5LSLA

Crystal structure of yeast hsh49p in complex with cus1p binding domain.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of U2 snRNP SF3b components: Hsh49p in complex with Cus1p-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding domain
molecule keywords Protein HSH49
total genus 21
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lslA00
2D9PA 3S8SA 4LJMA 3P5TL 5EN1A 1DZ5A 1U1OA 1YTYA 1M90T 3NS5A 3VAIA 2DK2A 3MXHP 2MQOA 2MKKA 2N3LA 2XS5A 3S7RA 4WKRA 4V19X 2LMIA 2MKHA 2MZRA 2Q79A 4M5DB 5LXYA 2MQMA 4QU7A 4IUFA 3ULHA 1UW4A 2DGWA 2G1DA 2JX2A 1X5SA 1HD0A 2CQ4A 5ITHA 1QVFR 2HVZA 2FC8A 4U67Q 4F02A 2D9OA 2L41A 2VODA 2NZ4A 3LQVA 2ERRA 4WFNQ 3EGNA 3K0JA 4W92B 1KD1T 2LXIA 1WI8A 3NMRA 3DXBA 1K73T 2NLWA 3NS6A 2CQHA 2DH9A 2F9DA 1NO8A 2DH8A 2AD9A 1WHYA 5DDOC 3P6YC 2CPDA 2DGUA 3G96A 3HI9A 2CPXA 2KXFA 2UP1A 3NNCA 3J7ZT 3VAMA 2KH9A 2KXNB 5JVGQ 5JVHQ 2KRBA 1S79A 4ZKAA 3BS9A 2LKZA 2X1FA 2LEBA 4W90B 3B4DA 2LECA 2HZCA 3UD4P 5GMKa 2ADBA 3IWNC 2HGLA 1YHQS 1Q82T 2DNYA 2CQ0A 1SJ3P 2KHCA 1JJHA 2MQPA 5CXTA 1WELA 1KOHA 2DH7A 2MGZA 5HL7Q 3HHNB 1OWXA 1VQKS 2MPUA 2MZQA 2KI2A 3VAGA 2N3OA 2KU7A 2M2BA 2DNNA 2RVJA 2SXLA 2YTCA 2MKCA 4UY8T 2M52A 1YJNS 2CQBA 2RS8A 2RRAA 1WEZA 3PIPQ 2FPHX 1AUDA 1A9NB 1P1TA 2MYFA 3D2WA 1ZZFA 1WHXA 2DNZA 1X4BA 1HA1A 3MUMP 3DLLQ 1WHVA 3SXLA 2JRSA 1O0PA 2YWKA 3CD6S 5LSLA 1VBYA 1DHMA 1SJ4P 2EK1A 1L3KA 1DRZA 1FO1A 3P3DA 1Q81T 2RU3A 5HO4A 1VQ8S 3I56S 1SXLA 1K8AT 2HGNA 2MKSA 4RU2A 1YJ9S 3CMES 1H2VZ 2MKJA 2AYEA 2DGSA 1H2UX 2DNQA 1X4DA 2OSQA 4IO9Q 1OIAA 3UD3P 2G4BA 2JWNA 1UAWA 5GAGU 2QEXS 1WG5A 2KG1A 1VBXA 1VQOS 3FEXB 3G8SA 1UP1A 3CMAS 2DNLA 2GHPA 2DISA 2MY7A 3UCZP 3TP2A 1X0FA 1FT8A 3G9CA 1KC8T 3Q2SC 3G4SS 3CCMS 2CPZA 2CPHA 2MZSA 1WEXA 4FXVA 2CQDA 4A8XA 2RUGA 1FJ7A 1CVJA 3IRWP 2ZJPQ 2RNEA 1HL6A 1VBZA 2M9KA 2DGXA 3THPA 1M5OC 3NNHA 1URNA 3EGZA 2JVOA 2MSTA 1FNXH 5H1SV 3MUVP 3CPWR 1X4FA 1WG4A 2DHGA 3CC4S 4ERDA 4UQTA 1M5PC 2MJNA 5IM0A 2DNGA 4F26A 3VF0B 2KT5A 2XNQA 4C0OC 5BJRA 2CQ3A 4J5OA 2CQ2A 2MMYA 1U1KA 3EX7B 2CPEA 1YJWS 3ZZYA 1PGZA 1D9AA 2X1GA 5D77A 3BO2A 2DO4A 1N52B 2V94A 2OIHA 2DNOA 1WF1A 1R8PA 3CCLS 2M8HA 3NNAA 1VQ4S 3US5A 2DHAA 2VOPA 1SJRA 5GVQA 2E5GA 1XN9A 1X4AA 1U1MA 1B7FA 3MDFA 2DIUA 1YI2S 2MZ1A 3CCQS 2DNKA 5GAEU 4PRFA 1NU4A 5GAHU 2CQGA 2KXHA 2DGVA 1JJ4A 2AYGA 1YWXA 3UCGA 1X4HA 2DGQA 5GADU 2N7CA 1VQ7S 5DETA 2KG0A 1VC6A 2XSFA 2DGTA 2KVIA 1VQ5S 4FXWA 2X1BA 2E5HA 1N54B 5IM0B 3MD1A 1RK8A 2MZTA 4YUDA 2QA4S 4WIIA 2LQ5A 1JJ2R 4QPTA 1A7GE 2A3JA 5CYJA 2CPJA 2L9WA 1FXLA 1M1KT 3G8TA 2RQCA 2QFJA 4OZ0A 3FEYB 2N82B 4WF9Q 2KRRA 1R8HA 3V4MA 1U1PA 1FHTA 1OO0B 3CUNA 1M5KC 4Y0FA 2MY8A 2MSSA 4Y00A 3VAHA 2LCWA 2J76E 2WBRA 1Q86T 2OTLS 1N8RT 5MLCV 1WTBA 3BEGB 1VQ9S 2G0CA 2KFYA 4QQBA 1U1NA 4Z2XA 2VONA 1WEYA 3G71S 2FHOB 3SDEB 1OPIA 2PE8A 2LA4A 4CH1A 2LXUA 5IQQA 2LA6A 3LPYA 2O3DA 2CPIA 2MKIA 1ZZNA 2E5JA 2EVZA 2DHXA 2M4MA 2M7SA 4F25A 2DNHA 2EK6A 1QVGR 2PEHA 1H2TZ 4LMZA 1JMTA 3TYTA 1VQLS 5DM7Q 1U1QA 3CCSS 2YKAA 2RRBA 1ZH5A 1M5VC 5LSOA 4PKDB 3UWTA 1G2EA 2E5IA 4WCEQ 2KYXA 1BY9A 3N9UC 5IFMA 2ZJRQ 2RS2A 4C4WA 4EGLA 1VQMS 3MUTP 2CQPA 2DNPA 3MD3A 2E44A 1QM9A 1K9MT 3MURP 3VAFA 1X5TA 2KM8C 3RW7A 2DB1A 2OSRA 2M0GB 3UCUP 1WI6A 2F9JA 2MHNA 1UFWA 2FC9A 1U2FA 1IQTA 3G6ES 1KQSR 4CQ1A 1X4CA 3H2VE 3CULA 1X5OA 3UE2A 2VOOA 3JB9k 4CIOA 1X5PA 5FJ4A 1HD1A 1VQNS 5LXRA 3B4MA 2KM8B 2KN4A 3U1MA 3H2UB 3S6EA 2RQ4A 2GO9A 4C7QA 4TU8A 2HYIB 3CCVS 4ED5A 3BO3A 2OTJS 1WWHA 1FJCA 4CH0S 3VAJA 2D3OR 3CXCR 2HGMA 2AYMA 2J0SD 3THTA 3BO4A 1RKJA 2ADCA 4P6QA 1S72S 2B0GA 5LJ3Y 2MJUA 5CA5A 2J0QD 4QU6A 3VALA 2DNRA 2YH1A 2J8AA 2MQLA 2RT3A 2MQQA 2DITA 1NJIT 2CQ1A 2LEAA 1U1LA 4TU7A 2BOPA 2K8GA 3VAKA 3R1HA 1VC0A 1W2BR 3CCUS 3R27A 5LJ5Y 2DIVA 2CQIA 5DM6Q 2X1AA 2M70A 1SJFA 2XNRA 2MZJA 2MGZB 3CCJS 4YOEA 4WFAQ 5DDRC 4PR6A 4OZ1A 1U6FA 5D78A 2MB0B 2U2FA 3I55S 3MOJB 3TO8A 2LYVA 2M88A 3CCES 3L3CA 1WF0A 4LIRA 3SMZA 2CJKA 3CF5Q 2XB2D 2XS2A 1P27B 3P49B 2XS7A 1SJQA 1WHWA 3Q2TC 2CQCA 2CPFA 2JVRA 2YH0A 3OW2R 2DHSA 2MXYA 2OJ3A 4IOCQ 3SDEA 1U6BA 4WFBQ 1VC5A 1WF2A 1X4EA 4TU9A 2DO0A 2F3JA 3RW6A 1KOOA 1N88A 2MQNA 2ZJQQ 1YITS 2I2YA 1D8ZA 3R1LA 2I38A 2DGOA 3CTRA 2U1AA 4TLQA 1DBDA 3ZZZA 1Q7YT 3CC2S 2AYBA 4BS2A 1PO6A 1X4GA 1YIJS 1VQPS 2M8DB 1VQ6S 2DNMA 2BZ2A 1U1RA 3PIOQ 3CC7S 2L08A 2CPYA 3CCRS 3J7YU 5DDQC 3MI7X 1H6KX 2K3KA 1FJEB 4IOAQ 1F9FA 3S01A 4YB1P 5DDPC 1WG1A 2FY1A 3U1LA
chains in the Genus database with same CATH superfamily
