5LSLA

Crystal structure of yeast hsh49p in complex with cus1p binding domain.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein HSH49
publication title Crystal structure of U2 snRNP SF3b components: Hsh49p in complex with Cus1p-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding domain
total genus 21
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lslA00
2X1GA 1NJIT 3R1HA 5CXTA 3MXHP 4YUDA 1X4FA 1P27B 5D77A 3MUMP 4CQ1A 1D8ZA 2CPZA 2J76E 3I56S 2GHPA 4TLQA 3P3DA 4V19X 2JVOA 2MGZB 4CH1A 2J0QD 2MQMA 3CCRS 1YHQS 2M9KA 3RW6A 2U1AA 2XSFA 2VOOA 2DGTA 3Q2SC 4TU8A 1OPIA 1X4DA 1X4EA 4UQTA 2KG0A 3US5A 3ZZYA 3H2VE 3S8SA 4WCEQ 2K3KA 3MI7X 1X0FA 1U1MA 1M5PC 1S79A 2MGZA 2X1FA 2MJNA 2DK2A 1QM9A 3MURP 2F9DA 4TU9A 4CH0S 1X5OA 3FEXB 5GAEU 4W90B 4F25A 2U2FA 2M2BA 2G0CA 1U1QA 2DGVA 1KOOA 2FC9A 2EK1A 1UP1A 3U1MA 2YH0A 2HZCA 1X4HA 2MMYA 1VQ4S 2XNRA 3PIOQ 2JRSA 2AYEA 3TP2A 1JJHA 2QFJA 1VQ9S 2EVZA 1VQOS 3I55S 2DHAA 5LXYA 2MHNA 3U1LA 1WF1A 4WIIA 2DO0A 1U1NA 2DHXA 1FNXH 2MSTA 4Y0FA 1VBZA 1FT8A 5D78A 4WFNQ 5GADU 1VBYA 4LIRA 2CQ1A 2DIUA 5MLCV 2RVJA 1ZZNA 2DGWA 2O3DA 3BO3A 2JX2A 2XS2A 4YOEA 1L3KA 2ERRA 2MY7A 4WFBQ 3CC2S 4LJMA 1U1RA 1YITS 4FXVA 5LSLA 2HYIB 1NO8A 1X5TA 5GAGU 3D2WA 2KU7A 3VAFA 2LEBA 1VQLS 2DHSA 2MZTA 4OZ1A 1KQSR 4EGLA 2MZ1A 3MUVP 1UW4A 5IM0A 3SDEA 2MZQA 5HL7Q 3UCZP 2CPYA 1U2FA 2LMIA 2N7CA 2M88A 1U6FA 1Q86T 1A9NB 1ZZFA 2CPHA 2L08A 2JWNA 1WI8A 3L3CA 3CCQS 1SJQA 2E44A 1H2UX 2MQNA 2KRBA 2DNNA 2LA4A 5H1SV 1WF2A 2CQIA 3CCVS 2CQPA 3SMZA 1KC8T 2DGQA 2KYXA 1UFWA 2Q79A 5GVQA 2KH9A 4PR6A 2M70A 1WHWA 2CQHA 1KOHA 2B0GA 3VAGA 3FEYB 2LKZA 1X4GA 1WEZA 2HGNA 5LJ5Y 2LQ5A 3J7ZT 2MKKA 2RRAA 2KI2A 2MQPA 5DDPC 3HI9A 2KRRA 1H2TZ 2F3JA 2CQGA 3J7YU 2X1BA 1HD0A 2MZJA 1WG4A 5JVHQ 3ZZZA 1VC6A 2N82B 1F9FA 4ED5A 2CPIA 1O0PA 2RQ4A 2MJUA 3NS6A 2DITA 2MQOA 2AYMA 2F9JA 3VAIA 1VQ8S 4IO9Q 4BS2A 2LCWA 1FO1A 2I38A 3LPYA 3NS5A 2XNQA 3MD1A 2VOPA 1OIAA 5EN1A 5BJRA 2CQ4A 2DNHA 2UP1A 2PE8A 3VAMA 2YH1A 3G71S 4ZKAA 1JMTA 3JB9k 1X5PA 2RT3A 