5LSAA

Human catechol o-methyltransferase in complex with sam and dnc at 1.50a
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
214
structure length
214
Chain Sequence
b'DTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol O-methyltransferase
publication title human catechol O-methyltransferase in complex with SAM and DNC at 1.50A
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 214
sequence length 214
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5lsaA00
3UJDA 1YB2A 3E23A 5C0OE 4YUXA 4FR0A 1P1CA 1B42A 1SQFA 4RSRA 5K0CA 1D2GA 1O9GA 4FT4A 2ZZMA 4LG1A 4QVGA 1X1BA 4FS8A 5LQUA 2P3LA 5HFJA 3FPHA 1Q0SA 3EEYA 3DR5A 5DSXA 4PGGA 2R6ZA 4E2XA 1H1DA 5KVAA 1FJXA 3LDGA 2AN3A 3EVCA 5KS2A 1NE2A 4RTMA 2I62A 2PY6A 1M6EX 2YTZA 3HVHA 7MHTA 4BLUA 5GM1A 4RV9A 3FUWA 2VDWA 3D2LA 5K09A 3TLJA 2AOUA 2B78A 4ZTBA 4FSDA 5KYGA 3LL7A 3IEIA 4PYIA 1G8AA 1VP3A 2IFTA 3HCAA 2P7IA 3B3JA 4ER7A 3FPGA 1ZGJA 3EVDA 3MCTA 4V0RA 3HVIA 4CKBA 1D2HA 5FHQA 4X63A 3KKZA 3B5IA 5EEGA 2ERCA 3FPJA 3FUXA 3GRRA 3HA7A 3A27A 4LECA 1UIRA 2PGXA 3U81A 5KQSA 4BP3A 4U7PB 4DF3A 3LSTA 5FA5A 4ER6A 2OO3A 3OE4A 4OBXA 3G88A 1L9KA 5F2KA 2PLWA 2BH2A 4R6WA 2OXTA 3REOA 4C07A 1X1AA 2AR0A 2I7CA 2ZIFA 5C9ZA 2ZSUA 3UWPA 4PIMA 5DX0A 1JR4A 1AQIA 5EG5A 3EGEA 4X41A 3OPNA 3V8VA 1KPIA 3PS9A 1P39A 3G8AA 5DM2A 1RI2A 2PSSA 4CKCA 1IXKA 5K0JA 5DPMA 4G56A 1KYZA 3A25A 2ZCJA 3DH0A 2Q41A 3C3PA 3MAGA 5FCDA 3C6MA 2QYOA 2ZZNA 5K01A 3HNRA 3B3GA 3H2BA 3AXSA 2VDVE 5E9JA 1L3IA 3GDHA 3QV2A 1YUBA 1ZHFA 4GUAA 3DMGA 2UYCA 4RVHA 3SGLA 2QRVA 3ERCA 2VP3A 4QQKA 4C06A 4QTUB 3TPZA 1Z3CA 2P3QA 3ID6C 4XCXA 2ADMA 3KQYA 3QOXA 1O9HA 1I1NA 4P7JA 3DULA 4KIGA 2JHAA 1VLMA 4IV8A 5FA8A 1NW3A 1V39A 2ZWVA 2OY0A 2GAFA 4CKEA 3BKWA 4EQZA 5CM2Z 1U2ZA 3KHKA 2PKWA 3EVGA 1RI5A 2YVLA 3ORHA 4ISCA 4NECA 1X19A 4XUDA 4AUKA 4YUZA 2P8JA 5DM1A 3NVKI 2NP7A 4MWZA 3NVMB 3UJBA 1R74A 3EVFA 5E9WA 2ORED 2B25A 2G8NA 3P8ZA 4QPPA 4PYJA 2BR4A 4GC9A 3FUTA 3T7TA 5EMJA 1ORHA 1JG3A 1RJDA 4OQDA 4U7TB 2Y1WA 4WVLA 2Y1XA 3O31A 3NW9A 5U4XA 3TOSA 3GGDA 2PXAA 3A7EA 3Q7EA 1BC5A 2PT6A 4E30A 3NTVA 4EVIA 4AZTA 2HV9A 3TM5A 4DMGA 4GOLD 4YMGA 3A26A 3DOUA 2WA1A 5GWXA 5E8JA 2AOVA 4YV2A 2AN4A 3FTFA 1IY9A 1XCJA 2GLUA 3G5TA 4GC5A 4A6DA 1VE3A 5FWDA 3CGGA 3HCCA 4IV0A 5EZSA 4MHTA 3P97A 1MJFA 3G8BA 2P7HA 4P58A 5HIIA 1DL5A 3T7RA 1R18A 5ERGB 5FQNA 3HA5A 4DM3A 1XVAA 1XJ5A 3DLIA 4FT2A 2FHPA 5E1MA 2HWKA 2PWYA 2ZVJA 3MTIA 1KHHA 4KW7A 4EKGA 2XVMA 4KIFA 4C05A 3LDFA 2EJUA 1NW8A 5ICCA 3NMUF 4PYLA 3PLAE 3BKXA 5FQOA 5MHTA 4OQEA 5DLYA 1D2CA 2NXNA 3GJYA 2C7QA 2JH9A 3OE5A 5DSTA 4L7VA 3EVBA 4M7RA 2OZVA 5LR6A 2Z6QA 3KQMA 5T67A 2QE6A 2ZULA 1FP1D 4PGHA 3HM2A 1I4WA 2HR1A 1EG2A 2PWPA 1SQGA 3I58A 2BR5A 1G55A 1PRYA 1SUSA 3HEMA 1KYWA 1R00A 3I9FA 3BZBA 2GA9A 5DRTA 3QOWA 3SM3A 1ZGAA 3HCBA 5E1BA 3RIEA 4KWCA 5IH3A 4BP1A 5BW4A 2XYQA 2AVNA 3CCFA 1R8XA 1NKVA 1KIAA 1WXXA 3I53A 4R8RA 5EVJA 2PT9A 3VC1A 1AV6A 3KPJA 1NW5A 3B7PA 3AJDA 3P71T 4HGYA 3S68A 5BP7A 5ICEA 5LQAA 3HTXA 1HMYA 3PVCA 3FTCA 3HCDA 2XVAA 3KR0A 4AZVA 1YF3A 1M0EA 3KQTA 5DTMA 2NXJA 3KR2A 4PYMA 2YXLA 3RODA 4DQ0A 4F84A 5DXJA 5LQNA 5EHIA 1AQJA 2OB2A 3M4XA 1RI3A 3P9IA 4PWYA 3F4KA 3TR6A 3TQSA 5FULA 4C04A 2OYRA 2FYTA 3LKZA 5BW5A 1L3BA 2PV0A 1VIDA 5EMLA 4YUWA 2O0LA 2P35A 5JR3A 4BLWA 4DA4A 3OFJA 4LWPA 4RYLA 1XTPA 3CC8A 3CJTA 4MTLA 2A14A 3KPUA 3OU2A 5EZQA 5KQRA 8MHTA 2ZWAA 4C4AA 1G60A 3GRZA 4HTFB 2WA2A 3EPPA 3GRUA 1JG4A 2PBFA 2G70A 2N47A 5HIMA 5ICGA 4ER0A 2Z6AA 5T64A 3BXOA 4O29A 4FGZA 2KW5A 5EEHA 5K0GA 3KQPA 1VP9A 1L1EA 1M6YA 2BM8A 3FPEA 3Q87B 2JH8A 1NV8A 4FP9A 4E32A 2AN5A 2CKDA 4PYKA 2PXCA 3PB3A 1TW2A 4QVKA 5D1HA 5F2OA 2ZFUA 5CCBA 2B9EA 2YQZA 3G89A 3KPWA 4EMSA 5LSAA 3GXOA 5CVDA 3HA3A 2VS1A 2CL5A 3OU6A 1JG2A 1RJGA 3G2PA 2PX5A 3UJ6A 4X61A 2UYHA 2BM9A 3BWMA 3X0DA 4RTPA 3P2EA 5GINE 1KXZA 2ZTHA 5K0FA 1KPGA 4HRAA 2CMHA 3HVKA 4GBED 2PVCA 3LGAA 4UOEA 3LKDA 3V97A 5E1DA 4CWAA 3TMAA 2ONZA 5BXYA 4GOND 5FHRA 5LQRA 1NT2A 3ER8A 2PJDA 3DP7A 2AOTA 4MQ4A 5DXAA 5GM2A 2V7EA 2AZTA 3UJAA 1DCTA 4DKJA 4KDRA 3MQ2A 3GRVA 3G2MA 4AZSA 3LDUA 2IDJA 3MERA 3C6KA 4MIKA 2IBSA 3BUSA 2ZZKA 3OZSA 3EEOA 2I6GA 2NXCA 3A4TA 2O06A 3AWIA 1ORIA 3P2IA 3KQWA 3FZGA 3G2QA 4H0NA 4PONA 3T0IA 4PIPA 3THRA 5CIYA 1T43A 2EX4A 1QZZA 1XDZA 5K0LA 2P3OA 5CVJA 2IDKA 5K8VA 2BZGA 4P7KA 1QAMA 3DXYA 5HOQA 1EJ0A 4E33A 4RVFA 1XXLA 3P2KA 4KRGA 5GP1A 2FPOA 3AXTA 2E5WA 2ZBPA 3UBTA 4RWZA 1JQEA 1BKYA 3DMHA 3IV6A 3EVEA 5EHGA 5CCXA 5DM0A 2G72A 4HSGA 5FWAA 3THSA 5GIPE 1G8SA 1ZQ9A 4HC4A 5DWQA 5E8RA 5K05A 4YMHA 1JTFA 2OBFA 4HTFA 1R6AA 3BWYA 2ZIGA 1P91A 2H11A 2VDUE 3PFGA 4GQBA 4CTJA 4F86A 3NDIA 2IH4A 1VL5A 3KPYA 2IP2A 4M37A 1F38A 2AS0A 3SXJA 4Y2HA 2VZ9A 4KVZA 5DX1A 3TRKA 3G7UA 1EAMA 2ZW9A 1N7JA 3JWGA 1JTEA 2ESRA 2H1RA 3EMBA 3EVZA 3P9CA 4DZRA 4QDKA 3KQQA 1NV9A 4B17A 1ZG3A 1XDUA 1IM8A 3GNLA 3GCZA 3M33A 3SVZA 3KQSA 2FCAA 3SR4A 1NW7A 3O4FA 4V0QA 5CUQA 2AOTB 4POOA 1R8YA 3M6WA 3TKYA 4AX8A 3LBYA 5CD1A 1F3LA 2NXEA 3IYLW 5H02A 2K4MA 3C0KA 4WXHA 3KQOA 4GF5A 4E2ZA 3KU1A 3EGIA 5HZMA 3L8DA 1BHJA 1I9GA 3LBFA 2ONYA 3KPVA 4OA8A 5DTQA 2LD4A 3ELWA 