3PCOB 4LFCJ 1GXTA 2BRLA 1YTYA 2B5JB 4LR8A 3FQLA 2CNLB 3QNWB 4WYWA 5A2QU 2EW9A 4DCJB 3QSIA 4A8WA 2CG4A 4EBCA 3CDAA 4N76A 3MXHP 1YRXA 4FN5A 4X4PA 1HHTP 3D68A 3LPEA 1PAEX 3S7RA 1HR0J 4Q44A 2LMIA 2AW0A 1TL3A 2D3ZA 1VRTB 4ED0A 1SV5B 2MQMA 4PXCA 1N56A 3OJUA 5HI7A 2DR6A 3DYAA 4KFBB 3A1YG 3SSQA 1TK8A 3PKMA 4K4WA 3OVBA 3EJMA 3TX8A 3DLKB 2JOQA 3DKDA 3ZZRA 3SYZA 3QRPA 4DR7F 1MMNA 1U7LA 2AEJA 2AJ0A 2FQQB 2B3TB 3BYPA 5CYQB 2G1DA 5ETVA 1TMMA 1RTJB 2WOMA 1KLMA 2UUBF 2X3DA 3AXMA 1QVFR 3CD0A 3IS9B 3PV8A 4O3SA 2NZ4A 1HPZB 2DCUB 4TKTA 1Q1KA 2XZDB 4UOHA 4PG6A 3OTCA 2GQCA 4ED8A 2VD3A 5KG4A 3CO0P 2H4YB 3KLHA 5HP1A 4A8OA 1T3NA 1KD1T 4W92B 2JEIA 1HQEA 3RAQA 2JDJA 2KJWA 3VTIA 3NMRA 4CO3A 1AZSA 2I2YA 4DR7J 2EFQA 5D0GA 3DXBA 3I87A 3BPDA 4RZRA 3AA8A 4N8OA 4YB5A 1LW2B 3TUIC 4K4YA 1S9GA 1TL1B 3P6YC 2BJ9A 3DDKA 4LR9A 4CO4A 3G96A 2J6SA 2QYGA 3HI9A 5KFYA 3W8GA 3D4JA 4KHMA 2ZNZA 2R7WA 1Q5VA 4NLDA 2HZAA 3QT6A 1VBKA 4NYOA 3G6VA 3NNCA 2W4CA 2FUG9 3VAMA 2HHVA 3HXMA 4PPZA 2ZE2B 1S7IA 2KRBA 1JXLA 2LKZA 4RBUA 1S6QA 2MKYA 4DV7J 4QYRA 4AQYJ 4IOBA 4K5SA 3IWNC 1V6HA 3CVKA 3EE3A 2WVDA 4L3NA 4Y2MA 3MTJA 4IRDA 2CQ0A 3CSKA 3HJVA 2KHCA 1RWUA 5CXTA 5GAEI 2HQFA 5DG7A 2HIYA 3MR6A 4Y2KA 4OLPA 3OTOJ 4ED7A 2XTJP 4ATNA 4HKQA 1RLCL 4J9VA 3Q24A 2X51A 1I94J 1JB0C 2ZDOA 4ZPTR 3MMAB 4IKAA 1VMBA 2KI2A 5DZ7A 1YZ7A 3TAMB 3N01A 5FLXU 5KFMA 1GMWD 5AJ3J 4QCLA 2AJQA 2FVPA 4C11B 1IKXB 2VG6A 3QLHB 1WSRA 1REVB 4HI1A 1S1XA 4M5MA 3NCPA 2Z2LA 2AWZA 4ZMMA 4DV2J 5KT7A 4KC5A 2W8KA 3MCOA 3VGVA 2WONA 1XR6A 1T05B 2EC2A 4DDFA 2JC0A 2RRAA 2AZ3A 3B54A 3W7BA 4DL6A 4DL0C 4R0JA 3UDLA 2FPHX 3DFEA 4YB6A 5D4NA 1P1TA 5HVHA 3NGTA 4MK9A 4P7VA 5CQGA 2WW8A 3H5UA 3TI0A 1N33F 4KKOB 4ED1A 2OPSB 1ZM2A 5DRKA 3SXLA 1FRJA 3TJ9A 3R2CJ 4PAAA 3OUYA 1JLAB 4I2PB 3OSPA 4ZVSB 5A6PA 1DHMA 1ZPVA 4OYIA 4NMXA 4EBDA 2HVEA 2VIHA 1T11A 2EK1A 1X9WA 1SJ4P 1DRZA 1YKWA 1N36F 4B9UA 4DU8A 2H1YA 1Y5IB 1DTQA 2K2PA 1VQ8S 4BHQA 1Y4ZB 4X64J 2HGNA 2CJBA 4ICLA 4F4WA 2VQEJ 3CMES 3TUJC 2B5JA 3FC9A 2QL9B 1H2VZ 1RI7A 4YN3B 2W7OA 3PYDA 5BYSA 4RU9A 2DGSA 6FDRA 2GJIA 4E8UA 1FEHA 3VR1A 3IN5A 2R8IA 4DR1F 4Y28C 1BHNA 2Q6BA 2DXFA 1SVDA 5KFHA 1N6QB 4DR2J 5RUBA 2JC1A 3PYFA 1DLOA 3T9ZA 1NXIA 3MEGA 5F9LA 1R43A 3QGGA 2JWNA 1UAWA 3M8YA 1QSSA 2K1RA 1TKXB 3P5BP 2QEXS 2KG1A 1EARA 1VBXA 4QIGA 3H59A 1U02A 2CZVC 1D3WA 3GJSB 3ISZA 2R9LA 2VJVA 2XYHB 3GMGA 3FBCA 2OI2A 4QWAA 1UP1A 2V4JA 4O3RA 2L3MA 1YITS 1BUXA 2R7UA 3V6JA 3GPAA 4ZOSA 1FRKA 4WIQA 2OPRB 3UCZP 4K4TA 3CJ4A 3PY8A 4FDFA 4DZDA 4X65J 5B0AA 1FJGF 1X0PA 3IR5B 3BGLA 3CCMS 2BE9B 2Y1RI 4ZVUB 3QJPA 1NSAA 2JFKA 4LF2A 4CO2A 2RUGA 2HNYA 3ENAA 3D6HB 3EVMA 2RNEA 4RNHA 3IRWP 2ZJPQ 1HNZF 4ECVA 1S0VA 1U0SA 1OSDA 4K8RA 3NGDA 3DLBA 3D6FB 2DD8S 4E0DA 5KT6A 3THPA 4DX6A 3NNHA 3KXDA 2RHQB 1LWFA 3NXZA 3QLHA 4UW2A 3W3SA 3D9BA 4FZVA 2I6WA 2A6OA 3NBPA 4X4TA 5AXNA 4CLYA 3MUVP 2J7UA 3J7A1 5IWAJ 1QJHA 4UQGA 3VVTA 3HVAA 2HS0A 4IDKB 4UQTA 5HVFA 2ATCB 2GMHA 4ED4A 4ICLB 1TL4A 3GILA 2RD5C 1TK0A 1W2IA 4U8VA 4RUAA 1ELOA 3L7OA 1N5TA 3T1AA 4NI2B 5J2MB 1OY8A 3C66A 3Q8PB 1U8SA 3PNIA 2YPZA 5KAKA 5CH7B 1NJXA 1Y5LB 2HWIA 4QJVA 2CQ2A 2HQIA 1SQFA 1T9XA 2OPSA 1Q95G 2GQQA 4Y2IA 1RWKB 2H9ZA 1U1KA 2V50A 1RWVB 3FVYA 4KV8B 2XI3A 1OQ6A 4NYPA 5K5MA 2C2RA 1PGZA 4ANCA 3MAAB 1UVNA 2R7TA 4V1Ak 1F9EB 2C28A 1FERA 4KPCA 4WFYA 4J37A 1J5OB 2GFFA 3NNAA 3QAUA 5JMNA 3UR0A 1F1BB 1J5EF 3H20A 3KMQA 1ZYQA 3BZQA 3NGKA 3US5A 5HANA 3QIPA 2BJEA 4EWTA 2GHVC 5KFQA 2VICA 5GVQA 3QGPA 1T05A 4B9LA 1PYOB 4PWWA 3PW0A 4U7UD 4DR3F 3DRRB 2B56A 3QT7A 3EICA 1AYEA 1BQXA 3MM7A 3BR8A 1AZSB 4HTJA 1SH0A 4W4MA 4C48A 2QSFA 5F8LA 4J9OA 5GAHU 4B3OA 3OT9A 2KXHA 3DRRA 4ZP6A 3CJKB 4BC9A 1D8YA 2NSBA 5KT3A 3I4HX 1TUGB 1JJ4A 1IBKJ 2AYGA 2HURA 1X4HA 3LH2S 1RYSA 5C42B 5DETA 3PRBA 5J2PA 5LM7E 1KTQA 2Q66A 2EFGA 3K57A 4I1TA 2IRYA 4ELUA 4NLRA 1VQ5S 4FXWA 4DSEA 3QFHA 5HROB 1N54B 3OUYB 3CT9A 4HHJA 4WZQA 5IS2A 2ZOMA 1S6QB 1RK8A 4RLEA 1FFWB 2KB2A 1S10A 1HWJA 1LWEA 3SCKE 3GIIA 4NCGB 2BQ3A 4OZ3A 3D54A 3GWCA 5KFJA 3ZTQA 3GP9A 1M1KT 3I5CA 2D41A 2OHDA 2ZM6F 2RSQA 2ZHAA 1OQ3A 2N82B 4WF9Q 5CD4H 1R8HA 1U0HA 3GJQB 4ZVHA 3V4MA 4CYUB 2VDIA 4NLYA 4ZJLA 3W9HA 3MM5B 1FHTA 3T3FA 3CUNA 4QWDA 4Y0FA 3OVSA 2NCKL 2QRRA 1ULRA 2B51A 2VH7A 3I9ZA 2MSSA 3LP0B 4Y00A 5CAAA 1G3OA 5HSPA 1Q86T 1S9EB 1IKXA 4ETXA 1T0TV 2IFXA 2PSZA 2I1RA 3RJMB 5C25A 2AJ4A 2ZH5A 2UVRA 4OZNA 3M2RA 2UU9J 1BWVA 2G0CA 3NY0A 1FWKA 2ASDA 3G71S 1FFSB 1IJFB 1RHKB 3OXFA 4NEZA 1OPIA 1O6XA 4OYBA 4ECRA 2EG2A 1TQLA 1VS3A 1WOPA 2LXUA 2W9BA 1ZETA 3LPYA 2FJDB 2K3IA 5IQQA 1UCNA 2EVZA 2RAQA 4N77A 4PG7A 3HMJG 3T5HA 1TKZB 5D0HA 2EK6A 3M9NB 2R7XA 4ZJQA 5J2NB 2LXFA 3PRVA 1JMTA 2R4FA 3KFWX 2NPFA 3CCSS 2BANA 2YKAA 1U25A 4BBYA 1ZH5A 3KG4A 2RRNA 5HJXA 4GC7A 4FVCA 3QJJA 3CDBA 3PYEA 3OQ2A 2HBZB 1KQKA 4ZCIA 5EGYA 2LU2A 2OAUA 4ZCLA 3HVTA 3LA0A 3GSIA 2OD6A 3TOQA 2LQBA 4M5NA 4OX7A 1GFWB 1OJ4A 4URQU 4KGKA 4NEYA 4ANEA 3HVRA 4B3RJ 4PG5A 3HX9A 2VFUA 4IDKA 4X4SA 3QRQA 2P9EA 4DFJA 3MD3A 2GQ2A 5KFVA 2E44A 3IR6B 2OEMA 1NK8A 3VAFA 2IIHA 4ZVOB 2DB1A 1K1SA 3FKBA 5A8RA 1TKDA 1YZ6A 4F04B 3S1TA 2W2QP 2QT7A 4F0HA 5D8HB 1QDUB 1SL1A 2V63A 3G6YA 2KHDA 3UDEA 3UCUP 3EGVA 1Q79A 2W2PP 1U2FA 1P9YA 3EWGA 1U2RA 2IDEA 2C2NA 3EGWB 3AQOA 1X4CA 4B02A 2AGPA 1KQSR 2DVIA 1R6YA 1RTIA 2EKNA 2IVYA 2WOMB 1LFWA 2G1HA 2HRTA 1VI7A 2KT2A 2QMXA 3I0RA 3CULA 1TAUA 3IMQJ 3QO9A 2MLXA 1X60A 3QIPB 3VWSA 1SKUB 3LTOA 5FJ4A 1HD1A 5G4DA 1NHUA 3U1NA 4A8YA 4DSLA 1VQNS 5LXRA 1WC5A 2I5JB 3B4MA 2XCPA 1YQHA 4HYKA 3ENVA 4J9RA 2V8PA 3DHXA 1FDBA 2KN4A 2OP5A 3N6LA 1KRPA 3SCLE 2AV5A 3H2UB 2BW2A 5D0EA 3TJ8A 2RQ4A 2GO9A 3L09A 7FD1A 4UZCA 4BWJA 3H5YA 1RSCA 1TVRB 3FRYA 3HZEA 3QBCA 3R9LA 3AY0A 3ZZ0A 1RT7B 1WWHA 4G65A 3W5XA 3T19A 