5LRSA

The transcriptional regulator prfa from listeria monocytogenes in complex with glutathione and a 30-bp operator prfa-box motif
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
236
structure length
236
Chain Sequence
NAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for glutathione-mediated activation of the virulence regulatory protein PrfA in Listeria.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transcription
molecule keywords Listeriolysin positive regulatory factor A
total genus 73
structure length 236
sequence length 236
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5lrsA02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5lrsA01
1FP2A 3ZMVA 2IXIA 3ZN1A 1TBXA 4AD9A 2CO5A 4I0AA 3FXQA 4U0WA 1ZG1A 4IF4A 1S3JA 3QPHA 3I59A 1XGMA 4PZJA 5HI0A 2G7UA 1RZ4A 1OYYA 4KIGA 1FPQA 1KYWA 4GYGA 3PLQA 3RTRA 2VPVA 1USTA 4HBLA 3UKTA 4UXAA 5DCFA 2F5CA 4AVPA 1GXPA 3L7WA 2A68F 2KKOA 1EYBA 2VBWA 1CAUA 2WTEA 2M87A 3OF1A 4BHCA 5D5VB 4LG0B 3GYDA 5E16A 3IHUA 3PQKA 1UW8A 5HVQC 2MNGA 4A0ZA 3U1DA 1SQ4A 1P4XA 5F6FA 4S05A 2BNOA 4HX7A 1FT9A 1BOAA 3BWGA 1G6NA 4ZU7A 3LFKA 3SMHA 1SD4A 4KFCA 5FQ0B 2Y0OA 4LLOA 3UKVA 4AIHA 3SFZA 3QP6A 4BYYA 4HYEA 3WTUC 2IT0A 4D7TA 4G6QA 3BZ6A 1MJ9A 4LFUA 3QAHA 4CZZA 4CHUA 5DDGA 4OMYA 3O6BB 2QCSB 4CGZA 2UY9A 4XBFA 3WW3A 1KU7A 4EJWA 2RVCA 2KRFA 2A07F 1ZREA 5IT9Z 2DQLA 4EJOA 2O61A 3HTUA 4XF3A 2M8EA 2FEZA 2AS5F 3HSFA 5CADA 5ICEA 1I6XA 3RPQA 3LSTA 3EBRA 3EO6A 2XL9A 1SD7A 1JE8A 1K6OA 3BJOA 5FFZA 4AVCA 4A5NA 1U5TC 3I59B 3H8UA 1IXSB 1S7AA 3I54A 1FWZA 3TNQA 4QMAA 2D93A 4D0PA 4IEPA 3BU7A 1W7PA 3J7AO 3D0JA 5FDBA 2M45A 2Q8KA 3E6BA 5I93A 4XF9A 4O5VA 1AWCA 1XCVA 3L2CA 1IN5A 1QQIA 4UVCA 3DKWA 2QZ8A 4HSJA 1WGPA 2MH9A 2GWRA 3U0ZA 1DDNA 4ESJA 3I53A 1J0RA 1F9NA 5JR7B 4ZZDA 3BOQA 5DV5A 4LJZF 4A5MA 1S8NA 1FBSA 1FBQA 3JSOA 1HSJA 2UXXA 2RQPA 5I0RA 3T1BA 2NNNA 3NSTA 4HF2A 1IN4A 1FY7A 1V4RA 4LUKA 3WTWC 3R6SA 3L9FA 4JTOA 1WQ2A 3PVBB 2O8XA 1EH6A 4P9UA 2QENA 5KHKA 4BHPA 5HLIA 1IXCA 2VBYA 1ZN2A 1CAXB 3OV8A 1ZX5A 2OQRA 5DCMA 2W85A 4Q5SF 3TGNA 1R5GA 3LA3A 1ZZCA 3E6MA 2EFQA 2Q30A 1X82A 1XE8A 1HW2A 4K2EA 2LF7A 2D5FA 3J80K 5J8CA 1MDMB 1FI2A 5E8IA 4G7HF 3QU3A 2HDCA 5HS7A 2Z9OA 1H1IA 4KWKA 2FMYA 4EWEA 2V09A 1D5VA 4HMZA 3DN7A 1SEFA 4O9EA 3ZMZA 3M8EA 1GQGA 1NHAA 3TKYA 1L0OC 2UZKA 1CGPA 2W57A 3K1NA 2W24A 1JHFA 2FBIA 4N9IA 3F3XA 2JSCA 3KP4A 2YX7A 2M5WA 1S29A 2VXZA 2K4JA 2O0YA 1O7LA 2GC0A 4HOBA 3J80Z 4M6XA 1TQIA 4EGYA 4UHTA 2QJVA 5D5WB 2KJCA 3ELNA 3BB6A 3C3WA 1RUOA 2ZNZA 1T2KA 2P8TA 3TOAA 4CDGA 5L3EA 4F8AA 3KLOA 5LHHA 1STZA 1D8JA 1P6RA 4XSXF 1I1SA 4MTDA 4KU8A 2VBXA 3FXUA 3PNAA 3VOEA 1J75A 1QBJA 5J6XA 4MGYE 5TRDA 4ETSA 2PMUA 1VTNC 4QLCU 1IAWA 4OIQF 1YFUA 1Z6RA 4Y15A 3S2WA 4Q0VA 4EJVA 1EH7A 4IEXA 1S7OA 4E70A 4L11A 5AVPA 1XGNA 2B9UA 4Q0QA 1EV7A 4YARA 2XHKA 1R00A 4I2OA 4HF0A 1TLHB 2L54A 3WODF 3ZDSA 1RI7A 3TDUC 3ZMTA 3P9KA 2HFHA 2E1NA 1DGRA 3SXWA 1G3WA 2PFBA 1IPJA 3U10A 5ED4A 2CGPA 4WXHA 3I64A 3IRQA 2HKOA 1O3TA 2ETEA 3WE3A 4EJUA 2VODA 2M30A 3M8FA 4IEVA 4KIBA 4XFGA 4L5JA 1V70A 4FX4A 2CYYA 2XAGA 4ESBA 4Q0SA 3F8CA 4TV7A 4YFNF 1XSVA 3RKWA 3IKTA 3K1PA 2DAOA 2IW5A 3ECOA 1KU2A 1J59A 1HW1A 3HRUA 3R0AA 1XMAA 2DW4A 3M70A 1H9TA 1H1MA 3GFIA 1WWXA 1Z1DA 4WXCA 2CQKA 4KU7A 4ORFA 2FU4A 1W5TA 3ISPA 4EJTA 2PEXA 1F4KA 4M9SA 3R61A 3ZN0A 5LLQA 5D5UB 3HHGA 3HUGA 2FBHA 3SCFA 5AONA 4OIRF 4QGMA 4UVAA 2B8MA 4ENMA 2ET1A 4O6JA 3GBFA 5I8YA 5LBQA 5IT9K 5D1IA 1YTYA 3V7CA 3RNSA 2ISYA 2OAZA 1IUYA 1ODDA 1VP6A 3CO7C 4IHSA 4M72A 1XMKA 1H9GA 3O2PE 2OU2A 1SFUA 2QBYB 3WTZA 2IA2A 4LUMA 2OZ6A 1TQMA 2BNNA 2PLYA 4FHTA 1I1GA 1SMYF 3Q5FA 4HA8A 3NJZA 3D5LA 2JT1A 4QGNA 3BPZA 4O3MA 3E6DA 1ZZ9A 1RTVA 2IA1A 5K5OA 2CAVA 4ENKA 1ON2A 4Z2YA 4KMUX 3SHFA 3WGHA 1B1BA 2HTSA 2UY8A 3V8LA 2MLKA 4BIFA 3SCHA 1QZYA 2FRHA 1YFYA 1ZH5A 3KLNA 1J3RA 4XRFA 1J58A 4A0YA 3GX4X 2HS5A 2V1XA 4Y13A 1UPIA 4MGIE 3CO6C 4PGGA 1T38A 5BQTA 3BDDA 1ZLJA 1Q1HA 2MLGA 4HDUA 2EV5A 2H6CA 1T6SA 2EV0A 1K7AA 1P2FA 1KU9A 3WTYC 2BYVE 2RC4A 2YSRA 5L3FA 2EA4A 2JZYA 3QOPA 4PIXA 2NAZA 1Z7UA 3NL1A 4A0XA 2L3DA 4LLLA 4KUMA 1ZG5A 3T8RA 2P17A 3H3UA 1FX7A 2GA1A 2PYTA 4HN1A 4FX0A 1GVJA 1U12A 2QBYA 5LRSA 1QPMA 5A2QK 2R3SA 2FSWA 4OIPF 4Z82A 5H6QA 5JI6A 3VEPA 1WA4A 5H6RA 1K79A 1TQ5A 1SFEA 3MPBA 4I98B 4BQAA 3E97A 3WTSC 1G4DA 2CFXA 3LWFA 4XFFA 5BPIA 3I0TA 2K4BA 4L2NA 3MAJA 4MQ9F 4XLNF 5C6CA 3TOBA 2D1VA 3C3VA 3PQJA 1OI6A 2XIGA 4RAZA 3V8KA 5E1XA 4TLFA 1F1ZA 3NW4A 3V4GA 1O4TA 4JQFA 3J81Z 2XLAA 4ON0A 2GZWA 3BROA 5K1YA 1U3EM 4GGGA 4I02A 4MGZE 2XAQA 1UIKA 4JV4A 3HSRA 4P9GA 3F6VA 3ERED 3HYIA 2OA4A 3KP7A 1J1LA 2A3SA 4HLTA 3WTTC 4G7ZF 4LTAA 2IXKA 5FLJA 2HKXA 1P4WA 4RB3C 1MJAA 3TQNA 3H3ZA 1FZPB 3EHKA 3F22A 3FZVA 2HOEA 1UIJA 2PMHA 3KGZA 2ZKLA 2MPFA 3KZZA 2ZJ2A 1LEAA 3DP7A 2RGVA 3H7JA 3CEWA 2Q1ZB 4WCGA 5L3DA 4LMYA 5DYMA 3CUQA 5JCTA 2YU3A 1QNTA 4RGUA 1USSA 2XKOA 6PAXA 2A5YB 3TO9A 4DNCA 4D7SA 2V9VA 5CVUA 4I0BA 4IRGA 3WGIA 3ES1A 5BUVA 2QVOA 1BJAA 2XV4S 1B6AA 3V8JA 2OZUA 4B29A 4A12A 1KU3A 1XB4A 5KHIA 4KA4A 4WVZA 5ERIA 5FGMA 1LRHA 2DK8A 4HV6A 4IEYA 3USSA 4AQ2A 3U11A 4YSFA 2LDUA 