCA 4ZVPA 3MPOA 4I0WB 4ZMRA 2PUGA 4V2UA 2WWXA 3DL4A 3FKSA 2VHEA 5HE9A 4DDMA 2QU8A 3RUAA 1E2UA 1QIEA 3WNDA 2J0EA 3CA8A 5K3AA 4C3VA 4JI7B 3OM0A 3K0BA 1LB1B 2C9ZA 4EL0A 3VJRA 1MQAA 3EOAI 4G67A 1S2MA 4MUMA 3CQ9A 1I3CA 3BMQB 1IEWA 4OL0A 4AO6A 5I3ZA 2EHDA 3GRVA 3TTWA 4NZPA 3RYCB 1YS1X 4ZCTA 2A0WA 1VLLA 2AWOA 4LXGA 1M67A 2NYRA 5KMGB 4RS3A 2OVFA 1KDRA 3PQ2A 4PSUA 2XGGA 3V7FA 1YACA 1CQJA 3DO8A 4HN4B 3WR5A 1HI9A 2PLFA 2Q50A 3F8WA 1L4MA 1I2DA 4BFYA 3E9EA 1XQYA 3BIWA 4I4IA 4JBIA 4TM8A 4N40A 1UPTA 4ZT2A 1LVUA 3RRFA 3RVRA 1CB7A 1NBWB 2AKAB 2CBGA 3C3BA 2PTGA 1WVMA 4FT2A 4RDCA 4RHCA 1M33A 5C8YF 1Z2OX 2J5BA 2YZMA 4MV4A 5JBIA 5F77A 1G21E 3ZLBA 4EHFA 3REQA 1N8SA 4NX2A 4OK5A 1G3QA 1RBZA 1TOAA 1TZBA 2WF5A 4MJXA 1C0IA 4C76A 3ZW8A 1QGUB 4P8RA 2I6FA 1VYHA 1C8LA 2ZVQX 3KETA 3CX6A 1DCFA 3KKQA 5AVSA 4FOSA 3RFVA 4QDZA 2V54A 3M33A 1UK7A 4J94A 1N2GA 4JBYA 2OSVA 1ZVJA 4ER6A 1MV5A 5IXJA 4W8HA 3I9MA 4KK3A 4F4UA 1XTZA 3DLCA 2C4VA 2H1FA 3ZHVA 5BWLA 4GDMA 2PO5A 1NURA 2HLHA 3RCBA 5IC6A 5K99A 5FFFA 1V5GA 1Y9EA 5AK3A 3L40A 3UK2A 4PM4A 3I45A 2PBLA 1UBHS 1EWTA 2O2SA 2Q9BA 3KKMA 4LXTA 2H57A 4AT1A 1QK5A 1PL7A 4W1PA 2IBSA 4QVIA 1MA3A 4MDEA 1ZIYA 2IPMA 3EEYA 1ZJYA 4KLAA 3AY7A 1EFKA 1T9CA 2RG7A 3PHBE 3QKSB 4NIMA 3RABA 1PCXA 2V65A 3A9VA 3ENQA 1SNYA 5FPTA 4MYUA 1MV8A 5FUXA 1RLUA 3NPAA 2X6RA 4IFIA 4PX3A 4QXPA 3FGZA 1EVQA 1OTXA 1QFMA 2JIBA 4FFWA 4D0RA 3IAAA 5G0VA 5EAIA 2I3AA 3D0QA 4BKPA 3WTBA 2A8YA 3EEQA 4OO3A 4RSMA 3TLMA 4JOQA 4DMUB 4YVFA 2AG1A 3WLJA 1RRFA 5D6NA 1K7CA 4RE6A 1EK6A 1E9AA 3AINA 3WWPA 1GNVA 1GZUA 2XUIA 3HA2A 4M4SA 2NQ8A 4EPXA 1DAMA 4QBTA 4QELA 4C1BA 2EL9A 2NV6A 3G9QA 3PNLA 2F90A 4LJAA 1GZ4A 3ZWMA 1E1LA 4DKJA 3UGTA 2YNMC 1YT5A 4UC0A 1LFDB 4QHSA 4PIMA 1U7XA 2BKVA 4LQCA 2P9ZA 4NRDA 2X19A 1V1RA 1Y7TA 4Q6BA 3TTSA 4CKBB 1R6XA 3WYGA 3N74A 3P2EA 1Q20A 3P2KA 3U44B 1C3JA 5I4IA 3EIFA 5AI4A 2ZTSA 3MTQA 3UOGA 1MH9A 1Q0PA 2C95A 3P0FA 3TMAA 3OCYA 2BR3A 1YJ5A 2DFNA 2YXEA 2Q8QA 2HWUA 3H4MA 4CDGA 4YJ3B 2LP4Y 4GT1A 2H5EA 3VZCA 4LIPD 2G8LA 5ITWA 3K9QO 4HTFA 3KJEA 4RD1A 2YFYA 3SNKA 1IY8A 2D3WA 2ZUBA 3IUMA 4F5YA 4HXGA 3I0ZA 2VTDA 3NANA 4RK0A 4XJTA 5B3AA 2P40A 1UBGA 4AJLA 3QUTA 2EJWA 2FPIA 1QV9A 4JLSA 4LJ6A 2P6NA 5DBGA 2EFYA 2FSVA 1DIHA 3SYKA 2L17A 5SZKB 1BQEA 3F6YA 3OIYA 3BIJA 3VR1A 1QHXA 4WN9B 2ECKA 1YS6A 5J5VA 4HAWA 3S0JA 5CDFA 4Q00A 3VU3A 2QUIA 5EXDA 4KN5A 1SUEA 4RPHA 4YH1A 1G66A 5K8IA 1T5DX 1ORTA 4E7OA 3EGOA 3TUIC 2QLFA 3BK7A 3QUBA 1XVUA 2EX4A 4HZUB 2W42A 4E94A 1QYXA 3Q7PA 3U4HA 1AV7A 1AZTA 1PL0A 1QWSA 2JS7A 2Y4OA 4LSZA 1TXGA 3WQQA 1AB6A 1NPYA 1E7SA 2GERA 2W6ZA 2IC5A 3JVUA 1CVIA 2A4MA 1NASA 4Q15A 3HI6A 5UKDA 4HB2A 4HLCA 3UAWA 4D26A 3N2KA 5EYPB 4HVCA 2XYHA 3EIWA 3I9FA 3ZWBA 4KO2S 3A37A 3FCOA 3GJ8A 1G3UA 1ZGHA 3ENZA 1P3Y1 3P0EA 1G6HA 1Q91A 3EJ6A 3OTIA 4FHZA 5G1NA 4WBNB 2Z8XA 1DIGA 3VKHA 1YRQA 2QY9A 3G23A 4PXAA 5ALGA 2HMAA 4M0KA 1PVVA 3BIFA 4AY2A 3FXAA 4QRHA 4WERA 2M6KA 2WHEA 