3HVJA 3DTNA 1EQAA 2IIPA 5K0NA 3TFWA 1YZHA 3LHDA 2HNKA 4P7GA 5ICFA 5D1NA 1BOOA 3B3FA 3GRYA 5K0EA 1NW6A 2C7RA 2UZ4A 2FRXA 3FUVA 3NDJA 3R3HA 2YXDA 5HEKA 3A7DA 3MTEA 5CVEA 4RTLA 1WS6A 4YV0A 3JWIA 3FYDA 2I9KA 5EIFA 3EVAA 2FK7A 4RTQA 1WXWA 2ZBQA 3GIWA 5F2NA 5LQCA 1L3CA 2R3SA 4HGZA 2ZBRA 5LQKA 1INLA 1FP2A 3KR9A 2UYOA 4CTKA 3O7WA 1X1CA 1YFLA 3T7SA 3LCUA 3LPMA 3DXXA 4QDJA 3B89A 4C03A 1RI4A 1ZKDA 3M6VA 3EMDA 4FZVA 4PYNA 3KQVA 2OPBA 3M70A 1FPQA 3FYCA 3CVOA 4PCAA 3VYWA 1QYRA 3I64A 4DCMA 5HIKA 2GB4A 1NBIA 5M5BA 1KP9A 1SG9A 3WSTA 2H00A 5EKXA 4A6EA 1JSXA 3SMQA 1SKMA 1JQDA 4F85A 1N7IA 3LCCA 5DT2A 1UWVA 3UA4A 1MHTA 3PT9A 2JHCA 2QM3A 3BWCA 1RJEA 3NWEA 4E70A 3LCVB 5C1IA 4QTTB 1PJZA 1SVUA 3PFHA 4E2YA 4OX9Y 4PYQA 3M6XA 3C3YA 1FBNA 1VBFA 2EFJA 3TM4A 4ATNA 3UFBA 1HNNA 4KDCA 2PX2A 5E2AA 3RW9A 3UJ9A 5K0BA 4RTJA 3SSOA 1O54A 3SX0A 2OB1A 4EK9A 5E9QA 5IKMA 5E2BA 2YX1A 2ZIEA 2NNWB 2DULA 1XDSA 4RVDA 1RI1A 3ELYA 5EMMA 2XYRA 3CJRA 1G38A 3CKKA 3UJ7A 3OU7A 3FTDA 1QANA 5CVVA 1WG8A 4YUVA 3VSEA 5E1OA 2QY6A 4ER3A 3FPFA 4HG2A 2IH5A 3E05A 4EKIA 2G1PA 3SSNA 3FRHA 1Q0TA 2B3TA 1OR8A 3UJCA 2PX4A 2HMYB 2Z6UA 2JHPA 5DTRA 1EIZA 2F8LA 2ZLBA 1X1DA 2CMGA 2PX8A 3BGVA 4GEKA 4LWOA 4QPNA 4XUEA 3OZTA 2YXEA 1JG1A 3E7PA 3PX3A 5JUWA 5EMKA 1P1BA 3OCJA 5FUBA 3UA3A 4YV1A 1WZNA 2NP6A 1QAQA 4RTNA 2C7PA 3FUUA 3K6RA 2O07A 2PXXA 4OBWA 4Z2YA 4M38A 3HP7A 2V74B 1SUIA 1TW3A 1XCLA 4AZWA 4RVGA 3FTEA 5EKUA 1DUSA 2AOXA 3NJRA 4JXJA 4OA5A 5LQJA 2O57A 1YFJA 9MHTA 3M6UA 3R6TA 3R24A 3NWBA 5EQJB 2NYUA 4PYOA 1YZ3A 4Y30A 2YUIA 4RTKA 3JWJA 2JG3A 1KR5A 3BWBA 2G71A 5EIWA 4DCGA 4RTSA 4HH4A 3R9XB 5P8WA 4IKPA 2GPYA 4RTOA 2AOUB 3MGGA 3OFKA 2HTEA 5FTWA 4P7FA 2AVDA 4PNEA 4PCLA 4R05A 2XYVA 3DMFA 4RTRA 1EJ6A 4FSXA 3AY0A 5DM4A 4E31A 5HILA 2XBMA 2WK1A 3DUWA 3HCEA 3K0BA 5B1SA 4ER5A 1JQ3A 3PX2A 4R6XA 2O05A 3VC2A 4X1OA 3EGVA 3MCZA 3PTAA 5T6BA 4R8SA 2CWWA 2IBTA 3TKAA 1NBHA 1WY7A 2DPMA 4XUCA 3LX6A 3ER9A 2P1DA 3SSMA 3UJ8A 5GIOE 4M36A 1QAOA 2IGTA 2EJTA 2JJQA 3ANXA 3BT7A 2IH2A 3R0QA 3HCFA 2B2CA 4RX1A 5EPEA 4X60A 4YUYA 3UZUA 1Y8CA 3DXZA 4K6MA 5GOZA 4C08A 3LECA 5DX8A 5EC8A 2AOWA 3CBGA 3KR1A 3MB5A 1VPTA 3ELUA 2P41A 3I5UA 5EGSA 5FADA 1TPYA 4BLVA 5K03A 2GH1A 1G6Q1 5HIJA 4BY9E 3E8SA 3P9NA 3GO4A 4PINA 3FRIA 1RJFA 4E2WA 3BGDA 3BGIA 3ME5A 4CXMA 4GOOD 3G2OA 10MHA 3GU3A 2P40A 5DRYA 2EG5A 1JSZA 2GS9A 2IPXA 3JWHA 3IHTA 3OZRA 2C7OA 1N2XA 5CVUA 3GWZA 3MHTA 4IWNA 1UFKA 3G5LA 1VQ1A 2QRVB 2UYQA 5EOVA 2OKCA 3P9KA 5G02A 3CJQA 3DLCA 2FK8A 1AF7A 4GOMD 1KPHA 2YR0A 3ELDA 4QQNA 2BR3A
chains in the Genus database with same CATH superfamily
1A4RA 5AM0A 3OECA 1TD1A 2JK1A 4DANA 4DCVA 3TCKA 2AFVA 1TKAA 2PL3A 3ZU5A 1O9GA 1XEAA 3ABZA 3BGWA 1VG0B 4ZT2A 3WLAA 1NQWA 2G76A 5DHPA 1J6UA 3RJ5A 2I2AA 1XZFA 3W5CA 2QTLA 1TCBA 2OCBA 3LY8A 3PDIA 3ZV7A 3EXHC 5HTOA 4FUTA 2VVTA 3MFYA 4HGPA 3CPJB 3EVCA 3YASA 3K4PA 3WK8A 2QTCA 4IZHA 1KI6A 2GKGA 3AMVA 1J2YA 3P5BA 2J9YB 2XUZA 2P9CA 1A96A 1QYVA 2O4UX 2VRCA 4P53A 1VCIA 1YJ8A 2YJ5A 1TYZA 2EGGA 3CX7A 2WG2A 3HYTA 4WLVA 3PHHA 2RB5A 4HEQA 3VR3A 2BGIA 2IFTA 5GTDA 5KAPA 4M76B 1KGDA 3B5EA 3EVNA 3GVCA 5DGXA 3AM3A 3REQA 2GESA 3WWZA 3INYA 3K70C 1RLIA 3IAEA 2LP4Y 2C7OA 3OF3A 4CKBA 3ZU3A 4X92A 5T4EA 2JCVA 4UM9D 1S96A 3LAWA 2D2EA 4LECA 3DNMA 1DG3A 2ZJ4A 2NUTA 3OT1B 1Z3IX 2FUCA 3PPXA 1AGYA 4RZHA 1A9YA 1WDLA 4JP5A 4M4SA 3TD6A 1U4NA 4IHJA 5AHWA 4PAOA 4DN6A 4EW1A 3VJRA 2WUGA 4TSFD 1XIVA 3GEGA 1HG0A 5KVQA 1Z5GA 2A9JA 2QRZA 4X24A 4BVLA 5IHXA 2D1RA 2VTVA 2HTFA 4MYSA 1JR6A 1D6NA 4PLZA 5DYNA 3L4SO 1AQIA 3NNNA 5KX5A 1Q12A 4O8CA 3PS9A 1P39A 1VYHA 1FL9A 2GPTA 2WFLA 4Q9HA 1PG5A 2NLOA 4CODB 5JT1A 3A6KA 4ETNA 1L9XA 1UZAA 3VTFA 5EWLA 2Q41A 5EXXA 2ODQA 1SELA 1IZ8A 2ZTLA 2QQGA 2YXBA 3B38A 3WLMA 3FN4A 1YDFA 3DMPA 3DOIA 4LNAA 3B7WA 3DLAA 5BWNA 1IBLB 1KMQA 3FCOA 1KSHA 3OZWA 3BCRA 1PFUA 2G9UA 3F3KA 1ZS9A 4V38A 2ROQA 4PM4A 2UYCA 1GD1O 5I7HA 4XVQA 4FYYA 2MR6A 1DDGA 4UCWA 2DBRA 4CTNA 1LBHA 2ZBVA 2EYUA 4Z0NA 1EZ4A 1M7HA 1K63A 4MAMA 4P7JA 1Y5IA 4KIGA 1NP6A 1Z6YA 3FGPA 4P3PA 3CNHA 2QZSA 2F8MA 4L0QA 1U02A 2GAFA 5BSTA 3CRW1 3STXA 3ZCPA 3AVQA 5ADVA 5HVNA 4IEIA 2VTBA 4ETMA 3PXUA 1R9NA 3K2EA 4QNRA 3L0CA 1F51E 2DFKB 3FDJA 3U0BA 2O1SA 2P9YA 1FYXA 3FI0A 4HDSB 6AT1A 1D7OA 3L49A 5DM1A 1S3SA 2E3JA 2H2GA 1ELOA 2BFOA 2OKGA 2GJKA 1P2VA 1RAAA 2CJXA 1AUXA 1X7XA 2HHJA 2V7WA 3HABA 5E9WA 4ZHQB 5LKAA 1E9FA 1IOWA 4R9UC 5C3UA 3WHKA 5HCUA 4A8JB 4ZOBA 2CHEA 2I7DA 1TM2A 2FAXA 1E2GA 1E64A 1RJDA 2Z2IA 5FPTA 1UMCA 3DYVA 3L4BA 3U1BA 1F7UA 3D3WB 3N9IA 1BQ3A 2L2QA 1Y7TA 1LDYA 3H05A 1U0OC 3D6UA 3HMQA 3SZ3A 4PLWA 1UPFA 1UPCA 1GZ4A 2V6GA 3R8XA 1TAUA 2R4QA 2C2XA 2V96A 4FGUA 4MWCA 3LC2O 1C9NA 2GZMA 4BB9A 4JXXA 4EKDA 1EJBA 1V3UA 2R65A 2YJGA 1OTXA 5CFRA 3D8UA 1CUWA 3NOVA 3CZ9A 4BCDA 1UR5A 3I9V1 1E3MA 4Q82A 5CDTA 1ZP6A 2P62A 4ECEA 4NYMR 3RFTA 5JWRA 1DADA 1UDRA 2N42A 3SNKA 3I6BA 3MTIA 2WI8A 4CM9D 1N8KA 3HB4X 1NXWA 1XMSA 5KSPA 1M1NB 2Q9BA 1ISGA 4YCAA 3GLIE 3PLAE 3PFWO 1NBEA 3HUUA 4OQQA 1T25A 1RQPA 1GL9B 1THMA 1OFUX 4CUZA 4ENQA 2AEFA 5BPFA 3L6DA 2Z6QA 4LYEA 4R9VA 3SJBA 1Z6ZA 2QV7A 1GPH1 4IHAA 3VH2A 2XE4A 3VHLB 