3KE2A 2HZTA 2L4MA 2O8QA 1R1UA 2XROA 3CF6E 5FLHA 5TJJA 3ELKA 5LEJA 4MH0E 1O7FA 1B4AA 2Y75A 2A61A 5HDNA 4BH9A 2OBPA 4Q47A 2HJIA 3QP5A 3FM5A 1CAWA 2FNPA 1X3UA 2HR3A 2PBIA 2E1CA 1LEBA 1U6GA 4X6RB 1RC6A 3GF2A 2LF8A 1HSTA 3FMQA 3BY6A 3C18A 3E6CC 1W7PD 1K78A 1R7JA 4HQMA 2UYAA 5DCMB 4UV9A 2Z33A 2O1QA 4F7ZA 3GFLA 1KYZA 4UV8A 4I09A 3E5XA 1B59A 4U0VA 3F8MA 1UCRA 2Y48A 3HIFA 3WW1A 4AXOA 4WF2A 3LQQA 2F5FA 3ZP5A 1U5TA 1R5HA 4ZZLA 2L01A 2ZCWA 3JZVA 3CDHA 3S0MA 1FSEA 4GYIA 4Y17A 5BPDA 5FPXA 1HBXG 5BMZA 4H0EA 3LA7A 3H1MA 4QM9A 2QDRA 5F1RA 2FBKA 5JSOA 2A6EF 4KMFA 2O3FA 3JTGA 1PP7U 4RGRA 2RNJA 1XCBA 2D2WA 3HSEA 2ZO4A 3L2HA 2COMA 3WW4A 5J3UA 3CJXA 1LNWA 2JTVA 2N7GA 2XL7A 4GO1A 4E2QA 2CG4A 5JSPA 3HOSA 3QPTA 2YPRA 3BJ6A 1NZCA 3EYIA 1OKRA 1QZZA 3KGLA 2XLFA 4PGHA 1Y3TA 2ZKZA 2LSOA 1Q43A 2ET7A 5EFUA 4MX3A 1KQ9A 2GA2A 4EGZA 1ULYA 1S6LA 2GC2A 4HBNA 1KA8A 2IC1A 4HAMA 4HLXA 4LLNA 1YYVA 2ELHA 4XEZA 1ZRFA 4HVOA 2P7VB 1HKSA 1VJ2A 5LEKA 1Z6TA 4WBBA 4XETA 1J2XA 2HYFA 4NVPA 3F8NA 3CJNA 1QWRA 1O3QA 5C8WA 2BV6A 2WFPA 3SQNA 2FQ3A 5K8SA 1HQCA 2PQQA 4XFBA 1OD5A 2Q2EA 2WC2A 2XKPA 5CU1A 3GEZA 4J1XA 3CUOA 3RKYA 1XD7A 2ETHA 4LG0A 5FFXA 2PA7A 5CVJA 5DEQA 2E7XA 3W6KB 1RIOH 2ZBKA 5E20A 5FB2A 1H0MA 1HXDA 3TO6A 3LQRA 2NYXA 5FQ0A 3IC7A 2PAMA 2ESHA 3DQVC 3S7EA 1IPKA 2XASA 2DLLA 2R7DA 2UXNA 2EFPA 2D5HA 4LK1F 3DFGA 4L18B 1ZZ7A 4ZH4F 1TQPA 3H92A 3HRMA 5D5XB 2YR2A 2JPCA 2NS0A 5J48A 1YFXA 3D82A 4QX5A 3OD0A 4ZYDA 2C0ZA 2PTMA 2EWNA 3WG9A 4G94A 3ZMDA 4L0YB 2VQAA 1XDSA 4MEYF 4KL1A 5J7MA 4WWCA 3N97A 1YW9A 3BALA 3MCZA 4YNIA 4A6EA 4WK8F 3SZPA 5H20A 2PHDA 1T39A 4GCVA 4L9JA 3LAGA 1UHMA 1GXQA 4NHJA 1P92A 2CW0F 3HT1A 1BC8C 5JR3A 3U2RA 3K9TA 3L09A 1Z91A 1FLIA 3H1WA 4EM0B 4IERA 3ULQB 4Q0UA 2XGXA 1LDDA 1MD0A 3ABTA 3O14A 3PFIA 3FFQA 5E1ZB 2DPUA 3KMHA 3C1DA 2DO7A 1EH8A 1OR7A 2Y0MA 1RNLA 3MEXA 4M6YA 3VHRA 4AQ6A 5JSRA 1BI0A 1U5TB 5CJ9A 5EEHA 1PM7A 3GXOA 5ICFA 1JGSA 5KK1A 2Q4SA 4MZUA 1ZZ6A 1D3YA 1ZGJA 4HQEA 3DL3A 1ZGAA 2F4PA 3KP2A 3EYYA 3IKVA 3R4KA 4PCQA 3R60A 5J8FA 1BI2A 1IRFA 1ZRDA 3ETQA 4HVRA 1ZYRF 1J9IA 4K8FA 1LB2A 2VOPA 3IDCB 1QGPA 2AXLA 1XN7A 3ES4A 4HVQA 3KZYA 2VT3A 3I4PA 1A04A 1KQ0A 4IJAA 1CAWB 2GIVA 4YYOA 2MBFA 2K27A 4LULA 1EPZA 1IN8A 4CICA 4OIOF 2HYGD 4XF1A 3KSCA 1BBYA 5DUKA 3WE2A 3RDIA 1OPCA 3K1MA 4RGXA 1SD6A 2IA0A 4EROA 1IZ1A 3RYPA 1ZARA 3RIRA 3LAJA 1W7PB 3JAMZ 4EM1A 1PDNC 1FYKA 4H7LA 1SD5A 1O3SA 1OYIA 2DBBA 3KEOA 1CF7B 3N4MA 2IJLA 1QO0D 3RYKA 1BIBA 4ZU5A 3KFWX 5D6FA 4LGWA 2V79A 4CXFA 2Z5UA 3NEUA 4XLPF 4Q29A 3GWZA 3BCWA 2EK5A 1XGSA 3KP3A 5CYVA 1XSDA 4KICA 1QY4A 5KHJA 2V6CA 5K5QA 1BM9A 1REPC 4FAGA 1UCXA 4KWJA 2DQRA 1IF1A 5I8TA 2GU9A 4AIKA 2JPBA 4WZCA 1YW7A 3OGJA 2QNKA 3OOPA 2OYZA 3IDBB 3P9CA 3K2ZA 1DGWA 2K02A 3ABUA 4I01A 2M1BA 2GC3A 4G9YA 5BS6A 4QXKA 1R58A 2I45A 4HV5A 3T8TA 1R1TA 2FE3A 1BIAA 4IXAA 4YFKF 2QQ9A 4YIIA 2J5OA 4RB2C 2XRNA 1LQ1A 1G3YA 2EFOA 3P9IA 3MZHA 4ESFA 4LB5A 3WGGA 2J5PA 5FLXZ 3H50A 4PIYA 1E17A 5HDKA 3WU0A 3WTXC 4FAHA 3GVAA 4M71A 3GFJA 3ML6A 1IN6A 2H27A 4WXDA 2K0GA 5E1RA 4XF0A 4R1HA 5KHHA 2EA2A 3GYHX 1XE7A 1SAXA 1KGSA 2A6HF 5ILSA 3LAPA 2W25A 3KEQA 5DD8A 4QGLA 1BI1A 2X0LA 5HLGA 4PJYA 3IBMA 5CVIA 2XAFA 5LGTA 4X6QB 2ZXJA 3FHIB 5D6EA 4KT5C 2OZJA 1XSXA 1Q5OA 3M9AA 3BPVA 2KIFA 2QM3A 1IN7A 2VECA 5KHGA 3DXJF 3V7SA 2ZMEA 3ZQ7A 1ZG3A 4MEXF 4DINB 3COAC 4Q4ZF 2EA7A 2GQQA 3DPLC 1WSUA 2PAEA 4RB1A 1FSHA 2O6GE 2Z99A 3S7IA 3MZYA 4L5IA 1PUEE 1B9MA 4XF4A 1RGSA 1X8EA 5LHGA 1CAVA 2E7WA 3ZMSA 1UHWA 3JAMK 4LA2A 5LGNA 1P4AA 3SCGA 4B8XA 3G7DA 5F64A 2VBZA 2RV8A 4N9HA 4FBFA 1L3JA 2BBYA 4I7HA 3M1EA 4AIJA 5AIQA 2QWWA 3DF8A 4LK0F 4KIFA 2Q0AA 4NQWA 4A2UA 3CLOA 2QLZA 1I27A 2FF4A 2WWYA 4P5OA 1Y0UA 3FE5A 3CUQC 4LD5A 3SZTA 2WV0A 4EVIA 4UBHA 5BPXA 1TTYA 3BPXA 2EFWA 2OD5A 1LDJA 1DZRA 2OA2A 4BXUA 1CAXA 1NE6A 1SFNA 4M9XA 2HQNA 3H1YA 3EUHA 4YFXF 3HT2A 2GH2A 1X7NA 1ON1A 4ZYEA 4GXOA 1FYLA 1NYWA 5I0TA 4L0ZB 5FLIA 1IW7F 3RI4A 3K0LA 2PI0A 4Z07A 3GLXA 4IHTA 4RAYA 4I3PA 3NKTA 3GZ5A 1O5UA 2XUBA 2DCTA 4ONUA 2PQ8A 5E1WA 1YG2A 4P96A 2VC0A 2QYOA 4RD7A 2H6BA 4RGSA 4LB6B 4LA3A 1X8MA 2BE5F 5BOXA 2ESNA 1TW3A 1YLLA 1WRJA 4BHBA 3CLPA 1LKNA 4IETA 4KYWA 4EM2A 1O5LA 4HW0A 4PDKA 3EQEA 2HTJA 2FQPA 1UB9A 3GUDA 3I58A 3EETA 2CV6A 3T5XA 2EVXA 3F8FA 3VODA 2PFWA 5I8SA 3B73A 3QU6A 4M73A 3F72A 1B9NA 4CYDA 2VT2A 3P7NA 1U2WA 2KXLA 3LWCA 5HS8A 4KNYA 3W6JB 1RL3A 3CO2A 4RS8A 3EQLF 1W4MA 2LKPA 2ZNYA 2D1HA 4YIFA 2RDPA 4E2SA 5K5RA 1OFNA 1IRGA 1BC7C 4ZU4A 3IWFA 3I5UA 1ZZ8A 4PIZA 3R0JA 4P55A 2IRFG 1MGTA 4O9GA 5JFRA 4WX9A 2B0LA 4YRDA 4R79A 4U7DA 1CF7A 2F5EA 4JVAA 3FZ3A 2NRAC 2LNBA 3H9AA 4P9FA 5FD5A 2MA3A 4UBGA 3REOA 1HW5A 1XRUA 3OTFA 4OLLA 2STTA 4MUVA 1R23A 1ZHFA 2HWVA 3LA2A 2CSOA 3KETA 4MTEA 1O3RA 1YQAA 3JSPA 5HDGA 3DPTA 1ZVFA 3SHRA 4MGRA 3WU1B 4IEUA 3ZPLA 2X4HA 1YIOA 1FNNA 4JK1X 1J5YA 4XFHA 3TO7A 2DT5A 5A2QZ 5LGUA 4HZFA 2L4AA 1YLFA 5CVVA 2Q0OA 1Z05A 2EJRA 3ZMUA 4L9VA 1R22A 1I5ZA 5DD4A 2HGCA 3IRRA 2Z69A 4XFAA 4IRHA 1YWKA 3GW2A 5E8GA 4ENNA 5CVRA 5D8LB 2HEOA 3U9GA 4QM8A 2BNMA 5EZWA 2H94A 2IXJA 5D4SA 2A69F 2KIUA 1CAVB 1FOKA 1U8RA 3FMSA 1TNSA 5FLXK 2P7CB 1MDMA 4E2GA 2D45A 1ZNPA 