2MYFA 1VC0A 2QA4S 1YIJS 2E5GA 5DM6Q 2KVIA 2CQ0A 3THTA 3THPA 3CCJS 3CCLS 1YJ9S 2G4BA 3CPWR 2LECA 3CCSS 4Z2XA 1WHYA 1WF0A 2V94A 3TO8A 3G8SA 5DDQC 2HGMA 1WEYA 1R8PA 1SXLA 2CQCA 2I2YA 1YJWS 3B4DA 2KM8C 2DGUA 1QVFR 3CUNA 1VQNS 2CQ2A 1YI2S 1VQ7S 2ADBA 2RU3A 2M0GB 2DNRA 2CJKA 2XS5A 1VQMS 5DDOC 1U1KA 3CC7S 2CQBA 1WG1A 1RKJA 1H2VZ 2A3JA 4PKDB 2DNLA 1DRZA 3SXLA 1U6BA 3S01A 1JJ2R 4P6QA 4YB1P 4QQBA 2ZJRQ 2HGLA 2ZJPQ 5IM0B 3SDEB 3CULA 3S6EA 1PGZA 4C0OC 1FJ7A 2LA6A 1VC5A 2MKSA 3VAHA 1JJ4A 1CVJA 1HD1A 4F02A 5ITHA 2MKJA 3Q2TC 1K9MT 3EGZA 2CPEA 3DXBA 5GAHU 3VAJA 3UD4P 4TU7A 2AYBA 2FY1A 2D9OA 3NMRA 3G96A 1UAWA 2YWKA 2MXYA 2MKCA 2WBRA 1U1OA 1DHMA 2OJ3A 3CXCR 2KM8B 1M5KC 1D9AA 3MOJB 2MZRA 1VBXA 3IWNC 1WG5A 2DNKA 1M90T 4W92B 2DNQA 1WHXA 3VALA 2CQ3A 2MKHA 5FJ4A 1SJRA 2NLWA 4C7QA 2SXLA 5DETA 1XN9A 2CPFA 1SJFA 1H6KX 3UCUP 3PIPQ 2M7SA 3V4MA 4WFAQ 2CPDA 2X1AA 1M5VC 5CYJA 3RW7A 2DH8A 2VODA 2OIHA 3CTRA 1R8HA 1VQPS 2PEHA 3G8TA 1YTYA 2FPHX 1HL6A 3VAKA 1VQ5S 2XB2D 1A7GE 4FXWA 3BO4A 3CC4S 3MUTP 2MZSA 2E5JA 4J5OA 1X4CA 1Q81T 1FXLA 1S72S 3CMAS 2HVZA 2E5IA 1VQKS 3ULHA 4QU6A 1DBDA 3UWTA 2N3LA 1HA1A 4OZ0A 5IQQA 2G1DA 2RS8A 3CCES 1QVGR 2KHCA 4UY8T 3NNHA 2L41A 3BO2A 1FJEB 2L9WA 4CIOA 2MKIA 2NZ4A 4RU2A 1W2BR 1SJ4P 3UE2A 2FC8A 3P49B 2CQDA 1OO0B 2J8AA 3MDFA 3EX7B 1Q7YT 1RK8A 3IRWP 2LYVA 3R27A 1K8AT 2MQQA 1YWXA 2GO9A 2DNGA 3CCUS 1N88A 2DO4A 2N3OA 2LXIA 1N54B 2BOPA 1OWXA 3R1LA 1G2EA 2QEXS 2DB1A 5LJ3Y 3HHNB 2KN4A 2DNMA 3VF0B 2OSQA 5DDRC 3G4SS 3UCGA 3N9UC 4ERDA 5CA5A 4WKRA 2RNEA 2OSRA 1VQ6S 2OTLS 1BY9A 1M5OC 1P1TA 3P6YC 3K0JA 1N8RT 2KT5A 1U1PA 1WHVA 1SJ3P 2J0SD 2KXFA 2K8GA 4A8XA 2AD9A 1AUDA 1Q82T 2DGOA 3CF5Q 2MQLA 2FHOB 5GMKa 1ZH5A 2EK6A 1FHTA 2DHGA 3BEGB 1B7FA 1M1KT 2RUGA 3LQVA 3CD6S 2OTJS 5HO4A 2XS7A 1N52B 5DM7Q 3G6ES 3G9CA 4M5DB 2MPUA 3EGNA 2MY8A 2DIVA 4LMZA 2M8DB 2RS2A 2M52A 4QU7A 2VONA 2LXUA 5LSOA 2DNYA 1KD1T 3UD3P 3MD3A 2MSSA 2BZ2A 2DH9A 3CCMS 2DISA 2AYGA 1NU4A 1WELA 2DGXA 3CMES 4U67Q 2ZJQQ 4IOAQ 2MB0B 3NNCA 1YJNS 4IOCQ 1PO6A 1X4AA 2DNZA 