5L46A 3PKYA 4Z7YA 3CB4A 1FJCA 4LREA 2HS3A 1XMOJ 3KJQB 4GVBA 1RE1B 2BXJA 1FRMA 4F4AA 3CXCR 2FVQA 1JLQB 2GZOA 3AXKA 1UKUA 1RAJA 5K14B 2MTLA 2ZITA 2PC6A 5E3RA 2J0SD 1R0CB 2VA3A 2DJWA 3EPGA 4M5LA 5L1JA 4XPCA 5J2QA 2ADCA 1S72S 1AROP 1SBRA 4GVBB 4M94A 3ZZTA 1MROB 2BE7D 4NPOA 2BUNA 2FLLA 3VALA 4CM2A 4IRCA 2DNRA 2YH1A 3B6BA 1ZM4A 1AFIA 3PJXA 1HBNB 4OHYA 3ENQA 3IRXB 2AJFE 2JFDA 5L38A 4CTAB 2Z8QA 3R6GB 4NXMJ 3LAKA 3QO9B 2HHQA 3DLGB 1TFWA 1U1LA 1UA0A 3AOCA 2J7WA 1HMVB 4WFZA 2AEFA 2Q1LA 4DL3A 1HYSA 5CCLA 3MM6A 2MQ8A 2V8GA 2I5JA 3BV8A 2QLJB 1IR2A 2WW4A 3CCUS 4DV4F 4P71A 4K0KJ 4WE1A 2VPXB 2JHEA 4ZPDA 4DWIA 1S6PB 2CQIA 4DX5A 2ZBIA 2FTRA 5DQIA 1SJFA 1YJVA 2YX7A 3TW0A 4F4YA 2C22A 4F0MA 2WB4A 3M1VB 3R7NB 2ASYA 1C1CB 4PPDA 1CQNA 4PR6A 1CG2A 1PYSB 2FHJA 3SV4A 4P9SA 4X62F 3KJFB 2ILZA 4EEYA 3AD9C 4Z7CA 3AFGA 3UPFA 3TO8A 3DLHA 1S1XB 2Z2YB 4U96A 3L3CA 1N34F 2ZDPA 2IBKA 1WF0A 4MIWA 5KG0A 3G6XA 4IQXA 5HLFB 5KOWA 4WYLA 3C6UA 1FRXA 1RCXB 1O8BA 4LIRA 2EFOA 3RB3A 1GEHA 2CWKA 2C3PA 3C14B 3HSDA 3JQMA 4M5IA 4CNZA 1LFPA 3CF5Q 1QLNA 4USTA 1AW0A 4NASA 3KK3B 4Y2CA 3Q8RB 5F3TA 2IVFB 2XB2D 1JLAA 3CWJA 2V2ZA 2XS2A 3MFHA 3IBCB 1RWMB 1F60B 3JSBA 1S49A 5KFZA 4KY3A 1TTHB 2ZH8A 2QO3A 5IOLA 1MMLA 2WVBA 2FB0A 3E51A 2CDQA 1FD8A 5ETSA 4ZHRA 4ED5A 2LU1A 5B08A 2CJ9A 1ZA2B 2HQGA 1YBAA 3DLEB 2YH0A 1X31C 3KHLA 1PSDA 3MF5A 4GKKF 2FJXA 4I64A 4TYBA 3MURP 2WZ1A 5B09A 1NK6A 2YPYA 3DOMB 2DKOB 3TVZA 4A8KA 1U6BA 4PXDA 2ZH6A 1OY6A 1WF2A 3IAS9 4I7FB 2KZZA 1LK7A 4YY3F 3KUEA 2HG4A 2Y1IA 1KVKA 1HBUB 5IT4A 1WC6A 2GVZB 1Z4UA 3WX4A 2QTWA 5IXUA 2LP4A 3DM2A 3ZZOA 5E5NA 3R1LA 3GFZA 4G1QB 4NCAA 4UUWA 4DCOB 3IBFB 4DSIA 3TAPA 3ETOA 1G7CB 1YJRA 2Z56B 3A8JA 3U02A 3ZZZA 4DU7A 2AD9A 1VLOA 1MU2B 4PYDA 3RU0A 3CC2S 3DRYA 2ZC3A 1DAXA 1EJ7L 3AT1B 3LW5C 1Q4RA 2FVRA 4BS2A 1IXKA 1RT4B 1H72C 4ZP9A 3RTVA 3PIOQ 2XMKA 3CCRS 3ELHA 1EIYB 3R5CA 5AT1B 2ZZMA 2YKPA 1B0TA 9ATCB 1F9FA 1M0SA 2OEJA 4YB1P 3T1HF 3PTWA 1VQ6S 3R7SB 4JUZA 3U1LA 2D9PA 2B4UA 1VOMA 2RILA 4K4XA 2FY1A 3M8WA 1RGVA 1UWBB 3LP1A 1YX2A 2G0JA 2N7YA 2BBEA 1Y7PA 3C16A 3KNGA 3P5TL 1I94F 1U1OA 1RHUB 3OFGA 4C8KA 3MZIA 2W2NP 3EXCX 1GXUA 4OYAA 4P72A 3PDNA 2LVWA 3OTOF 4URSA 4LVNP 2XZTB 2QSWA 2QX0A 4PYAA 4DQIA 2N3LA 4LFAJ 4ECQA 4DG1B 1JLQA 2XS5A 4WP3A 4WKRA 2GA7A 1EZZB 1JLEB 2Q79A 3AH6A 3AOAA 3QT8A 1HBMA 4PEOA 4O3NA 5LXYA 4Q45A 3AA9A 5E41A 4OI6A 3ULHA 3PW7A 1OSCA 2ROEA 3MM8A 1UW4A 4NRUA 1NDCA 5E7OB 1X5SA 3C2PA 4IH5A 3T6JA 1QSLA 2V6AA 1DQ8A 1RT1A 2HHSA 1PCAA 3GONA 4QR1A 2HVZA 3ILOA 1UZHA 2FC8A 3U7JA 4DEZA 4EK2A 4U67Q 5T14A 5CD4A 1HYSB 1CEZA 1CULB 1YJTA 2ERRA 2QLWA 3EGNA 2HQCA 2VFSA 3CJSA 3EZOA 3MWBA 4P10A 4XK8C 2CNKB 3E01A 1OYEA 4OI3A 4BLGA 4KV8A 4A46A 2LXIA 2XY7A 1KVJA 2CJXB 3GB0A 2VKZG 2AGOA 1QAIA 4PQAA 3PRDA 4JI7F 2CQHA 3N6MA 3HKWA 3FMBA 3QIDA 5KFTA 3UQSA 2F9DA 3MECA 5AXLA 2DH8A 4NLWA 2HNZA 5KFKA 1KHWA 3BDEA 3DN9A 3MPYA 5LMNJ 3A3NB 3MEGB 1WHYA 2AKWB 1N5VA 2CVEA 3H5SA 5DDOC 4OX9J 4JV2A 3FNNA 5HK4A 5KT4A 1Y3JA 4RJVA 4DOZA 1E6VA 2YQ3A 5EWGA 3IWXA 2KXFA 2BJ8A 4LBIA 3ITHB 3M9MB 4RW7B 4F4ZA 4JI6J 1Q0NA 2K06A 2YNIB 3J7ZT 3P96A 2IRXA 3GLJA 4P75A 2KH9A 1KQGB 1WOOA 5B0GA 5J2MA 2UXCJ 5F8GA 2LFVA 3CGIA 4NX9A 3BS9A 3D3CJ 2HKEA 1M1HA 4I69A 2OH2A 2UUAJ 4RUCA 2F8MA 2HK3A 4DPUA 4G1PA 2VBZA 4N47A 3UD4P 4LT6A 2ADBA 1UA1A 2B9XA 2B9WA 1HBMB 2VU5A 4FNHA 4ANDA 1HR0F 3K59A 2WHOA 4XPEA 1Q82T 4JI1F 2YBVA 2PGCA 4UTGA 5F8MA 2IM2A 4A4JA 4ES2A 3OPKA 3TX0A 6FD1A 1KOHA 4PG4A 1DQAA 1S1WB 2X3GA 2AU0A 3I96A 1HQ2A 4Q0BA 1NDKA 4IRKA 1R6VA 1TV6B 4OV1A 3K58A 2BQRA 1LEOA 2O5DA 4NE9C 2VPYB 2WRMA 3VAGA 4LFCF 1P6TA 3BSCA 3LALA 3Q8VA 3W2WB 1RP5A 3PX0A 1NJZA 2UUAF 2HS4A 2K7JA 1VQYA 2KU7A 2M2BA 2Z2ZA 3CDWA 1HNWJ 4ELTA 1RKIA 1RYRA 4DS4A 3FZ2A 2VFRA 3R5GA 2SXLA 2XEXA 3R5DA 1LW0A 1IKYB 4FYVB 4I68A 4I6YA 3SCJE 3W60A 1U24A 2BJ7A 2JL9A 3TZZA 1U47A 4V19J 1PBAA 4JI6F 4DXLA 2OPRA 1T8EA 3M8QB 2M52A 2K1RB 4DMZA 1YJNS 2RS8A 4K5RA 4DUZF 2HMIB 1UFKA 1PC5A 3M2RB 3HHLD 2DR8A 1BQMA 1GX6A 5LT5A 3PIPQ 4YP3A 2VBWA 4ID5B 3C46A 3CE8A 2XMWA 3CDUA 3UDCA 3NKYA 1K47A 1ZZFA 3KWMA 3ZTSA 1VLYA 5E3CA 2D7SA 4J9PA 2K7KA 1FF2A 1HA1A 2VL1A 2W24A 3KDOA 4MK7A 3IR7B 3M6WA 1WHVA 2CUYA 3DOKA 3M32B 4K2JA 2YWKA 4DSJA 2R8HA 5I3UA 1B3TA 3CD6S 3OL7A 1EP4B 2OO4A 2RH3A 4WTOB 1TELA 1L3KA 2KFZA 1FO1A 3M9OB 1XBWA 2GVDA 2HPUA 1PJ7A 1LWCA 4OI4A 2RU9A 3W64A 4DG1A 1FWLA 2DT9A 1TU0B 3DOLB 1K8AT 1LWXA 2MKSA 1FNMA 3VQSA 2QN6B 5HROA 3POTB 3HVTB 2QL5B 4OHZA 4KR0B 2MKJA 3K2YA 5DGAA 3A3OB 5KFEA 2OLWA 4NLQA 3FEZA 1LWEB 1HBOA 1A0OB 3DDNA 1KBRA 2DNQA 4ZCKA 3J7AN 5C2CA 3MPWA 1WD6A 4C3KA 2W8LA 4G6VB 1TL7B 5GAGU 5D0RA 3P4UB 2R7QA 4LFAF 3PO4A 1TMJA 2NZCA 1DTTB 1RT6B 2YKMA 4Z37A 3HCXA 3LUYA 5FIIA 2NS1B 2DNLA 5H9EK 2GGPA 2JEFA 1T9VA 2HHUA 2MY7A 2C2MB 1FT8A 4R0EA 5CZXA 3KMSA 2XO7A 1YSJA 4MKVA 1YBUA 3Q2SC 4ZDNA 1KC8T 2DRAA 2IM1A 4OYPA 1PYTA 2CNNB 4ZN1A 2XO6A 1Q8IA 1VIXA 3MM7B 3I6PA 3MPDA 3DCAA 3HFKA 2DRDA 1T94A 1VK3A 2LDIA 3CJRA 4F4XA 1VBZA 4FBUA 2NR0A 1YDLA 2Z4PA 3MAAA 4AXIA 4JI2J 2A18A 2DGXA 3J80Y 4OYMA 1S0NA 3VCDA 2H4WB 3CMQA 1URNA 3EGZA 3TWZA 2CJYB 1PBUA 3I0SB 