3TDZC 3FM3A 4OU0A 4AVAA 5L3CA 2YX4A 5HS9A 1EP0A 5IT3A 4EQQA 1PMIA 1WLTA 2FOKA 1YO5C 4META 1HKQA 3NRVA 2UYBA 3I7DA 4N0BA 1XGOA 2GAUA 2E9QA 4EWAA 2UWMA 2IVMA 4MQVA 4JBAA 5DUIA 2MH2A 4AWXB 1LDKB 2K9ZA 4FT8A 4UNOA 2F5DA 3QACA 1YUDA 2ADUA 3RPUA 3V7RA 5ILUA 5FD6A 3MYXA 1UFMA 4L9NA 5FPZA 2H09A 4R52A 3QRFF 3CTAA 1LR5A 2MC3A 1VR3A 2VONA 4GULA 2RKHA 2PN6A 2C6YA 4KN4X 2FA5A 3NQOA 3MDPA 5BV6A 1LVAA 2P4WA 5I0SA 3K69A 5LRRA 5JAXA 4EWDA 1DP7P 5E17F 3FHZA 3C7JA 4DQ2A 1LJ9A 3OCPA 4U7BA 5JHUA 3AAFA 2EB7A 4JTNA 4M74A 4U88A 1YS7A 1K78B 1C0WA 3VFZA 3KCCA 4B09A 4AVBA 3I71A 1DZTA 2RN7A 4LLGF 4IEQA 2BEOA 4HF1A 4MV2A 1V3FA 2NNYA 2P5LC 2XAHA 4KN7X 3H7YA 2FXAA 1BI3A 5HOOA 2VC1A 3J81K 3ECHA 3WTVC 3MFKA 3HRSA 2DPDA 1T0FA 2P5VA 4OFGA 3IWZA 3WW2A 2FNAA 2PAKA 2DK5A 1YHFA 2ACJA 1MJBA 3IIAA 1QXJA 4ENJA 1YFHA 2ZMEB 2R7FA 1Q3EA 2VE9A 3Q9SA 1TNTA 3RZZA 2K86A 4UVBA 3HQXA 2P6TA 1ONVA 3ST7A 3ACLA 4HLYA 2OPKA 4HX8A 1ZRCA 4J1WA 4G7OF 1T98A 2V1UA 1NE4A 3F21A 5T3NA 2HQRA 2GXGA 3FWEA 3GFMA 3FF5A 1PP8F 4LEJA 2XLGA 4L9TA 4OMZA 3HTSB 4XFCA 4KWLA 3LOIA 4UUVA 1EY2A 2VE8A 1FBUA 2XVCA 1UD1A 1E2XA 5FO5A 1J3PA 2BGCA 3BJAA 1W5SA 2O03A 3DEUA 5BY5A 3JW4A 3EDPA 2GXBA 4YG2F 1L3LA 5ILVA 2QQAA 3LZZA 1AOYA 4HN0A 3F23A 3FMRA 3O3KA 4RB0A 3E5QA 5D8KB 2KIMA 4IEOA 2QVSB 3TNPB 4ASNA 2ISZA 3VB2A 5FCCA 4S04A 3GO5A 1J7KA 3HHHA 3IL2A 2OQGA 3Q9VA 3CL1A 3RJPA 2QQBA 1FXZA 2Z2SB 1CAUB 2DFIA 2DU9A 2IP2A 2D40A 3SXYA 1FYMA 2GC1A 2IPQX 4OINF 2P5KA 2DI3A 5CLSA 2CAUA 4OOIA 2P6SA 3T0YA 3KP5A 4EV0A 2PG4A 4IVNA 4BAYA 2G7HA 4UXNA 1R1VA 1G3TA 1WKMA 1ZZBA 5JVTA 1XDUA 2TDXA 2ATFA 1O57A 3FX3A 3D0SA 1DUXC 3KP6A 3FXRA 4IEZA 3MWMA 5D4RA 4EMSA 2DTRA 2W84A 1DPUA 1ZAOA 1R36A 2VN2A 4CO8A 2XAJA 4HX4A 1U78A 4ZYHA 1OYWA 1YW8A 2F2EA 2PHLA 4IEWA 2MD5A 1Y9QA 1IXRC 2K7LA 3B02A 3E3VA 2ZFWA 3E5UA 3RKXA 5EEGA 1QXRA 4HSLA 1YFWA 1YS6A 1JHHA 4IRIA 3BP8A 1JUHA 1ZRRA 5HLHA 2Z3YA 3M7GA 1G3SA 1SMTA 1OMIA 1GQHA 1GHCA 1FC3A 1D8KA 1JXSA 3FJSA 4QWQA 4MNUA 4Q48A 5L3BA 5L3GA 2PJPA 4IESA 2B5HA 3HOTA 3DV8A 3HRTA 4M9ZA 4BNCA 3F6OA 4A6DA 3F8BA 3EJKA 2V1DA 4NB5A 3MQ0A 5ICCA 5KBFA 5KVRA 5I91A 4XSZF 2EV6A 3RYRA 4KDPA 3NVCA 2CWEA 3L00A 1ZLKA 3GZ6A 1RUNA 1MKMA 4Q0PA 2G9WA 5E18F 4HDVA 4G8XA 4IPAA 5LHIA 2IXLA 3M3IA 2KJBA 4XFIA 1NXMA 3G3ZA 1BN5A 4MGKE 1Z9CA 5AIPA 4R8HA 1CX4A 2IXCA 1DPRA 1WI9A 1J3QA 2JRTA 1KQ8A 2EAAA 1HKTA 4U0YA 2EFNA 1TW2A 5BXXA 4ZYGA 3JTHA 1MZBA 1FP1D 3CUQB 4MHGA 1SFXA 1F5TA 2FMLA 3UKNA 2MHFA 2STWA 5I0UA 5ICGA 3ROUA 4G6DA 2IXHA 2QUFA 2VOOA 3G73A 2H0VA 2L02A
chains in the Genus database with same CATH superfamily
4IDZA 1NKGA 1VMFA 3ZN1A 1UN1A 4EQVA 4OHVA 1FMWA 3FXQA 4U0WA 2AREA 5FKCA 5GKAC 4IQJA 3QPHA 5HI0A 1XGMA 1RZ4A 3ZN4A 4NHYA 4DBQA 3VLBB 1KYWA 2ZXHA 3WY6A 3MMYB 4KITB 3ZDVA 1GXPA 4QQLA 5L7OB 1EYBA 1CAUA 1ULFA 1PYVA 4E7HA 2ZGSA 4LG0B 5D5VB 4N8MA 3GYDA 5E16A 1RPWA 2ZA9A 3MW4A 2WQ8A 1TWHJ 1UZWA 2MNGA 5DZFA 2V26A 3BWGA 3LFIA 2QEXI 3OSDA 5GLVA 4AIHA 1W05A 2GIZA 2NN8A 4D7TA 4AK3A 2XWJB 3W2WA 3QAHA 3H1CA 1REEA 2C6SA 5DDGA 3ZLIA 3O6BB 2QCSB 4AI2A 2R7ZJ 1MH3A 1S0EA 3QH6A 1Z7S2 5C3EJ 4P08A 1LE8A 4XE9A 2B46X 4EJWA 3B6CA 2RVCA 2A07F 4NAMA 2NQYA 3OD4A 2QSFX 2P3YA 3ENRA 4XF3A 2CFOA 4BQ1A 1JKPC 5CADA 1I6XA 4COVA 4BJ5C 4Z6YA 1FX5A 1GNYA 1E5RA 5FFZA 2JE7A 4PDWC 1IXSB 5HV4A 2VQ0A 3TNQA 4QMAA 9ANTA 1W06A 4IEPA 5EWSA 3D0JA 5FDBA 3ZQLA 4JKMA 4RM3A 3WV6A 5I93A 1XCVA 3DKWA 3U07A 3V56A 2FBEA 2I5UA 2L9RA 2O8OA 4Y20B 4B7KA 3NWTA 2HWC1 2XDVA 2GWRA 4ESJA 3ZXSA 1J0RA 5G04L 4AGRA 1YCIA 5FYVA 4XDQA 4LJZF 2DA1A 1MQTA 3ZSKA 1FBSA 2EZKA 1FBQA 4P1WA 3PUAA 2Y30A 1HSJA 5E6HA 3H0OA 2F5VA 1ND2B 4RM2A 3T1BA 3ZFFC 3AL0C 3VHPA 2M2EA 1N78A 3K2OA 1SHWB 5IYCJ 4II2A 2CUFA 2M4GA 2Y6HA 4DY5A 1IXCA 2RS31 1ZX5A 5B5EC 2V5YA 5DCMA 3OL3A 1RUC1 1NZIA 3MLKA 5FZOA 3LA3A 1RHI1 1LKXA 5A7OA 5FKKA 1DGWY 4LOSA 5A3NA 4B7EA 1DDLA 1XE8A 1R1ZA 2BY0A 3ONQA 1SPPB 5ACA1 3PSIA 3J80K 5FYHA 2BXYA 2CMPA 5J8CA 1FI2A 3MBWA 1H1IA 2DBNA 3VZKA 4EWEA 2V09A 3KS7A 4RHV2 1L0OC 2UZKA 1SFYA 3VL8A 3K1NA 3HNBM 4W1UA 4F93B 3F3XA 3AKSA 2JSCA 2IFRA 3OB8A 1O59A 1MZ6A 2FOWA 1LOAA 1GQPA 4EGYA 1ACIA 4UHTA 1QOTA 4C30A 1QRYA 4QXCA 5SV5A 2P8TA 3H3LA 1XE0A 3G1MA 3KLOA 4LHNA 1STZA 1TE1B 1D4M3 1C1FA 1I1SA 4KU8A 1WW5A 3VOEA 2WFF1 2CQQA 1J75A 3PM1A 3N9QA 2XBO1 4MGYE 5TRDA 3KF5A 4ETSA 2ZX4A 3PMEA 5IUQA 1IAWA 4UF0A 3S2WA 1NLQA 1F5JA 1T8IA 2R30A 3VL9A 4E70A 1XGNA 1QKQA 4XMIA 4QB6A 4NPMA 5M3FJ 4KGGA 4Z2AA 4HF0A 2ZGKA 2OC6A 3CCLI 2L54A 3WODF 3V0AB 4XJUA 1JZ8A 3P9KA 1UYXA 4D9JA 1NCRB 1H2NA 2E1NA 3ACIA 5IYBJ 3JD71 1H6XA 1IPJA 3DXUA 2WQ4A 4WXHA 1O3TA 1GZ9A 2HEYF 2VODA 4FFGA 2J1SA 2M30A 1V70A 5FY5A 2XAGA 4TV7A 3RKWA 3IKTA 5JUVA 4LLFA 2IW5A 4FE7A 3LEMA 1ZKGA 1QNYA 2BOLA 2FDFA 3ABKH 1J59A 1HF0A 3R0AA 1H9TA 3GFIA 5BNNA 2HPIA 2WQZC 3ZXEA 4KU7A 3I2OA 2E2IJ 1CQ9A 2OUMA 1F4KA 2LS6A 1A8DA 5DABA 3HHGA 1OLQA 2HOAA 2JENA 4AU7A 4JYKA 3SCFA 3BZKA 3I9V2 3OOUA 4QGMA 4E7JA 2ET1A 2AENA 4FPJA 3CDLA 5LBQA 1PIV3 4HT1T 3RNSA 3FISA 1BL0A 1VP6A 5BNOC 3NRUA 1XMKA 4GJZA 2R5YA 4ZTJA 1XJAA 2L7MP 1SFUA 2HI3A 2B45X 3U14A 1QJX3 1SFKA 4IE0A 3HR9A 1SMYF 4XBQA 4Y5Z0 4LK6A 4O3MA 4BQNA 1PK6A 