2QUKA 1W4RA 1VYVA 4NYMQ 3G0BA 2G9VA 1F5SA 1J8MF 1TVMA 1T3ZA 1ZCAA 4YUVA 4KXNA 1ZJ4A 4DJ5X 1YA8A 3R4CA 3IVGA 2VWPA 2ADMA 2YIMA 5FORA 5E1MA 5BW5A 1G42A 1RJDA 1V5FA 1PJAA 3V3TA 3GLRA 4DUGA 2ZROA 3AG6A 1V6SA 4RTPA 2G7MC 2Z1MA 3G0OA 1RLOA 1T5BA 4FQ5A 4DG8A 1C81A 3BDAA 1UEJA 2Q27A 1K6EA 3F7MA 5HYVA 4RJJA 2HA5A 3OFVA 4V3BA 1FQWA 4JROA 1LI4A 3FKJA 1EEHA 2EIHA 1I1QB 3R3ZA 3VHXA 1V8FA 2KHZA 1XYYA 1QJ4A 4GOXA 1NQUA 2O7NA 2YV2A 3GGCA 4B6OA 4BMDA 1RQRA 2VP2A 5CNKA 3HH8A 3STYA 4W5HA 4D0GA 4ZMSA 4F5ZA 5AVTA 1UCFA 4RF5A 2QRZA 2QM3A 4YQYA 2Q4BA 2O2JA 1R6UA 4H7HA 5CX4A 4CMEC 1NM5A 1YVEI 5J4HA 2CY0A 3F3MA 2POQX 3ZHXA 3BJMA 5AVZA 3S2GA 1CYEA 4LYAA 4TTIA 5IABA 3D3WB 3COVA 2FQXA 1XZKA 1AUVA 2POCA 3S7ZA 4O4HB 1UXKA 1YSCA 3GP3A 5FI0B 3CB2A 3UHAA 2ID9A 1ECLA 3EY4A 4O8CA 4O4IA 1AHHA 1IOVA 1RHMA 2ZUCA 3ZNPA 1I7PA 1D7OA 1Z0SA 1W5TA 2F8MA 4MTCA 1S8OA 3TM5A 3NP9A 1ZSNA 1JALA 3I6YA 5AFSA 3P0HA 4QKQA 1HTBA 3WWOA 5JBQA 5EPOA 3AVWA 1PGQA 3ROZA 4CMJA 1LU9A 2NV0A 1HG1A 1HRDA 3P9PA 3SZGA 4LZNA 1XEAA 1NMEA 2PWPA 1YOBA 5CK5A 3Q1KA 4OJKA 4YPOA 2RAUA 4ZCIA 1PK9A 3L0YA 1H42A 4CEIA 4WY5A 3SYMA 1II9A 1VMKA 2XSZA 4KO1S 2VJMB 4NJMB 2R96A 3BULA 1M1NB 3ZCSA 4BN0A 4Q4JA 2RHHA 3ZGXA 3CKLA 5EMJA 3DOCA 2FB9A 5HFNA 1Z2DA 2L42A 1MQ8B 3KS9A 2BMVA 4DS3A 4HVLA 4FP9A 1DHTA 1YV9A 4ND8A 4HEHA 4WLFA 3FUUA 4ZKEA 4MQLA 3U1VA 4AJOA 4AWXA 4D98A 5IUNC 3ZVKA 1SUSA 1KXZA 3A3NA 3L92A 3ABRB 1L5FA 4C78A 1DB3A 3CH6A 1KQGA 3NTOA 2RGAA 5I8PA 2JI9A 3LYHA 2R84A 4R81A 1Z2EA 5IN5A 2LDBA 4E4TA 1GNPA 4H3HB 1XROA 1Q3TA 3V4LA 4Q1FA 1SPBS 4XGIA 2Q62A 3IXLA 3P9NA 4NU8X 4LYHA 1RXEA 3OCZA 3AF2A 5DHQA 1VQ1A 4BV8A 3DHWC 5BR7A 1NNUA 4LZLA 1FZTA 4E09A 3LUAA 4E14A 4WT7A 2ZRAA 1ISMA 3K1AB 3RF7A 1J1IA 4I5GA 3WTCA 1IDOA 1EBFA 5K8JB 5LL6P 1P5ZB 4KQMA 3LA8A 1PTJA 3USZA 4ENTA 2AR9A 4TZ0A 1XJCA 4PPFA 2IX9A 1GPKA 3AVQA 4FJ2A 2Z2XA 5JAPA 5JJKA 3UXEA 3NNDA 1QVWA 5AVWA 3CZ9A 5EKUA 2QMQA 4X20A 2CLLB 3HA7A 3KXKA 4X7BA 4Z51A 4ON9A 3TZBA 1UQUA 2I67A 5DMHA 4JI5B 3UMSA 4BTEA 4EF4A 5A6SB 2DUNA 2VT6A 3JYHA 3S5UA 1JR6A 2VHTA 2J7PD 4DWJA 4IDGA 1WDMA 3GRFA 4BGIA 1QIJA 5ECWA 2NSYA 3O94A 5IJ9A 2R6FA 1EB8A 1MRNA 2HA7A 4QBHA 1VGVA 1CVLA 1CFZA 1JR4A 1U4OA 4U3JA 4YJGB 521PA 5T3YA 3WDSA 3DCYA 4LTDA 2ZJ0A 2JFWA 2FU5C 3A05A 3UT5B 1Y98A 4IZ6A 4OK3A 3GEDA 2QRMA 4KOAA 3B6JA 4KBFA 4LC1A 1U99A 2B61A 3DQZA 3GP5A 3R7BA 2BC9A 3NHPA 3VGPA 4B9EA 4CCAA 3DVLA 2W90A 1DVRA 1RHQA 4C08A 1Q16A 3FDZA 1SG6A 5AUQA 4AL4A 2GJ9A 1ARZA 1QFXA 3PDHA 5JAZA 3HHEA 4ISBA 1MAUA 4RVSA 3ZHQA 1JHOA 3T3GA 4MQMA 4WWHA 1NW5A 5FOXA 5L7WA 1SU8A 1EH5A 3HM2A 5KIAA 4IOMA 4BN4A 2JLCA 2FX3A 3AF6A 5JLJA 1MLDA 2G9ZA 3KTFA 2XI4A 3TNYA 1MB9A 4RM2A 3G6KA 4XAQA 2P3QA 4RZXA 2G1JA 1H2EA 1CD5A 1UBTS 4JJIA 3EGCA 3RAGA 2PQ2A 1XRSB 1JHYA 5I5GA 3FTEA 3VTAA 1TC1A 3BH0A 5B1SA 1KE2A 3DWIA 2I22A 1ETHA 5DW3A 1USIA 1SIUA 2GZSA 4FJ1A 2XY4A 2XVYA 5ENDA 3S27A 3UJ9A 4IKOA 3EEIA 4Z8XA 2I2BA 4C6HA 2B69A 4UAGA 