2RQCA 1FJCA 3NNAA 3DLLQ 2KXNB 1URNA 2KXHA 4Y00A 2DNOA 2YKAA 3BS9A 2D3OR 4PRFA 1X5SA 1X4BA 2CPXA 4QPTA 3S7RA 2YTCA 2E5HA 2D9PA 1U1LA 4IUFA 2DNPA 2DH7A 2M8HA 3TYTA 1DZ5A 2JVRA 1WI6A 4C4WA 2KG1A 2ADCA 3OW2R 2CPJA 5JVGQ 1WWHA 4F26A 2M4MA 1IQTA 3H2UB 5IFMA 4WF9Q 1WTBA 1K73T 5LXRA 2RRBA 3P5TL 2LEAA 2KFYA 2DGSA 1WEXA 3B4MA
chains in the Genus database with same CATH superfamily
2EBGA 3KMQA 1P8GA 3MXHP 5CCLA 3CJKB 3R6GB 5M2UA 2AQ4A 2QSFA 1Y5LB 2HRTA 2OFGX 4DXLA 4OL8A 3ENQA 2CJYB 2GO8A 2F4VF 1QSSA 4GC6A 4TU8A 2ZEJA 4J7CA 4JI4F 1XC9A 5D4PA 1MMNA 3C16B 3CCTA 2GC8A 1M5PC 3TWZA 2H5EA 3OJSA 4ED4A 2BJ1A 1U2CA 2EFQA 1GK8A 4DQPA 4MIAA 2U2FA 2G0CA 1CPZA 2NXNA 2B6AA 1ZTWA 2B9EA 2B56A 4DN0A 3AFGA 3TI0A 3RG6A 1ZYQA 4A47A 1RWWB 3EXCX 3Q22A 2VASA 3U7JA 4WIIA 4ANEA 4C98A 2P6SA 4XK8C 3ENAA 4A8QA 3KK2A 1XNQF 1LFWA 2QZ8A 5HANA 2CRLA 4DV5J 1F5AA 4PABA 2C3UA 1JLBB 4I64A 1IM4A 1ZAXA 5CD4A 3K5LA 1U45A 4GO7X 2RH3A 4P2SA 1RWUA 2YX7A 4PR6A 2HLUA 4OI1A 2WTFA 4OZ3A 3BR8A 3TAMB 3LANA 3T9NA 4M5NA 4NMXA 2XI2A 5GAEI 4ED5A 5HROB 2H51B 5HAOA 2MJUA 5DS7A 4X62J 3PYEA 2QLJB 2AYMA 2HNYB 4NE9C 3PXGa 2LCWA 1O51A 1HWUA 5J1EA 1XR7A 4ZP9A 5HBMA 2RT3A 2GVZA 3MM5A 2E5GA 2YKOA 1HPZA 4ZHRA 3CCJS 1NXIA 1YJ9S 2BA9A 4DUYJ 2G4BA 1S9EB 1K1QA 4DQRA 2G0IA 4DX7A 4PWWA 2DGUA 1QVFR 2V2ZA 4X4PA 2CXEA 5KG2A 1DTTB 1UVJA 3F56A 4FP9A 4U6PA 1U1KA 5F3ZA 2CQBA 3DRYA 2AJ2A 4ZPWR 4NLDA 3FDSA 3QIPB 3VQTA 2VA3A 1WC5A 1RHQB 2AGQA 4ICLA 1PYSB 4FPRA 3KLIA 3PHEA 2A2CA 1UA1A 2F7VA 2CPEA 2V69A 3QGPA 1UVIA 1UVLA 1R0AB 3EVWA 3O6QA 3W2WB 2MXYA 4TN2A 1RT4A 2MKCA 4B3OA 2ROPA 1D9AA 1IWGA 2WW4A 1UEUA 1KKHA 1RAJA 3W60A 3C6TB 1RT3B 1A6LA 4B3RF 1Z2ZA 2W2PP 3H2LA 2HG4A 1U2RA 4DV7F 2DJWA 4UOCA 2RUSA 3KHLA 2H54B 1HARA 4LREA 2JOQA 3DHXA 3ISND 4DR3F 1SUQB 4NL5A 4QU6A 2RS8A 3G82B 2L9WA 2J7UA 1VS3A 2HZAA 4RU2A 2VJUA 4J9NA 2IM1A 3RR8A 1RTZA 1LWFA 2A2DA 4ES3A 4F4XA 4FF1A 4WIQA 3Q8RB 3C15A 4O44A 5EGYA 4ELUA 1TKZA 4ZLNA 5LJ3Y 3JTOA 3U02A 2XI3A 1R6VA 3QLHB 1G4CA 1S1TB 2XMMA 4MIWA 4EBCA 2RKIA 4M63A 