4WM7C 4ZZ8A 2A5ZA 2IA1A 2CAVA 5BNNC 1JW6A 2GP5A 4KMUX 1DU6A 3WP6A 3L2WA 1B1BA 1BLZA 2MLKA 4AI0A 1VBA2 5FZDA 3SCHA 3ALQA 5GPCA 1JZ7A 1QDOA 5TISC 2UWBA 3JD72 1ZH5A 1MR5A 3I2FA 3PIPF 2QQPA 3BDDA 3AL0B 1GZWA 2B7EA 3SH5A 3AL6A 3J7HA 1PO22 2EV5A 5FYUA 1T6SA 2EV0A 1CQTA 3WG3A 4KBZA 4B4CA 2VQGA 4E4SA 5IK8A 3KZIC 1D2QA 2IGNA 3NJVA 3ZQCA 1PZ7A 2HQAA 2BVMA 2VL4A 2M8GX 4JRLA 3AJZA 4JAAA 1ZG5A 2EQRA 4G9SB 3USUB 3VD7A 2XJRA 1R091 2QBYA 5A2QK 4IE5A 2C26A 3C7OA 3VEPA 4YZ1A 1TQ5A 4NPLA 2L7FP 3CJTB 4I98B 1AKHB 1IDYA 4XOTA 5FZHA 3EYPA 2J22A 2JD9A 2QCOA 2V73A 4EZHA 4XJAA 5BPIA 1URXA 4E4ZA 5C6CA 4Z1VA 3I2GA 3TOBA 1OI6A 1TNRA 4LE3A 3V8KA 4UFKA 3WUDA 3ZMOA 4E8DA 4TLFA 5F0CA 3GGLA 4DYRA 3DEMA 3J81Z 4ON0A 2GZWA 2C5DA 3GTOJ 4RHV1 2Z4FA 5F5AA 4R9BA 1AYN2 4XONA 4ES8A 3HQUA 1N1YA 3RFRA 4YZ5A 1E5HA 3HSRA 1FTZA 4P9GA 3AYEA 3DWLE 4D3WA 2ZJCA 3AP6A 5GPAA 3WTTC 4G7ZF 2IXKA 1PVC1 1TP4A 1MJAA 3TQNA 3H3ZA 4HEA2 2B4KA 3F22A 1POQA 5FP4A 5ABJC 5EYYA 1GUUA 2VZSA 3WCRA 2MPFA 2QGUA 3A22A 5C4XJ 1BBT3 2ZJ2A 4ARYA 5DYMA 1JMUB 3DPRA 4PUSA 1W99A 4RGUA 2WT1A 3OBAA 2YUEA 2DTZA 3S3MA 5BNOA 1OVSA 1WJ5A 3TO9A 4A6SA 2ZXWH 4DNCA 1H30A 1T0FC 2L7ZA 3ZXDA 4IRGA 1OQEA 3OYKA 2CV1A 2QVOA 4OI0A 1K5MC 5DPNA 1TVGA 3OPZA 2OZUA 3CP2A 4A12A 1KU3A 4KA4A 5ERIA 2DFHA 2RS12 4JGYC 4KBBA 4HV6A 4PBPA 3U11A 3MPPG 4YSFA 1DU0A 4QPIA 5IAVA 3AG2H 1KJRA 4CCDA 3MV01 3CF6E 1QH7A 1LCLA 5LEJA 4IHWA 2FMDA 2D98A 3L2UA 4DXTA 4CH7A 5FO9B 5DUWA 3VDCA 4BH9A 3TBDA 2HJIA 2HR3A 3L1PA 2E1CA 1LEBA 2BU9A 2LF8A 4TWTA 4C2UA 1C8M1 2DBIA 2JK3A 3PNTA 1TL8A 2G0EA 4NPRA 1YRNB 1ETOA 1R7JA 4CVUA 2Z33A 5FZGA 1N3OA 3FBYA 1IZ3A 5F2SA 1UCRA 3WW1A 1VQKI 2YMZA 2E60A 2QZ2A 2F5FA 3ZP5A 1JJ6C 3AKPA 3FUOA 1R5HA 5E3LA 5DAPA 4ZHNA 4NWVA 4XORA 3H1MA 5F1RA 1ERDA 4IE6A 2QFEA 2XG3A 2E36A 3Q3SA 1PP7U 1XCBA 3HSEA 2XVGA 1Y9MA 2P2KA 1LNWA 2N7GA 2XL7A 4GO1A 2WNUA 3NNFA 1SAUA 3QPTA 2YPRA 2G1MA 5JMCA 2CQXA 5J1RA 2XLFA 2W08A 1LOFA 3BR3A 2ZKZA 2LSOA 1Q43A 2P6HA 3H5RA 2E1OA 1JKRC 3PIOF 3LSPA 2LD5A 4HAMA 1ZRFA 3OS1A 1OOPC 3I3EA 2P7VB 3A7QA 4M3CE 4XETA 4TN7A 1HN1A 2HYFA 4AYBN 4CCMA 3F8NA 1EAH3 3CJNA 1O3QA 3SQNA 4LHLA 5K8SA 1HQCA 2PQQA 2Q2EA 4AGVA 3RI8A 5CU1A 1PGL2 2X6WA 3K48A 3CUOA 2WZPP 3NAPA 2YZ4A 5JVVA 2ZBKA 3WP5A 1L7RA 1VBC3 5E20A 2LKXA 1H0MA 3UL2A 3N9MA 3K4DA 2DCJA 2YDEA 1B8IA 2OT7A 3DQVC 1XYPA 2G4IA 4YG3A 2DLLA 4BEHA 2LW8A 4YW1A 1APNA 1F9KA 1W8UA 5L7OC 4L18B 1ZZ7A 1N77A 2PHWA 3ACHA 3RQIA 2GALA 2YR2A 4QPIC 3BG9A 2JB4A 2WNOA 3H42B 2JPCA 1W2UA 5J48A 2TBVA 3KYDB 3OY9A 3TOJA 4GJYA 4ZYDA 2IGMA 3WG9A 3OR1C 2RDNA 3OYAA 3ZMDA 1OXCA 3G1LA 1XDSA 2DUOA 4KL1A 1UQXA 3FBNB 4A6EA 4YNIA 1K3IA 4OYUA 5H20A 3NV2A 2R5ZA 1D2SA 1YIPA 1GXQA 1P92A 4CCOA 2Y6FA 4AI9A 3L09A 5HCHA 4IO9F 1H8AC 4C3IJ 2JDNA 3OYNA 1NCQA 3DBHB 4ZS3A 4YW7A 4B47A 3ULQB 2Q2EB 2DYRH 1LDDA 2XJQA 4RLQA 1AL23 3O14A 1UHSA 4QDRA 3PFIA 1YJWI 3FFQA 1BW6A 5K7ZA 5FZAA 4CCKA 1OQDA 4ZZ5A 2DO7A 2X1DA 3A0HC 2EIBA 3TEYA 2GMPA 3MEXA 4WM8B 2LBFB 1CWPA 1BI0A 2A3YA 3UJQA 3PU3A 2BPA2 2M4KA 1YQ5A 1JGSA 2WINB 1R49A 3CNAA 4F3JA 4IV1C 4YW6A 3PUQA 4OAZA 2F4LA 3EYYA 3IKVA 3R4KA 3FK7A 4TYSA 2XGCA 1HRV1 5J8FA 1QEXA 2CYFA 1IRFA 4HVRA 2VOPA 1ZK8A 2NVUB 2WNVC 2HOTA 1QGPA 3A03A 5T5OA 4ZDOA 2DA6A 5FZOB 3H35A 1AR71 4GIQA 1OUSA 2ZKNA 5JMOA 1ODNA 1KQ0A 3H5AA 4OIOF 5F2WA 5E89A 2WAAA 4A3XA 3QWLA 2GNDA 2X09A 4XZPA 3AKZA 1H4GA 3CJQB 1XG1A 3HZJA 1OPCA 1UKRA 3JRBA 5FXXA 4CUAA 4EROA 3RYPA 3ZFGC 2EXHA 3OY8A 2K5CA 1MS4A 5B1AH 1W0UA 1W7PB 2Z5WA 5HCAA 4M3CA 2VZTA 2RHPA 3F9KA 2D6KA 1MZ5A 2KMUA 1QOOA 3RYKA 4ZU5A 5D6FA 4LGWA 3BTCA 3ILFA 2Z5UA 4XLPF 2P3JA 4CUGA 3GWZA 2P3KA 1XGSA 3A4UA 1XU2A 1XSDA 1QY4A 4EJRA 1ZR2A 5JI9A 3O1SA 4MGSA 2OF7A 4AEMA 3QH7A 3DTKA 2DQRA 1RUE3 3PNVA 5F27A 4AIKA 1OCCH 5K4LA 1S55A 1W36D 3IDBB 3P9CA 4M3CF 5FKLA 4DZGA 1UPSA 3WDVA 3LSEA 2ZGLA 2KD7A 5T52A 2GC3A 4G9YA 2R7WA 4QKBA 3BIWE 1QGLA 2PHUA 5CKTA 1BIAA 4BLIA 2JG9B 2DVAA 2R072 3SISA 5EYXA 2OQ7A 2XRNA 1AYM2 4H55A 2BJSA 2RJ2A 5JLWA 3W20A 3VBOA 1FMD2 3AK0A 3RG0A 3WGGA 5FLXZ 4CUBA 3HOXJ 1UU5A 3KVBA 3W59A 2ZEWA 4UUSA 1JH5A 4PQ9A 1OA2A 1S4CA 4M71A 3GFJA 1A36A 1IN6A 4A45A 4AHZA 5C9AB 4CCLA 1VQ9I 5E1RA 1MZFA 1A34A 1XE7A 3ZYPA 5DD8A 4RAFA 4V2GA 5JVGF 1BBT2 2CNAA 3HN1A 4LR4A 5K7HA 3KF3A 5H9RA 2JA7J 1K4SA 2VZ1A 1GLHA 2FDHA 2ZXJA 3FHIB 4N53A 2DCYA 1VBA3 4KT5C 1QU0A 4UFMA 4YGCA 3I4IA 2CJJA 5DAQA 1WH5A 2P6CA 1G7YA 2HU9A 1X1BA 2W2IA 4DFSA 2VECA 4XJWA 2VVFA 3MIEA 4A3LJ 2L7KA 1WVRA 4DINB 3DPLC 2PAEA 1FMVA 3K4KA 1FSHA 2JJ6A 4OZOA 3H0GJ 2LREA 4L5IA 1R4NB 1B9MA 1AX2A 2BW3A 4WVWA 1RGSA 3LSDA 4MG2A 2IS6A 5LHGA 3AP9A 3ZMSA 4ZDLA 4FSJA 3QYEA 3R0RA 1B35B 4CEWA 1OFSA 3G7DA 2VBZA 4N9HA 4FBFA 1WLWA 5ABJA 4FXKB 4I7HA 4YPJA 1UY3A 5FUPA 4KIFA 2ZB9A 2Q0AA 4NQWA 1FIAA 4W50A 3VV1A 3OBZA 3FHAA 3SZTA 1TTYA 3HKZN 1LOBA 1X4OA 4BK4A 2BVVA 1DZRA 2IVJA 4M9XA 2HQNA 3H1YA 2XVKA 1ALYA 1HXS2 5J3LA 4YFXF 3HT2A 1QXPA 1PMHX 3AKTA 1F4HA 2GH2A 2VXRA 4QX3A 3S6PA 5I0TA 4QKNA 4L0ZB 2JDZA 3FBMA 3RZHA 3HBKA 1I5PA 1KITA 2ZAAA 4N7UA 2PI0A 2ZZJA 4YW4A 3VDXA 2K9SA 4FXGB 5LFAA 4P5YA 4I3PA 3FDYA 1JOPA 3FC0A 2PQ8A 5E1WA 5C33A 4WM7B 4DOZA 1W6PA 2HWC2 1X8MA 