3ZX4A 1P61B 3LK7A 2A9FA 2PAFA 3L6DA 3SICE 5GJCA 3RYFB 3ANMA 1E2EA 3BUSA 1MG5A 3DV2A 1OXTA 4FYHA 2PGXA 3KHUA 5CM9C 4QNMA 5HXAA 4CT5A 1W4CA 3Q7TA 1RWBA 3EXEA 1ZNQO 2D00A 5HR5A 2CF6A 4MROA 2D54A 4MV6A 1ANKA 1V3VA 4L4XA 3ONWA 4LF9B 1XD2B 2BVNA 1L5MA 2E2WA 3P2JA 3C7TA 4ZEMA 3JYLA 4ATNA 3ZDXB 1GIAA 1KPIA 3WLQA 3AXSA 1VLVA 1VBFA 3GPBA 1RCTE 1T3LA 1VG8A 2X6TA 2XB6A 4LHZA 4AS3A 4DTIA 1UP6A 4XWKA 2D7JA 2QX9A 1T2DA 3L0CA 4L7QA 3JQ8B 4U7FA 5D3QA 4AP5A 4EYQA 3O2SB 3VTKA 4L3VA 1SJ9A 1VJRA 3H83A 1I0LA 4PS0A 2DKOA 5P21A 2J46A 2XKAA 3QQPA 1WX1A 2AD1A 3OWHA 5EWLA 4ZFNA 1JG1A 3WA6A 5A4KA 2ZCUA 1J90A 1R6DA 4RTMA 3PFGA 1VXOA 4FOTA 5E1DA 3SEQA 3S2FA 2NXCA 3X1MA 3F8SA 2VTBB 2GXQA 4CM6A 2JD2A 3DOFA 2CEAA 1L1QA 1JNYA 3OFND 3PENA 1PK7A 4E5MA 7REQB 3M6IA 3LX4A 4NZYA 3UCFA 4WBXC 3ZXXA 3RS4A 5JAHA 4FM9A 1T9GR 4DA0A 1AZSC 5IW8A 5C53B 2H2IA 2IOYA 3JQPA 2O8EA 1GZHB 1Y89A 4CMGA 3U7JA 1S3SA 2VXBA 1OXVA 3AEXA 1MG0A 4R16A 1FTYA 5DEIA 2EKZA 5FFMA 2GXAA 2VJNA 2YWFA 4ZO9A 2W2XA 4FUTA 5JSZA 1G8PA 1Z0UA 3PNVA 5JAQA 3V4FA 4ZU3A 1UINA 1FK8A 1GR1A 2H7XA 2G25A 4HVTA 2P3SA 5LZ8A 5EE5B 3AKYA 1NFFA 1P4SA 10MHA 4UFOA 5F52A 1R0BA 1II0A 2NX2A 4OQPA 2CXNA 2II6A 3R3VA 2QLTA 4IINA 1T9KA 1HRKA 2PXXA 1W76A 2H2DA 4UNRA 4B3GA 1NP7A 1MW8X 5BN4A 4GKBA 4I50B 5BP7A 1E3EA 1Z2AA 3IIIA 3PBKA 4BRZA 2SHKA 1VMDA 3HJAA 5KQPA 4D4IA 4Q4JB 2COEA 4G4GA 4LQDA 3KKPA 3IH5A 4W8GA 3LUJA 5JC8A 3N58A 4JKIA 4H3SA 3U19A 3LVRE 4HDNB 2IJGX 5CVCA 1L7BA 1Y1PA 2VF2A 2J09A 5DLDA 3L18A 4NV1A 2GT1A 3OD1A 4UUMA 4C6TB 4Y67A 1EYZA 3O4JA 2DCUA 4KB5A 1F8YA 3ISVA 1VI5A 3LQ1A 1IBCA 1NC3A 1U5AA 4F97A 5KQGA 4Q3DA 4L8WB 4EZBA 1ZNZA 2OO5A 2DHCA 3G17A 2H5JA 2C61A 3BE6A 4CL2A 3L7JA 1E7QA 3PCXA 4YMLA 4CUKA 5K7SA 2X3UA 4AB1A 4B6FA 3KTOA 4C0LA 4WJLA 4BNIA 3ZD9A 3C24A 3I2GA 2WU0A 3G8YA 5D5HA 1JQBA 2PKXA 3H1AA 4EDHA 3PC4A 1DBVO 3ODGA 4MGIR 2FUNB 4UE3S 3TK1A 2Y1OA 2X1MA 4TWRA 1UP4A 2KWIA 2XMBA 3AP3A 3B3QA 2WOOA 2PR7A 3D7NA 4KR2A 4UHJA 1Q2XA 4KVGA 1SO8A 5HWSA 2FNAA 1F51E 1PR2A 4XGKA 1PFUA 1U0JA 2JBAA 1V1JA 2BGUA 3LBAA 4WDRA 3OLYA 1EFVB 1NFRA 3BWEA 3R5JA 1QB7A 4TTAA 3P19A 1HLDA 2EW2A 1V2HE 1RMYA 2VA9A 2YV4A 3LUCA 1A2KC 2XA9A 3KK0A 4BMPB 2CDAA 5FLEX 4UTNA 1RC8A 3KQTA 4Y1FA 2QE6A 5JD3A 1TQ8A 3ME5A 1QIIA 4UM9B 3L0IB 1J25A 5I9SA 1IK6A 2FPKA 3DPUA 2W7TA 3L4BC 4M7RA 3TWOA 3BMNB 3LSYA 1YKFA 1TC2A 5EESA 1C80A 2O8NA 4C4AA 2XTMA 1NG1A 1DUVG 2RC5A 4L5JA 3SFTA 1J8FA 1RCFA 2B3DA 4FDUA 3U7QB 2C9CA 3IT2A 4R0NA 5CCEA 4KIGA 3TQCA 1HFEL 2VPIA 2WF9A 1EHYA 2CUKA 1A8UA 3EXHB 2IGBA 3KSRA 3LQFA 4KZKA 3SKYA 5CB4B 3I73A 1NDUA 4EJ2A 5CGQB 2QN7A 2HN9A 2GGSA 4FGJA 1H93A 3DEAA 1B41A 3H87A 1KO8A 1E6MA 5AKHA 3UGKA 5AJWA 2QK4A 1I24A 3KKKA 2OZVA 1WBDA 3UYLA 3GPCA 3NHRA 2XMCA 1KH3A 3ZCQA 3QVJA 4I5IA 2HU5A 4CR7A 1RWVA 3HXPA 4KIJA 1JQKA 3EDRA 3TRHA 1DAOA 4EY6A 5U1PA 3KEMA 1H2ZA 3W8FA 3VYVA 1BZYA 1G5HA 3WK4A 1J4AA 3TPCA 3A4VA 3EXIB 3VUFA 2I6SA 1DKQA 1YOVA 5F5LA 1BEZA 