1RT1A 4R25A 1FF2A 4ZLJA 1Q8BA 9ATCB 1N8RT 1AFIA 2UUCJ 3Q24A 1EAYC 1FE4A 1SJ3P 2J0SD 2VFTA 3AOCA 2MQLA 4DPUA 3N0VA 4OX9J 4R8UA 5HVGA 5KTQA 2HFNA 5DM7Q 1URRA 2V9WA 4USKA 4F50A 2DIVA 3OQ2A 5LSOA 3K89A 4IH5A 1P6TA 2UVWA 2A6MA 1TK5A 3BN4A 1LW0B 2XEXA 2F4VJ 5IT0A 2HIYA 4JI4J 4Q45A 1Q79A 2HHQA 4RWXA 4W98A 2E5HA 2DH7A 3MMAA 1T8EA 1U24A 3PCOB 2Z58B 1GFWB 2EXUA 4KFBB 1K73T 2FZGB 2R7XA 4DSJA 4RBUA 2LEAA 4TVAB 6FDRA 1LK5A 1KFSA 3MUMP 2R7VA 5F9NA 3I56S 2KVQE 3VGVA 3DLGB 2IMOA 1XNQJ 3CCRS 1YHQS 3NWGA 5HLFB 4DF4A 1Q0NA 1C1CA 3T6BA 4CLWA 3MM7B 1S48A 1JXLA 4E98A 1R31A 4WCEQ 1Y4ZB 3D3BJ 3MFIA 3MEEA 3MURP 4CM2A 3LP2B 3M30B 2QFIA 1CBKA 3W9JA 2C28A 1D9DA 1EZZB 2OPSB 2V0NA 4ANCA 1RU1A 2AYEA 3TP2A 1VIXA 4P9SA 1K0TA 2MHNA 2J8SA 2C3OA 3DRRB 3WHIA 1U8WA 2UXBF 3ETOA 5MLCV 3HHKA 3GSDA 2AX0A 1C1BB 4X65F 3F0NA 1UETA 1NPRA 4ZPVR 4OJGA 1KQSR 1R43A 4H4OB 2POKA 4YDXA 2E9ZA 3V6DB 2IC3A 2NUHA 2IM0A 3R5JB 2MLXA 5AXLA 2MQNA 4ZCKA 1LWEA 2MDAA 2NXUA 1Z4UA 4ZP6A 4DV0F 4M8LA 2B0GA 3UD5A 3FEYB 3TUIC 3M9OB 2XHWA 3MAAB 4QBUA 5IC6B 5CYQA 3O3LA 4FVCA 2KRRA 4TNOA 3ZZZA 1KS2A 4ECTA 2RQ4A 1FTCA 1PJ5A 4RBTA 1S6PA 2B51A 1TMJA 1SH3A 5C42B 1LFPA 1QSLA 5D4LA 1FEHA 3NS5A 4F8RA 3BSOA 3I5CA 3ONQA 4RKUC 2EFPA 1CJUB 1NBEB 2K7KA 4KHRA 3THPA 5K8PA 4LFCF 5KFEA 1U0HB 1HBOA 2DKOB 3LOUA 4WP8A 1R8PA 4KQZA 1F2GA 1KDNA 1L5UA 2ADBA 4DSIA 4B3RJ 3Q8VA 3C2PA 4HTIA 4QR2A 1IM6A 4OZ5A 1DQAA 4DV7J 4J90A 3BKUA 2L9NA 4WJBA 1FRLA 4YB1P 2OPPA 1PC4A 1BGXT 1FJ7A 3BGFA 3MECA 4ZN1A 4DR3J 5ITHA 3U27A 3QFWA 2R8IA 1PYTA 4J9PA 2BQRA 1NJXA 2Y8YA 3TAQA 5IOLA 4OX8A 2ZE2A 1BXNA 3HHLC 4EU0A 2BE9B 2CJAA 3D1HA 4KIAA 4C7QA 2CPFA 1KLMA 4DR7F 2HK2A 3M2RA 3NXZA 3Q89A 5H9FJ 5IT4A 2GIQA 2VD3A 3JXOA 1R3NA 3VAKA 4QR0A 2JLFA 3BH6B 2MZSA 1OY8A 4IYQA 1F9EB 4P74A 3M6VA 3LO3A 3DOLA 4FBUA 3I31A 1RWNB 2CWXA 2VPYB 2K2PA 4J91A 3RR7A 5A8RA 4LRAA 1TL7A 2NZ4A 1YLXA 3C66A 4B9UA 4MIBA 3AD8C 3DLKA 2AT1B 3MDFA 3JQKA 4O0IA 4TY8A 1X9SA 4GO5X 2IDEA 1ROFA 3CIMA 4LQ9A 1AZSB 4KPYA 3PYDA 5KG6A 3UDCA 5D0HA 3KDOA 4W4MA 