2QZ4A 1NOJA 3UK7A 1KEPA 5BRJA 1LX6A 3N70A 3V8QA 1JVSA 4XX0A 3D8BA 1LDBA 2GEUA 2A57A 3QOWA 1ZA1A 5E1BA 3OQ6A 3FPCA 4KWCA 1UJ5A 2OZKA 4YVFA 3U49A 2PVPA 2BC9A 2Q5QA 1G20E 1K8ZB 4TL6A 2R5FA 3KE8A 3VR6A 5LQAA 1O03A 4C7JA 4QPZA 1DC6A 3ABIA 2DFLA 4UOZA 4XX1A 5BSKA 1CS0B 4HQOA 2PEZA 2A7QA 2X2OA 2BH9A 4KN6A 4YRRA 4A23A 4AXBA 2B6HA 2P75A 3AUAA 3RNOA 2ZRLA 2Y66A 1Q22A 2A1UB 3IQZA 3NANA 5L3SB 1D9ZA 3RROA 5BVGB 5BNIA 4O59O 5SZHB 1C3VA 3HGQA 4YHHB 1P18A 1WXDA 2B3DA 4EL0A 1TM4E 3B6MA 3ZHRA 4LSZA 2O59A 3TXAA 4BPBA 1RYDA 2X8WA 4WCFC 4W6ZA 3HRIA 4DIKA 3WAGA 2BGJA 2WQZA 1C9KA 5FJJA 1SZPA 1TC2A 1X3LA 1KJ9A 5AICA 4IUDS 4QXAA 3F9IA 1MZPA 1KDRA 3I0ZA 2V3VA 3K9NA 4ESHA 1YJXA 4Z7JA 3LY5A 4YRDA 2P9JA 4NV3A 1YB1A 2AFIA 3WLOA 5I8WA 1X86B 5JO0A 3IQFA 4G0WA 1EBFA 4O6VA 2G70A 5EQFA 2OXCA 3GPLA 3A2MA 5BRNA 4RMJA 2JRLA 1RJ9A 4MHOA 4PBSA 2BM8A 4FMDF 4UE6A 3V8BA 3HBJA 1RC8A 4B2IA 1KSFX 4NULA 1I2BA 1GSIA 2SHKA 1D8AA 1EGMB 2VJMA 2WF9A 4H0FA 5K5EA 1KJYA 4O63O 3QM1A 1AC5A 1U7DA 3L5OA 1FUKA 3CUKA 2IS6A 3CRZA 4LHZA 3H5OA 3PIRA 1OI3A 5CVDA 3HA3A 5IDVA 1UAYA 5FBQB 2IJGX 1GZ3A 1S3FA 2RHGB 5MN6A 4TL9A 4KK4A 2JGJA 2BM9A 2F1IA 2OCPA 3PUIA 4ILEA 4BLTA 2CL6X 4G9BA 3K0AB 1KPGA 3DD1A 4HNRA 5AUQA 3AOEC 5KTNA 3RYIA 4MUJA 1Y1PA 4MGHA 4JVMA 4RNDB 3VOAA 3PQ8A 3BWEA 4J7UA 5FTJA 4YR7A 6LDHA 3I4CA 5FHRA 3RSZA 1DWUA 1NT2A 2O2DA 3RFXA 2GJSA 1ESMA 4L0MA 1I7PA 2B1GA 1QHHA 3KSUA 4AP9A 1DAKA 3LA6A 4I9GA 3GRAA 2FLKA 1Q1QA 2GNAA 3GRVA 1YZLA 4OQLA 4YMSA 1R4NA 3O95A 2C1ZA 1E1MA 3LQKA 3MERA 1GZDA 1T8RA 3MRXA 3K0CA 1YHNA 1ZAKA 3SQXA 2GAAA 2R7NA 1QH9A 3QLJA 3S40A 3B9QA 1R5OA 4CCWA 2W2LA 4G09A 2BP7A 3WYDA 1YR8A 3G2QA 5LIRA 1C7FA 1H6CA 3CLTC 4U00A 2C5LA 1XDZA 4R2XA 3GLHE 3HXQA 2YW2A 4ASUD 2J48A 1GT91 4MVJP 1YASA 5I9SA 4JL6A 5CPBA 4YYEA 4QT4A 1FMFA 1OTHA 4WCFB 5T41A 8GPBA 1PJ4A 4UW9A 3WYAA 4QA9A 1OXVA 3V4VB 4OFZA 2AW5A 4B4DA 3Q12A 3AOGA 4PNZA 1Z7BA 3I32A 3IV6A 4ZJZA 4CF3A 3RAGA 2FSGA 1K2VN 1P2BA 1KQOA 2VNHA 1BH2A 1V25A 3K0SA 3VKGA 3RU9A 3QLVA 4BFCA 5IM4A 2H63A 2VA8A 3R0ZA 4M37A 2HF2A 1I2CA 5K6AC 1EAMA 1ZL0A 3HV2A 4ID9A 3WQSB 4M1MA 1L5ZA 1OTYA 3AJ8A 3SZOA 1XQYA 1HLDA 5CR9A 3UOGA 4A9AA 1AK9A 4QX6A 1XRJA 1CXZA 3L7AA 1ZUWA 4A2QA 1ANKA 4C21A 4FMCB 4HN4B 4AJ2A 2HM7A 5I4KA 1MB2A 4Z99A 3G7SA 2VBGA 1DXHA 4LSGA 1Z4MA 4UZSA 1XXHB 1ZJZA 1YFZA 2VYVD 4I3HA 4PPQA 1IWOA 3FDZA 2PKRA 1U3FA 3IVAA 4B8ZA 2XDAA 3K53A 2AX4A 3TKYA 4NENA 5JXWA 4JFAA 5T4FA 1JFRA 1FFXA 1K8QA 1MOPA 3TTUA 2NPOA 3K6SA 2HCTA 1ODKA 3FMPB 3I2FA 4F2WA 3AEZA 3EGXA 4U0JA 3OPVA 4AL4A 2R1TB 4OA8A 2BD0A 5FUYA 4OP2A 1KH3A 1WCIB 2R5WA 2ZS9A 4NDZA 3UTDA 4S1NA 4S35A 3S5UA 2VF5X 1ZNZA 2XMGA 1OA0A 4QUAA 3Q5DA 4RD2A 5SZIA 4RQBA 4F38A 3QBEA 4ARZB 3TZQA 1AKWA 2ACVA 3PE6A 1S2GA 3TTXA 4BXOA 1CZHA 2RHHA 5SYNA 5GJBA 2FK7A 4MGKR 1MB9A 4Q4JB 2C5GA 4WXMA 2R48A 4XGIA 5L51A 1KI7A 4ESOA 2TMGA 5FLXA 4M7PA 1J2UA 2VJAA 1OIVA 1YV9A 1UZLA 3DXXA 2I2CA 3M6VA 4ZDIA 4PPNA 1OX4A 2JLBA 4POAA 4Q9IA 4IBOA 1ODCA 2QRJA 5C3MA 1CUAA 1Z0SA 2AMVA 3I64A 1CUBA 5C37A 1DOZA 1QH1B 2GB4A 3T3MB 4D9IA 1Z7YA 3PHGA 2CNLA 3JX9A 3HR8A 1RXSA 5FL7D 1TKBA 2ID4A 1N7IA 2SKCA 2GHRA 3DMNA 4ZICA 1E99A 5L7YA 1OBCA 5HM6A 3ZIDA 2JJ8A 2ZRFA 3KWMA 4CDMA 1RJEA 1T8UA 1GHTA 3HGTA 4WKOA 2Q7OE 3OZBA 1E1DA 2EFHB 1Z0UA 2OAQ1 1B1CA 1W4ZA 2R8PA 4NMLA 3GGGA 2XT9A 5A6VA 4BUZA 2JI4A 2VJKA 1C8BA 3RW9A 2H1SA 3ZZUA 5JCJA 1R6DA 2HXYA 1UL1X 3S2IA 1RACA 2QTRA 2ZDGA 2RC5A 5A6SB 2XZOA 3NBKA 3THWA 3D2AA 2LZ0A 5I9TA 5HQTA 5IKMA 3PFCA 2IHUA 1U2PA 3GEHA 1QV9A 2QUJA 1TZMA 1EZ1A 3FSJX 1RI1A 4HYQA 3TR5A 2GPWA 3VZSA 3OQJA 4EHLA 4EUKA 4UEKA 3V4ZA 4OEHA 1U3TA 4ZREA 2B82A 4CG2A 1AKMA 1IY1A 2HA3A 2CJWB 4EKIA 1N1GA 2IYVA 3EZXA 3O8DA 4I5EA 3SSNA 3LUCA 3OLQA 1F1BA 1O77A 2BN4A 4XLTA 1HZZC 2PZJA 1E63A 4ZYXA 2GN8A 4MK4A 3WWCA 3W5UA 5ADWA 3V48A 1SUCA 1F0PA 1Z5VA 2EJCA 3CEHA 4AF7A 3K2QA 1ZD9A 1H4SA 2QYHA 2VNJA 4BNUA 4CU5A 1FYEA 2OLJA 1X2EA 3U3KA 1XTRA 1RBYA 1MOZA 2TYSB 2FR8A 2JGLA 3EG5A 1R9MA 4WY8A 5FUBA 3RRJA 1EPUA 4RTNA 1XTQA 3DM5A 3WHIA 4HT3B 1ZCZA 1TCCA 2WQ6A 1UANA 1QLHA 2DH6A 3IMKA 5KJFA 1XYVA 2HLNA 3QLEA 5EP1A 1Q83A 1GFIA 3R24A 1UJ6A 1YL7A 3H8JA 4CL3A 5KTPA 5HKOA 5F35A 4BV3A 2RMKA 3JD0A 1AHIA 3KIPA 3FMVA 4NJEB 4R8KA 4CE6A 3ESRA 4F72A 3JQBC 1NURA 3B1WA 2C00A 3DMYA 4FWIB 3A14A 3BM5A 4XLLA 1M7BA 4N5IX 2HTEA 4QBHA 4UFNA 4ZI2A 4CL2A 4LQCA 1C9DB 1UC4B 3DMFA 2C5EA 3I09A 4O4JF 1K5PA 5A62A 3L0OA 4Q9JA 4G0YA 2XBMA 1LB1B 1XQVA 2F90A 2VIIA 3K0BA 2CXHA 3N0WA 3RSFA 5KPJA 2H18A 2GD0A 3VC2A 5SY4A 3RUHA 3K2IA 4X00A 3FY4A 2NO4A 3TRFA 2FEOA 2J59A 1G64A 4BBJA 2P90A 4PFJA 5HNKA 1XPOA 3ZD6A 4XGRA 4QUIA 3PIDA 4J0CA 5C8YF 4A2WA 4AY5A 3ANXA 2C20A 2IH2A 1L8QA 4PLFA 3KKOA 2VH2A 5EJ4A 1R12A 2YCLA 4FBLA 3MINA 2YIVX 5EINA 3D59A 4LZZA 4IGFA 5M7EA 2H5EA 3NHYA 2HPZA 2P5TB 3IP6A 3ELUA 1P5RA 1CETA 3TQOA 2I3AA 5DNVA 1TPYA 4JQYA 1MPXA 2VHWA 3MTQA 1L4LA 2GEFA 3CZ4A 1PEDA 2ADFA 4YAKA 4FX2A 4EHKA 1N2GA 2XNDD 1M67A 2JAQA 3COSA 4OYHA 2EG5A 2Q3HA 4FVTA 1E3QA 1NWHA 3AG6A 1HFJA 3GWZA 5CVUA 2O8CA 2P6MA 1EM8B 3IQHX 5C1OA 2ORVA 3TLGA 5IS2A 3KNZA 1D09A 2GNOA 3BG5A 3F5DA 3P9KA 4DMCA 2WJ3A 3SXUB 