2Q2NA 3HKEB 4MMXB 2RGRA 1N5DA 1MABB 1JDUA 3K0EA 4Z0HO 4HG2A 2UZ0A 4C0WA 1F6DA 4DR2B 1TAQA 3HJBA 2O05A 1RJEA 3PEVA 1Z5ZA 4GSKA 2CJWB 1RRPA 3HCPA 2PYIA 3D3QA 4RTRA 2PUTA 5FBWB 3PX3A 1E61A 3EA0A 1JLHA 2RGWA 4WHMA 4R2KA 1H66A 1VL8A 1V8PA 1G8KA 4WLOA 3ROKA 1NW6A 3OEEA 1CR6A 2I65A 3AQ4A 2ZXEA 1GKYA 2ZSBA 4MUGA 4U7WA 4QUAA 3QKWA 5A4IS 1RBQA 3T3PB 4IDBA 1NJ5A 1NQOA 4BNHA 4CU5A 3VV2A 1Q6ZA 3DPSA 3I9OA 1JFTA 5G2OA 2HIHA 1QC5B 4YAOA 2EARA 4DR7B 1KGDA 1TAGA 1S89A 3QUCA 3ZZMA 2GKSA 3EXAA 1ZK4A 1Z8DA 3CZQA 4FCCA 4BNWA 1C9NA 3FPJA 5F78A 4E5YA 2NM0A 2PH3A 2DAPA 3CJQA 3HA3A 4UCWA 5JG7A 1T35A 4JI3B 3QG5A 1A5BB 1Z38A 2WA2A 3EGDB 4YDHB 5DK6A 4JLBA 3DMNA 1A96A 1P39A 2Q1SA 3LFHA 5KPDA 4P3NA 1XPUA 5CX1A 4KR6A 4G1UC 5FHRA 5F2KA 2AZXA 3PC2A 1JJAA 2IBMA 1ZOPA 4ZQBA 3TD9A 1CUYA 2P9YA 2YMPA 6ABPA 3E22A 4KAXA 2D5AA 1STOA 2H29A 4PRLA 1A88A 1M1ZA 2F1OA 3A2LA 4MYCA 1L5RA 1C0KA 4HB4A 4UPDA 5DGXA 3UVEA 4E08A 4YX9A 1KDPA 1QORA 3H6HA 4NEGA 2IYYA 4KQKA 1N78A 1XRQA 3LBIA 3DVAB 2R00A 4H4CA 4L16A 2O2GA 2OECA 5K0TA 4RVUA 1X7GA 3ZCUA 5K0FA 4XFKA 4YPVA 1NLUA 3CEPB 3CRRA 3ZN2A 1L8AA 1AZWA 2WPDD 5HMMA 4MJLA 2AF3C 2GXUA 2FZEA 3LE8A 1G2QA 1GNSA 1N33B 3OZIA 1UDWA 3ONVA 2MSNA 4MVJM 4J4BA 2PKQP 2PO7A 2B83A 3Q98A 1DQZA 1VBNA 4X90A 3TPFA 1SGWA 2Y9PB 5JD6A 4RY8A 5DYNA 4QVKA 1TAUA 3S3TA 4MDFA 4MUNA 4G5GA 4N7MA 4TLCA 2GNOA 3NGXA 2B78A 2PKYX 1SWWA 2JCVA 1ECCA 3E0QA 4QBKA 5A5VA 5L3QA 4MR7B 3LKDA 1ZEMA 2EYUA 2HCFA 3TW8B 4PLWA 2YH2A 2MR6A 3UTDA 2OILA 3DMYA 5IAAA 3O95A 2IOFA 3TXAA 1PLKA 3KFXA 2XMDA 2DECA 4JN6B 5KNBH 2QB5A 3K8OE 3GBVA 1E1YA 1Y8ZA 2YC4C 1H6AA 3OMXA 3SWWA 2QTVB 4K2HA 4ICIA 3Q41A 4NXNB 3VNVA 1S4QA 3EMBA 1WPXA 3A3KA 2VDLB 3IVMA 1ZQ1A 2O7RA 1Y81A 3E05A 4FCVA 1NRXA 4LCJA 1U2RA 1UKZA 3RE1A 4M0CA 2W48A 3L41A 1ZONA 3AOGA 4OU4A 3RIYA 3MM4A 3W3AD 4JB0A 1OCEA 1YRWA 4WLUA 4OI2A 5EIWA 3THYA 1ZJWA 2JFUA 1DBPA 1O0BA 1VYTA 1LVGA 5FLYA 5FTMA 4ZCLA 3A6ZA 3ZVLA 1KY5A 3E9CA 4B76A 1BGWA 2WJPA 1RU3A 3E5MA 4KQCA 2MWMA 5DGCA 1Q0SA 2OESA 3HRHA 3AR2A 1CLUA 3GNLA 2OQVA 4NOJA 1TQDA 4H6XA 4E0BA 3KG2A 3HDHA 1ZEJA 4Z4GA 1W0JA 1R5OA 3K16A 2O7QA 2AFIB 2ZTMA 3KTAA 2G09A 4M53A 2JLRA 4O8ZA 4YRLA 4ZAWA 3CEAA 1SBNE 1PI3A 3I12A 4GMHA 4LY0A 5EERA 1DXOA 5IBPA 1NQWA 3IVCA 3X1WA 1WXWA 1H0SA 3MG9A 2QWXA 2B3TA 1ZVQA 5DE3A 2I4RA 4B47A 3QSYA 1YCGA 4DEVA 1LSSA 2ISSD 5MFPA 5LNK6 4F2WA 2CNNA 2PQMA 4Q4HB 1I8TA 3WK9A 3W2IA 2PH7A 2Z0MA 2SCUB 1IBLB 1EX1A 1JHDA 4ENRA 4RU1A 1QTIA 5FUBA 4IMPA 1G4AE 2MHCA 1G8AA 3PQ3A 3HJUA 1RVV1 2YIDA 3QKRA 2YZNA 3WNZA 1THTA 4MVXA 5EHXA 2W2MA 2W2PA 4CPDA 2GCNA 4NS1A 3N0WA 2QSYA 3LY7A 1T9AA 3QX7A 3WGKA 3UCXA 5BYBA 2ZTHA 1Q0ZA 3IAEA 1R4NB 4TRRA 4LNUB 2ZFUA 2NZ8A 3IIMA 1C9JA 1GTVA 3ILXA 3NBFA 1UMCB 2G4VA 4Q7KA 1SXIA 2AOWA 1R8SA 4HPJB 4A73A 2Q9CA 3LH5A 3E48A 3HJHA 2G5CA 3QVVA 4JD5A 2ZW9A 4K9NA 5HDQA 3UHOA 2P9CA 1G0OA 4AZVA 3MCWA 5JC1A 3W04A 4EA8A 1BCRB 1Z82A 5FBZA 1F12A 4OIMA 4TVKA 3VFDA 1FU7A 