5LMUF 3PO5A 4F3QA 1UJ6A 1NZ8A 2BKNA 2YKQA 3K5LA 2F8EX 3UD3P 2W1BA 3GTYX 2NXEA 1FNXH 2DPIA 1U8WA 1KKHA 4LSLA 5BYQA 3GG1A 3I5AA 4FXDA 3CC4S 2LDYA 1GTEA 3M2VB 5AE2A 1VBYA 1M5PC 2MJNA 1H0HB 4YY3J 4F26A 1DURA 5SUHA 4B3TF 4IG0B 1C1BA 3UN5A 2QZ8A 2XNQA 4NA1A 4P2XA 2IRUA 4F36A 4Q2LA 4LBPA 3NL0A 4HVZA 4RW6B 1IM6A 1S1VB 4ZP7A 5CHCB 5IT0A 2HVHA 3F44A 1IWAA 2ZBPA 3HULA 3SBMA 2FLPA 3DOKB 3M32A 3MMJA 4RW4A 3SQOP 4KIAA 3W66A 4DV0F 5DLFA 2CPEA 3SFUA 3ZZYA 2BRKA 3BREA 3PHEA 3QMQA 2V94A 1N52B 4TYAA 2OIHA 2DNOA 2NREA 2XWYA 3MFIA 2ZBQA 1R8PA 1IWGA 1XR5A 3SV3A 4LF9F 3H98A 2W9AA 4J9MA 1GAOA 1XQIA 2J0WA 2FIUA 3ET6B 3QAEA 4U7CA 2A2CA 4C8NA 2E1MC 2QA4G 2IMOA 4CCHA 1XC9A 4JYAJ 2XSJB 1HNVA 2AEMA 2HBQB 1Y5NB 4ILRA 4N7TA 3ILJA 2BE2A 3HT3A 2ZHBA 1B7FA 5B0CA 3H0PA 1LW0B 3WBZA 1N34J 2CKWA 2BACA 4ECXA 1SUQA 4DFKA 2DNKA 2MDAA 5GAEU 2MLZA 4PRFA 1NU4A 3K5OA 2XG8A 4CWBA 1HNVB 1T03B 5KG5A 4DV3F 2DGVA 3O3LA 1KVIA 2VG7A 1IKWB 2OPPB 3D0HE 1K0TA 4L72B 1FKAF 1UW9A 1RABB 1GTHA 1H74A 3BKTA 5ADZA 5K14A 1RWOB 3GE9A 1SQEA 2QL7B 1LWCB 2ZBRA 3FGVA 1VC6A 3KLGB 3BO3A 1JLGA 1DFDA 2YNIA 4CLFA 2WK4A 2R7VA 9RUBA 5B0BA 2X1BA 3JSRA 4C9DA 4N56A 2NUHA 2ZC4A 3MD1A 1RU2A 4QIFA 4DV4J 3JSMB 2C2DA 5H9FJ 4YUDA 1TP7A 3SSSA 4LFBJ 3K17A 1KNZA 4PQUA 3GZ7A 5IZHA 3BQ2A 1S1VA 1HLWA 2ALZA 2A3JA 2GMJA 3GIJA 2QGFB 1WNEA 3KHGA 3MGJA 4ZP8A 8AT1B 1FX4A 4ZPWR 3KJVB 3G8TA 2RQCA 3R5AA 4JYAF 4K7QA 2QFJA 3FEYB 3TAQA 4KB7A 1CC7A 1NK5A 2A10A 2IA6A 1TKTA 1Z2ZA 2BE2B 2G0IA 4RNNA 3T1YF 3JS9A 1M5KC 1S77D 1DQ9A 2ZH3A 1S6PA 2MY8A 2ZEJA 4CLSA 2LCWA 2F65A 3NOCA 3PHTA 4OX6A 3SI8A 5M2RA 4RNMA 1N8RT 4ELVA 3BBFA 3BEGB 1WTBA 1ROFA 1VR6A 4OLOA 3HHKA 3RR7A 1XMOF 1U1NA 4Z2XA 1WEYA 2LQJA 3W5YA 2FHOB 2WSCC 4ENOA 2PO4A 4NLGA 1Q8LA 3GJTB 2CVIA 3EZUA 2LA4A 4CH1A 4ZLNA 3D1OA 2PI4A 2V4JB 2KL8A 2EWHA 2XULA 1ZZNA 2O3DA 2BABA 2E5JA 4JI0J 1I5OB 2XC9A 3V6DA 2DHXA 2M4MA 4F25A 2AQ4A 1N4LA 4KHPF 3W63A 1H2TZ 3V81B 5EUHA 4Q43A 1VQLS 3BBBA 5I3PA 1U1QA 4DUYJ 4C11A 2RRBA 4CNYA 4M5KA 1JWWA 1SIWB 4K2XA 1NKCA 1UFLA 2A1BA 3HP6A 3I5BA 1NB7A 2ZWPA 1MWQA 4Q2MA 4CO5A 3HHLB 4CT9A 2D3O1 1R0BG 1CJKA 2E5IA 2HFUA 3RYLA 1TAQA 2VC0A 1C1BB 2KYXA 2VUGA 4PXEA 4ZJOA 3JSMA 2DHHA 3WDOA 3N9UC 2QA1A 2YWWA 5IFMA 4PWDA 1R27B 5HN0A 3MUTP 2CQPA 2DNPA 4IYQA 4WPAA 3QATA 1V3SA 3DGPB 1VHFA 2C3UA 1JXEA 4ZHRB 3KYLA 2VQFJ 1K9MT 3BQ1A 3HO1A 1X5TA 2HLTA 5F8NA 1RBLA 1T02A 2V8DA 3CD7A 3G2XA 1UVMA 1NSKL 2CA9A 2OSRA 4USWA 4YHHF 2V34A 2ABYA 1LW2A 2L9DA 1SQGA 3RR8A 5ETOA 4ECZA 1UFWA 2MHNA 4WXWA 2BJDA 2C3YA 3C8YA 5CCMA 3ADAC 4KH0B 3A13A 1HARA 3RBZA 3HD1A 4GRSA 4B9TA 4O3QA 5B7WA 1NH8A 4WTYA 2Q6CA 3BGFA 4ED3A 4G1QA 4JI8J 1X5PA 3TA0A 1VQSA 5HBMB 2VG6B 3F73A 4TVAB 3N5FA 1HNXF 1REVA 4B3MF 1X7VA 3NGRA 5CYMB 3FBFA 1V5IB 3D0GE 2J9DE 3MCSA 1KLMB 4YDDB 4C0HA 3U1MA 1AB8A 1S6OA 1NBEB 4LF1A 2BX6A 1IM4A 3OHAA 1Z1ZA 3DOMA 4D3HA 3BDPA 3H42A 1WKJA 1U09A 1Y0HA 4FP9A 4MTPA 4ES1A 3Q8YA 4J9SA 3KLVA 4MFBA 2CG8A 4O3PA 4CH0S 3DI6A 4IQMA 4OJHA 5LL6d 3W1YC 3VAJA 4C8LA 3NMAA 1VRTA 2E29A 4K59A 2CRLA 4LSLB 5F3ZA 3KLEB 4FF4A 2VG5B 1I1GA 1D9DA 3G9CA 2FLNA 2ZKUA 4LRBA 3VHQA 4ZN3A 4WBFA 1E6YA 4XTTA 4LF7F 2BM0A 3M6UA 3THTA 3BO4A 1RKJA 2UXDF 3B82A 2XCAA 1TL1A 2G2ZA 2B0GA 2ZE2A 1NPPA 3IM8A 1RWPB 5THWA 2MJUA 2JLGA 4DUZJ 1S5ZA 3D6MB 1O51A 3O6QA 5C5JA 4GC6A 3GSDA 2VASA 3MMCA 3Q8UA 2ZM6J 2VHGA 2D74B 2ATLA 1XTZA 2RT3A 2UZAA 4NZ6A 5E3AA 1Y10A 3G8QA 1CJTB 1CS4A 2J8SA 5F0UA 5A0YB 4Y6IA 3J80U 3OL6A 4RNOA 3V4IA 5D3GA 3OR1A 3C14A 2OMOA 4AL7A 2K8GA 3MCNA 5CYMA 1VC0A 3VGTA 1VRUB 1N5YB 3PFEA 3R27A 5LJ5Y 1HBUA 1LWFB 2HWHA 1V9OA 4IO1A 4KGVB 2KO1A 1QE1A 4ZVRB 4R8UA 3SQGB 3W2WA 1I3OB 4E2FB 1WOSA 2EI5A 1MSWD 5IT9U 3MM9B 1S59A 1PJ5A 3GV7B 4JI1J 4YB7A 3UO0A 4C8MA 1U48A 5T41A 2QYCA 4LIWA 2VC1A 4RUHA 3CCJS 4YOEA 4WK3A 3RUBL 1IBKF 3H8YA 1G1XA 1H38A 1SV5A 4U9RA 4OZ1A 2HMIA 4ZVGA 2HZVA 4MIBA 3VVUA 3BBCA 2APOA 2U2FA 2AIRB 2NXJA 3EUNA 3F0NA 2UV8G 3DLKA 1UEUA 3CCES 2UXCF 4EYHB 1GH8A 4X4OA 2B4PA 4CLWA 2J9DA 4LSNB 4O3OA 3MCMA 1CJKB 3RZAA 4YR3A 2RJZA 2PA8D 1OYDA 1QSYA 2HHHJ 1NHKL 5I3UB 2C2ZB 4CLKA 1X9MA 4JB8B 3QQCD 1QTMA 2B9YA 1TUVA 1T3OA 4DR5J 4U95A 4RR5A 1H7WA 2FHJD 3HKZD 5SZTA 3HHLA 1DY3A 2RHSB 3BF4A 1J2VA 1VQOS 1FTRA 2DXEA 4OZLA 1LKZA 1FXRA 5A2QY 3AJ2A 3BGOP 1KLNA 4USHA 4I2PA 3GIKA 1B0VA 3K5NA 4A8QA 5L1LA 3SDEA 4DL7A 4KH1B 1HW8A 4R5PA 1UVKA 3LP2A 4OIXA 4JBCA 1X4EA 2E7XA 2Y3YA 4TU9A 3V6HA 4DL4A 4ILMA 4JV5F 2V5HG 2J7KA 3T5JA 4O44B 2J5AA 4DN9A 2GC8A 5I42A 2ZJQQ 1EHWA 2UXBF 2GCFA 3O5TB 2I38A 2OMLA 4FKYA 4FPIA 4DR6F 4X66F 3HSGA 1CULA 3CJ5A 1IKYA 1TV6A 3W9IA 2BVZA 4P73A 1HBNA 2DEJA 4I6WA 4WWSA 2FY8A 3QYYA 1PO6A 3NCRA 3AHPA 4YFUA 4DLGA 1ACMB 3R7BB 1WKKA 2CPYA 5D3GB 2DY1A 1O5JA 2A6MA 1FJEB 2ZVSA 3S01A 2MQPA 4HTIA 5GAGI 2QFIA 5DDPC 5B0FA 4OV6A 2VZ9A 3JQJA 3D5MA 3RAMA 3D67A 3M8SA 1YLXA 1SKSA 4K4UA 3MEKA 5KFOA 2Q43A 1DZ5A 4LQ3A 5EN1A 5ETTA 1RAEB 2YQ1A 3MEDA 4ZA1A 3X3UA 2WVCA 8RUCA 2GIQA 3TQ1A 1DLOB 2FZCB 1JNRB 2DK2A 2FGOA 4J9QA 2MQOA 3A8IA 5D4LA 2MKKA 1NK0A 1Z2LA 5IT9Y 1JLBA 4F2RA 5F8IA 3M2VA 4V19X 2DPJA 1RT3A 2MKHA 3B8HA 3ITHA 4K4VA 4QU7A 1F6TA 1RTZA 