4BLJA 4YFZA 3O8GA 2BE5F 1ZBE3 1X50A 1TW3A 3C7GA 4H3WA 3CLPA 4KYWA 4EM2A 2OCEA 2HTJA 3I58A 5E3NA 4JGZC 1T08B 3ZXFA 2KDZA 3FLPA 1WJEA 4CYDA 4QB1A 3P7NA 4NC6A 1C5HA 3S3NA 2WAQA 2LKPA 4BMEA 2V72A 2W82A 4GRIA 3U4XA 4E2SA 1OFNA 2XGEA 1C28A 1RUE2 4BDYA 1WW4A 4ZU4A 3IWFA 1O8SA 1G2HA 2P37A 3OYWA 2LM3A 5FP7A 2NP0A 2WRAA 5EEAA 1OQYA 4KNCA 1VFCA 3WHTA 1GLNA 2E63A 4YRDA 4R79A 1WWYA 4U7DA 3W2AA 4JVAA 2LFBA 3RWNA 2NRAC 2LNBA 3H9AA 4O65A 2ID6A 4D5FA 4UBGA 4XIOA 2BVBA 1W5CC 4JGZA 4YGDA 1R23A 4D6QA 4XCAA 1G9AA 2WV1A 3P3NA 3OYBA 1YQAA 4XIKA 2RS13 4JHTA 4AYBA 1QHDA 5HDGA 3DPTA 2VTXJ 1UO9A 3I3BA 1ZVFA 3SHRA 1RIRA 4N53C 4JOMA 4FPYA 2DT5A 5A2QZ 3JQXA 3OYEA 1QF3A 3B69A 2DA2A 1JYTA 2Q0OA 4RS5A 2X1EA 1Z05A 1FPN3 3FHQA 4L9VA 2WNUB 5DD4A 5FY4A 2Z69A 4XFAA 4Q8KA 1YWKA 1R1A1 4BISA 2L9LA 4ENNA 5CVRA 4XLAA 4QM8A 1VBB2 5EZWA 2H94A 2IXJA 4XN3A 4R9DA 1RJ8A 4UFJA 2GNMA 2A69F 2A6WA 2UURA 5FLXK 2Y6LA 1B72A 4OU0A 4GWMA 2YX4A 2E34A 5IT3A 1W0NA 4EQQA 2R071 2FOKA 4GMP3 2PMZA 4META 1HKQA 3NNMA 1XGOA 1YX3A 1JTXA 2WUHA 5GAGJ 4EWAA 4MQVA 1VQOI 1N3QA 5GJ6A 1A6IA 1YJKA 3NAPB 5A6YA 4LBOA 3AZZA 4FE4A 3RPUA 1J09A 5ILUA 1ULCA 3MYXA 3ZRGA 3QRFF 3SQOA 3ZN5A 2MC3A 2VMIA 5DQ0A 4KN4X 3KHBA 4W6WA 2JIJA 2FA5A 3NQOA 3O1TA 5I0SA 3K69A 4AG4A 1QJZA 1DP7P 3QLQA 3PUIA 2JQ7A 5E17F 4IGQA 2KL4A 3LDBA 1LJ9A 4Z2WA 2NS8A 4JTNA 4U88A 3I2JA 3P6BA 2FX0A 4AVBA 2QKLB 3I71A 5A3UA 4FTEA 1DZTA 2LOOA 1QJU2 1JU3A 2BEOA 1W2OA 1V3FA 3WT3A 1LU1A 1L7QA 1TME3 1IQDC 3KZ4C 4NNJA 4QX0A 2VNVA 4HPQA 2VTFA 2Z42A 3SLIA 2BGOA 5GLUA 5JZGC 3JXSA 3ECHA 3HRSA 1B72B 2DMUA 3AMQA 1XNTA 4NE9A 2DPDA 4CP0A 3BYWA 2WZR1 1CZSA 1BW5A 3BTIA 1JUPA 2YFUA 2FNAA 2PAKA 3SNMA 2AEZA 1YHFA 3MFCA 3K46A 1VRH3 1QJU1 2ACJA 3OPTA 2YS9A 1YQ8A 1MACA 4ENJA 1EV13 3T3YA 1YFHA 2R7FA 1K61A 2HH9A 4HPKA 4BE3A 4HG6B 4CPBA 1E57A 1OJLA 2P6TA 3ZIXA 4AUXA 3ACLA 4HLYA 2ORZA 4HX8A 2WB1N 4G7OF 1WW7A 1T98A 2DT6A 2HPMA 1WLCA 4AAPA 1S1AA 4OI1A 3GFMA 3JB8A 5EHDA 2XLGA 1H0BA 4KWLA 3LOIA 1EY2A 3CMAI 5FY0A 2X05A 2Q1FA 2WO1A 3ZXLA 4RMNA 4AW7A 1RINA 2BGCA 4YEJA 5JOZA 1Z3XA 2EIDA 3GNEA 1QHGA 5IY5H 3EDPA 4O7XA 2VQCA 2LYCA 1L3LA 3WG1A 5ILVA 4HN0A 1Y1VJ 3K10A 1FOD2 2XQXA 2CW7A 3O3KA 1NK3P 5D8KB 2PLV1 3C2HA 3TNPB 1PGW1 1DYOA 4MOAA 5A7WB 1OQ1A 2COBA 5FCCA 1D1BA 5BNGA 1ONAA 3HHHA 1MMDA 3ZQFA 2OQGA 5LA9A 2Y6GA 2QQBA 2Z2SB 1VBB1 4RQPB 1MW7A 4QD2A 1BZWA 1FYMA 4HPKB 1UY0A 2IPQX 4PSXA 1QMJA 2DI3A 4NDLA 2BWAA 3N05A 2ZXIA 1IKPA 4EV0A 1SLLA 3VBFC 1AYN3 4BAYA 1ORKA 1LECA 1R1VA 1AXYA 2Q5TA 1WKMA 1GNZA 1AJOA 4EN0A 5IP6A 1VQ5I 3D0SA 5J1UA 4IV3A 1NTCA 2OUJA 3VBUA 4CO8A 1H4HA 1U78A 2VZPA 1YW8A 3DEEA 4IEWA 4COYA 1JN2P 5FKOA 4A3BJ 1Y9QA 2K7LA 2QUOA 2R043 4PLMA 2ZFWA 3W21A 3RKXA 5EEGA 1QXRA 2RM21 3ZMNA 4A7YA 2BDRA 1YFWA 4DIQA 1JHHA 1ZRRA 3M7GA 5DTDA 4HNVA 1Z7S3 3FLTA 3C7FA 2JN6A 2Z1DA 1W03A 1OMIA 3BTZA 3WDXA 2FDKA 3HL2A 1GHCA 1REDA 4XC9A 2KLOA 5FZ6A 3D6EA 3VUOA 5L3BA 4IESA 3IH3A 4CDQB 3HOTA 3DV8A 3DKXA 2GNBA 2GN3A 3AZYA 3DYMA 3O1RA 4A6DA 3F8BA 2F17A 2BFUS 4AHXA 2JDYA 1VQ8I 4Q5OA 5KBFA 3OGVA 3BIEA 4XSZF 4OHXA 3NVCA 2CWEA 1DYPA 3WP3A 2GOMA 4L5EA 3L00A 1ULOA 2E2HJ 1RUNA 3OYHA 5E18F 5CFDC 4G8XA 4IPAA 2WNEA 3RS6A 3H9JA 4YZ3A 2XB6C 3SC7X 3PIGA 4XFIA 1NXMA 4D0QA 5I0DA 1BN5A 2KFDA 4CDUA 5HV0A 2DN0A 4R8HA 3M4OJ 1NA1A 1W6NB 2IXCA 3CLQA 3ITQA 4J25A 4YFWA 1YQ6A 4L97A 4U0YA 2BBVA 5FZLA 1FP1D 1P8JA 1SFXA 3VKMA 4W65A 3UKNA 4LNVA 1I3HA 3JBG3 2XUEA 5FKMA 5FR3A 1MS1A 3ROUA 1UXXX 4G6DA 2IXHA 2NLRA 3HM5A 3WZ1A 3ZMVA 4WZFA 3S30A 2HEWF 2CO5A 2BERA 1D0XA 1HB2A 1NCRA 1S3JA 2ZSHB 4AAXA 3I59A 4KIGA 1JODA 1IOAA 4F91B 1FPQA 5CFDA 3BQZA 2DUQA 3GM8A 3Q8AA 2AO9A 4UXAA 2F5CA 4AVPA 2LALA 5GADJ 2WTEA 3E1F1 1T33A 1IS3A 3VBHA 2W0XA 3IHUA 1A3KA 5DZEA 2UWCA 1ASJ1 3SEQA 3GZAA 2RV9A 1SQ4A 5F6FA 4S05A 2ARAA 2BNOA 1BOAA 1JZ5A 1G6NA 4HNTA 1UF2C 1E0EA 1Y8QB 3LFKA 2Y0OA 3Q0UA 2RR12 2V1NA 4C3HJ 4N90A 1ENSA 2VJ4A 3AG1H 3WTUC 3TB0A 1VAVA 3ZXGA 4LFUA 5C3PA 3LSKA 4IE7A 4CHUA 2AYHA 3J7LA 3AMHA 3JBG2 4OMYA 1W6MB 5A33A 4LJHA 3RCOA 1LGCA 2WO2A 4Q4X1 3OSGA 1IQAA 5FJKA 1VF9A 1D1AA 2KRFA 4PI0A 3QCWA 4EJOA 1W2AX 3HTUA 4E6KG 3HSFA 1X9TA 3PJQA 3RPQA 3EBRA 4I0WB 1SD7A 3PL8A 3FXJA 4AVCA 4A5NA 1U5TC 3I59B 3OYFA 2Y31A 4AQSA 3H8UA 1X36A 1FWZA 2VB6A 2D93A 2KT0A 4DB5A 3GZUC 1WGXA 4B1RA 4NIAA 2ZJQF 1JI8A 1AHSA 3MW2A 4QQHA 4K8RB 2Q8KA 4BCUA 4XF9A 4O5VA 1IN5A 3T4HB 1WGPA 2RR11 2YBKA 3QODA 3GTJJ 4AC0A 1F9NA 2LROA 4ZZDA 4XRSG 4A5MA 2DXIA 1HDDC 5EDNA 1S8NA 2XAUA 3SDBA 4JCKA 2HQ5A 3X2QH 1SLTA 5I0RA 2NNNA 2CRGA 1JZ3A 2MC4A 1JHNA 2VQLA 3W9AA 4OMDA 1V4RA 5JLXA 4DEQA 3B3QE 4LUKA 1IS6A 4LOCA 3A21A 1WQ2A 3IAQA 2O8XA 3GF6A 3G6EI 4P9UA 1W9TA 4Q4Y1 5HLIA 4L8QA 3CJIB 4PFOA 5CG9A 2B63J 1CAXB 3GTMJ 1VBE3 1GP6A 3A4CA 1I3QJ 1T56A 2P1BA 1R5GA 3MIFA 2EXKA 1HX6A 2YC4A 4I76A 2EFQA 4W97A 4PFPA 3VZLA 5CA6A 4PJJA 1HW2A 4K2EA 4LBJA 2E71A 1DFQA 5JOWA 1G59A 1RUH3 1MBFA 2LRDA 1IV6A 1PK6B 4G7HF 4OWRB 4DZJA 4XTPA 2HDCA 2Z9OA 1UX6A 1XNBA 3LIGA 2FMYA 2ZJPF 3CKHA 4HMZA 3OSFA 4NMIA 3ZMZA 3M8EA 1S0CA 4BE0A 1RUF3 3DBLB 5FREA 3AZVA 1U5ZA 4HFSA 4Y22A 3I8TA 4RFT0 1JHFA 4XQ4A 3KP4A 1S29A 2VXZA 4GQ7A 3BU0A 4FTBA 4LQRA 