3U19A 1OXKB 1Z2PX 2OHOA 2JBAA 1PT8A 4FJ2A 3B1YA 3MBIA 1HLFA 3D5EA 1YB2A 5JS6A 4TTPA 4FU0A 4GWLA 1FSFA 4YH1A 4LNHA 3AF2A 3S2ZA 2QHXA 2R6GA 4QGGA 3UV6A 1AN9A 4RABA 2VP6A 2OESA 5G0VA 1J00A 2CXPA 4LRTB 3RUDA 4UXHA 3OMWA 3JQ8A 5JFGA 1JJVA 1TVCA 1W36C 3S1LA 4RE5A 4A8TA 5AOAA 4J03A 4P93A 1C1XA 5U4QA 3L5KA 2Q5JA 1SZJG 2VEDA 4IXMA 3D2LA 2VJYA 4JMLA 4CM9A 2C9ZA 4D98A 1J06A 4MPDA 4B3CA 3K1JA 1G8AA 3JPYA 3D6TB 3U9TA 2BTOA 5JXIA 3RYTC 2AJTA 1RAIA 5BRAA 1TAHA 1TF5A 2H07A 2C3MA 3BJMA 4TLAA 3VSAA 2GFQA 2AMLA 2XUJA 2A6PA 4MW4A 1GKUB 1XZGA 4J07A 1MJGA 1XDGA 1B6TA 2C2WA 4BMDA 2I4RA 4YQFA 1OZ0A 2FU5C 2MSKA 1HEIA 4C0XA 3T3HA 1WIWA 2BBOA 3ZD7A 2C3OA 3E5RA 1F8XA 3REOA 4C07A 2GO1A 2BHSA 4FGSA 2YDYA 1FUEA 2A5DA 4EKYA 3BHJA 3EIOA 1PSWA 3WWYA 2V3WA 3NRBA 1LD3A 1E3WA 1SCKA 5DM2A 3JATA 2PUAA 3MAGA 2QTVB 3COWA 4Z4CA 2FUG6 4J16A 3ZU4A 5H59A 4YAFA 2AH5A 5D7NA 3RTDA 1JG6A 1W4LA 2RHTA 4QDXA 1PR0A 3BMCA 3QEKA 3LK6A 4GYWA 4RF4A 2RC6A 3QVUA 4B48A 4I9HA 1GADO 4LHWA 1WW2A 3GFGA 4CI9A 2ZJAA 4F60A 4L4XA 1YJQA 1PDVA 4JP2A 3AETB 4R2IA 3QEMB 1Z3CA 4B3DA 2MU1A 4XCXA 4P38A 3NASA 3G2IA 1JX6A 4IGIA 2OYCA 5FV7A 1MAHA 4BPRA 5J2TB 1L4KA 1P4SA 5FA8A 4Y8VA 2ZB8A 2JATA 4DLXA 2N46A 3RVSA 1RKXA 3TR0A 1U2ZA 4GNRA 1QYCA 4B46A 1B3BA 1BE1A 2GM3A 5HKKD 1PSZA 1WL8A 4BDTA 4CRWB 2RGUA 1C81A 3ZK9A 3VYUB 4CGYA 4UDXX 3R5SA 2Q7XA 3AZOA 4JI5B 4AXXA 1W36B 4OJKA 4RJ2A 2WIBA 2C9MA 2FPPA 1S8AA 1KHTA 3RSQA 2R8XA 1EA7A 2FA9A 4DREA 3G9UA 3B53X 3GDGA 1XX6A 3GH3A 2AKEA 3SLGA 3QH4A 1TI7A 1FRNA 4O5OA 2HT1A 2WW8A 4O25A 3IC5A 3BXFA 3CTMA 2XKAA 4HN9A 3FCUB 4ZO8A 3F5FA 4K7JA 5FTKA 1TLTA 1L5HA 4EG6A 2IHNA 1EFTA 5KTKA 4OKNA 4Y9RA 4G5OA 4QECA 4K9PA 1QGZA 4J0JA 2XNJA 2YVKA 5L4SA 5EZSA 3HCCA 1OH8A 4C22A 4YC7A 2VLIA 1F8UA 1MJFA 4DM3A 5TSDA 2XDQB 1EVQA 1SUBA 4FT2A 2V1XA 5E1MA 2HWKA 2ZVJA 4RY0A 4HUTA 4DA8A 3EAGA 1R0KA 1DPFA 2QTMA 1CQZA 3JAWB 3WQHA 1U9CA 4LZOA 3WGIA 4RY8A 2W8BB 5DJ5A 1Z26A 5B55A 3PC3A 1ACLA 3GAAA 1DKQA 4C4PA 3AZPA 4GZ6A 4U7DA 2OZVA 2PVSA 1H0KA 1V1MA 3AGQA 2QUZA 3FKJA 1N3LA 3PI7A 1UBOS 4GBJA 5E6SA 5LBTA 4FQ8A 4PR0A 2WD8A 1MRZA 1RPAA 4PG6A 1SA0B 3LHKA 3C7AA 1SPXA 4MTCA 2FY8A 2J4DA 2KMLA 4ODIA 3WKBA 4ASUA 1AK1A 1LBSA 1TCAA 3BK2A 3FDIA 3Q7IA 2C5FA 3K70D 4CQNA 1E6LA 1OY1A 2RARA 2PRYA 3HCBA 3UPDA 5FIUA 4LC0A 3VZCA 2VPXA 4PAGA 2EZUA 2IDMA 1C7IA 3I53A 2ZGVA 4PG4A 3GUYA 2J9XB 2QGNA 4MS3B 3VC1A 4JP3A 1VJRA 4BNYA 4C0QC 1CQPA 5TJ9A 4E5UA 5BP7A 4JBWA 1U0RA 1XHLA 3FTCA 2B0JA 4B7AA 1V7PC 2XVAA 1KYYA 2G3YA 3TEMA 2B6NA 3S27A 5A2GA 1LLFA 1X8JA 2NZJA 3S99A 1E3EA 1ODSA 4JLVA 3TUJC 4EZBA 2C97A 3HO6A 4IUBS 3D8NA 6GPBA 2WIDA 2SBTA 3P9IA 3ZCSA 4EHHA 1K7CA 3HB9A 5AK0A 5CLFA 1BGVA 1LDGA 5ITSA 3RBVA 1Z7WA 2P68A 5BW5A 1VIDA 3PNKA 4V2UA 4R01A 1U7PA 4PO9A 1JB9A 4JCOA 2EQBA 3FNHA 2G1UA 3I72A 3PFIA 4PANA 3V33A 2V7VA 3AUKA 4LI0A 4P35A 3ZQUA 5HE8A 3CJTA 1OXXK 3HP1A 1ZINA 3GJ8A 3F67A 3V1MA 1SXJC 2WP8J 5CX1A 3ICQB 1QR2A 3DFKA 4NU5A 2VYVA 3DUFA 2FUG1 3H8SA 1Z45A 1W7AA 1DJMA 2HMWA 4KN5A 3TW4A 3OY7A 5T64A 2PKXA 2AF3C 3F74A 4C88A 1M2GA 1SXGA 2P0AA 3F3SA 2R85A 2XUPA 3RGWS 2IYEA 2I6UA 4C76A 4BQNA 2F1OA 1A5BB 4IGKA 5H68A 4D0NA 5JZ9A 3HFJA 4DRXB 1P3JA 4OHVA 4HVAA 3VJMA 4C5BA 4MP8A 1AZSC 2WJYA 4LF9B 2CNWA 5C1PA 1UPAA 3P0JA 5BSMA 3NHFA 2IYWA 2XMSA 4JJFA 2GFIA 4DR2B 3Q8KA 2J3HA 3KJXA 1JG2A 4M0FA 2PX5A 3CW9A 4TRMA 1KIFA 3GFQA 3PQ5A 4EABA 4G4SP 1ZI9A 2D1QA 3HFGA 4BFVA 1HNZB 3FZEA 2C2BA 5FBRB 4HRAA 5K0FA 4DV3B 2OBBA 4C5CA 1XJWA 2IELA 2VJOA 1KMIY 1C1HA 4YPFA 4CETA 1V3QE 4I5FA 4ZV4A 2WKRA 1W4CA 3ZDRA 3W1EA 2W9XA 5T4HA 4JSRA 4L3VA 4J4HA 5GM2A 4AJOA 1T5DX 4M1TA 1TPZA 4XDGA 2FMTA 3EIUA 1MEEA 3MQ2A 1LI4A 5EIXA 2ATEA 4HPXB 4X54A 2PRIA 3LRTA 1PNQA 3MWEB 1WKCA 1IK6A 3VR6H 2JGRA 1H94A 4Y2YA 1GPAA 1MAAA 4TT3D 3S70A 1EP9A 3MUEA 3CVYA 5FL7A 4G0OA 3KEGA 4CV1A 2A9VA 3KC2A 2QLTA 1PL6A 1JH9A 1Z2EA 2QS9A 1O6CA 4U39A 1Z88A 2FMXA 1CUZA 2Y2UA 4M1ZA 1IIRA 1NQUA 1RXUA 4KGVA 1KYXA 5F7XA 1GL3A 1FSGA 1L5FA 1XXLA 3PE4A 2GVNA 3T54A 5IP5A 4R9RA 1SKMA 5GP1A 2WHRA 1JIKA 3DV2A 3F71A 4U2DA 2AFHA 2C78A 3H2ZA 4ZOCA 4LBYA 2WU4A 2YV3A 3UOWA 4E15A 4DB4A 4O4JA 3ZUGA 4LF4B 4F9GA 4YAUA 4E0BA 1SXJB 3OBBA 4GYJA 4FFWA 3CWZA 1N3YA 3V1UA 5K05A 5EYPB 3QVGB 4DQXA 1JEAA 3RHTA 4KE8A 1G2IA 4N3CA 1DC3A 3AEQA 4CTJA 5WRFA 4Z54A 1JDPA 2G4CA 3RBZA 1E96A 1VXRA 3B7GA 2ZI7A 2FSUA 3D31A 4NEGA 4W1PA 2GEDA 2XXAB 2VT6A 2QG6A 1LA2A 3EVZA 1U8EA 5LP6A 5LMUB 4U9IS 3EYAA 3KM0A 2Q5FA 3IH5A 2WE7A 3SKYA 4E6EA 3WLJA 4GPD1 4HV4A 1KJIA 1ZWLA 3QTTA 1HDGO 1GFZA 3DXFA 3R3UA 3H5RA 4L74A 4NE7A 1J4AA 3MJEA 2P77A 3BL5A 4JI0B 2IHTA 3JU3A 3NAMA 1VFNA 1K4YA 4K03A 3GLGE 2XA1A 4M89A 3UUFA 3HU3A 2WUDA 3AU8A 4MGIR 1NJ2A 4YDSA 1O6BA 4Y9TA 4BL5A 2H1CA 1KH2A 1CCWA 4CF4A 1EHCA 1EGVB 4OXNA 1NJSA 1PZEA 1UC9A 3D4NA 3F9CA 3IQGX 4HDOB 1S3IA 4RK1A 4JH0A 2DFNA 5KI6A 4A0GA 2COUA 1SVKA 3ER6A 1YT5A 3KKEA 2ZUTA 4AS2A 1CK4A 2QPOA 2YYAA 1MCZA 1A9RA 2ONYA 1DV2A 1PZMA 3I9LA 1E4YA 4EUHA 5D1NA 1CEYA 1PUIA 2VJCA 4DIUA 2VPQA 1JEEA 3LT1A 5IAKA 5DGHA 2YWHA 1MX3A 3WIEA 3WC4A 3U7QB 2EIHA 2CB0A 3IDQA 5EIBD 3NDBB 4AN0A 5EP3A 3EPKA 4KR9A 4ESVA 5JZMA 1NVMB 2ZWPA 