3IBWA 1UZDA 4L3KA 3KG1A 4DR1J 4TXSA 4NRTA 2VBYA 4CZCA 3WZ0A 2DGWA 2KJVA 2JX2A 1HD0A 2W7AA 1IJEB 3H90A 2GV1A 4KGMA 3H25A 5ITHA 1HNIA 3NLCA 1WC4A 1S48A 5HJYA 2JEGA 3QWPA 1D1UA 1L3UA 1GMVA 1HFEL 2VV5A 3FSXA 1N36J 3LQVA 3OR1B 2EBGA 4ZITA 3JTOA 4GKKJ 2OGUA 1ZA1B 3NGSA 4MKAA 1PG5B 2H3EB 2FVCA 5C25B 1QE1B 1WI8A 4R8UB 1APSA 4UF4A 4UOGA 3HZGA 1RTDB 3D0IE 1CJUA 1DTTA 1RT6A 2OFHX 2NLWA 2YKMB 4FYWB 4DPYA 4WKYA 6AT1B 2DH9A 2FJEB 3FUYA 1NO8A 1HWLA 2GNKA 2YQ0A 2VJUA 4USJC 4DQPA 1KN6A 3H5XA 1UETA 3OLAA 3NOGA 1TL7A 2DGUA 5C24B 4X2BA 2OELA 4LF5J 2CPXA 5H9EJ 3G82B 3E2EA 4ECYA 2UP1A 2FZKB 1RTJA 4AYBD 3T41A 3JAMU 5DZ6A 3VZIA 2KVQE 2HHTA 4GO5X 3BGUA 4GMKA 1S79A 2D3UA 2EEYA 3F56A 1SIZA 3HF5A 4ZKAA 4DSKA 2DYAA 2X1FA 1E6YB 4W90B 4JOUA 3B4DA 1YRTA 4H4KC 2HZCA 4QZVB 4IR9A 2BR0A 4JP8A 3DGVA 1SC1B 1KONA 2FDNA 4X4RA 1MROA 4ZPBA 3UR3C 3GFXA 5KG6A 1EP4A 2ZUGA 2DNYA 3C19A 4DJBA 1SJ3P 2OUGA 1JJHA 4B9SA 1AFJA 2L48A 4NYZA 1HWUA 1UVJA 2R8GA 3L7PA 3PJWA 4I2QA 4H4OA 2ZHOA 1SL0A 4J7CA 4KHRA 2C2OB 1WTFA 3HHNB 2PIIA 3ZFVA 2BJ1A 3X1LB 4K0KF 2MPUA 1C0TA 2MZQA 3M30B 4RL1A 2JSXA 4RWXA 3H7HB 1LQ9A 5HQLA 4ZLJA 4AQYF 4ECWA 4NCBA 3VGSA 4DLEA 3CIMA 1TR0A 2N3OA 3DU5A 3FK4A 5L9XA 4EYIB 4DR6J 1MNEA 4LSZB 5CABA 1TVRA 3MAQA 4OFZA 2AZ1A 2X7IA 3MEEA 4QIWD 4NL5A 4RKUC 5L1IA 2UXBJ 1RWWB 3NG8A 1C0TB 2YTCA 2MKCA 3M30A 4Y2AA 1FKOB 1RAOA 2HIQA 1CBKA 5I4MA 2XWXA 1WEZA 1F3FA 1RTDA 1PAUB 2IM0A 3MOZA 1RB0A 5KFSA 1FEEA 3D7SB 2Y0SD 1Y00A 3GU0A 4QWCA 1AUDA 4NLXA 4HT5A 4KT0C 1A9NB 2MYFA 4NZ7A 1WHXA 3DLGA 3PX6A 2DNZA 2EKYA 2KT3A 1S0MA 1IR0A 3A8KA 5ETRA 4FS2A 4AL6A 1RACB 1EAYC 3DLLQ 1VJQA 2J9CA 5L8RC 3B78A 4KRWA 1O0PA 3RBXA 3DRPB 2V2QA 5GMEA 4DR5F 5LSLA 1XEZA 2HSEB 4L6V3 3VGUA 3OLBA 2IA0A 2F7VA 3C6TA 1Q81T 1S4FA 1QTNB 1RWXB 4DPTA 4PQUB 3FZBA 3SCIE 2JLFA 3CJ0A 1FD2A 5HO4A 1RT7A 1VISA 2HNDB 3DRXA 4IFVB 2V9WA 1GNKA 1HWKA 2UUBJ 4MJKA 2I8EA 1YJ9S 1FXDA 3KJVA 1HHQA 4EBEA 1F2HA 1NZAA 2H5EA 1QUVA 5GMDA 2GO8A 1JKHA 2WSFC 1CSJA 5FLXY 5MAOA 4M5GA 2UUTA 4YMEA 3J7YI 2ZH9A 1H2UX 1MWYA 3HPOA 3PW2A 2V2KA 2ASJA 1IUJA 2CADA 3I9V9 3M1VA 3MTKA 4EU0A 1XMBA 3KLFA 3KLHB 3KLIA 3FMWA 5D4PA 3W5ZA 1WG5A 4ECSA 2YNGA 3MHYA 2PMHA 3L95X 1ZM9A 2HQ3A 3A3PB 3MAHA 2E9RX 1S1UB 2YKNA 4HT7A 5E2QA 2IY5B 4IR1A 4OX8A 2GHPA 2C2KB 4ZPCA 2ACYA 3TP2A 5HMWA 2RQKA 5KFCA 4ALZA 3O2IA 4C0BA 2XMAA 3GQCA 3GJRB 2HFZA 4IH6A 4PCQA 2F4VF 2HBRB 2CPZA 2IC3A 2RF2B 1RTIB 4WE1B 5D4OA 3ZTPA 1REGX 1S1WA 2VB6A 1S1UA 3CJ8A 3FBBA 3UI3A 1SH3A 5KFWA 1WEXA 4FXVA 1KFSA 3IC1A 4L73A 3TEHB 5K8PA 1FJ7A 3OXGA 2R7OA 4DR4J 1HL6A 3QFWA 2CZ9A 5HMXA 3MPVA 4F50A 2M9KA 4LRFA 3Q22A 5AXKA 1T7PA 2AJ2A 3FCWA 3QJLA 1M5OC 3L4BC 1ZS6A 1IBMF 2W4DA 1LV5A 2JVOA 1WC0A 3HD2A 5ETKA 1NKBA 2FLOA 2MSTA 1JNZB 4LF7J 1FKPA 3LP0A 1JKHB 5H1SV 2DEIA 3CPWR 4LUBA 4EO6A 4Y65A 4OZ2A 4ERDA 2ZD1B 2QIFA 5D15A 3CD5A 4DX8H 4UOCA 1EQMA 2RB7A 2VG7B 3VF0B 4URGA 2FVSA 1WKLA 2KT5A 1YG0A 5BYRA 3W62A 4C0OC 2XYGB 1XNQF 1TL5A 1FWPA 2UUWA 4LR7A 2XMMA 4RW7A 2GJFA 2V8VA 1JLGB 2XMVA 4AUKA 4A8SA 1Q7LB 1FDNA 3DI6B 1NPKA 3N28A 5A8KB 2XBPA 2CYYA 3DRPA 5J1EB 4DF8A 1D9AA 2X1GA 5D77A 3BO2A 2E1CA 2E5LJ 4KJIA 1HNXJ 4USIA 4I6AA 1IKVA 1HKAA 3CCLS 3TANA 1JJCB 1FTCA 4NZ0A 5JXSA 3QZ7A 4BWMA 5KFUA 1RWNB 4DV5J 3V6KA 2XMUA 1GK8A 1VYAA 5DS7A 1B70B 3DMJB 2LQ9A 4KBIA 2H5IB 1RT5B 4PZVA 1M1GA 4HL9A 2V4QA 4ED2A 3GV8B 3RRGA 3CNQP 1XN9A 2HK2A 1X4AA 2N4CA 4USMA 1U1MA 2DIUA 4OHWA 1PC4A 3PACA 4MKBA 3SQGA 2PFFB 2G2YA 2MZ1A 3DM2B 2XLIA 3PVXA 3N5BA 4YHHJ 2VDHA 4P74A 3CCQS 1KSPA 3CCZA 5HBMA 2VA2A 3IFEA 3L7UA 4I7FA 5HATA 2VQFF 1NK9A 4CYUA 5A8RB 4LF8J 2PMWA 3OTEA 4LRDA 1YWXA 4O0NA 3WX8A 4ES3A 5GADU 4DFMA 2NXCA 3Q8QB 1VQ7S 4LF6J 4RW8B 4ZVEA 4DBQA 3UDVA 2BKOA 1JX4A 4ZVPB 4OI0A 1M5HA 2DGTA 2IJRA 4QW8A 4ZS6A 4DV1J 4A48A 1Q78A 1ZAWA 2QA2A 5IC6B 3MMAA 1ZTWA 1FVSA 5EWFA 1FCAA 5IM0B 2NQPA 2PD1A 3AD8C 5KFRA 4DPWA 1UTAA 2MZTA 4QBUA 2W01A 2F63A 4CP5A 5EX0A 3VV2B 3KK3A 2QA4S 2E1PA 2LQ5A 4HH0A 1JJ2R 4I0WA 4YS2A 1NHVA 1R8BA 2AT1B 4M63A 2I0XA 3VZHA 5BXIA 5CYJA 2BW7A 1S0OA 4OQJA 3QPIA 4DR3J 1FXLA 1QAXA 2DRBA 4G3IA 3C6UB 2P9GA 2Q3PA 2J6UA 3EPIA 2B8QA 2CZ4A 2QMUB 3FSYA 3KKFA 4OZ0A 4ZCMA 1NMEB 3OSNA 3LWLA 1TK5A 3FCVA 2V2VA 3CJKA 2IAJB 1B99A 4OJ3A 1JQGA 3M2UA 2CXEA 1T9TA 2V9KA 3UN3A 5DQGA 3W2VB 3ZXWA 4CRJA 1QAYA 2ZFHA 3KHRA 3VAHA 4LRCA 1FI4A 5F8JA 1HQEB 2YKOA 2FZGB 2GIFA 3PW5A 1VQ9S 3BH6B 5EX3A 3HVWA 4HI2A 4P7TA 3G87A 2VONA 2NYIA 3PX4A 1VK8A 3T1YJ 2NUUG 3IGVA 2PE8A 3BM7A 2JNJA 3T5KA 4N8NA 2YNHB 2HBYB 1KS2A 2P5VA 3GR0A 3NWRA 3KK2B 3EMTA 3JXOA 2LA6A 4K4SA 2CPIA 2BYCA 3R3TA 1NUEA 2J9EA 2M7SA 3RBEA 3HHDA 2DNHA 1QVGR 4IH7A 4FF3A 3OL9A 3HT0A 4DQQA 2ZVIA 1ZM3A 5DM7Q 5G0RB 5LSOA 5H9FK 3MM6B 4PKDB 1C0UA 2ZBCA 3C15B 4DV6F 5CYQA 4LVOP 3V5RA 1BMQB 5T7LA 3RRHA 1V5VA 2IBOA 1G2EA 3D1QA 3ENWA 5LSRA 4WCEQ 1BY9A 4YR2A 3SFGA 2YWGA 3M6VA 3MEDB 2RS2A 3J7Z5 4C4WA 1QY7A 3BSNA 1S9GB 7FDRA 1Y11A 1U45A 2E7WA 5HVGA 5M2UA 3Q89A 1QM9A 2WAQD 1JLBB 4GO7X 2OEKA 1T95A 3IAM9 2UV8A 1F5AA 1E6VB 1PILA 3GYXB 1V3RA 3RW7A 1BQMB 2D69A 2KM8C 3KHHA 2H65B 4P52A 4U8YA 2RDJA 4DV1F 4P2SA 4ECTA 3A12A 1WC3A 