2K4JA 1IUFA 1VQNI 1O7LA 4HOBA 1TQIA 1Q56A 1GZWB 5DXDA 2A5WA 1RUD2 3CCJI 5F6KA 2KJCA 1YE9A 1W8OA 2A1XA 2NM1A 3BB6A 3C3WA 3ELNA 4LIVA 1RUOA 3WNKA 1Y0NA 1ZQ3P 5KC5A 4CDGA 4FPLA 1MBEA 3BN6A 5L3EA 2VMFA 5C8CC 2XC7A 3FXUA 5IW0A 2CSGA 5J6XA 4C3JJ 1X4PA 1OF4A 5F5CA 4M3EA 2PMUA 2MW8A 4ES9A 4OIQF 5FXWA 5EJCA 1YFUA 4Y15A 1H2MA 4EJVA 1EH7A 1V6LA 1W3VA 5LY2A 5AVPA 1Z21A 2R7SA 3DYOA 4YARA 1DCSA 2XHKA 4CEWC 3AG4H 1TLHB 2OXBA 1RI7A 2QQWA 4DZPA 3UT0A 4Y7NJ 4ASLA 1AVBA 1RJ7A 1G3WA 2R7VA 1N1TA 2VASA 1LVKA 3IRQA 2HKOA 2ETEA 1BJQA 3KIOA 3TW7A 4Y22B 2JD4A 3M8FA 1T95A 4KIBA 1W3XA 4TTGA 4K6BA 5F0FA 4FPFA 3F8CA 5IAXA 4C9YA 1XSVA 4F92B 4E7ZA 2W3JA 4AEDC 1FYUA 4Q4V1 3HRUA 2DW4A 4QWNA 1HRI3 1WWXA 2K2SA 4DXSA 3P1IA 2CQKA 2IBDA 4LO5B 4M9SA 3R61A 5LLQA 1UY4A 4B3AA 1D0YA 5CFCC 2JMWA 1K45A 4BXFA 3ZOIA 2HBUA 4HL0A 4UVAA 4IOCF 1VMJA 5IT9K 3V7CA 2ISYA 2X5IC 2W00A 3RZLA 5CKQA 3K4BA 2OU2A 3OYDA 1YQ2A 4PDWB 2IA2A 1XXNA 2LG4A 2DFCA 4N43B 2BNNA 4XXPA 2PLYA 1NUKA 1I1GA 2KM2A 4QXBA 3Q5FA 3ZYIB 5EPAA 3MIHA 1BK0A 3BPZA 3WX5A 3E6DA 1RTVA 5K5OA 4ENKA 1ON2A 4JGYA 3SHFA 1IGNA 3WGHA 5BNQA 3CCRI 5JIAA 2UY8A 2YB7A 1GBGA 3DCFA 1WW6A 4BIFA 4DMIA 3MLJA 4B1LA 4DRRA 3V0BA 3GTLJ 3K3OA 5DG1A 1TC3C 4XRFA 4QDSA 4Y13A 1RKWA 1UPIA 1MQTB 4PGGA 3VWBA 3BZCA 5BQTA 1GV2A 4GDFA 2MLGA 4LBLA 2A6TA 1V5EA 2RC4A 3ZFEA 3HQRA 3WNMA 3O1VA 1AR93 2EA4A 2VR4A 4E27A 2YXSA 3QOPA 3WQ7A 3MKLA 2TEPA 3KB5A 1UG2A 1Z7UA 1U8BA 2VL8A 1BQPA 1WH7A 5L19A 2P17A 3SEZA 2XSJC 3HMYA 3Q8BA 3H3UA 1N1VA 2GA1A 1F31A 2PYTA 2R041 4FX0A 3DKQA 1U12A 4V1PA 4S2FA 1H8TC 4C91A 1WA4A 5H6RA 3AZXA 4BUPA 3IB3A 2HYJA 4GWIA 3JCIA 3MPBA 4BQAA 3E97A 2LVSA 5JXGA 1IGOA 1ST8A 1G4DA 2LTNA 1UZZA 3J7MA 5FZ3A 1ND2A 4CYCA 2K4BA 4Q4X3 4X8NA 2D1VA 1RUJ1 1MMGA 1WCQA 2XIGA 1W90A 1ZYBA 2OPWA 5E1XA 1R1A3 1F1ZA 4XICA 1C57A 3BTLA 5K1YA 5CISA 5FYSA 3INAA 4WM8A 1UIKA 3AYDA 4XKWA 5AVAA 3F6VA 3POEA 3URFA 2Y6JA 2OA4A 3KP7A 1J1LA 4HLTA 2HKXA 1S2EA 1V6MA 2EPFA 4TZDA 2WA0A 3EHKA 4PT6A 2HOEA 1BVP1 5FRAA 5A7PA 2PMHA 5FMDA 1RUG1 1MNEA 5A1FA 2R6QA 3VZMA 4HKWA 3H7JA 5L3DA 3THTA 1OVPA 2JDUA 5JCTA 4XOPA 2YU3A 4XL9A 3PUBA 2XKOA 2VZVA 3N7MA 6PAXA 3CDZB 4MO3M 2X5IA 2VUAA 5GZCA 4P9JA 4D7SA 2HOSA 4CPBD 1VBE2 3GTKJ 2RS51 3FLRA 5BUVA 1BJAA 2XV4S 1KS5A 4P9XA 4K9SA 5FZIA 4U87A 1V0AA 4FFFA 5KHIA 1AR61 2VOVA 2DK8A 3USSA 4IEYA 3NJYA 4X6AJ 2FCVA 2Y2ZA 2VNOA 2LDUA 3OR2C 3FIWA 2L4MA 5IVFA 2XROA 5G05L 1KDKA 4XKBA 3HWJA 5FLHA 2EIJH 3ELKA 5J09A 3KV4A 1IDZA 2MG4A 2PLV2 1UMQA 2A61A 2DA3A 4P9YA 4YIRX 5HDNA 2X29A 2NS7A 1VQPI 3FM5A 2FNPA 2M0MA 1QPIA 2M7AA 1Z67A 1CPMA 1FV2A 5KHDA 1U6GA 1RC6A 1I9RA 2QF7A 1PJRA 3H9QA 3PUFA 2NOGA 2DU0A 3E0JB 3BY6A 2OV7A 4XBNA 3TEZA 2TRTA 3WQBA 3HBZA 2UYAA 3KCXA 4H2AA 1UWWA 4UV9A 4M3CB 3MLLA 1IHMA 2A6XA 2WR9A 2RE9A 5FYIA 4U0VA 2HBTA 2JG9A 4WF2A 1RUI2 1DF0A 2V4AA 4RN5A 2ZEYA 3F0CA 4XYXA 2C24A 4UAPA 1LFUP 1HQNA 3JZVA 5GZEA 1FSEA 4GYIA 3JU9A 2KP6A 1RUI3 1G86A 3LEGA 2WS91 3I2IA 1F36A 4UW6A 2FBKA 1NH3A 4KMFA 3JTGA 1MZEA 5FYYA 2KRCA 2RNJA 4AHYA 4NHLA 2ZO4A 3DLLF 2Q8DA 2JUGA 3ABMH 3CJXA 1OLRA 4E2QA 5C4WC 3DGTA 1MQTC 3HOSA 1DGLA 1BMV2 1RXGA 3BJ6A 5J1XA 5JR2A 3WQ1A 1QZZA 3H8XA 3BTXA 4PGHA 2VCCA 4AHWA 2WN3A 1Y3TA 4MX3A 3AXDA 4EGZA 1ULYA 1OLTA 1S6LA 4HBNA 1KA8A 4HLXA 2ELHA 4XEZA 4HVOA 4FPOB 1C8M2 3ASIA 1HKSA 4GH4A 3OY8B 4IZZA 1J2XA 3GBGA 3L2QA 2VJXA 4XURA 1W0PA 4OULA 5C8WA 4ASKA 2E35A 2JVHA 1QNWA 2FQ3A 5KWRA 3P5JA 2GMEA 4XFBA 3LOBA 3VHOA 1RUD1 4INDA 3GEZA 5FP8A 1JYVA 1XD7A 3AFKA 4ISRA 2PA7A 4ZS2A 2J1AA 5DEQA 3W6KB 2VPLA 2DU1A 2CUEA 1EV12 2VI6A 4MLOA 3ZKYA 4HK9A 1R093 4QDQA 3POBA 4GA9A 3IIIA 3TO6A 2VD7A 1V6KA 4CDQA 5FQ0A 1BXHA 3LNQA 2YUSA 1IPKA 4XLEA 1IG0A 2R7DA 4YWAA 5F3GA 3THCA 2D5VA 3DFGA 3J26N 2DDAA 3JRFA 4ATFA 5FP9A 2NS0A 1YFXA 3D82A 4FASD 3LDRA 1HOMA 2ID4A 1BOBA 2PTMA 5H9SA 1BBT1 4G94A 1W36C 3CMMA 1WCSA 5BYNA 2VQAA 4MEYF 5J7MA 2RJLA 2EINH 3N97A 2W46A 3MCZA 2JX9A 4WK8F 3VBRC 1QJY1 5ABJB 4GCVA 3LAGA 5B66C 3CBNA 3OEBA 3U2RA 1UOBA 1NCRC 2HWB2 3CZJA 3H1WA 2QQUA 2CGNA 4IERA 4CA9A 3OYLA 3OBRA 1SLAA 2XGXA 4C90A 1VQ6I 1QVTA 5IJRA 1XX5A 1RNLA 4M0HA 5CBLA 3CC7I 1K5MB 3VHRA 5C3SA 5ERLA 5JSRA 1MBJA 4FPCA 1U5TB 4CEYC 1YJ9I 1ZBE1 5EEHA 2WFF3 5ICFA 2HYXA 5FZBA 5KK1A 1ZGJA 3K7AJ 2GMMA 2DODA 2ID3A 3R60A 3I97A 2VZ3A 2R92J 1SDDB 4FQGA 3ETQA 4Y1YA 1J9IA 2CY6A 4XPVA 3OGSA 4BXXJ 3ORJA 2DA4A 4FPEA 2ZHMA 4QPGA 1W04A 1PGW2 3ZIWA 3TAYA 3ES4A 1XNKA 3KZYA 1SZBA 4A3FJ 1A04A 1CAWB 1IS5A 1O4YA 3HNYM 4A41A 4LULA 5JOXA 2HVRA 4CICA 2HYGD 4XF1A 4BIOA 4JQRA 3KSCA 2A75A 4ZC3A 1OKOA 1T6BX 1QQP3 3VSLA 3K1MA 4RGXA 4CP9B 1AYM3 1DGRM 3FBIB 2IA0A 3CF2A 4M3FA 4NUBA 4XVHA 1YRZA 4GFBA 1F15A 5ACA3 3RIRA 3MIDA 4U2AA 1LEMA 1FYKA 2Y0IA 2DYSH 3N4MA 2IJLA 3JRGA 4ET7A 1QO0D 2P81A 1W8ZA 4NIIA 1IS4A 3WNPA 2C9KA 2V79A 3ZYBA 3NEUA 4Q29A 2EZIA 5C44J 1I1EA 1AR82 1SC7A 3KP3A 4D94A 4KICA 2CV2A 1W0TA 3RI9A 1LESA 4COZA 2VC9A 1RMU3 1U5IA 2VLAA 5FMOL 2WZR3 1I6HJ 1D0HA 2CTVA 1GVDA 3BTJA 3CZUA 3VGIA 3H8RA 2W1SA 3OOPA 2I07B 3LSHA 2QQ8A 1DGWA 4QPYA 2R7EB 3ETPA 2R7QA 4QPGB 2N8GA 5E88A 5T50A 2HXIA 5BS6A 2ELJA 4QXKA 1Y1WJ 4HV5A 1APLC 3T8TA 1U5XA 5FWEA 4IXAA 4B4RA 