1Q7GA 2RGYA 2VP5A 4JJZA 1A9PA 1AQNA 2PYDA 3K9HA 4F11A 2ZT6A 3NM5A 3F9RA 4EHJA 3V4RA 4TKLA 4AP6A 1NRXA 2V6FA 3AVPA 1T9GS 1SU6A 2OAP1 3G8CA 2WJGA 4OP1A 4Q3NA 4RIFA 3G85A 3I0MA 4BCBA 5LXTB 3E9ZA 4GFDA 4BAZA 1CZOA 4JZKA 3M70A 1NXXA 1P5HA 1JMVA 1VSTA 1I30A 3A6LA 3RVJA 5F9HA 1QYRA 3TOXA 3UUGA 2IOYA 3CLUC 4K8OA 1VJ1A 5LFAA 2AQ8A 3DDWA 4B34A 4EB3A 2Y05A 3WSTA 1SG9A 1YHYA 2H00A 3F6PA 3HWSA 3KLBA 1YZYA 1JQDA 2XQVA 3JVIA 1VMEA 3UA4A 1UBTS 1MHTA 3DZGA 3KWJA 1ORRA 1QS0A 2QJWA 3KB8A 2XNDA 4LMRA 4OD0A 1NDQA 4V1CA 3KVRA 5CURA 3KLMX 4RPLA 3H4MA 1ZUNA 3I52A 3JQRA 4XPZA 1PD1A 2Y27A 4N6OA 2QVYX 4MMZB 1KGSA 1XZHA 1ONNA 2IIQA 1RHMA 1W85A 4C0SA 1QGUB 2OWDA 2FEPA 3W9SA 4BV9A 1JR2A 4EG8A 4YMUA 4MDFA 2VH1A 4K9OA 5EMMA 5J2UF 2J3JA 1QBGA 1JA9A 1ZJJA 2I55A 3S2EA 121PA 3OG9A 4FMCF 2IH5A 4ALIA 1SCUA 1ONPA 1QFJA 1DINA 2WVGA 5IG2A 3MWDB 4PIVA 3VX4A 3UEOA 4NE9A 1HUQA 4X7BA 2Z30A 1SAYA 2ZPTX 4NZOA 1IZZA 2GK6A 1YJAA 2OK7A 3EQ2A 3AERB 4BGUA 3VPXA 3KE9A 4URXR 1C0PA 3MPOA 4QKQA 3ONDA 5EP4A 1P7WA 4BQRA 4PFQA 2IKQA 2E6KA 1WBJB 2HK6A 4M0KA 4TV8B 2DQSA 4KO4S 4MNTA 1TQHA 3H4TA 3M6UA 5ANRB 3OQVA 2H4XA 1BHSA 1W76A 1RJWA 1MABB 4RTKA 1G1MA 1Y3DE 1V9CA 3BWBA 2M6KA 3WRVA 2J9RA 3O8BA 3SF8A 2IY8A 5HKLA 3S2UA 4YREA 1T4CA 3PFBA 4K87A 1GXSA 1A98A 3AHFA 3FWZA 2EW1A 3IESA 4KPFC 4YMTA 5LU8A 2XYVA 3KJHA 1U7XA 3UWMA 4P98A 3O2NA 2MR5A 5KYYB 2ZBGA 1ATZA 4GPAA 4TQUS 2PZFA 4BE4A 5IFKA 1MV5A 4DIBA 1FMTA 2P78A 3K1AB 2D4AA 2NZVG 4JB8A 4E3ZA 5TPZD 1V2GA 4NVRA 2ZUFA 2BIFA 4US2R 3A9RA 3NG1A 5EJ8A 3QUTA 4M1KA 1Q0PA 1X38A 1JVBA 2XGOA 4OXYA 4PX9A 1U2SA 2XXJA 3WRYA 3PRYA 2FOLA 1MO4A 3WV5A 1KNQA 4Z6KA 3BWXA 2OOKA 3ESXA 4F4IA 1E9EA 3FF1A 5CG1A 4M36A 5GIOE 1ISMA 2EJTA 4B31A 5LZ2A 4X65B 1UJMA 3C7TA 2H1OA 2ONCA 3JY6A 5ALNA 2V5UA 2L42A 3S3TA 5DF1A 4MV8A 5DX8A 1JIIA 3C74A 4DA0A 4DM7A 4JCCA 1KK3A 1IPHA 4JQCA 5ALZA 1EKXA 5FADA 5KVVA 2UUBB 3GMTA 4KJZA 3L8GA 1R0LA 4QDOA 1GGNA 4EL5A 5LZ7A 4BX8A 5B1IA 2FWPA 2UUPA 3AWDA 1QV6A 3BGIA 3GEDA 4OXIA 3DPSA 1AKYA 1IQUA 4S24A 5AJZA 1ESCA 3A2KA 3CISA 4IXDA 5KQMA 3DHWC 2CD9A 3JRNA 3AONB 3GWGA 4TQGA 3IUJA 5HKKA 3PV0A 1R4MA 3ASUA 1NGSA 3MW8A 3PGKA 4P5EA 5EWMA 1U80A 4I1VA 1O87A 3QFSA 1UFQA 1KZ6A 2CD7A 4BLQA 1UAAA 2QMHA 3N8IA 1U2TA 4J1TA 3VJKA 3AR2A 4DUYB 4WKBA 1KPHA 1Y48E 3G02A 3OZXA 4E5VA 1K7XB 1KSJA 1MJGM 1XLVA 2CKMA 2RBKA 1GVHA 1BX0A 3QFRA 4WERA 2ACEA 2G80A 4LFAB 3AC0A 4AY3A 5DASA 1O5TA 1QPGA 4EEKA 1PDWA 4A92A 3BZUA 3KOUA 3WK7A 2PUDA 2JD2A 1FB5A 1DG1G 2FFHA 3FWHA 3ZBPA 1O58A 2JGAA 2ACWA 1MX9A 4FN4A 4GX1A 1ZN2A 3MCWA 4JWTA 3EEYA 2CZCA 3EE6A 4M7WA 1H1DA 3O93A 3O3MB 3Q7RA 5FLKA 421PA 3L04A 5HXAA 4Y2SA 1EFCA 2O1XA 5FWYA 4W5JA 1VDZA 3PJDA 4GR9A 1FC0A 2E4UA 5JCPA 1E5LA 2D8AA 3CNBA 4G1CA 3A6ZA 2VQEB 1KJ8A 2Z09A 1FNSA 3A9SA 3EQ6A 4JVNA 1M33A 2HDWA 4HDSA 1GG5A 1W5FA 1KS2A 3S44A 5AKGA 5L9AA 2ZYVX 3EXHA 2BW0A 3LRXA 3K8QA 1FS4A 2DWCA 2EERA 3HCAA 5HM8A 2LKCA 1RLJA 2WQ7A 2HADA 2O7RA 3FPGA 1T6XA 1Y3AA 4GAEA 3EVDA 1XVIA 1YAHA 3JD2A 4A8JA 5M34A 5U9CA 2QW8A 3O1JC 3N0VA 1G6OA 1JIVA 5BT8A 4DW8A 5KKNB 4TGLA 4MLCA 2N0SA 4MIYA 4BAGA 1K7EB 3QKUA 4U5QA 3HHPA 5FLEX 1DEXA 3PC6A 1BCRB 2ZREA 3LIPA 1RMTA 4RH1A 3T3GA 5DBEX 2BJWA 3WIBA 3OPNA 4JEHA 2WMNB 5HKBA 1CY2A 1U2DC 4A7PA 1IOZA 3GAZA 1T5BA 3DE6X 3SYNA 5E0OA 1EFAA 1CUJA 1CE8A 2ZI4A 4YRZA 3MFQA 2FKNA 4M55A 4K3VA 3SVTA 1X2BA 1CQIA 2ZCJA 2P9EA 1G5HA 5BR1A 5A4JA 3SYTA 4WZAB 2GT1A 2XJ9A 2PSJA 4P80A 2QN1A 3PEUA 1HQCA 2X8LA 1VZ2A 4JL8A 2ZAOA 2WWGA 3QV2A 1ZHFA 1PYGA 4YNBA 1PJ3A 4MW5A 2LCFA 4S1PA 4BGDA 1PS0A 1U3VA 1UJCA 2PS1A 2PZBA 5KSOA 3HM9A 3SGLA 2IXGA 2N1MA 1DP4A 1GA1A 4QQKA 3VZQA 4KHPB 5LDGA 4IDFA 3WDLA 4GVPA 3SQWA 5AI6A 4BMXA 2V9CA 3I8SA 4W7IA 5EA2A 4BLOA 4DR5B 4O4IB 4OYRA 1CUDA 2QAIA 1IXRC 2YVUA 3JTMA 4Q0MA 1PJCA 1Z0FA 4EQZA 7YASA 2YOGA 1GCOA 3OZCA 2XYPA 3D1JA 3WKAA 4I14A 2K7ZA 2J0UA 2PKEA 3BE5A 1NVDA 1GA6A 1OJ7A 3P52A 3L0BA 3EPHA 1XZIA 1TEVA 5M2QA 1JIQA 3RCBA 2JIOA 2Q50A 3G9XA 1H3FA 2AYZA 3KSDO 3C39A 1UJBA 4LQLA 3P8ZA 4MP6A 4KR2A 1LRLA 2ZBUA 3V2UA 4TLBA 1M2VA 1D2MA 3SG0A 3VUFA 4ZCTA 3I2IA 3I0NA 4B6GA 1Z33A 4AF8A 4D7AA 3L8EA 4Q9NA 5U4XA 2RIPA 1QRRA 1V9SA 1LS1A 2PXAA 4LFCB 1XVLA 1ZXLA 5FL3A 2IZ1A 5DNUA 1PV1A 3CN9A 1H5UA 3WBKA 1RRKA 5TE9A 2QP3A 4OI2A 1UBKS 4NE2A 2O5EA 5B4VA 3HVUA 1IY9A 5CH5A 4A6DA 3OCWA 5F9FA 3KWFA 3R3WA 5I48A 2XEXA 3AIMA 4AKSA 3U13A 1ZMTA 1II0A 3I5AA 1QVZA 4N7JA 4H4DA 4S0ZA 1HM5A 1KJNA 2QVZX 2ZYTX 4P6VF 5EUBA 3SR3A 4C6TB 3WMEA 2BMJA 3HJNA 4MYHA 3ZHTA 4IX1A 1FFEA 2XAUA 3CF4A 3GVXA 1IUNA 3T0FA 1EE9A 1VI5A 5I8PA 4V1CI 3OFVA 1W36D 3KKKA 2PX3A 1E18A 1BE8A 3LBAA 4TLMB 1U7OA 4R7TA 3U3XA 2G9RA 4BKRA 1MVNA 2ZB4A 4Z7OB 4L7VA 2FI1A 3FNQA 3PEVA 4FB4A 2VQ3A 2GHIA 4JJAA 1E7RA 3HMKA 3GRPA 3HKCA 4B2PA 1U9YA 3T9AA 4YROA 2FXIA 1F4PA 1Z2AA 2WAYA 2FEMA 3P9RA 3TLAA 2FZEA 1NMSA 2YIMA 1GPYA 2I91A 2HQ1A 3D2CA 3GRKA 1H9AA 1AE1A 4MLPA 3IVMA 4KXFB 4MHSA 1Q1BA 1A2KC 2ZYWX 1Z06A 3QENA 1PFKA 1JIUA 1A2OA 4FOPA 4JT8A 1P1IA 4ND4A 2DKOA 2ZSAA 3BH0A 4PRLA 3R5XA 3S1AB 4AO8A 5KC8A 1XPJA 2JLAA 2CDBA 2P3SA 1GPBA 3DJYA 4LX0A 5ILGA 5BWOA 2CN1A 4BV8A 1QX3A 4KAFA 2PTHA 3DW1X 