1YGYA 4F67A 2HNZB 1D0EA 4UZBA 4JI4F 4LF6F 2F9JA 1RT5A 5HQMA 2FC9A 4OMFG 3G6ES 3OV7A 4LF8F 2AJ1A 3IS9A 4CQ1A 4KKOA 4CDIA 4XIUA 2ZKTA 2IJNA 3H2VE 4LF9J 2RDDA 4RO0A 4TY8A 1NDLA 4J9KA 3UE2A 3JB9k 4R5PB 4Q8EA 3O1LA 2FD2A 4PWUA 2HAIA 3PR5B 4HR2A 4FF2A 1N6QA 4FYYB 2EBEA 3LGHA 1N0VC 3K8WA 4X64F 2Y8WA 5HQ8A 3E01B 4FNIA 4DV0J 1FKOA 3U27A 1TKXA 2YNFB 4CH7A 1WSVA 4C7QA 1WC1A 1U26A 4DV5F 5E33A 2F4VJ 2GAHC 2R2RA 2E66A 3EYZA 4PABA 2HHWA 1FA0A 1VRUA 5K8OA 1N5YA 3EZ5A 4LRAA 1N33J 5L1KA 2W9CB 2E5LF 4GKJJ 5F41A 3TAMA 2D3OR 1RBOB 2HGMA 4NI2A 2QV6A 4JI3J 1GQEA 4OYOA 2AYMA 4QOTA 3M7VA 4AXJA 2IPOB 1IKWA 1FE4A 2OPPA 1F5BA 3AAWB 3AODA 1FK9B 2RUSA 3DRSA 3OTBA 3VQTA 3C6TB 3OJSA 1F5CA 2XGQA 3LWMA 3V6DB 1BXNA 4RW6A 1QAJA 1XNQJ 3KLGA 2HHXA 3PZPA 1S12A 4DL5A 4KGZB 1H73A 4O4GB 4QU6A 3GFHA 1RAAB 4EMDA 3NAIA 1LNQA 2JH3A 4LF4F 1R8CA 3PM9A 1FDAA 2VPZB 1SJ1A 2VF3A 3HM9A 4DQSA 5J2NA 1NJIT 1M5SA 2CQ1A 1RJJA 4FPRA 5T7LB 2MLYA 3QGIA 3TRGA 1RT2A 4TU7A 4WP9A 3VAKA 4FYDA 3SIPB 2GAGC 2DIVA 3MPUB 4B3SJ 2C3MA 3ICLA 5DM6Q 1RISA 1NCLA 2XSJA 1WDTA 5A0YA 3V4IB 1X8DA 5B0DA 1NDPA 2XMTA 4ID8A 4B9NA 5B0EA 2ASLA 3OHBA 1F2GA 2Z57B 3IO1A 2VFTA 2GGPB 1HHSA 3K7RA 4RW4B 5KFDA 1N48A 4HACA 1P1LA 1S9EA 1U6FA 4F4KA 1RCOB 1K1QA 2PEBA 2MB0B 3I55S 4NLOA 3MOJB 4USKA 5A8WA 1XWLA 2LYVA 4MMOA 3K89A 4AL5A 3MM8B 3BQ0A 2RE1A 5J1NA 2XY5A 5KT2A 1NNDA 4J91A 2IYGA 3PXGa 2ALYB 1EETA 1MLAA 4N5SA 2CJKA 1GMUA 2RDIA 3PG9A 5LOQA 4MK8A 1LK5A 3QT5A 1D09B 2O66A 4DF4A 4DX7A 2HVIA 2YWFA 2AX1A 2GJ2A 1AXQA 3IM9A 3T5LA 4BDPA 2ZZNA 1P27B 4QIVA 3P49B 1L5UA 1B4SA 3I82A 2XM3A 4HH1A 4YEAA 2MHEA 3IXQA 3Q2TC 4C8OA 1K0VA 2AHOB 5L9NA 4W98A 3FFIA 2CPFA 2XLKA 1RZMA 3R6LB 2OPQB 5E0OA 5ETLA 4NOHA 3SEOA 3WHIA 1HWIA 4RU2A 3IA0A 2XGPA 3POTA 4H4MA 3UN2A 1SC3B 3OW2R 4OI1A 1XIQA 2MXYA 1L3TA 4JV1A 1NH7A 3TQEA 1W26A 4TN2A 4TLRA 3LF0A 1VGYA 2WONB 4R25A 4YR0A 1VC5A 2M3DA 4QR0A 4B08A 4DCPB 3KLEA 1UPMB 3MEEB 1NJWA 2DO0A 3Q83A 3KOAA 4DS5A 3BKUA 4HACB 2F3JA 3RW6A 3BGRB 2POKA 2PT0A 3LAMA 3ZNJ1 3I0SA 1AT1B 2GIRA 3JTNA 3MMBB 1HNIB 5KG1A 4F0KA 5BR8F 3SZ2A 4LBHA 4BCAA 1AA1B 1G6BA 4K4ZA 3NRBA 4DI6A 4MIAA 4RW9A 3CTRA 1HNWF 2KZMA 2Z2MA 2P2CB 4KO0B 1J27A 1N5SA 3DU6A 4TY9A 3RRKA 4I4BA 3W9JA 3MR3A 1DBDA 3HLUA 2G2OA 3DMJA 3R5BA 3NEKA 4TNOA 1CC8A 1Q7YT 2AYBA 3ZO7A 3MMBA 1WJ9A 1T9WA 1VQPS 1YIJS 3PYGA 2DNMA 2W2OP 5K9FA 3Q8SB 2FJVA 3DLEA 3BH7B 2YX1A 4ZPAA 1IBCB 1ZAVA 3N0VA 3TVYA 2L08A 3MM5A 3TEGA 4USVA 3J7YU 1J5OA 3CC7S 2B4OA 3IG1B 4RBTA 2HLUA 1HI8A 4C97A 1KR4A 3M4XA 1PKUA 3OR2A 2DR7A 1Q5YA 3S8SA 4ILLA 3KUGA 1SL2A 2H48B 4LJMA 4F8RA 3OVAA 5IC4B 4NCGA 4IG3B 3M8PB 4CLPA 5DG9A 2FGCA 5U47A 3ZTOA 4CTAA 1M90T 1FK9A 3NS5A 3M05A 1H98A 2E1AA 3JTPA 5KFBA 3VAIA 4OYXA 2P9CA 5C24A 2V0NA 4XAKA 4NA2A 4O4GA 4AE5A 1RHQB 4A47A 4B17A 2NYHA 4H4KA 4QW9A 2QC3A 2MZRA 3THVA 4M5DB 5LMNF 3FCHA 3D28A 4ID5A 4ITSA 4X84A 1CLFA 4IUFA 1IR1A 3AB4B 1VDHA 4MAKA 5C42A 3SSRA 4FS1A 4JI7J 4JI5F 4OX9F 4JI2F 4JI0F 2BMBA 1MG7A 2YY3A 2NXNA 2BKPA 4CLZA 2OKQA 2DXDA 2KYZA 3E8OA 3L9ZA 3RGIA 1SKWA 3WC2A 1NEEA 2EXUA 2AX0A 2CQ4A 1NKEA 4LF5F 1KTVA 2F8HA 2Y1JA 1RAIB 1R89A 2FYXA 1WUUA 4M8LA 1ZBTA 3MR2A 4C6AA 2DY9A 5HMYA 3MR5A 4F02A 4X4UA 2D9OA 1SH2A 4P2FA 5EHHA 2L41A 4OHXA 1RT2B 1S76D 2VODA 2LLZA 5DO2A 4WFNQ 1JLFB 3K0JA 1S6UA 4C8ZA 5DGBA 1AUSL 1F0XA 1VJWA 3OFFA 4I67A 1XK8A 1P8GA 2EG1A 2C2EA 1HQUA 2AMCB 1SC4B 4MYUA 1JLCB 2IC3B 2RF2A 3NS6A 1IKVB 1BGXT 4YQWA 1K73T 2VFVA 1ICEB 4HLBA 4RNFA 4CI0B 1FRLA 1RQ0A 4M5HA 3KLFB 2F5GA 1YRUA 2B43A 2CPDA 3KLIB 2JJ4D 4C2MA 1N32J 4ED6A 4QYZJ 4DQRA 1LXNA 1K44A 3WIVA 1VRQC 2C3OA 4A8MP 2FHKA 1TL3B 1SKRA 3KUHA 4C3MA 3ILIA 3TA1A 2KXNB 5JVGQ 4DUTA 1FKPB 5JVHQ 2CWXA 4EZ9A 1RBAA 3GYGA 3JYTA 3KDNA 2V69A 4WJBA 2LEBA 1JK9B 1R8AA 2HQDA 1IBLJ 4IFVA 2ZD1A 2LECA 3LO3A 4WXOA 2FJWA 2UXDJ 1S9FA 1WACA 5GMKa 3T1HJ 3I31A 2A2DA 1URRA 2HGLA 4M5DA 1YHQS 4ETZA 1T03A 1XNRJ 2CJQA 2WVFA 1GXLA 3TA2A 4CM0A 5CZVA 3NAHA 5DLGA 3KG0A 1WELA 1RHJB 2DH7A 1U2CA 2DBBA 4J9NA 2MGZA 5HL7Q 1SI9A 5KTQA 1OWXA 3DC2A 5K8NA 1VQKS 2O1PA 2B7CB 1RA7A 4LQ9A 4QIEA 4MKYA 4UY85 4O4RA 3I0RB 2HFVA 3MR7A 3R5JB 5GADI 3BN4A 2WTFA 2BQUA 3DDIA 1UWBA 3LP1B 5A6WA 4ZK7M 4D3GA 1FVQA 1SUQB 3GIRA 2DNNA 3LGNA 2BANB 2RVJA 1SPBP 4OHVA 2DR5A 2I9SA 1ZPWX 5AE3A 4ECUA 3TJAA 5KFAA 3MM9A 2ZZTA 1R31A 4UY8T 4IFYB 3QRRA 1I51B 2CQBA 3WIUA 4ZVQB 1RTHA 3C3LA 1N32F 1ZTTA 3CJ3A 5JUMA 4DSFA 1KHVA 1YJ7A 4X4QA 1IBMJ 4QYZK 2EPIA 3TUZC 2KFNA 1FRIA 3CJ2A 4X66J 2P6SA 2P6TA 4C98A 3D2WA 2F1FA 1CJTA 2GHWA 1FRHA 2B4VA 2UUCJ 2ZH4A 2YX4A 4OZ5A 1V3ZA 1X4BA 4RWWA 3GIMA 3MUMP 2PA3A 1S1TA 5HMZA 1NPRA 2JRSA 1BQNA 1RLDA 2L9NA 1Y9OA 3D6TB 3N79A 2PN6A 2GMLA 5KFLA 1RT1B 4JV5J 3V2UC 4KE5A 2YWEA 5M2PA 4DL2A 1OMSA 3P3DA 4H54A 4X4NA 4NMLA 1CS4B 4XDDA 2RU3A 1ZOTA 3OFHA 3OR2B 3DHWC 3I56S 1SXLA 2WB1D 3ZTRA 4PUOA 1UMJA 1QD1A 4HDGA 2ZOFA 2HFNA 3BSOA 3LANA 2HVDA 2OPQA 2R8JA 2AYEA 3H4BA 2OD4A 3C16B 4JI5J 5G0RA 4E98A 5J1PA 1X4DA 2OSQA 4IO9Q 4AD6A 2H5JB 4X62J 4K50A 2HHHF 1OIAA 1RA6A 1GMWA 4Q5VA 2G4BA 1MWZA 4L76A 2Z58B 2Y8YA 1HI0P 4NXNF 2VG5A 1MN9A 4B3OB 1RADB 3G86A 1RAHB 1XERA 1VHIA 