3EG9A 4F12A 3EULA 2J1LA 1MAAA 3M5DA 1E9FA 4J6EA 4UOQA 4ANFA 5CA0A 2ZDHA 3ER6A 3DAYA 1A77A 4CQMA 3MJCA 1B0ZA 4G86A 3WE7A 4ZO4A 3JATB 4BKMA 2BJVA 3I2KA 3R3WA 3EXIA 3N1UA 3R3UA 5JO9A 3AVUA 3JX9A 3C74A 2NXNA 4ALJA 1N5LA 3DFUA 1ZL0A 5EQJB 1Z7YA 1L5LA 1MF7A 5CM8B 1C9KA 3AVOA 4EW1A 5FL3A 3ZS9A 1ZISA 2WA1A 1JVNA 2EF0A 4I3GA 5HBRA 3O8QA 3TBKA 621PA 3O3NB 5BSKA 3OM9A 5EWJA 4GXRA 5A1TA 4UJ5A 5FWYB 2ZRJA 3U7GA 1QH8B 2P8SA 5A05A 4D92A 3OQJA 3PFWO 2Q7XA 3ZHOA 4MWZA 4IX9A 2CHFA 4HY3A 4FOOA 3B5JA 4Z4CA 4GX2A 1A8PA 2XGMA 1GT6A 1QIKA 5JH7B 4HNTA 1Q0TA 5GM1A 4JGIA 1XLVA 4JLDA 2ZZNA 4Q16A 3LX5A 2QTGA 1OREA 4ZOLF 2QNRA 2GTPA 4JEIA 1VLQA 4PCLA 4KJZA 4JODA 4V3CA 1K4MA 4MLZA 1P29A 4ILKA 3A6FA 5BQPA 4G2TA 1KBZA 3EAGA 2ZJAA 4AP9A 1WMSA 1YOVB 4ZANA 1ZBQA 1TCAA 1HL3A 4Y2YA 3UXHA 2FEMA 4W5NA 3LC1O 3LU1A 1ZMRA 3UWKA 1TJ3A 1KU6A 1ZLXA 3RROA 5CFQA 1XNRB 3WXBA 5HQTA 4TV8B 5LQMA 1R6VA 2N1BA 1XKTA 3PHHA 4D8UA 5HKLA 4D9NA 4JZYA 3DE7X 3KV1A 1P9WA 4X63A 5J23A 3PC8A 2WAAA 4WZBE 3L8HA 4GKJB 3DZFA 3W8DA 5A04A 1GCOA 4DUGD 2VK1A 5B3KA 1ZUNA 1CLEA 1KAMA 3T38A 2BZSA 3FWNA 4P31A 4WN9A 4JH0A 4EF6A 3H4TA 3TAHA 3ZH9B 1XZBA 2AR7A 3QQ5A 2WSIA 1CT9A 3IHTA 1QPBA 1EWRA 2EZ4A 1NZDA 4HYYA 1V0JA 1FNMA 4JMLA 3VR2D 3B6IA 5MDHA 4N76A 4L8YA 2I7TA 3MJTA 1GY8A 2Q3HA 1R8XA 3IVRA 3MF4A 4TVBA 4ZV4A 4DSNA 5KX5A 3QLJA 3R40A 2WSLA 4OMDA 3TSYA 3TLJA 2JLYA 2IHYA 3Q8MA 1TEHA 1CERA 2JGDB 3DAFA 4A8JB 3BGIA 3CURA 3PG5A 1WS6A 1L7RA 2OGUA 5PNTA 4YJ3A 3KT8A 3WGUA 4BVHA 1KF0A 3N05A 3JD4A 2A9OA 1D1TA 1ZK1A 4O4JF 2XVXA 3IV6A 4X54A 4EZIA 1L4NA 5JYEA 1JIUA 4QTYA 1MUUA 1OGJA 1XXHA 1C29B 3BD9A 1M8KA 4MRMB 1RI2A 2DFPA 4XDGA 3UT6A 3TPZA 2C2XA 3K05A 2NZVG 1GCUA 3HYRA 3ZNOA 5TMPA 1LLDA 1KI3A 3HLYA 3O3CA 3QWIA 2WMDA 1V16A 1AF4A 2XUJA 3L1VA 5CG2A 1CCWA 2DR3A 2F67A 1OFUX 4C7MA 5F2EA 4C0KA 1KMIY 4RYLA 3C8DA 2D5IA 3GNQA 3GEBA 3FNFA 1V43A 4NE9A 3R7AA 4AJKA 1QS0B 4YFVA 4L27A 4G0YA 4E03A 2D2IA 2ZPAA 1OAKA 3MCTA 4MO9A 4R98A 4S1PA 1DKLA 3LC7O 3U4IA 2ZYIA 4TMZA 5CNJA 5DTRA 3ZZ0A 2B8NA 1BE1A 1QZXA 2Z57A 2RCNA 2GTIA 2CKDA 2OHIA 4MV1A 3SBEA 1XD9A 2L69A 2FEKA 2JVKA 2YVLA 4OHMA 3EVAA 3LIPA 1PKEA 1GCIA 4PCVA 1T9GS 3LDHA 2IVFA 1M5UA 4B5LA 1NGSA 1RWNA 1RZUA 3CX8A 2ZI9A 1HEIA 3LBNA 5LMNB 2RHOA 1TQ4A 2P1DA 2V1UA 2Q4EA 1HE4A 2IPXA 5FOWA 4YHHB 1MGPA 3B6KA 1ZGZA 2EC5A 2J3LA 3A4YA 4LXIA 2WD8A 4BO5A 1PJLA 3O1JC 1CDEA 1U4SA 1X86B 4R31A 3C6QA 2YZGA 2H6EA 3IMFA 3SSNA 4B4OA 3EBPA 5F7XA 3IUJA 4I6GA 4M9RA 3T06B 2XEXA 3VAAA 1U2GA 2FSFA 3Q9LA 1Q84A 1C3XA 4HSGA 2JDIA 4IDQA 4M8NE 1ZMXA 4MIOA 4CDNA 2GD6A 3CO5A 4TV8F 1W9HA 1YRAA 2F1KA 1QIFA 5DTEA 3TKLA 1GITA 5HHTA 1ZD8A 1C9MA 2Q5OA 1NW8A 1XPJA 1Y6JA 5F5XA 2LGJA 1BIFA 4FFLA 2JGFA 1QOZA 3WICA 2A5GA 4YYEA 4N7RA 5ETJA 3LWZA 2ZYWX 4I19A 2G9NA 3T5PA 1JH8A 4IDHA 1YI8A 3M3PA 2P3LA 1CG6A 5EWJB 1WZ2A 1X74A 2AOTB 4E5DA 2DQYA 1V8BA 3DULA 4C3OB 3QI2A 2AJLI 3WL3A 1VJDA 3Q2KA 1FRNA 3TFOA 1BVHA 2I0FA 4X71A 