4QE3A 1YF3A 1WR8A 5JZSA 4B4UA 3KEFA 3GI1A 4KQKA 4YJGB 2V59A 4AZTA 4HLUA 5EHIA 4F4CA 3IB3A 3UC9A 3WAJA 4IHKA 3ISVA 4DNPA 2GK4A 2GD2A 3BMQB 1J8VA 3PXDA 1WKBA 1SCIA 3TR6A 4D9KA 5AW3A 2I9PA 3F2IA 3CRRA 2RJNA 3GQBB 4PS0A 2OYRA 1GTRA 3CW8X 3TAXA 3O9MA 2PV0A 4KLCA 1XYGA 2ZYUX 5A9SA 2GYYA 1Q0ZA 1SOMA 2RBGA 3F3MA 3GUUA 4QUBA 4Q3OA 2GBLC 4RYLA 2WNSA 4EYOA 3CC8A 1A8IA 1PNVA 3CUSA 4FHEA 5EJMA 2HJWA 3IV9A 3MGAA 3O0DA 2BJVA 4MQLA 1A2BA 4D5EA 2CZGA 3KXLA 5I7FA 1KL7A 5HIMA 3VO9A 2B34A 2OM2A 2RHDA 3GLIB 4OLAA 4PLGA 3LYAA 4D74A 1RWQA 2D4HA 1WMBA 3DYIA 1DTSA 2OD2A 3G0CA 1OV6A 3O9VA 1C14A 4LZPA 4OU4A 5EJ5A 5U1PA 1NV8A 3SFVA 4CLOB 1PNOA 2AN5A 2QJRA 3MLAA 4DRZA 1KYQA 1AQLA 1JAZA 2DBZA 2ES4A 2I1LA 2IA5A 3QUCA 1RDFA 4ITRC 2UUCB 2GZRA 4IZ6A 5BSUA 1ZN7A 4OBBA 2BUBA 1EM6A 1Q7CA 1ZH6A 2JLSA 3FIJA 2CL5A 2FW8A 1VRCA 5J2UA 3ZS9A 2V8OA 4C7XA 4PQYA 1X92A 2CUNA 3ZHBA 2VJBA 3BWMA 3B9PA 4ZYVA 4A1FA 1TJ4A 3NHUA 3IKJA 4RORA 1G20B 2UVDA 5GGYA 4C2BA 4BC0A 4S3MA 5AW7A 1DGQA 1C2YA 2PE5A 4AQDA 5K8JB 2FVXA 4Y1EA 1H85A 1GEEA 1PEAA 2A8YA 1ZXBA 2OHJA 2P1RA 3DNPA 3L02A 2EBWA 4FR2A 1HLPA 4MI6A 1DUVG 3G5MA 1EG7A 4CM1A 1UF9A 4COKA 1G7CA 4KI0A 4KDRA 2I7TA 2VDPB 4IJWA 2CLCX 2R8RA 1H2BA 4CG3A 1VLQA 4JK3A 1ISPA 3FYHA 4DJAA 2CNKA 4MIKA 2XX3A 2X14A 2GN0A 4K86A 5AWFC 3VAZA 3EZGA 4M8LA 1T35A 4XTCS 3IT2A 3R7BA 1SB9A 2JLUA 1JU3A 4JJ4A 3OSZA 3NAQA 1M7GA 1EUDB 3KOWA 5GJVC 3VXKA 3WRXA 1NBOA 3OA2A 1F2DA 2GZ1A 2GTIA 5DT9A 3PF8A 4Q4JA 4JC5A 3A1NA 5CJPA 3QEBZ 1P9RA 1VCOA 3U16A 1WUHS 1JHPA 3IERA 4FCTA 1A5SB 1K68A 2FE4A 3ZHSA 1KVUA 1CUCA 3THSA 1I3LA 4B7UA 2IU3A 2HJRA 4PRZA 4YCDA 1EFDN 3TLBA 4JAVC 4RY9A 5C52B 1R6AA 1CY1A 2ZIGA 1P91A 2O5RA 3PQ3A 4X62B 5K3BA 2YY7A 2VUUA 4G1FA 4EY6A 4YXWD 1WDKA 1VKHA 3BRQA 3OVMA 1D4OA 1M0TA 1UQRA 3OKCA 4CLHA 2JCXA 1MAVA 4YCNA 2O9JA 2A78A 4K0KB 2FGJA 4E88A 3U4QB 3JAKA 1NQ5A 3GCDA 1GV0A 1NYRA 1I7LA 4OQZA 1K4MA 1A95A 1LPNA 5E3JA 5ER9A 1GAJA 5HF5A 1KU0A 3TSZA 4L4ZA 1WHTB 3EA4A 3P32A 2FCAA 1ZH2A 5LLSA 4RV4A 1N8SA 4QYIB 3VAYA 4BNDA 3DE4X 1RHKA 2IYXA 4Z86A 4D41A 3E5HA 1R8YA 2YINC 3MEQA 1JJBA 4LCJA 4D99A 3RS8A 5A6SA 4C3UA 3IYLW 4G5SA 2RGAA 4ZDWA 2K4MA 3UMCA 5EJ6A 2OMKA 2V58A 3QU5A 1EEXB 1SXJD 2IY9A 4K6OA 4AJJA 1AT1A 5IULC 3R6WA 5JBQA 4UVIA 4QYSA 1FP4B 1BEEA 5C46F 1UQUA 3WYEA 4KQJA 1S4QA 1YK1A 2LD4A 5F21A 1G41A 4Y2JA 3W2HA 4EZIA 2PGDA 2CJWA 2J33A 3IHLA 3GLHB 2WD9A 3SQMA 4UXJA 4X95A 4YCJA 3GFFA 3O2QB 5ETJA 4QASA 3R7AA 3R3HA 2ID9A 3CH5A 3T9DA 2ZSDA 1X1TA 4EI7A 1TA9A 4D3SA 3D8SA 3ETDA 3LC0A 5A71A 1N6NA 1RP1A 1U9IC 3NEYA 5TPZA 1N5LA 3H2SA 3ZDFA 2TECE 3ICOA 4OVKA 1YS7A 4Q7JB 5JDIC 1GM5A 4TUYF 1I5EA 3CMMA 1X14A 4PPGA 2E4YA 1L1FA 1E7YA 1XAHA 1MMFB 4Q1BA 4FN5A 1JR3D 1H5QA 1X15A 1ZKDA 4TVOA 1QYWA 1Z73A 2OPBA 2PSDA 1W46A 3AFMA 4LZWA 4AMVA 3DEFA 4BBPA 3DBHB 3NIDB 2AC7A 4MGEA 3OP1A 2I3BA 1NNEA 3NOXA 2F48A 3AHCA 3CWQA 1XD8A 5JS7A 2H1IA 4LJLA 5EZYF 1AQYA 4NJEA 2A1TR 1ZQ1A 3U4IA 4KBGA 3DE5X 1M2EA 1FPMA 3ANMA 3WKEA 1NW4A 5C7IO 1GGEA 2H48A 2ZAGA 4B84A 1SCBA 2IYAA 5DBGA 1CJBA 4DLRA 2ZRHA 1GN9A 2Q0HA 3DPUA 4EB6A 3LA8A 1GNPA 1U2QA 2GTPA 2VYQA 2YFHA 3U40A 3M6XA 4KR0A 4D02A 3TG8A 1VBFA 2VHTA 1KY3A 3IUSA 1FMLA 3R7WB 2JI7A 3VM6A 2Q45A 5B1EA 1E9CA 4RTJA 2C54A 3GNSA 1NDHA 4BVJA 1JI0A 1G3IA 1XTIA 1XZPA 3KVYA 3W9YA 3CVVA 3FOZA 2ZB3A 3N3AC 4XQ9A 1LV8A 2EXXA 3BAZA 1NQVA 3DD5A 1T1SA 1UKBA 1OGYA 3Q88A 1NONA 4RVDA 4ZJYA 4W9RA 3O4GA 2NPIA 1TKCA 3H6KA 3OU7A 4GOJA 3CLKA 4X1IB 5AKXA 1BXZA 1YQXA 5F76A 3DZJA 2QUAA 4HG2A 1E3DA 1YRHA 4MA0A 2FV8A 3S2SA 3OZGA 3X2FA 3PUWA 4QOHA 1OR8A 3U3JA 1K75A 3ENNA 4QYWA 2EKBA 1KI9A 4FD2A 1EIZA 3CF0A 2F8LA 3BGVA 5AW1A 3B3QA 3Q11A 3S1SA 1E2LA 2Q6VA 1U5AA 3IA2A 3UAGA 2PJRA 1Z9BA 2X8JA 1O1YA 2I78A 1P62B 1Z5UA 3RPEA 2J3EA 2QORA 3LX8A 4BECA 3I9OA 2LPMA 2BRUC 2DQYA 1LI5A 4R2LA 1HZZA 4D8TA 5ICMA 3HNPA 4UASA 1Z4OA 2WWYA 3A1WA 3GEPA 4OBWA 3TD9A 1O94C 1X8KA 2JAXA 2YXNA 1WRBA 3L0SA 2B36A 2AEJA 3IP7A 4J4TA 3ZBTA 4UEJA 5C32A 3PG5A 4Y0AA 1RHRA 1HI9A 3NWBA 2I7XA 3PXAA 4Q19A 2O7VA 5EQJB 2Z8XA 3HXMA 5BNZA 4LK3A 2BGKA 2ZUSA 3PGA1 4KRXA 1E4EB 3MT9A 5P8WA 2XJ4A 3OJOA 1SC4A 3HKBA 4CCYB 1XMXA 3MJSA 5CK5A 3ZE8A 4FQ5A 3W06A 3CURA 1IL0A 1L6IA 3IJRA 4MQBA 4RHFA 3QFTA 1NFRA 3B12A 4BTEA 4YUAA 1UCFA 3UJPA 4JV5B 1CYEA 4F8YA 2EF0A 1Y42X 3MSXA 4L6AA 5LXTF 3L43A 3JQBA 2JGKA 1XCBA 4ER5A 4QJ4A 3IBYA 3PKZA 3TLZA 2X76A 1NG1A 1B8UA 4P33A 4KPYA 4XIYA 2QLJA 2H7XA 4TKVA 1I7SB 1JB1A 3DTTA 2O8BB 3FPSA 2HAEA 5H16A 5LPNA 3EIEA 4R68A 1ULHA 3NX4A 1YDWA 1US8A 1QOPB 4YB8A 3VPCA 5C35A 3O03A 1RYHA 2BFFB 2B2CA 1FZQA 1M8KA 1XG5A 3JALA 3FYUC 3GA5A 1FU7A 4XD7D 3UT0A 3DXZA 4HRVA 4B82A 4JUDX 1HNXB 3LECA 4FS3A 3UYLA 4HNQA 3SQDA 5EGSA 1HZJA 2AZ4A 4HL6A 4CLXA 2DP4E 3Q10A 4EFDA 4Z7NB 3UPUA 3P9NA 4UDOA 3LVRE 2ANBA 3DNFA 4CXMA 1CRLA 3LYUA 1B0ZA 5EMNA 4KXMA 1OT3A 4QODA 5F78A 5A06A 3LO8A 4WACA 1ABFA 3QI2A 3I5MA 2XA9A 1XN1A 1NX9A 3ISTA 2EU8A 1GPJA 7ABPA 2QRVB 3FCYA 5J3JA 5DN9A 2ZJ7A 2CL7X 4UHJA 1FCJA 4GXQA 4WA7A 5FTNA 2QN3A 2BT4A 1BOFA 3UQZA 1IVYA 4UE3S 1FDWA 3H9QA 4FR0A 4NAHA 4GIBA 5K0CA 3O92A 4HCJA 3OIUA 1WTCA 3N2KB 1X1BA 2H4FA 2FX2A 1ICIA 