1RT4A 3A8EA 3FEXB 3GFYA 3PFOA 4J90A 4OI2A 3NS7B 4NWBA 3G8SA 2QLFB 4MH8A 3OL8A 4EFAC 3CMAS 3PW4A 2COLA 5DQHA 2V67A 2NPIA 1EKRA 2DISA 5KG2A 4KO0A 2R42A 1X0FA 1XMQJ 5EDWA 3CCWA 3NWGA 2YVSA 1FDDA 1KP6A 4KSEB 1NSQA 4ZIWA 3G4SS 2CPHA 1KDNA 1MN7A 4I2QB 4M5JA 4NXMF 3QZ8A 2MZSA 5ETPA 3W2VA 1MMDA 2CQDA 4A8XA 3RAXA 1TZ0A 1CVJA 5HP1B 1NK7A 2FHMA 3EDRB 3K5MA 3HSJA 3LGMA 2XZWA 3BR9A 1HW9A 1RHRB 4J9LA 4PUOB 1UVLA 2E9TA 2GVZA 2QJ3A 2HRYA 3M8RA 3JSYA 3DYAB 4KFBA 2DR9A 3J81j 2BEFA 1X4FA 1HMVA 1KWMA 2DTJA 3HFVA 2IM3A 4FVMA 1YBTA 1WG4A 2DHGA 2XI2A 3I32A 3UVJA 5BR8J 1F9HA 1NJYA 2H54B 3IGNA 5IM0A 2DNGA 3GCWP 2XY6A 4L74A 3Q23A 2B6AB 2CIMA 3H40A 4KPYA 4NA3A 4NLPA 2BDPA 2HAFA 5KFIA 5KFNA 2C42A 2CQ3A 2ZNYA 4J5OA 4EO8A 5BJRA 3KNAA 2BA9A 2RMLA 4MFBB 3DRSB 4MT1A 2IVMA 2MMYA 1DARA 1S1TB 5E3PA 1C1CA 3R97A 5F9NA 5HLFA 4F3OA 4EZ6A 1MU2A 4C3LA 3EX7B 1QUPA 1UWAA 1WDDA 1YJWS 2Y9HA 2EC0A 3V81A 1RUSA 2DO4A 3QGHA 4G1IA 4KQZA 2O67A 4KGXB 2KTQA 1WF1A 4NLTA 3RB4A 1OY9A 1HPZA 2FJBB 1L3VA 2M8HA 4DHVA 1VCTA 3NBPB 2FJAB 1OPZA 4TQSA 1VQ4S 4XO0A 2JEJA 4Q8FA 4KTQA 2DHAA 3KK1B 1KFDA 5E3QA 2ZUAA 2VOPA 1SJRA 3LOUA 4Q7AA 4X4VA 2WCXA 4WK1A 5L39A 2E5GA 3ETMA 3CJTA 3J81Y 4DV7F 3TUPA 3MDFA 2ZOGA 3R8YA 1YI2S 4B3MJ 3JQKA 3BB5A 3BPSP 1HQUB 4JI8F 2EFPA 3NGUA 2NXUA 1HBOB 3NCQA 1LXJA 1C2PA 3DGPA 5ETMA 4WFXA 1FFGB 1XJWB 2YNGB 2CQGA 3N6NA 1TKTB 3JAMY 1MW7A 3HDSA 1YK9A 1NK4A 1VFJA 1H3DA 3CCTA 3UCGA 2DGQA 2N7CA 3KJNB 1GX5A 2GS8A 3FQKA 3ISND 4DPXA 3KTQA 1ZAXA 3OTDA 2KG0A 3UFCX 2CDRB 2XSFA 4B3RF 2WBMA 1ITPA 5F0WA 2KVIA 3NP5A 4WZMA 3P8BB 1JIHA 4B3SF 4O23A 2CAJA 1UJ4A 2G13A 4Q0BB 2E5HA 1BLUA 3TARA 1NAQA 4NLUA 2JZ5A 4WIIA 3AD7C 5A8WB 1W25A 4QPTA 3O44A 1A7GE 3ZZUA 2RKIB 2CPJA 2L9WA 3C15A 3EDQB 4RPFA 4LF4J 1U49A 1NB2A 2R2TA 1TFYA 2XQCA 1CPZA 2HNDA 1Q53A 2KRRA 3OXLA 3WC0A 1UL3A 1U1PA 4BC7A 4OJ1A 4EUVA 1A6LA 1RU1A 1B64A 1OO0B 3O8WA 1S99A 1UVIA 4DUYF 1C0UB 4U6PA 2XHCA 2E9ZA 2HNYB 2WBRA 2J76E 2ZH1A 2OTLS 4EI2A 2UU9F 3I4PA 2HFOA 5ETQA 5MLCV 3RB6A 4JI3F 1T9YA 5K8MA 2F40A 5KG7A 2R7SA 1S57A 4O44A 4KHPJ 4ZVFA 2ACMA 5FD1A 2ROPA 4L75A 2B7BB 3OFEA 3TVKA 5IQ6A 4QQBA 2KFYA 3HJFA 4GKJF 3GR1A 4TY8B 5A76A 2CNOB 4ZVTB 3SDEB 4B9VA 3QWUA 1IVZA 2XS7A 2VBXA 2R2UA 4WP8A 3WQPA 1R0AB 1XR7A 2UVVA 2YKNB 4QR2A 2W7PA 4U7UK 4NLSA 2MKIA 1PJ6A 3IP0A 4HHHA 4F3MA 4CO0A 2IDLA 2PEHA 4IG0A 1EQ0A 4LMZA 3HFZB 3TYTA 1RDRA 3CW2C 2PFDA 3ZZPA 4F7VA 4DN0A 5KFPA 1SC6A 1M5VC 1DTQB 1SCJB 1HIYA 4QWBA 3E3XA 2Y0BB 4Y34A 2IHR1 5KFGA 4HEA9 3TNVA 3UWTA 5I3QA 2W9CA 1S4EA 2ILYA 3CIZA 4OZJA 3W65A 5IV3A 4PWDB 3OBIA 3UD5A 2B8PA 3M8ZA 2MEWA 3ISNC 3DNCA 4RBVA 1B7YB 1D9FA 2ZJRQ 4JI4J 3FBEA 4HHUA 4IG3A 4P2MA 3D66A 3UVJB 4EGLA 1VQMS 3AJ1A 4LFBF 1JLEA 3BKFA 4CO1A 2DCLA 1XMQF 2B6AA 1EX8A 1RHMB 2ROGA 1SB6A 3AQPA 5F8HA 4RW8A 2C1EB 3TZXA 1BE4A 3FJ2A 1TKZA 4HDHA 3M8PA 2QLXA 2M0GB 1KEKA 4J9UE 3H4DA 1Q8BA 1R3NA 4GVLA 3FRZA 1P9QC 1WI6A 4NXNJ 1EETB 2IJFA 2CJAA 2VKRA 2RIJA 3BSAA 4S0MA 5KT5A 3EXYA 2W9BB 4DV3J 1IQTA 3PEJA 2B9EA 3HHEA 2V4RA 3T6BA 3QSYB 2E1RA 3T9NA 2XYPB 1J5EJ 2KDOA 4PXBA 4DV6J 1X5OA 4ZIVA 3PR4A 3GV5B 2VOOA 2BV3A 3CJQA 1W7WA 4RW9B 3RG6A 2D1CA 3W8PA 4CIOA 4OJGA 4H4OB 3KK1A 4JV0A 2LEPA 2O01C 3MMCB 2UVWA 2OFGX 4CLTA 2KM8B 4OYZA 1UJ5A 3M2UB 4IFYA 3S6EA 2BM1A 1X9SA 2OJ3A 4TU8A 4DFPA 2HYIB 2V8HA 3FDSA 1BD6A 2OTJS 5KFXA 2CFXA 2HFSA 4XDCA 3ILLA 2HHPA 3EVWA 5KFFA 4RUBA 1S97A 5AE1A 1RT3B 4TQRA 4WU3A 2UUCF 4A8FA 1RAGB 3D3BJ 1BWEA 1PIEA 1NRKA 1U0HB 3G82A 4I56A 4KYZA 5J2PB 1BQNB 5IWAF 2QE5A 2H51B 4ZLPA 3AJDA 2HW3A 3IG1A 3BYRA 3UNYA 4P6QA 2J6TA 5LJ3Y 5CA5A 3AOBA 4B3TJ 2J0QD 3FFIB 4CT8A 5GAHI 1H7XA 2VPWB 2J8AA 3HK2A 2MQLA 2F4FA 1HNZJ 2QG9B 4CLLA 4DZ6A 5D6GA 7AT1B 2R7RA 2W25A 1IN0A 1WORA 2DITA 3HSZA 2MQQA 2QMWA 4N41A 4F2SA 2E7VA 2GVDB 2LEAA 3R2DJ 5LMUJ 2BOPA 4X65F 5KOXA 3R1HA 5AXMA 1FJGJ 1W2BR 2HRUA 4AFFA 3HHLC 1CJUB 1NSPA 4FYXB 1C4CA 2EFNA 3BGRA 1KQFB 3FSIA 2HWTA 5K20B 3OD2A 3D1HA 2X1AA 2WSEC 2M70A 5DJBA 2ZH7A 2IAJA 2PDAA 2XLJA 2XNRA 2MZJA 3Q0AA 3BJYA 2MGZB 2W4PA 1Y3KA 1FNOA 2A0FB 3TR5A 1XNRF 1NM2A 2YXLA 3F41A 4USUA 4WFAQ 4PG8A 5DDRC 1RAFB 2BJ3A 4H4MB 1IBLF 4B9MA 4YDXA 4DR2F 3K8VA 1F3VA 2AP6A 3PEHA 4WU2A 3PJ9A 5D78A 4FKXA 2XHWA 1Q8KA 3LP2B 2YWHA 4AT1B 2LQ8A 2M88A 2Z30B 3DLJA 2J0XA 3GYNA 2N4DA 3IRXA 3P45B 5J2QB 4M95A 1N5QA 2QLBB 5A8KA 5J1EA 5I42B 2WVEA 2VQEF 4OL8A 3SMZA 3RB0A 5KG3A 3GG0A 2ZH2A 3M6XA 1OS5A 4O0IA 1BC6A 3TZYA 1I6JA 1YJUA 1YVFA 1R7IA 1SJQA 1CJVB 3DOLA 4UOFA 4UUXA 2Z0GA 4RX6A 4QWEA 2PI5A 1WHWA 2GW8A 3ZNUA 4KAIA 3J81U 1CQMA 5ETNA 2CQCA 1HI1A 2IYIA 1S7HA 1VIOA 2RKIA 2YNFA 1IQZA 1NLKL 4FF1A 2JVRA 3EVOA 3GCXP 4OYWA 1JLCA 4QPXA 5DG8A 2DHSA 5C7PA 2AF6A 1CJVA 2RQMA 4Y3CA 2IMWP 5IV4A 2KKHA 1UPPA 3EM1A 3ZC4A 4IOCQ 1RXOB 3JYTB 4WFBQ 3CO9A 2JLEA 3M8QA 2R3VA 5FDLB 3TZWA 1GT8A 1UEKA 3MECB 4NLVA 1EKSA 3RBDA 1EB0A 1L3SA 1JXVA 2G9OA 4LSNA 2R8KA 1KOOA 1N88A 2MQNA 2EFVA 4CLUA 4DV2F 1D8ZA 1B0PA 1U6ZA 2BOAA 1RTHB 2XMJA 2HEKA 3ONQA 4DPOA 8ATCB 2DGOA 4MYTA 3UW1A 2UVUA 5HAOA 1U4BA 3CDEA 1DJ0A 4ZLLA 2W2MP 1TUWA 1FX2A 3BN7A 2U1AA 2Y1LB 5FDLA 4UT4A 2NSCA 2AGQA 5EWEA 1JLFA 5AJ3F 1N0UA 4TLQA 1UEVA 4M1KA 3H2LA 2V68A 3IWLA 2ZWOA 3DXSX 2YNHA 1T9UA 3K5PA 5C2GA 5JJBA 3KK2A 1R0AA 1LOUA 1X4GA 1Q16B 1FESA 2M8DB 2PMZD 2BZ2A 2P8IA 4ZPVR 3W61A 3AB2B 3UNGC 1FE0A 3A4TA 4DR4F 3Q86A 4C8YA 2M5YA 5DDQC 3MI7X 3N4WA 1H6KX 1G4CA 2GX8A 2K3KA 1C4AA 4ER8A 4FBTA 2R2SA 4IOAQ 3ET6A 1U1RA 3CEDA 1WG1A 3CCVS