4X5OA 1MX1A 2RHDA 4FHGA 5H02A 4EB8A 2Z5LA 3OIVA 1DJLA 3SHOA 3KEOA 1V11B 4V0NA 3GEIA 1J09A 4G24A 4UZFA 1AQ6A 3WNBA 1B6RA 3VDXA 3DUWA 1QTRA 2J08A 1T6NA 3ZJ5A 5KC9A 4TOIA 5B53A 5DYYA 3HWSA 1D0SA 3O4HA 5LU8A 1QH1B 5J43A 2CJWA 1EDZA 1UBMS 2Z04A 4OXRA 4HWTA 2D5BA 4IHAA 5G53C 3AESB 5JS1A 1Z3IX 1UPUA 2X8LA 3HBLA 3TTVA 2HLPA 4HAVA 1A50B 4MEBA 4IXWA 1E1CA 2ECOA 2HX1A 4R2WA 1JSRA 3QF7A 1Q7GA 2ERYA 2REQB 4MGHA 5IAGA 4CKEA 3IALA 1A0OA 4CCSA 4GOLD 1UC5B 5LD2B 1UK9A 4MPRA 3KDAA 3SE0A 3GA5A 3K0AB 1KEVA 4MITA 1RYYA 1KI1A 2G72A 1OILA 2V7QD 3T52A 2GWRA 1N6PA 1YH3A 3BS4A 4KMSA 5FPQA 4HL6A 1ONPA 2CMHA 3HL4A 1CV2A 1TKBA 2VPTA 4FEGA 4J8PA 4QHYA 1EQ2A 2CMGA 1HQKA 4BV9A 1S7CA 3CMMA 1QH0A 4PVCA 1RRMA 3GVPA 1HDYA 3T0IA 3LIIA 3LXMA 2HSEA 2OZKA 3PRKE 1FJXA 3OD5A 4P53A 1IN5A 4LDAA 2VEOA 1JT9A 5AK6A 1SC9A 5HZHA 1CF2O 4C06A 1BN6A 2HADA 2Z8ZA 5G1PA 2C5BA 1ZW1A 2WB4A 2YWJA 1IXSB 5ILGA 2J7KA 1TVKA 3TINA 4U7DA 1JXMA 3HC7A 3ZE8A 1GGKA 1PVDA 3HUFA 3WS7A 5FWXB 2EJTA 2VDQB 2JANA 1FP4B 2ORIA 4KIWA 5CT5A 1LGYA 3KD2A 4YRKA 3G0CA 2D1RA 1PR3A 1XZQA 4BLOA 2V4ZA 3ZS8A 4P5PA 1KP2A 2XRFA 3JR7A 5DTJA 3DCNA 1ZM9A 3F6SA 3Q2IA 3UWOA 1E6KA 3DFFA 4CODB 1ODSA 2GMWA 3ZNNA 4L8LA 2NADA 2PZAA 2C0CA 1JQDA 4EG6A 5K05A 2HHHB 4LKOA 1UF9A 2BONA 3GZJA 4MQ4A 4OJYA 2AX4A 3ASUA 3ZOKA 4MWTA 3RHFA 2FI1A 3W2HA 3PJGA 1I7DA 2IZ6A 2ZAMA 1JRLA 4YT2A 3BA6A 3E81A 5JZ9A 1A9ZA 3TB6A 4EPTA 4L2IA 1OBVA 4Y6SA 3HABA 1U1DA 1E4YA 4RV4A 3LCJA 3TAUA 2CD7A 4FMPA 4ZVMA 1FYXA 5IJ0B 1FUKA 1Q5PA 5JZMA 3HA5A 4MLPA 2J0UA 1O96B 1Z47A 2BLLA 2HDNB 1W1IA 2JEZA 3O6VA 4YBRA 1H85A 3T3EA 5CB8A 3RDPA 1DMSA 2VQDA 5CYPA 4N65A 5HF9A 2O7VA 2EFGA 1G63A 1KY4A 1SBYA 1WXGA 2Z8YM 4GKAA 1DG9A 3VVCA 1RZRD 3E70C 1SB8A 3EDOA 1GV0A 4ZTBA 5CXXA 5TPWB 3NPMA 4K6OA 2YHSA 1WL8A 5LR6A 1SKYE 4BZQA 2CYBA 2A0XA 1C9DB 1YB6A 4CQNA 1HNWB 1SCJA 3RBXA 4WVFA 1VECA 1Y8RB 1FYFA 3AFHA 3L0OA 5TRTA 3VPXA 1ODIA 4FQ8A 3AFIA 1A04A 1GLVA 2HUNA 4MQEA 1G8SA 1JB9A 1ZY2A 2OCXA 3HU3A 1SOMA 2GHTA 2NZYA 2V03A 4JUDX 3KNZA 5GTDA 1UADA 2YOGA 5JJBA 2C82A 1A9PA 2HY7A 3JQBC 3QVLA 4GPIB 4CFSA 5CVVA 5LJLA 1PWEA 4G4JA 3AEQA 4QBFA 1XZEA 1W2WB 1LV7A 1HE1C 2JVJA 1VSUA 2BKXA 3C5HA 2V7PA 4C0BA 5JALA 4AVYA 1ZAYA 1N92A 4P3YA 4TMKA 1OH6A 2YN2A 4Z0PA 4EA7A 1W44A 4EGSA 2PLNA 2IH2A 2SKDA 2Y05A 3A9RA 1CF4A 1P18A 3CRZA 4OF4A 3M89A 4OK6A 1LKZA 1OLXA 3F74A 1GG9A 3T1QA 4BFXA 1GKKA 1KMMA 3QI7A 1SCQA 4QOIA 2F9LA 5B6JA 3QEBZ 2MSWA 2GJAA 2HHCA 2OCDA 4GLFA 1SBZA 4IG9A 1JLMA 1NVAA 3FZQA 4KIUA 1NR1A 3ZE0B 2AE2A 1I2AA 3C5CA 3AC0A 4LI0A 5FJIA 1TRKA 4BWGA 5BWCA 5LOVB 3BHNA 4H6WA 3WIBA 2PWBA 4IR7A 5EIFA 1VIDA 2XWPA 2A14A 2XKJE 3I3OA 3TZHA 1JL3A 1SQFA 1G5QA 2E37A 4QPNA 4TUYF 7REQA 1KZGB 3UO8B 4YXFA 4PC3A 4P4TA 2AQHA 5REQA 3OKCA 2NUTA 3HPQA 4E22A 4CF3A 1XZIA 2J4CA 1W7AA 3BMOA 3K2EA 3LV8A 1VHTA 2PCLA 4FDVA 2CFOA 4IGKA 1IPFA 3PDCA 3KOUA 5D6OA 5DVZA 1KA9H 2WSSA 1KBQA 4ILEA 3W2TA 3EIHA 4FXPA 4KO3S 3THWB 1JJVA 