3ABOB 2A0XA 3NATA 1NVWQ 4DQUA 4H7DA 1RYYA 1S0UA 3LLMA 1PK9A 3IBSA 1M75A 5HG0A 5KCMA 1FU4A 2ZE7A 3N2IA 4AJLA 4TV8F 1O7JA 4CMBA 1GTJ1 1L1RA 3OAAD 3GNQA 2DBQA 1S1CA 3RDPA 1E2KA 1N9KA 3EARA 3TOZA 5LU9A 3EEQA 1C2TA 2B78A 2F3PA 4OHFA 3W7AA 5JSHA 4LHEA 4C14A 3I2JA 1N0UA 5CHEA 5I9MA 1GRRA 3VO1A 3BCSA 1Z22A 3OOJA 4U02A 4RK7A 1V8PA 4BWFB 4FDTA 5LZ4A 3TTWA 1LNZA 1KFCB 4IL5A 2DTDA 3TBFA 2BEJA 1H2RS 1OWNA 3MCTA 3W6NA 3W0LB 2E37A 3QF4A 5DN6D 2Q28A 1RXCA 4MDEA 3N0TA 1K6EA 1N2JA 3HUDA 4B87A 5JW6A 3HU2A 2AFIE 5AHKA 3R0XA 3MAAC 3WLPA 4DADA 5A5DA 1PNRA 4H3HB 3SKVA 2DWUA 4TWAA 2X8BA 2B7CA 1U1DA 2HIGA 1P0IA 3BOSA 3FYUB 2H1FA 3LPCA 2F3UA 3MYRA 1V47A 2PGOA 3GJXC 2AX3A 4FCCA 3HUFA 2X19A 1KOJA 2Q9AA 3OKFA 4F2PA 1KPIA 1NVVQ 2F8TA 2VWGA 2ZR9A 2KBFA 4UBOA 4MKXA 2PSSA 4GE0A 1ILEA 2HIMA 2VDMB 4IEFB 1MG0A 3T99A 1J21A 4MROA 1T2CA 4YHBA 2GUWA 2ZQ5A 3H75A 4XWTA 2OCDA 1QMPA 4G9GA 3KQKA 3UWSA 3NALA 1RQRA 3U1TA 1QGED 2PD3A 1LNSA 1CIPA 3U80A 4EFNA 4LYYA 2G28A 3E8XA 1EDBA 3EFOB 5H0IA 1SXHA 1M8PA 2YV4A 5K3DA 3U56A 1TEZA 1JZQA 4Y2UA 1K5GA 2B4RO 4ON9A 3RJMA 2R7AA 3KAPA 1OBOA 4AD8A 4ZJPA 1SHLA 1ZVMA 2CXQA 2NU7B 3SVLA 1SA0A 1LFAA 1JT9A 2NTNA 3ICWA 4BNJA 2VN8A 1SNYA 4M1QA 1M5RA 3JZFA 1O97C 1LWOA 1TLLA 2N75A 5TARA 4RXMA 2XH8A 4BVBA 5HK9A 4UVGA 1X7GA 4CKEA 1NU6A 5KOJB 3A2LA 1ECBA 3ANSA 5ECWA 4Y6OA 4QSHA 3K4QA 1UJNA 4MS3A 3FKSD 3Q3EA 2HO4A 5K6RA 4DPLA 3ESCA 3A3NA 3VH3A 1G8JA 4RESA 3AINA 1J1ZA 4WGFA 3GYBA 2JGIA 2ZI5A 4DG8A 2Q9CA 1T2EA 2GZ3A 1M2OB 1ZN9A 3TJMA 1B74A 2QXYA 1JALA 3ENZA 2DTXA 2A0KA 1GVNB 5IEBA 3TYXA 1YQEA 2IP1A 7AT1A 3NVAA 2HV9A 4NCXA 1ZNWA 2E6UX 1H8ED 2JL1A 2WTMA 1ZCAA 3C98A 2RHWA 3IIMA 4GOLD 4Q3LA 3FTFA 1TZ2A 2WWTA 1XROA 2CVQA 3AFGA 4GC5A 5BQPA 5ENVA 1KK1A 3GJ4A 3QSYA 3E5MA 2WAMA 5LLTA 1BDHA 3ROZA 2W98A 3NKLA 1XVAA 3OMLA 3Q5GA 1I80A 2G5TA 4WK6A 3E03A 1NR1A 3T5MA 2UUOA 4L8YA 1P77A 2WF8A 2XVMA 5CLHA 3KQHA 3HDGA 2YFYA 3L7YA 4OOEA 3M9WA 2WB4A 1N2HA 2F2TA 1E4OA 2I1QA 2WJAA 3UV7A 5I4CA 1D0IA 2FPLA 5KDOA 3FCXA 2FJPA 1JLLA 1N4AA 3BMOA 1IHDA 2JH9A 5LR6A 4B3BA 2RH9B 1NF9A 1N8NA 3I2GA 4DRXA 5EXSA 4M9ZA 2P4EA 1JHZA 2PWPA 1UOOA 2VUSA 5K2MA 3RKUA 5C9ZA 3D4BA 4CIVA 1ZRSA 4HUQB 2YVAA 2GCIA 1K4KA 1M10A 2OV6A 2RGEA 1NN5A 2ODEA 3BCHA 3HEMA 4MRMB 3WA7A 4JFRA 1T0PA 5IUKC 1ZHOA 1GUAA 4XIFA 3D5QA 4LTDA 3PCRB 3SS7X 1YUNA 1D07A 3ADOA 1RBZA 4MYTA 4BP1A 2ADOA 1T91A 2CSUA 1DFGA 1P7CA 3ZVNA 4R8RA 1GSOA 1YL5A 3FMOB 1P3DA 1NNLA 3TVDA 1NQAO 1PLLA 2FUNB 3SHQA 2BGRA 4K8RB 3C5EA 1AK2A 1U8AA 4WV3A 3K94A 2ZETA 4ZT3A 1XJCA 3W2TA 1MO6A 2HDNB 4OM7A 5TPWA 4RXTA 4J3FA 5JWOA 3IT3A 1PWXA 2I76A 3IRUA 4TUYA 4YXWA 3JQ7B 1Y8QA 5FULA 5IZCA 1B7GO 3V4SA 5JAOA 1GJRA 3EEFA 4ND2A 4G8JA 3WGNA 1KQGA 4CKWB 2BGMA 5J1SB 3H0CA 1GUFA 4NONA 2LTAA 1OFGA 3BB3A 4LUCA 5AI5A 1XTPA 3PYLA 3NHAA 1UZMA 3GAMA 4K05A 2RB4A 4NG5A 2P2GA 4IZIA 2GLTA 3SD7A 3T7AA 4RGQA 3VPAA 5K8IA 5FR2A 4F5YA 5EZYA 3D1LA 1JWAB 4MR8B 3LOPA 1OV4A 2KLBA 1ZVQA 1YE3A 3I3OA 1HYEA 5B3JA 2O4CA 4HDNA 4Y98A 2C4HA 2Q1XA 1W5AA 3DLTA 5AVRA 3W77A 3HUEA 2ZSBA 2OHGA 1C4WA 3AHDA 1SXJA 4ER7A 3REFA 2JH8A 4P36A 2R4UA 3DOFA 1W0CA 2PXCA 1KEWA 1SHZA 2YZMA 5HZGA 3CB2A 2Y2VA 3LSYA 3B36A 1DJNA 2O52A 3I01M 3CYFA 3BHMA 1B0UA 4EMSA 1H2YA 3DMRA 4DDHA 1CY8A 1JVNA 1NOKA 4HAWA 4B6JA 5ICSA 3LXXA 3ZWVA 4BOYA 1X13A 2V6IA 3G2PA 4DILA 4YRSA 1T3TA 3GLRA 3LY9A 1EUZA 4G84A 5KOHA 4A0QA 1UZUA 1NUSA 4MS4B 1DAGA 2BHRA 4KMSA 3RFUA 3PT5A 3K35A 1JS1X 3ZEAA 5CDHA 2ZI3A 2ZM6B 3A6FA 3LKDA 3AI3A 2IYLD 2JIRA 4CWAA 4N0QA 4GBGA 1TIPA 1FJHA 2N9UA 2OFOA 3ASVA 2A9KA 1TJ3A 2ZYIA 1R16A 2QMEA 3C5WP 5F2EA 3R75A 5A02A 1T2VA 1JR3A 2RGDA 4C89A 4U8GA 2IU6A 2W2NA 2O8VA 4J6EA 4XQCA 1Y7LA 3ZS8A 1MAWA 1XRMA 1T0BA 3ZLVA 3GJZA 4I4TB 1YBMA 5FNVF 2ZXFA 1M2WA 4GI5A 4X1KA 2POQX 1F0NA 1QIJA 2ZIWB 5CFPA 4ZRMA 4UMDA 1ML3A 5J43A 4EJSC 3KQWA 4H0NA 4KTVE 5F33A 2BMVA 4EO7A 2WJHA 5CLQA 3F6CA 4QIHA 4TMTA 4MV0A 4WXRA 1OOEA 3FM9A 2XOKD 3KSRA 3RYCA 2HA5A 1OFVA 5KDLA 4FDLA 4CU2A 2AG8A 4F5WA 2H4HA 2F9MA 1ISFA 2VPTA 3NIFB 1EFUA 1IHUA 2W2XA 1RQGA 1UK7A 4KXNA 1MOSA 4RCVA 5DYYA 3EDQA 3OSUA 5FWXA 3BD6A 5ALQA 1NLFA 3Q3IA 4N5LA 5ALTA 1TO6A 3Q9NA 4EENA 1X7WA 1GNRA 1LLUA 3LZDA 4RPKA 4ROSA 1IVSA 5LXTA 4DCCA 4U5XA 2RKWA 3CMCO 5L6LB 1N25A 1QG2A 4CUKA 3B9BA 3RIXA 3ILXA 4ALMA 3RH0A 4EJ0A 3T35A 2PMWB 3FR7A 3VZDA 4BZZA 4GP9A 3IO5A 4IKEA 3EBOA 4JT4A 1FTQA 4BIMA 4A6PA 3NTOA 3KYCA 3OLWA 1H2WA 3KQQA 1DKNA 1L8OA 1ADYA 2VAVA 3SJAA 4EF6A 2BKUA 2WHQA 5SYAA 1VA5A 3AUFA 3DSRA 3RRXA 1PWEA 3EQ8A 3KQSA 4BZPA 5AKLA 3R41A 3X2EA 1HETA 3NBAA 4KQ2A 4O2BB 5CUQA 4XIGS 2NQ2C 3EF3A 1QGUA 1XA4A 3ZPXA 5THXA 4N47A 2BSXA 1D1PA 2IWHA 4GLLA 3AILA 3GIDA 3M2TA 1EDDA 1GCUA 1GPKA 1IHOA 4XARA 1GTVA 3LUDA 4UJ5A 1JKJB 3EW9A 5CK4A 3NIBA 4IXTA 4DQVA 4ZZ3A 4I2VA 1IB6A 1O0SA 4ZOAA 4JASB 4LPKA 4N5HX 1JMKC 3FDFA 3R23A 3A05A 5GGXA 1SG6A 4B6FA 4EW6A 4PCVA 1FDUA 1CJMA 2WHPB 3A7DA 3MTEA 1ZSVA 3OEWA 5JMPA 4RTLA 1DAMA 1HO3A 4BQFA 4GMDA 1E2MA 1C50A 4R40A 1VGRA 4YRCA 1S7GA 2FB9A 4ZJUA 3VKHA 4EI2A 3LRPA 4DJFC 2R3SA 4OJYA 3QXHA 3OF2A 1Q15A 3IULA 2Y1LA 3Q6MA 1X1CA 1EVZA 1OYYA 2C5AA 4QULA 4D1YA 3NC0C 3UB3A 1S1MA 