chains in the Genus database with same CATH topology
1GXTA 2BRLA 1YTYA 2B5JB 3FQLA 4WYWA 2EW9A 4A8WA 2CG4A 4EBCA 3CDAA 4N76A 3MXHP 1YRXA 4FN5A 4X4PA 1HHTP 3S7RA 4Q44A 2LMIA 2AW0A 1TL3A 2D3ZA 1VRTB 4ED0A 1SV5B 2MQMA 4PXCA 1N56A 3OJUA 5HI7A 3DYAA 4KFBB 3PKMA 3A1YG 3SSQA 1TK8A 4K4WA 3OVBA 3TX8A 3DLKB 2JOQA 3ZZRA 3SYZA 4DR7F 1MMNA 1U7LA 2AJ0A 2B3TB 5CYQB 2G1DA 1RTJB 2WOMA 1KLMA 2UUBF 1QVFR 3CD0A 3IS9B 3PV8A 4O3SA 2NZ4A 1HPZB 2DCUB 4TKTA 1Q1KA 4PG6A 3OTCA 2GQCA 4ED8A 2VD3A 5KG4A 5HP1A 3KLHA 1KD1T 1T3NA 4A8OA 4W92B 2JEIA 1HQEA 3RAQA 2JDJA 2KJWA 3VTIA 3NMRA 4CO3A 2I2YA 2EFQA 3DXBA 3I87A 4RZRA 4K4YA 3AA8A 4N8OA 4YB5A 1LW2B 3TUIC 1S9GA 1TL1B 3P6YC 3DDKA 4CO4A 2J6SA 3G96A 3HI9A 5KFYA 4KHMA 2ZNZA 2R7WA 4NLDA 4NYOA 3G6VA 3NNCA 2HHVA 2W4CA 2FUG9 3VAMA 3HXMA 4PPZA 2ZE2B 2KRBA 1JXLA 2LKZA 4RBUA 1S6QA 4QYRA 4IOBA 4K5SA 3IWNC 1V6HA 3CVKA 4L3NA 4Y2MA 3MTJA 4IRDA 2CQ0A 3CSKA 2KHCA 1RWUA 5CXTA 5GAEI 5DG7A 3MR6A 4Y2KA 4OLPA 4ED7A 4ATNA 4HKQA 3Q24A 2X51A 1JB0C 2ZDOA 4ZPTR 3MMAB 4IKAA 1VMBA 2KI2A 3TAMB 3N01A 5KFMA 4QCLA 2AJQA 2FVPA 4C11B 1IKXB 2VG6A 3QLHB 1REVB 4HI1A 1S1XA 3NCPA 2Z2LA 2AWZA 4ZMMA 5KT7A 4KC5A 2W8KA 2WONA 1XR6A 1T05B 4DDFA 2JC0A 2RRAA 3W7BA 4DL6A 4DL0C 4R0JA 3UDLA 3DFEA 2FPHX 4YB6A 5D4NA 1P1TA 4MK9A 4P7VA 5CQGA 2WW8A 3H5UA 3TI0A 1N33F 4KKOB 4ED1A 2OPSB 1ZM2A 5DRKA 3SXLA 1FRJA 3OUYA 3OSPA 1JLAB 4I2PB 1VBYA 5A6PA 1DHMA 1ZPVA 1X9WA 4EBDA 1SJ4P 2EK1A 1DRZA 1N36F 4B9UA 1Y5IB 1DTQA 2K2PA 1VQ8S 4BHQA 1Y4ZB 2HGNA 2CJBA 4ICLA 4F4WA 3CMES 3TUJC 2B5JA 1H2VZ 1RI7A 2W7OA 5BYSA 4RU9A 2DGSA 6FDRA 2GJIA 4E8UA 1FEHA 3VR1A 3IN5A 2R8IA 4DR1F 4Y28C 2Q6BA 5KFHA 1N6QB 2JC1A 3UD3P 1DLOA 3T9ZA 5F9LA 3MEGA 1R43A 3QGGA 2JWNA 1UAWA 1QSSA 2K1RA 1TKXB 2QEXS 2KG1A 1VBXA 4QIGA 3H59A 4DL3A 2CZVC 1D3WA 3ISZA 2R9LA 3GMGA 4QWAA 1UP1A 2V4JA 4O3RA 2L3MA 2R7UA 3V6JA 4ZOSA 1FRKA 2OPRB 3UCZP 4K4TA 3CJ4A 3PY8A 1FJGF 5B0AA 1X0PA 3IR5B 3BGLA 3CCMS 2Y1RI 3QJPA 2JFKA 4CO2A 2RUGA 2HNYA 4RNHA 3IRWP 2ZJPQ 2RNEA 1HNZF 4ECVA 1S0VA 1OSDA 3NGDA 3DLBA 2DD8S 5KT6A 3THPA 3NNHA 1LWFA 4UW2A 3QLHA 3W3SA 4FZVA 3NBPA 4X4TA 5AXNA 3MUVP 2J7UA 3J7A1 1QJHA 4UQGA 3HVAA 2HS0A 4IDKB 4UQTA 3GILA 1TK0A 2GMHA 4ICLB 1TL4A 2RD5C 1W2IA 4RUAA 1ELOA 3L7OA 1N5TA 3T1AA 5J2MB 3C66A 3Q8PB 1U8SA 3PNIA 5KAKA 5CH7B 1NJXA 1Y5LB 2HWIA 4QJVA 2CQ2A 2HQIA 1U1KA 2OPSA 4Y2IA 2GQQA 2H9ZA 3FVYA 4NYPA 4KV8B 2XI3A 1OQ6A 5K5MA 2C2RA 1PGZA 1UVNA 2R7TA 2C28A 1FERA 4WFYA 4J37A 1J5OB 2GFFA 3NNAA 3QAUA 3UR0A 1J5EF 3H20A 3KMQA 1ZYQA 3BZQA 3NGKA 3US5A 4EWTA 3QIPA 2BJEA 5KFQA 2GHVC 4B9LA 5GVQA 3QGPA 1T05A 3PW0A 4DR3F 3DRRB 2B56A 1BQXA 3MM7A 3BR8A 4HTJA 1SH0A 2QSFA 5F8LA 4J9OA 5GAHU 4B3OA 2KXHA 3DRRA 4ZP6A 3CJKB 4BC9A 2NSBA 5KT3A 3I4HX 1JJ4A 2AYGA 1X4HA 3LH2S 1RYSA 5C42B 5DETA 3PRBA 5J2PA 1KTQA 2Q66A 2EFGA 3K57A 4I1TA 2IRYA 4ELUA 4NLRA 1VQ5S 4FXWA 4DSEA 5HROB 1N54B 3OUYB 3CT9A 4HHJA 4WZQA 5IS2A 2ZOMA 1S6QB 1RK8A 4RLEA 2KB2A 1S10A 1HWJA 1LWEA 3SCKE 3GIIA 4NCGB 2BQ3A 5KFJA 3D54A 3GWCA 1M1KT 3I5CA 2D41A 2ZM6F 2RSQA 2ZHAA 1OQ3A 2N82B 4WF9Q 5CD4H 1R8HA 4ZVHA 4C8OA 3V4MA 1FHTA 4NLYA 3MM5B 3T3FA 3CUNA 4QWDA 4Y0FA 3OVSA 2QRRA 1ULRA 2B51A 2VH7A 3I9ZA 2MSSA 3LP0B 4Y00A 1Q86T 1G3OA 1S9EB 1IKXA 4ETXA 2IFXA 2PSZA 5C25A 2I1RA 2AJ4A 2ZH5A 2UVRA 4OZNA 3M2RA 2G0CA 2ASDA 3G71S 1IJFB 3OXFA 1OPIA 4ECRA 2EG2A 1TQLA 1VS3A 2W9BA 2LXUA 1ZETA 3LPYA 2FJDB 2K3IA 5IQQA 2EVZA 4N77A 4PG7A 3T5HA 3HMJG 1TKZB 2EK6A 3M9NB 2R7XA 5J2NB 2LXFA 1JMTA 2R4FA 3KFWX 2NPFA 3CCSS 2BANA 2YKAA 1U25A 4BBYA 1ZH5A 3KG4A 2RRNA 4GC7A 4FVCA 3CDBA 3OQ2A 1KQKA 4ZCIA 5EGYA 2LU2A 2OAUA 4ZCLA 3HVTA 2OD6A 3TOQA 2LQBA 4OX7A 4URQU 3HVRA 4KGKA 4PG5A 3HX9A 2VFUA 4IDKA 4X4SA 2P9EA 4DFJA 3MD3A 2GQ2A 5KFVA 2E44A 3IR6B 1NK8A 3VAFA 2DB1A 1K1SA 5A8RA 1TKDA 5D8HB 3S1TA 2QT7A 1SL1A 3G6YA 2KHDA 3UCUP 1Q79A 1U2FA 1U2RA 3EGWB 1KQSR 4B02A 3AQOA 1X4CA 2AGPA 2DVIA 1R6YA 1RTIA 2WOMB 2IVYA 1LFWA 2KT2A 2QMXA 1VI7A 3I0RA 3CULA 1TAUA 3QO9A 3QIPB 3VWSA 5FJ4A 1HD1A 5G4DA 1NHUA 3U1NA 4A8YA 4DSLA 1VQNS 5LXRA 2I5JB 3B4MA 2XCPA 1YQHA 4HYKA 3ENVA 4J9RA 3DHXA 1FDBA 2KN4A 2OP5A 3N6LA 1KRPA 3SCLE 2AV5A 3H2UB 2BW2A 2RQ4A 2GO9A 3L09A 7FD1A 4BWJA 3H5YA 1TVRB 3FRYA 3HZEA 3CCVS 3ZZ0A 3AY0A 3BO3A 1RT7B 1WWHA 3PKYA 1FJCA 3T19A 3CB4A 2HS3A 2BXJA 1FRMA 3CXCR 2FVQA 1JLQB 1UKUA 1RAJA 5K14B 2ZITA 2PC6A 5E3RA 2J0SD 2VA3A 2DJWA 3EPGA 5L1JA 5J2QA 4XPCA 2ADCA 1S72S 1AROP 1SBRA 4M94A 1MROB 4NPOA 2BUNA 2FLLA 3VALA 4IRCA 2DNRA 2YH1A 1ZM4A 1AFIA 3PJXA 1HBNB 3ENQA 3IRXB 2AJFE 2JFDA 5L38A 4CTAB 2Z8QA 2HHQA 3LAKA 3QO9B 3DLGB 1TFWA 1U1LA 1UA0A 2J7WA 1HMVB 4WFZA 2Q1LA 1HYSA 5CCLA 3MM6A 2V8GA 2I5JA 4DV4F 3CCUS 4WE1A 2VPXB 2JHEA 4ZPDA 4DWIA 1S6PB 2CQIA 2ZBIA 2FTRA 5DQIA 1SJFA 1YJVA 2YX7A 3TW0A 4F4YA 2C22A 2WB4A 3M1VB 2ASYA 1C1CB 4PPDA