4TLRA 4LBIA 5KFZA 2KT5A 4DUZF 3MM8A 3MR5A 2YPZA 2YNHA 1Q7LB 2RUGA 3CD6S 1NB7A 2PA3A 1CULB 3RB3A 3G6ES 4OJ1A 1TP7A 4ANDA 2BMBA 4QU7A 2Y1JA 2YWFA 3MD3A 4RPFA 2WOMA 3QRQA 4DJBA 2C2ZB 5KFRA 1OMSA 2RQCA 1FJCA 3ADAC 1IWAA 1PAEX 4I7FB 2GIFA 1RWVB 1N5VA 4NCGB 2ZM6J 4TKTA 1Q8KA 4USTA 1CC8A 1KTVA 4ILRA 4ZVRB 4CTAB 8ATCB 1MN9A 4TYBA 4KAIA 3H59A 2CPJA 2C2EA 3FCHA 3PKYA 3HVWA 2FLOA 3OR1B 2RRBA 3LP1B 4YB5A 1SIWB 1Y0HA 3QPIA 3MCNA 1X4FA 2D3ZA 3AD9C 4QWCA 2UXBJ 2NXCA 1IXKA 4L3NA 4DL6A 2FLPA 1FA0A 3I96A 1XERA 3PX0A 4U95A 2VOOA 1LW2A 2DXFA 4X65J 4YR2A 2IDLA 2B7BB 1VK3A 3Q0AA 1X0FA 1ZM9A 1QD1A 1XIQA 4KGXB 5KT3A 2DGVA 1PKUA 2GS8A 3JSMB 3LW5C 3C14B 3LP0A 4RO0A 4K4XA 3B82A 2MMYA 1VQ4S 4DV0J 1E6VB 3BGRA 1LXNA 3TVYA 1HNXF 4UY85 2VPZB 4M1KA 4O3SA 1RT2A 4WFBQ 1O8BA 3PRDA 4KKOA 3KLFA 2FVQA 2XMTA 5ETSA 4F2SA 4LSLA 4NXMF 4QJVA 2GJ2A 2QA4G 1UW4A 2HK3A 2M88A 1X0PA 5KOWA 2L08A 4D3HA 3QT6A 3JQMA 3N6MA 1WF2A 4OI3A 4LFCJ 1QE1B 3SMZA 5K9FA 1UFWA 2Q79A 4WP3A 2G1HA 2QC3A 1G1XA 2HFSA 2Z2YB 4DFMA 4DPWA 2P6TA 2DRDA 2CZ9A 3RYLA 3HP6A 2YWHA 3J7YU 4EUVA 3O44A 3DHWC 4JI1F 1H7XA 3NAIA 4WFXA 3OJUA 4Q8EA 3NOCA 2W7PA 5H9FK 2ZNZA 3ENWA 3GFYA 1RISA 2VICA 3UN3A 3E2EA 5BJRA 3K5MA 4ZKAA 1X5PA 4A8MP 2RF2A 5EWGA 3THTA 3CCLS 2LQ9A 3HHLA 2W4PA 4QW9A 4WE1A 3OTEA 2FLLA 4JI5F 1NDKA 2KM8C 2KHDA 3ENVA 4DR7J 6AT1B 2AJFE 1F3FA 3M6XA 2H9ZA 1HQEB 5FD1A 4L6V3 3GQCA 4P6QA 2RIJA 3ET6B 4I0WA 3SDEB 3CULA 3AJDA 2A1BA 3N6LA 3S6EA 5FDLB 5KFCA 3PNIA 3AOAA 2AYBA 2D9OA 2Y1IA 1F6TA 3KNAA 2QL7B 2QMUB 4OYXA 3WX4A 4DLGA 5HVHA 1V6HA 4C8ZA 3NL0A 2F5GA 3VWSA 3TQEA 1YJ7A 1S4EA 3RGIA 4M5HA 3FFIB 1D8YA 3D67A 5DQGA 5ETKA 3TA1A 1RTJB 2HHTA 3G8TA 5DG8A 2FJBB 1FVQA 2Z57B 2DBBA 3RBZA 2F8HA 1KHWA 1T9XA 2E5IA 3GYNA 2XWXA 4DUZJ 2FIUA 1RT5A 5HQLA 2V50A 3CDAA 2YBVA 2L41A 4IFYA 4PG8A 1YRUA 1AFJA 1RT6B 2MKIA 5L39A 1W2BR 3EPIA 4JI0F 1TV6B 4YY3F 2UV8G 1H38A 5DGAA 1TR0A 4RLEA 2BOPA 1VMBA 1RCXB 2RAQA 4EZ6A 4LF4F 2J6SA 2DNMA 3FMBA 5BYRA 2OSQA 4FYXB 2VBXA 5A6PA 3QAUA 1VQ6S 1NUEA 5C25A 2OTLS 4HT7A 2IBOA 