221PA 3CS3A 2YMQA 3LQ1A 3OOHA 4TV8A 1RI4A 2FP4B 5KZMB 4URHA 5L3RA 3Q8MA 2BGWA 1OW3B 4CMCA 3NKFA 3L01A 1JAHA 2WYHA 2WM8A 4IJ6A 4NU8X 1E5QA 1O6GA 2AMYA 3BC1A 4DCOA 2OO7A 2WWXA 3CEAA 4EWLA 2Q99A 1RHJA 2I4LA 4TT8A 5FBLB 2R96A 1M1YE 3P9ZA 3EZ2A 4UDYX 1QO0A 4MV4A 2D06A 5CU7A 1SM4A 3QW2A 2QM3A 4F5EA 1FU8A 4DQDA 2X15A 1KKMA 1OLUA 4RKWA 5KYYA 4QGSA 2FZ4A 2WIAA 5PNTA 4KXQA 1CRPA 4R54A 1T8TA 3K1AA 4Z1OA 1VPLA 4WPGA 5KOYA 2MSDB 5F4ZA 5JTUA 1TEHA 3HYCA 4GRIA 3SSOA 4IKOA 4NIMA 3ZNNA 1CDZA 1H69A 3VTKA 4ZVVA 3DDNA 4CF7A 4PSVA 1VCMA 5A0TA 3SJUA 5JPIA 4LRSB 1YUMA 4N54A 1VM6A 4R1MA 3FETA 3QITA 2PL9A 2XCUA 2Q27A 1I2DA 4FLFA 3ZQJA 4TYWA 3BXPA 3LDAA 1FSPA 1YB7A 3MJFA 4RETA 5BUZA 3AKDA 4H4CA 2GJ4A 4FLEA 4NU6A 3VNUA 1CY6A 2PUWA 4OI4A 4BEWA 4NABA 4LXQA 4ZVSA 5SY6A 1VPEA 3NWOA 4P4TA 1Y8RA 4ROTA 5E6UA 1RKUA 1DO0A 2ZM5A 4JJGA 5JYEA 1U2GC 2A33A 3HB0A 4K6KA 4IRMA 4Z3DA 1QFYA 1EVIA 1LS6A 4G85A 2YJTD 4RULA 4W5RA 3ADDA 4FCVA 1PQYA 3OAAA 5CXSA 1UK8A 4RA6B 3ET5A 4O1HA 3DFZA 4KQCA 1HXHA 2UUAB 4R8MA 2AZMA 3KZXA 3HP7A 2ZVQX 4FSHA 4BO2A 3HBMA 4D0GA 5DI3B 2EZ9A 4AK9A 4C4XA 1ABBA 4CL0A 1O57A 2IUUA 3GEBA 1ZICA 2W2VA 5HJ2A 2F43A 2C92A 4D5GA 4M9QA 4URFA 1LSUA 4U3JA 4I08A 4Z8YA 2AYYA 5DN6A 3D6NB 2X3YA 3WIDA 2O0MA 2H85A 3R9XB 4DJDC 2PL5A 2XLCA 4C0BA 3DLBA 5EPUA 3EQ9A 1PR6A 3DEHA 3K1TA 4BNIA 1NXQA 1NTOA 3ITNA 2IXEA 1H2ZA 3PQFA 5AW9A 1JHXA 1EJ6A 2Z1NA 4NJMA 4EPXA 1QUFA 1II8A 4DIEA 3M0EA 5HDBB 1MC1A 2Q3FA 2AC2A 1BDBA 1A9XB 1M34E 3E84A 2JZOA 2DBVO 4JC0A 4GMXA 1Z4PX 4YO7A 5BN4B 1CT9A 3DCNA 3AJ9A 2BFAA 2PJZA 2QMQA 2WWFA 3FRJA 1Q1GA 5JNWA 2XWSA 4R8SA 2J6HA 4LJSA 1AKNA 1VHWA 3RUAA 1XPUA 2NZ2A 1O3YA 1Y81A 1E0JA 4XIJA 4XVRA 1LDNA 3E9NA 4CMGA 5FOTA 4PHCA 1EFVB 5D5PA 2JJQA 4GL2A 4QM6A 4NMHA 5I9LA 4MKIA 1Z4LA 4OQMA 5EPEA 1FFCA 1OD6A 1JHRA 1ZK0A 3KJNA 5AK3A 4OQXA 4B3XA 4DNOA 1YDHA 3JD3A 2FQ1A 1O08A 5IHPA 2RHBA 1LW7A 3CBGA 3MOSA 1WXFA 3REGA 1D0SA 1TIKA 3LPLA 3VKWA 1D8TA 5IKEA 2QVBA 3NETA 3T4EA 2NZUG 1VTKA 1E59A 1WWKA 2K5UA 3KSZO 1W88B 2EQ5A 2EC5A 2CB9A 2J32A 4GVLA 5AI8A 2CT8A 5REQB 3JWHA 3MHTA 1N2XA 2C4TA 1ZW6A 1SUAA 1Q7TA 3FKSA 4YQYA 1E1KA 1VLLA 3A32A 1BDIA 2P2CA 2HWYA 2UYQA 3I8XA 5LP1A 3DCJA 3WYCA 3D7LA 5JMOA 4YRLA 3EEIA 4EA6A 4WZAA 2VBIA 5CA0B 1QSGA 4W9NA 5FUWA 4RZXA 4QQNA 4C2TA 1P6QA 2UV8A 3R7SA 4ZK2A 3VC3A 3E23A 5FX2A 3F1KA 1E3SA 1B42A 2QN9A 3GPIA 4FE7A 2AWOA 4UUOA 4OJTA 3C14C 5BYAA 4OHYA 2PMFA 3GJ3A 2FRVA 1ZMXA 1H8EA 2DVMA 1H4TA 3OJXA 2DH5A 2PUTA 1R9JA 3PNVA 2HA6A 2W6CX 4CPDA 3H2YA 3LDGA 4MUMA 2P5YA 2YV1A 1Q0UA 3HU5A 3NCHA 3ORYA 5KS2A 4JNCA 1RBQA 1YRLA 4PS1A 1RSZA 2BEVB 2XBLA 3KL4A 5D7BA 4EY7A 1ZLXA 2VC2B 1YDEA 4LDQA 1GQQA 3UICA 1ZD5A 3FNRA 3G2LA 1Q0QA 1AXGA 4V3BA 3LUBA 5F9MA 1GZVA 3LU1A 4N48A 4GM4A 2B20A 1NRWA 1ZUHA 1TM1E 3EDOA 4WZBA 4PQFA 3SZRA 4EBBA 4XOIA 4D3XA 1JXOA 3P45A 5H3LA 4CKYA 1NI5A 4NCIA 2QL5A 3NIGB 4MA4A 5IJZA 1EUCB 2O6LA 3VNRA 3BQMB 3DFUA 3IJ5A 2JBHA 4RK4A 2WSIA 4OMDA 1O94D 3CXRA 4I5DA 3B70A 3NHRA 4XWOA 5EJEA 1J2JA 4YCCA 1XMJA 1EINA 5C81A 2UU9B 4Q9AA 4HYEA 2B5VA 4UTNA 2IYSA 2OXTA 1I5RA 1QF7A 1UZNA 2XNCA 1VJGA 2BMEA 1DQZA 3HL4A 5EG5A 3N7UA 4ZGGA 5KHOC 3MMZA 1M8FA 2H1LA 2AJ8A 3INRA 3N2EA 1KA9H 3O73A 5BSGA 2D7DA 3FOAA 3K0FB 3ZY3A 2FPGB 3E3OA 3C6MA 2AJLI 4RC9A 1QH8B 1I2ZA 3NTUA 5K01A 3K71B 4OLJA 1YE8A 2VUTA 1UPTA 5FOQA 1KAGA 5BQOA 4XI9A 5LIPA 2OYSA 1L3IA 1U2DA 3PDCA 1AGXA 3D7RA 4N5MA 1V16B 1S9HA 2D5IA 4EA7A 1WXGA 1U8XX 4KEAA 4UULA 1YR7A 3NV7A 1M0SA 3EXEB 1KBOA 4NBVA 1FRQA 1GY8A 3GZJA 1K6MA 1L5VA 3ID6C 2CLIB 1JAIA 1IULA 4A73A 2PAFA 4U9HS 1FUUA 5BUCA 4QBKA 4HDKA 5FNVA 4MUEA 1XDWA 4H3VA 5A3JA 2KE5A 2Y1GA 3ILYA 3LPNA 1WBBA 3JYNA 1FQOA 3RVOA 1K6IA 3PKJA 4AM8A 1XCMA 1TQ8A 1EA5A 2ARKA 4Z4GA 3AT1A 4A2CA 1JL3A 1P6XA 3DDOA 2ICAA 4IDEA 5K51A 4MV5A 4XB2A 2VEOA 2C95A 5AK5A 8LDHA 5GVSA 2GCEA 3H99A 1YRQA 3HEAA 2HRBA 1EVEA 4QOIA 4OG2A 5CXQA 3BMQA 1UWKA 1XZBA 1LPAB 2X7HA 2PT6A 5KOIA 3GQBA 4ZI3A 1L5RA 3V8NA 4HWRA 3TM5A 3ROEA 3BE6A 3FNBA 4CFSA 4LI3X 3Q0TA 4DWJA 2AFHE 2HBQA 1NM5A 1WSWA 4MIEA 1VMDA 5CM8B 1PR9A 1CIVA 3PEWA 1Q21A 3ODGA 3P97A 4F71A 5B3KA 1Z8HA 8MHTA 4DIMA 3HJGA 5AP9A 3Q4GA 4KIWA 3EUAA 2ZJYA 5DHTA 5CFLA 3U61B 3UCEA 4EKGA 2Z4TA 4TS1A 5B1HA 4B71A 3GLIA 1NW8A 4HB2A 4HLCA 3LT0A 2IYUA 1LXCA 2FMUA 3JASA 4OQFA 3M6FA 1IXSB 1I36A 4GSLA 1JEYA 1HKHA 1UWCA 1VGVA 5TRTA 1EI9A 2NXNA 4HGNA 1GGHA 2ZK7A 4ARIA 2J0SA 4JKIA 2FWRA 2OZEA 4KNWA 1TYBE 4M7RA 5CFZA 5JMTA 1QU2A 2HSJA 3E4DA 2B8EA 3ESDA 3PUXA 1RM0A 2WNHA 4LTMA 1KRWA 8ATCA 1YB4A 4OGWA 1SUSA 2I4MA 2QGZA 4FBMA 4CIWA 4ZEMA 1JFLA 1Z4NA 1KMCA 4G0PA 4P7BA 2XOKA 4RENA 4C0AC 4XGNA 4DA9A 4JOSA 1S3GA 1QR6A 3RVMA 1ZNXA 1G20A 2W6PA 3FSGD 1T3LA 2BGUA 2PT9A 3VKUA 1FYWA 1Q7EA 3CO5A 3AKCA 3K8OE 4JYBA 2H29A 1KE1A 4DLKA 1X7YB 1YR9A 2XWJI 5FOUA 1P0CA 3T34A 4EGSA 4LC1A 1M0EA 4DE5A 1MNAA 1T8SA 1RWWA 2A35A 2I3ZA 3FHCB 3LKBA 4G26A 2EG9A 3TOVA 3HDYA 4LE0A 4AKGA 3C5VA 4P9NA 1KKLA 4Q6BA 1FVOA 2RG7A 4DLLA 1CUYA 4TVKA 1BTOA 4ZA2A 1YB6A 5HE9A 2C59A 4R3UC 4BLWA 4C3OB 4S04A 3L79A 1EYZA 3CVJA 4P3KA 3CY6A 3NDRA 1AMNA 4JI4B 2QL6A 4OOFA 4LF8B 3EPPA 1IMOA 5IMBA 1VRWA 3GRUA