5K0UA 4YFKF 2QQ9A 2HWB3 3SZGA 4RB2C 4A6OA 3TP3A 2FCTA 2LKSA 3IV5A 1FV3A 4LB5A 1WPKA 3BODA 3H50A 1KQRA 2K9LA 3LSIA 2NMOA 5HDKA 4XN0A 1X58A 2RS11 5A7WA 3WTXC 1R6RA 4FAHA 1DU3D 3E1SA 2QQOA 4OQ8A 4QPWA 4Y33A 3FUQA 4LBKA 3WDWA 1WKYA 2ZHLA 3ML6A 1HRI1 3U1KA 4QX1A 4QHOA 1DHKB 4XF0A 4NOTA 4D8MA 1SAXA 4QX7A 3LAPA 1JGGA 3POSA 2W25A 2DMNA 2NVQJ 3KEQA 1LHNA 4LOTA 3U78A 1QIQA 4II3A 2IGOA 4XUQA 4LKSA 4XUNA 2C1FA 4BJTA 4PJYA 3GHNA 2R042 2JE8A 4FFHA 5JPMB 4X6QB 3B9IA 1ODMA 4BY1J 5IK7A 2RJKA 2OZJA 4G6TB 1UZYA 4Y1XA 1Q5OA 3AG3H 3DU5A 5FY8A 4Y20A 5KHGA 1OURA 2ZMEA 3UETA 3FFZA 4BJ6C 1GUIA 1ZG3A 3QBQA 4Q4ZF 3COAC 4RB1A 2O6GE 2Z99A 2MEV1 2YV8A 4QHBA 1LHWA 1LU2A 2Q8OA 3BG6A 3CD6I 4KGQA 3OYMA 1CAVA 2E7WA 3JAMK 1ND3A 3SCGA 4DS0A 4B8XA 1GFF2 2WFF2 1L3JA 2BBYA 1F4AA 2XVLA 3M1EA 5AIQA 2WAQN 4DYCA 4AE2A 3K4JA 4JDOA 1WCKA 2VIXA 2HWD1 2I10A 4XKVA 1DQ6A 4P5OA 3DPRC 4LD5A 4UBHA 2EXIA 5BPXA 1LDJA 4BE2A 1NE6A 5J40A 4HNUA 1O6UA 2E2JJ 3EUHA 3B93A 4FP3A 2XPJA 4FFIA 4QB2A 1VZ0A 1HIXA 4OI2A 4BS9A 2EAKA 3VKFC 4CEYB 3WHUA 3I4MJ 2ZMEC 4AEJA 4PF1A 3RI4A 3K0LA 5FYBA 1O5UA 2XUBA 2DCTA 2A73B 4P96A 2RS53 4LB6B 3J7AY 5BNNB 4XILA 5BOXA 2W87A 3JQWA 2BZTA 1YLLA 1R092 5AFEA 1XC6A 2CL2A 2W94A 3S16J 1LKNA 2WNVB 1RC9A 4MFEA 1IKQA 3VD9A 2HWF2 1UY1A 4I3GA 3KLSA 4FI9A 3EETA 1RMU1 3F8FA 5GP9A 3B73A 2JG8C 1MNDA 2AHQA 1U2WA 2KXLA 3WR0A 2R7OA 4KNYA 2XOMA 3OYGA 4JDNA 1S0JA 1RL3A 3CO2A 4RS8A 3EQLF 1W4MA 1FAYA 2X9DA 4YELA 3J7NA 2XB5A 2ADEA 5K5RA 1RUG2 1BC7C 1Q8SA 1US2A 5A3PA 2VUCA 3R0JA 3HPHA 4AQTA 2CUZA 1YOVB 3ZYFA 4HOOA 5H9PA 2Y33A 3F2ZA 2HVQA 5DZGA 3I2HA 3VSKA 3PDQA 5IOZA 2RR13 1HDPA 2VJ5A 1PVXA 5FD5A 2Y0SA 1HW5A 3OTFA 3GMEA 1ITYA 2NYYA 2STTA 2QZ3A 2LK2A 3OUIA 1HLVA 5EGOB 3K3NA 1TWFJ 1H89C 3LA2A 1TWCJ 1D5YA 2CSOA 2R073 2LY2A 3KETA 4OI4A 3IN9A 3JSPA 5IVCA 4MGRA 2X4HA 1FNNA 2X10A 2Z16A 4MVTA 1J5YA 3TO7A 1HQLA 5APAA 2HDWA 3KX2A 4XUOA 5CVVA 3LQCA 3ZMUA 1XNDA 1ZRIA 3JB4C 2HGCA 3IRRA 2GP3A 3GW2A 5E8GA 3I3LA 2HEOA 2XUMA 3U9GA 4NHMA 4OHZA 1UG0A 2Y9YA 5D4SA 2LP0A 2OX0A 2KIUA 1FOKA 1GMMA 2YU2A 4RSUA 1KDMA 1U8RA 1B35A 1TNSA 4X1EA 4IQ4A 3FM3A 2JKXA 3TDZC 1DBNA 1LHVA 1KS4A 5L3CA 4ZDPA 5HS9A 1EP0A 3FK6A 1V6JA 1QH6A 4M00A 1WLTA 3CU7A 3RSNA 4ZPIA 1YO5C 2E19A 3NRVA 4IGOA 2KRHA 2TUNA 1CVNA 4MXWA 3DKYA 3K70D 1TT0A 4AFDA 2G9GA 4LG3A 2UWMA 1COV3 1H2KA 4UW5A 4JBAA 5DUIA 4CU9A 2K9ZA 4CRQA 3RVHA 4FT8A 4UNOA 3HNMA 5JXJA 1KFUL 3V7RA 2W1QA 5FD6A 3M2MA 1MS9A 1WA6X 2H09A 1XNCA 5J47A 4Y5TA 3CTAA 1JKQC 1VR3A 3PU8A 2RKHA 3U1XA 3MDPA 5LRRA 1RB8G 3FHZA 2W1UA 4DQ2A 4B44A 1JYXA 4XLFA 4FOVA 4ABZA 3OCPA 2YBPA 1JZ2A 1Z78A 3TYJA 5FRMA 2Y8KA 3BG5A 3VBHB 2FD8A 2XONA 2C4XA 2R7TA 4LLGF 5FYZA 2NNYA 2P5LC 2XAHA 3ACGA 4K7JA 2YPJA 2FXAA 1K4TA 3D5SC 3ILRA 5BNOB 2VC1A 3J81K 1AU7A 3PJRA 4RA2A 3N7JA 4AVTA 3AM2A 1T0FA 4PQQA 5EG0A 5IATA 2BQPA 3J7ZI 4OFGA 4DUWA 2M9HA 4XABA 1MJBA 5D8AA 3IIAA 5DUVA 1QXJA 1HJGA 4Q4V2 1OISA 3PMSA 2VOKA 4YVSA 4HANA 4Z92B 3ZPOA 2AXTC 1Q3EA 5AC92 2X6OA 1RHI2 2K86A 3HQXA 1Z7LA 3J7YJ 4Y1UA 2OPKA 2QQVA 2XRLA 4LHKA 5T3NA 5BNPC 1H1AA 4F3QA 1WMDA 2ZGMA 5KXEA 4JX5A 1Y39A 1FEXA 4LEJA 2OW4A 3ZX7A 3MHZA 2GOXB 4Y3OA 4UUVA 3RWKX 4Q8LA 3TEWA 1FBUA 1AXZA 1NAEA 2XF5A 1E2XA 1AR72 1J3PA 3BJAA 2O03A 1ASJ2 2K9MA 1UJ8A 1JUMA 5BY5A 4KJZA 4P00B 2R5YB 4YG2F 2A7AA 4AM3A 1AOYA 1PO13 3MUY1 3ZO0B 1G9BA 2ILMA 5EG0B 1BVVA 2WWUA 1MS8A 2EIKH 3VB2A 3S32A 3LOCA 3WF3A 3C7EA 3Q8CA 3IL2A 3CL1A 3Q9VA 1LNSA 1FXZA 1EV11 2VU9A 4AGGA 2IP2A 4RL7A 3GDBA 3O0WA 2ME0A 2MFZA 3GCMA 2GC1A 4FCYA 5C4WA 4ZXKA 3ZYGA 1YC61 2EF6A 4AVVA 3KP5A 4XOGA 2LUWA 4LE4A 3DECA 4XW3A 5A1LA 4CTEA 4IV1B 3KHCA 4UXNA 1OSGA 1G3TA 5FZFA 3E7LA 3KP6A 2W5FA 3FXRA 4EMSA 1R36A 3SITA 2XAJA 1S0GA 5IFTA 1OYWA 2F2EA 2PHLA 4BQOA 1W39A 4CZCA 4Y1ZA 4KT6A 2BW3B 4P9IA 3I3QA 3BOPA 3BP8A 1HC8A 3CHXA 5FZCA 2NVYJ 4CDWA 2JRMA 2K9NA 2WWJA 2YBSA 1GQHA 2MSYA 1G9DA 2YYOA 1FC3A 4MYEA 4QWQA 5A7NA 5L3GA 1TMF1 5IVVA 2B5HA 4LO8A 4Q4Y2 4M9ZA 4S2DA 2BOJA 4JKLA 1NT0A 4NB5A 5ICCA 4QT6A 1RUG3 5L7OA 2QDNA 2B7YA 3KYCB 3RYRA 5HXMA 4Q4Y3 4YG6A 1Y8RB 1TWAJ 2VNGA 4PLNA 5J4VA 1ZLKA 2ADDA 3CESA 4HDVA 4PCRA 2J1EA 3RZDJ 2KJBA 1VRH1 1GZCA 3G3ZA 2D7FA 4A7KA 5D2AA 1JOJA 1DPRA 1WJDA 2EAAA 1HKTA 4XM3A 3A02A 5EYRA 4ZYGA 1RVF2 1ZA7A 3CUQB 1F5TA 2RS52 4R9AA 2HWC3 5EF6A 5HXVA 1WCUA 4CCCA 2Y69H 5JZGB 5CB7A 1XMXA 2QUFA 2H0VA 4C0BA 1FP2A 1S0BA 5F3CA 3IUOA 2DVBA 1Y6IA 1ZG1A 3HVDA 3IH2A 4Q4W3 4PZJA 1D1CA 2A6VA 3NNGA 4GYGA 3PLQA 4RBOA 2LTPA 3RTRA 4HBLA 1PO11 5J98B 2R0QC 3KM5A 3L7WA 2VMHA 2LY9A 2A68F 2KKOA 4QAWA 2FQ4A 4FO9A 2Y0SN 2M87A 4BHCA 1K6YA 2RQQA 4HSTA 2HWD2 4XLHA 1UX7A 5A3LA 1TMF2 4ZXEA 4B3NA 1UW8A 2DMQA 3UV9A 1FT9A 1FOD3 5F3IA 5A6ZA 2QKDA 1ZELA 5FO7B 4KFCA 4LLOA 5C8CA 3NWSA 5EZHA 3QP6A 4BYYA 3NARA 2VXDA 4HYEA 2IT0A 4JGYB 4Q26A 4G6QA 4NR1A 3KV6A 1BR4A 1PZ9A 3QQAA 3UGGA 3LEIA 5B3SH 2WNVA 3WSOA 4RLFA 1IRXA 2UY9A 3MFAA 1YYNA 5FPBA 1XPWA 3O5SA 4XBFA 2DCEA 3ZR8X 2DQLA 3ZFFA 2O61A 1D0GA 1OH3A 1O8PA 2FEZA 2AS5F 5ICEA 3LSTA 4OAYA 3EO6A 2XL9A 3QOEA 1K6OA 3BJOA 2HWE2 4XTMA 3S57A 3M1HA 2QTWB 1S7AA 4D0PA 3PVNA 3I55I 2DCZA 5CG8A 2M45A 5GZFA 1UZ0A 4NAOA 3E6BA 3OMYA 