2RSQA 3MR6A 5HMWA 3Q83A 4ECUA 1AUDA 4OHWA 3UDVA 1V3ZA 3IBFB 3KJVA 4N8OA 1S0VA 4M5LA 2NR0A 3CE8A 3IG1B 2DEIA 2JNJA 2HBYB 2BZ2A 2C2RA 2BJDA 2UUBF 3N79A 3CCMS 2DH9A 3M32A 4M5JA 4WYLA 1JLGB 3MTKA 1HFEL 3IM8A 2C2NA 2KXNB 3A3PB 2DY9A 2J9DE 4CRJA 5F8JA 1X4BA 2CPXA 3CJ3A 3ZXWA 3QFHA 1AW0A 3HSGA 1NDCA 3CO0P 3OD2A 2LDIA 1S1XA 1QAIA 5J2QB 1B4SA 2OEKA 1OY9A 3OBIA 1Q4RA 4V1Ak 4N76A 1NJZA 5CYMA 2E1PA 1X9WA 1HNIB 2IAJB 2NPIA 1HNXJ 4A48A 4ELTA 2BABA 4DPOA 4ZVUB 2G9OA 4RNHA 1ZA2B 4OI0A 1CJVB 3GJSB 4NI2B 2RDJA 4ED2A 4NXMJ 4IFVA 3NBPB 1FDAA 5KFQA 3ITHA 2MEWA 2HEKA 1DAXA 1SV5A 4HTJA 4J9VA 3I0SA 1S12A 5J2MA 3HFVA 3KJNB 3ZTRA 2PI5A 2KO1A 5C7PA 1H98A 2WSFC 3I55S 4P2XA 5LXYA 3DM2B 2GGPB 4G65A 1U1NA 3FBFA 2DR5A 1F1BB 2EW9A 4ZJLA 3FQLA 2B4UA 4JI1J 1NO8A 1VDHA 2IRXA 3ILIA 1X5TA 2CZVC 2BE2B 3TA0A 4RWWA 3UDEA 3FRYA 3UCZP 2GHWA 1W25A 2DXDA 3TJ9A 4BDPA 2E44A 4CT9A 2KRBA 3RBDA 3KLEB 2DGQA 1DFDA 3M2VB 1JLFB 4JI5J 3JTPA 1KOHA 1CC7A 3ETMA 1WACA 3AT1B 4OZ2A 5K14B 2ZH9A 1JLAB 4I2QB 2F3JA 3VZIA 2W24A 1HD0A 4ED8A 1N6QA 3H7HB 3R7BB 2RILA 1H3DA 4IH7A 2HHUA 3DRXA 1N34F 4C0BA 4ECVA 2JH3A 3HJFA 3M8SA 3MZIA 2HNZA 4OYBA 1MG7A 1MU2B 1WEYA 1N5TA 2V4QA 5F8IA 2UUWA 1IKVA 4DU7A 3DI6A 1B7YB 1XK8A 2DNRA 2CG4A 3IAM9 3W8PA 1PJ7A 2V6AA 4IR9A 1ELOA 4O4GB 2C1EB 3IN5A 1L3UA 1KLNA 3GCXP 4P2FA 1VC5A 5KFTA 2WVEA 2O01C 3VAJA 2XULA 2P9GA 4QYZJ 5G0RA 2VG7A 1LWXA 1VBXA 2C3MA 1WG5A 2HS3A 1VRTB 3P4UB 4JI0J 3MMBA 2V34A 1XN9A 4KH0B 1H6KX 4YY3J 2FTRA 1P9YA 5AXKA 1UFKA 3TR5A 3BF4A 3DLHA 4FNIA 3F73A 4LF4J 4C8LA 2OKQA 2PEHA 4B9MA 2WSEC 2XB2D 2YNGA 3NGTA 1ZPWX 5KFHA 4QIVA 2YXLA 3CJQA 5IT9Y 2HHXA 2CYYA 2WB4A 1FJEB 2OPRB 3T5LA 3UE2A 2R2SA 3W2VB 3QMQA 2VA2A 3AAWB 3IGVA 3CDBA 1D1UA 2YWGA 3X3UA 5GADI 2VKZG 3KHHA 2NREA 3NS7B 4RU9A 3VGTA 2UUBJ 2PI4A 4ERDA 4WKRA 3D3CJ 2RNEA 3QSIA 3A12A 2P9CA 4FKYA 2FB0A 1TVRA 3P6YC 3K0JA 3NG8A 2KFZA 1U1PA 4L72B 3NGDA 4A8XA 1M5SA 1S1WA 3UW1A 3RAQA 1S6QA 1RTDB 1M1KT 4GVLA 2V8PA 2I5JB 5KFVA 2RE1A 1CS4B 2MPUA 2C2OB 3W66A 2M8DB 3RB6A 3GTYX 2V5HG 