5BY2A 2FEPA 2JK1A 1T8RA 4MWOA 3U4DA 2V74B 3ZU4A 2QMUA 1I6WA 1UAAA 1EM8A 2ZSJA 1G8FA 4KAAA 4NENA 1E1CB 4C22A 4XEUA 5ALQA 4IZHA 4US2R 1YJBA 2HLDD 3TTXA 1VCHA 2YJGA 1SHLA 2VT7A 4B3FX 5AXAA 2ODBA 4CR8A 3ER9A 3DL7A 3UAVA 2VK2A 1A7KA 1U2TA 1F6WA 1Y6QA 2WUGA 4WOJA 4N7JA 2B94A 1U2PA 1A76A 2EEPA 3NGMA 4BQPA 2RHGB 3K5HA 1MHPA 2WJWA 5CIWA 2DR2A 4NWIA 4DC1A 2Z30A 3N2NA 2C2ZA 3GQVA 2O8VA 1UP7A 2GN4A 4ZQEA 1HOTA 4F6LA 1SIOA 4Y0NA 3H65A 2JFBA 4I8IA 4J3NA 4PLFA 2DPXA 1MO5A 4TS4A 2ZK7A 1I3LA 3F6CA 1HEYA 3ZGOA 2X7JA 2HFKA 4EPVA 2O5EA 1KH2A 4HQKA 1Z28A 3ONFA 3PQDA 1Z8FA 2HPZA 4MW0A 4Y6QA 2PHZA 1X1SA 1SQSA 1JAXA 4NU5A 4BLVA 4CW7A 1M2NA 4J3FA 5FNVB 4B6SA 3LDFA 4EJMA 5A02A 1GQQA 1NONA 4D8YA 3CCCA 2Q07A 2P4QA 2XXBA 5TQ0A 3ZCTA 1M5RA 5IH7A 3WGGA 4Z4EA 1X1DA 1JDJA 1Z4NA 1FTQA 3TEFA 1TUGA 2IYZA 4K6KA 5EIOA 3S44A 4A8TA 3T15A 1ZUNB 3PDIB 1V39A 4IH9A 4BUZA 5KUTA 1TJNA 3DC2A 3V8QA 4JI2B 3K0HA 3I9NA 3GJ4A 4QUBA 4F6RA 2FLVA 1T8UA 3PIRA 2B4QA 4K0KB 1I6LA 1BFUA 3AQIA 3NOOA 3BCSA 4OHWA 1RS0A 2QGNA 4KFRA 1SY7A 2OQ2A 4D3XA 9LDBA 2QD1A 1OAAA 5C81A 2A1UA 1KO7A 1A5SB 4IILA 4BLRA 4FPXA 1T5LA 3C3XA 4YRQA 3PP8A 1GZ5A 3KXLA 5HQJA 4Y1EA 3GFVA 3E84A 2FPPA 4UEKA 3UA3A 3OQOA 4YI3A 4PGFA 2UYYA 3EF3A 2JA2A 1X94A 2IRWA 3IP7A 3FE2A 3L43A 2J67A 3TZLA 3MCVA 1EWKA 1Q7EA 1T6ZA 1GTRA 4LF7B 3M1LA 4B3RB 5K3OA 1NU8A 1VCOA 1WCWA 3C8MA 3OJEA 4OXXA 4HLUA 1PW5A 3A26A 2CVPA 4MQEB 3MNFA 4N18A 2C03A 1NJ6A 2AQ8A 2QXYA 2B7BA 1MTZA 4PG4A 3UMVA 4MHOA 1WUYA 2IYRA 3CUYA 4LYEA 3AR5A 4NC9A 5D51S 5FYQA 3T4XA 4RJ2A 4JLUA 1P7PA 1B26A 3JD3A 2P9EA 4CUJA 5BRAA 3JRXA 5JZVA 1K5PA 3IEPA 3CLUC 5I7RA 1M10A 4L3OA 3BWBA 2HYDA 2BJHA 2QT9A 3ECSA 3AUAA 3UPDA 3IKTA 3QYFA 1JKMA 1RHJA 3ESRA 3PDJA 4DR6B 3F9RA 1F60A 4WJZA 1YIDA 2DKNA 3IJ5A 2OV3A 4XSVA 4Q5IA 2PD3A 3ENNA 3ZU2A 1L5YA 3ADKA 4B46A 3H5LA 2YWRA 1S8AA 1YWGO 4RA9B 1U81A 2KM1A 5FKJA 2FZ4A 4BO1A 2WILA 2JPDA 3HB0A 4PO9A 3W5CA 2CFIA 2C5FA 1BMTA 4J7XA 1JW9B 2JLQA 4YMWA 3WL5A 3RJ9A 2HPHA 4ZEOA 3GT3A 1NE2A 5BUZA 3DBIA 3DYIA 3QNMA 2I1VB 4LGMA 3QBJA 2FQYA 3OOYA 4HQ0A 2OCIA 1U2GC 3OE7A 4RCZA 1CKEA 1F2TB 1ENZA 3A6JA 4NG4A 1SXJE 2H7YA 1HE8B 3OCUA 3C3YA 1LJUA 4GMXA 5EP2A 4KXXA 5LDHA 1QG6A 1NSFA 1NVVQ 1E2QA 3U9TA 3K6SA 3MTIA 2WWFA 4TL7A 2I4OA 3TKAA 5JU6A 4E13A 3KSUA 1DIBA 3LO8A 4HGPA 1W29A 1W85B 3DFMA 3IMKA 1KPHA 2GZ1A 4TLMB 3UJPA 2EKPA 2AN9A 3HV2A 3NWBA 1VHQA 2W2TA 1Z56C 4E3WA 2QNBA 4EZEA 5A5GA 4M37A 1TCCA 4J90A 4L5CA 7ADHA 3LWDA 4A8PA 1KARA 3T9FA 1AA9A 3KVNA 4ZIRB 3KQOA 3R7LA 4IQGA 2VZEA 4PZEA 1XDDA 1HYQA 2E4WA 4HQFA 1D6NA 5BSHA 4HLQB 1XIVA 5CDTA 4J0QA 1N2IA 1O5IA 1CY0A 2AFHB 3DW3X 3G2IA 1A8SA 4GGMX 2J0SA 3HN7A 4E2ZA 2GS9A 3DEJA 3ESDA 2B2XA 4B3JA 2BMEA 1U2EA 3F78A 3OX4A 4JA0A 1N5KA 1ZQ9A 3QWFA 3HDTA 3JZAA 1E62A 1TO6A 1V9LA 4QPZA 3U0VA 2F8TA 4CLXA 2FDCA 1M6EX 2H4WA 4MUHA 4UVEA 1O97C 4EATA 4AKSA 1L3CA 1VKJA 2IP1A 3D6HA 2Q5JA 1XL1A 4QTUB 4GL4A 5DGTA 3WADA 1QH8A 3JQAB 3Q11A 