5E3OA 1GZTA 1Q8VA 3LFMA 1AWCA 3L2CA 1O4ZA 1QQIA 2QZ8A 3ZGKA 4HSJA 2VQTA 2MH9A 3S8PA 1GYKA 3U0ZA 1TME1 2JIGA 3WQ0A 4A69C 2WLPA 5JR7B 4EATA 1S0IA 4BWOA 3BOQA 5DV5A 3IMNA 2WNUC 2E53A 1G8WA 3JSOA 4FOQA 1ND3B 3I3MA 1EJ9A 3F95A 4GWJA 4HF2A 2GSYA 1SBEA 1IN4A 4NC8A 1FY7A 5KXDA 1F8VA 2CV0A 3WTWC 4CCNA 1FOXA 3L9FA 4JTOA 4WVVA 4CDXC 3PVBB 5B4NA 1LGNA 1EH6A 4M6VA 2RNGA 1VLNA 5KHKA 1V9U1 2PJRA 2VBYA 2KHMA 2ES3A 1QU3A 1MSFC 2W85A 1FOYA 1GWKA 4Q5SF 2EILH 3TGNA 4LBQD 3K77A 3VYUB 3NAPC 1S7EA 3OUJA 5EJZB 5KXCA 2VKDA 2GH8A 2LH9A 2D5FA 3PIJA 1KRIA 4HKLA 3RMYA 5E8IA 3QU3A 2XF7A 5HS7A 1XC5A 2CS3A 1SEFA 3DXTA 5LZ6A 5FV3A 1GQGA 3OWTA 1NHAA 3TKYA 4IV3B 2A6YA 2SBAA 1SVLA 1PGL1 2W57A 4XDOA 3HEIA 2O7OA 2W24A 4BGDA 3HOVJ 1M06G 4TLGA 5A70A 4AF9A 2YX7A 2M5WA 3OOXA 3RRDA 1NY71 4CDXA 1LODA 1RUF2 2GC0A 3J80Z 1PZ8A 4GALA 3PVOA 2AQFA 2W95A 5D5WB 2VO5A 3QYBA 4AI1A 1C5IA 2ZNZA 3TOAA 3JBG1 3MN2A 4PBOA 1EPWA 1SCRA 3ECQA 5LHHA 4AOCA 3DU6A 3ZSMA 4R4ZA 4DXRA 3PNAA 1QBJA 1ZBA3 2VUJA 2RDSA 2Y6KA 2BBAA 4TXWA 1VTNC 4BY7J 5M5YJ 1Z6RA 1W6MA 5A33B 1V9U3 4IEXA 2D6MA 1S7OA 3T2QA 1R00A 2QQNA 5FZ9A 3THDA 4I2OA 5FZMA 1JS9A 2P34A 5GALA 1U0JA 1V9U2 2YGMA 3B01A 5FMBA 5J1YA 2HFHA 2K40A 5FZ0A 5D8AC 4LT5A 2DF7A 2PFBA 5ED4A 2CGPA 3WOGA 1YJLA 3WE3A 1W6NA 2ICWG 3CMGA 4EJUA 2BVLA 4IXLA 5FFOC 2IVIB 2LMDA 3C8XA 2HEVF 3NKGA 4IEVA 4L5JA 1VBA1 2WYFA 2CYYA 4ESBA 1D4M1 1XPXA 4WM8C 3K1PA 2DAOA 3ECOA 1YI9A 3OIPA 2W47A 1NX9A 5HBAA 4DJAA 5F8PA 1GICA 1QJY2 1H1MA 4W6XA 3N7LA 1ZTRA 1W6QA 4XMYA 1Z1DA 4WXCA 2ZGTA 2FU4A 3M4FA 3VHNA 1MEC1 1W5TA 4EJTA 2VZRA 1WD3A 4QU2A 3ZN0A 4ISQA 5D5UB 2DTYA 1P7JA 3IAPA 1L7LA 2LR8A 1DIWA 3J4UH 2VMEA 1V5FA 5AONA 4OIRF 3KWVA 2HYKA 2DWRA 4ENMA 1W9YA 3GBFA 5I8YA 1XSRA 3AP7A 1IUYA 1ODDA 4IHSA 3IT8A 4P9WA 4M72A 5DMYA 1H9GA 2VMCA 3O2PE 1VBC1 1WD4A 2QBYB 3WTZA 2H0BA 4ZKTB 4LUMA 2OZ6A 1AA7A 4V2FA 3WU2C 2ZX1A 1K5MA 3BKZA 4HA8A 3N9LA 3D5LA 2JT1A 3MICA 1DZQA 3WDUA 4D7YA 4IQPA 1WCDJ 2HLEA 3N9OA 2HWE1 1XNAA 4XCBA 1VIWB 3AL5A 5IVEA 2PX9A 3PL0A 1QZYA 2FRHA 3LE0A 3KLNA 3S1QJ 1J3RA 2VAUA 4A93J 1J58A 4A0YA 5LBEA 1FNYA 4MGIE 1O91A 1T38A 3FXLA 4F55A 5GZGA 2NXNB 1ZLJA 2VE1A 4HDUA 3HB9A 1NA1B 5F5IA 2H6CA 1K7AA 3O0XA 1P2FA 1KU9A 2BYVE 3HXLA 4XJZA 2YSRA 2M7BA 2Z79A 2R16A 3T2TA 1PGSA 1PVEA 2JWPA 5DDJ3 3NL1A 4DUXA 3CJIA 1UU4A 2RM23 4KUMA 1CPNA 4XR6A 1FX7A 5B2GB 4MHUA 2IS4A 2V5DA 2AQEA 1X33A 1HRV3 3MGUA 5LRSA 4BQ5A 4UB6C 5E8AA 4Z82A 1ZBA1 1Q8PA 4J19A 1K79A 3CZ6A 1JI6A 2JA6J 3EXUA 3JRHA 2VMDA 3WTSC 5L9RA 4XKCA 3NO8A 2CFXA 2WBKA 5ISLA 3LWFA 3I0TA 4L2NA 4MQ9F 4XLNF 4BE1A 1HJFA 4YW5A 5A3TA 3BI3A 2D6PA 3C3VA 3PQJA 5FMOS 4RAZA 1OHFA 2WY8Q 2YC0A 4UW4A 3V4GA 3GTQJ 1O4TA 2XLAA 1Q1VA 5FYMA 3BROA 1U3EM 5A80A 4Q4X2 4GGGA 2XQRA 3MKWB 1W0OA 4I02A 4OUEA 4MGZE 4R9CA 4PI2A 1A5JA 4BQWA 4JGZB 4FCAA 5BNPB 4RFRB 5CKMA 2G9FA 3OPWA 3ERED 2A3WA 2I74A 2DMTA 2DV9A 4KH9A 1FZPB 2D6OX 3FZVA 1UIJA 3LSMA 3O12A 2ZKLA 5FXZA 1S72I 1FIPA 3KZZA 2W1WA 5A3MA 1PUFA 1LEAA 3DP7A 2RGVA 2VKHA 2L2OA 4WCGA 1ULGA 4DOUA 3CUQA 1HQWA 1QNTA 1SLBA 1FNZA 3OIOA 3ZN6A 3EUHC 4F83A 4I0BA 1HRI2 1PO21 4LO6B 4DRVA 4JHZA 3U75A 2LY1A 1KONA 1C1LA 1XB4A 4WVZA 5FGMA 1DP3A 1LRHA 5DUXA 4RGGA 1YO8A 5F0HA 3ATGA 3KE2A 2HZTA 1R1UA 4UFHA 1UOGA 3BOWA 3I4NJ 1B4AA 5IK5A 5FZ1A 3QP5A 3ZVXA 1CAWA 1V00A 4XXAA 2PBIA 3MIGA 1GV5A 3OS0A 3TBIA 1X3ZB 4UFLA 1H2LA 5IVJA 5IOYA 5LA2A 1J1TA 4CP9A 3C18A 1OCRH 1W7PD 2CU5A 1K78A 4FQ4A 4HQMA 2OTJI 2ZGPA 1J84A 2ZAHA 4CU6A 2O1QA 5FUNA 4C1WA 4F7ZA 4ITVA 1EAH2 2WWSA 1U9OA 1YXWA 4D1QA 1CIWA 4P02B 1A31A 3E5XA 1OR7C 4RQPA 1B59A 4JP0A 1GU3A 2Y48A 4A3IJ 4AXOA 3LQQA 4PDWA 3EUKL 1U5TA 2EIEA 2K3PA 3AMMA 4ZZLA 3ZKUA 2ZCWA 2ZGOA 3CDHA 1X19A 1VBD3 5BPDA 3BR1A 4Q1PA 1HBXG 1LOGA 5BMZA 4H0EA 1ND2C 3JRDA 4V19K 2DFEA 4A3CJ 1B09A 2YPDA 3FN9A 2QQMA 4CYCB 4M4RA 2O3FA 2VULA 2PQSA 5T5JA 2L9NA 2D2WA 3K75B 4DYQA 3T30A 1OLMA 3HUGB 3L2HA 3WW4A 3B00A 3DLAA 4RDUA 4NRMA 3V0BB 3D1NI 3R4UA 1UYYA 1NZCA 1OKRA 1JYCA 2MYSA 1GDTA 4AWDA 5EFUA 2QQKA 3ASNH 1KQ9A 4BMBA 3UYJA 2CU7A 1A6QA 2GC2A 4N4OB 3IAM2 3EMRA 1YI7A 5A7QA 1YYVA 4Y5SA 3TEXA 1CX1A 3PFYA 1RXFA 1GANA 3BUCA 2WN2A 2CH0A 4DGWB 4NVPA 3L9JT 1QWRA 3OYJA 2EXJA 2BV6A 4I6ZA 2EALA 4H14A 5LCWL 2ZGNA 1OD5A 4FTHA 2XKPA 2RG4A 2SLIA 3RKYA 1JZ6A 1DP0A 3I3DA 4LG0A 5FFXA 4URTA 1SFPA 5CVJA 2E7XA 4Q4V3 5K7PA 1RIOH 3VYRB 1AL22 4AL9A 1UKGA 1O4XA 4CE8A 3LQRA 3G1OA 2NYXA 1YI2I 2PAMA 2WLQA 5F08A 5FY9A 3S7EA 3CC2I 2XASA 3FKIJ 1HCRA 2XJUA 2WKKA 2F6CA 4CP2A 4JZRA 5GTHC 4ZONA 2OPTA 2PLV3 1V6OA 5L73A 2X51A 4ZJZA 3HJRA 2L9SA 4ZH4F 3OBTA 3H92A 3HRMA 5D5XB 4UFIA 1QDCA 4CEYA 4KISA 2C0ZA 4YM3A 2EWNA 3AP5A 4L0YB 4U36A 2P3IA 1WMXA 2ZZQA 3T0BA 1QQP1 4WWCA 4O61A 2VXJA 3BALA 2LC2A 1T2XA 4CDUC 3APBA 2M34A 1YIJI 4EEFG 2GNTA 2PELA 1UHMA 4NHJA 3HT1A 1W1WE 1BC8C 2DDUA 4SLIA 2JA2A 3WF4A 1Z91A 1FLIA 4HK8A 3HKZA 1IRZA 1AL0G 3LGRA 4AI3A 4BQXA 3LPGA 4Q0UA 2DPUA 3ABZA 3C1DA 4FPGA 1OR7A 4RQPC 1G9CA 4M6YA 4CCJA 2BWCA 2JXAA 4LK7A 4AQ6A 1ZA4A 1FPN1 3BG7A 4GXLA 5SV8A 5CJ9A 2J1RA 1PM7A 3GXOA 2R062 2Q4SA 4YGBA 3ZYHA 1D3YA 1EAH1 5J4YA 3CMEI 1ZGAA 2F4PA 1R71A 3KP2A 1W8WA 3U21A 4C1XA 4PCQA 3ZQGA <