5KG1A 4J9SA 4RW9B 2BJ3A 1CJKB 4RW7A 2VBYA 4KRWA 1WD6A 2WB1D 4U67Q 2HQDA 2EKYA 3NNCA 1YJNS 4XIUA 1X4AA 5DZ7A 1OS5A 3RUBL 2CUYA 2KXHA 2DNOA 3CJ5A 2ASDA 2D3OR 3DRPA 5D3GB 4IH6A 2M8HA 2AJ1A 3HCXA 4X4SA 3CJSA 4ECXA 3GONA 4MYTA 1W7WA 2UUTA 1IQTA 4NRUA 2QMWA 2BKOA 2Z8QA 5LXRA 4DG1A 4DFPA 4IOBA 4Q0BA 1QLNA 4RW8B 4NEZA 4KO0A 1S0OA 3W8GA 3BQ2A 2H1YA 2J0QD 4JOUA 1KVIA 4EO6A 2XSFA 2MLYA 4UQTA 4P75A 2R2UA 3DYAB 1QTNB 1S79A 5K8NA 4TU9A 4P73A 4RNNA 2AJ0A 2NCKL 1KOOA 4ZP7A 3BQ1A 3SV3A 1X4HA 4I4BA 4ELVA 2QFJA 1VQOS 1HYSB 4J9OA 3V4IB 2MSTA 5L1KA 5GADU 1QTMA 2ERRA 5LSLA 1TUWA 2AEFA 4RR5A 2KU7A 3MMCA 2DHSA 2IRUA 3R5CA 3J80Y 4EI2A 3FNNA 1TQLA 4CO1A 1N34J 2J0WA 3MEDB 4WWSA 1GH8A 2WONB 1WI8A 4UT4A 3RB0A 3V5RA 3POTA 4I56A 4N8NA 2Z2MA 4F4KA 1S77D 2OH2A 1BQMB 3IS9A 3OUYA 2R2RA 4MMOA 2UXCF 3O8WA 3M1VA 4OYAA 3G6XA 3R3TA 2G2ZA 4N7TA 4PWDB 1OYEA 3AA9A 5BXIA 2E7VA 3PV8A 3KTQA 3CIZA 4MK9A 1NMEB 1BE4A 1BQXA 2RDIA 1IKYA 1JNRB 2ZZMA 2V8HA 2B6AB 3T41A 3G71S 4RZRA 4FS2A 5DM6Q 2OPQA 3BPSP 4WYWA 4IG0A 1HNWF 4LUBA 3M6WA 2I2YA 1YJWS 1ICEB 3KK2B 5KT6A 3ZZTA 5CABA 5F3TA 1IBLF 3QZ7A 5E41A 3DNCA 4OHZA 4HHHA 3JSYA 1FRHA 1RT7A 4QQBA 3DU5A 3MM9A 5CZXA 2L3MA 5KFAA 2DCLA 3PFOA 1CVJA 4ZJOA 3DC2A 2W9BA 3DXBA 3AB4B 1R8AA 1DJ0A 4O3OA 4RNFA 2C2DA 2XY5A 1SBRA 2ABYA 3HDSA 2CVIA 3PVXA 2OI2A 1SJFA 2F8EX 1T9UA 2M7SA 4B9SA 1ZM4A 3QRPA 3DMJA 5DLFA 2B9YA 2HHHF 2PSZA 3L7PA 3VR1A 5J1EB 4DV6J 5HBMB 5KFSA 1WC1A 3PY8A 2GVZB 3MM5B 4I2PA 2BJ9A 2ILZA 1FXLA 2XGPA 1HPZB 4ZHRB 2YKPA 5IQQA 1QVGR 1UJ4A 2W7OA 1CLFA 1CQNA 4WK1A 4WTOB 3M05A 5L1LA 2FC8A 4G1QA 2Q66A 2FGCA 2CQDA 1KNZA 4OYOA 1NEEA 3ZO7A 2KDOA 2NS1B 3RAXA 1C2PA 1P9QC 5GAGI 3LUYA 4ICLB 3WIVA 1NK6A 3UQSA 3KLIB 5LM7E 2KKHA 1KTQA 5ETMA 3H42A 3J7Z5 1XWLA 2GAGC 1JIHA 1RT4B 2ATCB 3HT0A 4ZCMA 3V6JA 2VFSA 2K8GA 2AD9A 3H5UA 1OJ4A 1K44A 1NAQA 3KK3A 1B7FA 6FD1A 4AL5A 4N5SA 4NOHA 3I9V9 3D0GE 3GCWP 2XS7A 2HIQA 3AD7C 1GAOA 4ECWA 4RW4A 1NDLA 1FRXA 4C3MA 3PO5A 2Y0SD 3QT8A 3TRGA 2DGXA 3HSJA 2HHPA 4R0JA 1U4BA 2YTCA 2AX1A 4NLPA 3TYTA 