2ON6A 2V6IA 4FWIB 4GRDA 3RC1A 2A94A 2P9TA 4EVRA 5ESDA 2GCPA 2LRHA 2GO7A 1I2ZA 3BD6A 5JS7A 1VB5A 3AR6A 1A9XA 4AJHA 2SKCA 3E5RA 3OJCA 2WFMA 3OC0A 1JAZA 4BEJA 4CIDA 1QGAA 2YXLA 2K2WA 1C8KA 2NMVA 2BFEA 4HRXA 4KXYA 4OXQA 3TNFA 2EBHX 3SQXA 4YP0A 1CJSA 3M6FA 3BOSA 3DNFA 4NJEB 5A4AA 4XX0B 5K3DA 3SXUA 1Z4JA 2O1XA 3ZJYA 1YFLA 4CF7A 2IW1A 3SN6A 2C2YA 3BC1A 4M1SA 3NV9A 1OSNA 2ZB8A 4J76A 3DMFA 4INAA 2WPNA 4KDFA 1QV7A 2QU7A 1K9VF 2Y1FA 5JRDS 4PHCA 5HGXA 1LPMA 4IUYA 2ZJ3A 4NCAA 1JDSA 1LNZA 1LQ2A 3HR4A 3MUEA 2ODPA 5KWVA 4UBJA 2JA1A 3IE0A 5BQ5A 2V6BA 4OXYA 1BU8A 1MORA 4JHLA 2VH5R 2W2OA 1GTG1 3AW8A 4NV0A 3U26A 4XYEA 1F4PA 3CH7A 2EFDB 4LPSA 5DI3B 4LF5B 4WKBA 1MC8A 3KL2A 1A9QA 1LLUA 1MB3A 5FEMA 1GQFA 4Y2RA 1E3JA 1HFKA 3NAQA 5DLQC 1NUQA 2GVDC 4C7VA 9ATCA 1AMUA 1K66A 3BRQA 4O2AA 1UMBA 3FOCA 2V3VA 3JV7A 4ZCRA 5IDWA 4N3BA 2BFPA 1SEVA 2LWIA 3LQQA 2ATIA 3N6RA 3EARA 2QMHA 4EM6A 3IAHA 5GVSA 4L74A 4XD7A 2Y0BA 3WDLA 2GARA 1VMIA 4RPLA 5DBOA 1EP2B 4EGJA 3GRUA 1YCDA 3ISJA 3DLIA 4MKZA 4IX1A 1K4KA 1XSEA 1ZK2A 2FFBA 4P33A 1R00A 3KT3A 3R77A 4X1KA 4QJIA 4BQEA 5KSZA 1GTZA 5DM60 5EHZA 3TBHA 1VCMA 5JECA 1JJ7A 4Z1MA 5AW8A 1KI6B 2P9JA 3E4DA 4PBRA 3GG2A 2ZVPX 3IVXA 3LZDA 4Q4AB 4HDNA 1E6LA 2OZLB 3E5HA 4TKUA 4UZSA 1P2BA 1F0NA 3PPIA 4LDNA 4XUCA 5DCUA 1L5HA 3BE4A 4BPRA 5AW1A 4TLBA 4RFSA 1D4ZA 3PHIA 3F46A 3GFFA 4C2TA 1EUYA 3GAMA 2GN9A 1JQLB 3EB9A 1SA0A 3O90A 3PSHA 4WW0A 2H1LA 4BQIA 2EWWA 5EIHA 5K5EA 4U7GA 3IOEA 4TMFA 3SEAA 4IDAA 1CY1A 3D4NA 1MMFB 2Q2WA 5IULC 3L1HA 3O2QB 4MB6A 2WU4A 1R18A 4TKMA 1L6RA 2EDAA 2F8SA 3OLVA 3EXHA 4NNJA 3O9MA 2ZANA 4E5UA 4AJPA 4BVKA 3GIWA 4Y8VA 1AC5A 1M0WA 2V98A 1IUNA 3QWHA 4LGYA 2J6HA 1UM9A 3IQEA 3RJMA 1NY5A 4RHFA 1YVUA 2UVPA 2B99A 4W5JA 4P0QB 1F8FA 1OUMA 1D2MA 1E77A 4HAYA 1FFEA 1KJJA 2GUWA 2FJ0A 4CM4B 3LPLA 3JASA 4I7EA 3ZDCA 4EPWA 3RUFA 1DC7A 1KP9A 1P4AA 2GFHA 5CH3A 4ZEXA 4YCLA 2KPOA 3JSAA 1VPVA 4DADA 2CJFA 2IZZA 1Z5NA 3DDNA 1PNOA 2OLKA 4M8LA 2FH5B 4QM6A 3IAFA 4CF5A 5C32A 2VCEA 2VHJA 3ITDA 3MFQA 2HTFA 1BMDA 1RKQA 3GV0A 1OLSA 1ND5A 1SZJG 3RADC 2AQIA 3H6KA 1Y4UA 4NOKA 3RSSA 3TIGA 4YMVA 5KDOA 2XTZA 3PXXA 4B31A 2JKZA 2D7CA 1QG0A 3ZUPA 3CG0A 1AKQA 4HYTA 2BEKA 3D9QX 4HQOA 2AFHA 4BO0A 4A23A 1AKYA 2E6KA 3PGLA 4MRNA 3NEPX 1GGNA 3I9KA 1RAFA 3V2HA 1BVYF 3LCCA 3ZE2B 1AK2A 4JYBA 1O7JA 3WZ2A 3JQ9C 2AYXA 3B1WA 1PJCA 4H0CA 3ZE1B 3Q7IA 2EWMA 4N5IX 3HSKA 2ZUDA 1AX9A 1DWOA 3FZGA 3WQSB 1LK5A 3H9EO 3T5AA 1UH5A 1VB3A 2GEDA 4J0EA 5BR1A 1GRNA 4P4SB 4RHTA 3OFSA 2CZCA 1DSSG 4MV7A 1JSXA 4TUYA 1FFCA 3FGNA 1QHYA 5L3RA 1T1EA 3SHFA 1UBEA 2OBLA 4JC4A 1C7IA 1IAQA 4DLSA 1UKBA 2VHYA 4HS4A 3UWDA 1MABA 2FVXA 3DOJA 3FI9A 3HBJA 4HD8A 2ANCA 2HBZA 3Q12A 4ZCPA 4BO7A 2F9MA 2J4DA 2QM0A 4LZPA 1T5IA 1XJQA 1PT8A 1Q1NA 1S3FA 2E4AA 2ZI4A 2ZR0A 4ZARA 4DIUA 1XAJA 2JIQA 2FMTA 4QYWA 4UTZA 3QBEA 1R50A 4J1NA 4IDDA 5EKTA 3HYSA 1ZRNA 5BSWA 5EQFA 1BDIA 2EX1A 4P4UA 1U8XX 2R8OA 4RVNA 4JSRA 5L6LB 1DJPA