1DLOA 3Q8UA 3W64A 4RBVA 3S1TA 4ED3A 2BW2A 1RYRA 1LWFB 1NNDA 5D0RA 3C15B 1WEXA 4O44B 3K59A 4DS4A 1TKZB 3AXMA 3IWLA 4XPEA 2JFDA 3TUJC 4TLQA 3SQGA 3FSXA 1VK8A 4F0HA 2ZITA 3D6HB 1RHUB 2RKIB 1HHSA 3K5PA 3NCPA 3VQSA 1A0OB 1DARA 4HYKA 4LQ3A 1S4FA 4M95A 2BJ7A 2MJNA 2HFVA 3GG1A 4J9RA 2FC9A 4NLTA 2ZUAA 5A0YA 3PYFA 3NCRA 4WZMA 3PEJA 2A10A 5T14A 1FNXH 2FDNA 2UXCJ 2W8KA 3H4DA 4WFNQ 3H5SA 3OTOF 2HYIB 1XR5A 1V5VA 5GAGU 2XC9A 3I32A 3MMAB 3HKZD 1UVNA 4WZQA 3H90A 3M7VA 5F8MA 3JSRA 3H5XA 1Q86T 2V2VA 3GG0A 3VHQA 3GJQB 4HI1A 3MHYA 3CCQS 3N28A 4FS1A 3QJPA 1HNWJ 3QWPA 1KC8T 2DPIA 4PUOA 4ZCIA 2FY8A 3VAGA 4LFBF 2R8HA 5LJ5Y 1I1GA 2N4DA 3D1OA 4P7TA 1YVFA 3BKTA 2XLKA 3HI9A 1C1CB 1H2TZ 2CQGA 1IJFB 1VOMA 4DZ6A 1S1VA 3MEEB 4AYBD 1C0UA 2VUGA 3HVTA 1ULRA 3MGJA 3TAMA 4DQIA 1G3OA 5EN1A 5CCMA 1SC6A 2LU1A 2F63A 4LR9A 4OJHA 4O3PA 1UTAA 2CQ2A 4H54A 1YI2S 1TL3A 2JC1A 5F8HA 4Q7AA 3TEHB 5EWEA 4ID8A 1HWIA 1B0PA 2ROEA 1H2VZ 4PKDB 2HHHJ 4CLFA 4IKAA 3OL6A 3LGMA 2GJFA 2BKNA 3GV5B 1T05A 4DZDA 4ED7A 4ATNA 5ETOA 4YQWA 4FKXA 2HGLA 2H4YB 2IC3B 4ECZA 4HL9A 2LA6A 3D0IE 1YK9A 4MJKA 2N7YA 3WC2A 1LWEB 4TU7A 1UA0A 3CDWA 5IZHA 2W25A 2QL9B 4HI2A 5IC4B 5FJ4A 5CYQB 5HQMA 2DPJA 2CPDA 3QJJA 1S6PB 4G1IA 3PRVA 2ASYA 2XM3A 2K3IA 3C6TA 2KFNA 3CW2C 3KXDA 3I5AA 2HVDA 3ULHA 1R0BG 4DMZA 1TKTA 1ACMB 2N3LA 4DV2F 3HJVA 2KHCA 1HBOB 5FLXU 3JAMY 1KQKA 1F9HA 4I69A 4DBQA 2XTJP 4NA2A 4RW6A 4KBIA 2CKWA 5F8LA 1FWPA 1PIEA 2OPPB 1FD2A 3VF0B 3MECB 3N9UC 2BE7D 2E1AA 1IUJA 1NK5A 3UR3C 1Q95G 4Y2MA 1VLYA 2VC0A 1KR4A 4I6YA 4GVBA 4FYWB 1UPMB 2ZE2B 2L48A 4MKVA 4F67A 2OMOA 5ETPA 1KLMB 2QO3A 2BRLA 3EXYA 3FZ2A 2GIRA 2RS2A 4KTQA 2QLBB 1JLEA 2LXUA 2QYCA 4IQMA 2DNYA 3EVOA 4P2MA 2Q1LA 2PMWA 2WZ1A 1NK7A 3QAEA 3GPAA 2HNDA 3FCVA 3DOLB 2DR7A 1NCLA 5KFDA 1N0VC 4PRFA 2PT0A 5A8RB 1LW0A 1TL7B 2APOA 1YX2A 2B9XA 1T7PA 4LRCA 4NZ0A 1WI6A 2BM0A 3MFHA 3DLKB 1LEOA 4TY8B 1PILA 2YY3A 3M6UA 1S49A 3FUYA 4K4VA 5HK4A 1D8ZA 2CPZA 2J76E 5L9NA 1UCNA 2YKMA 3OTOJ 2ZDPA 4X4OA 3JYTA 1VJQA 3GR0A 4B3TF 3O1LA 3MM8B 1TL1A 5KFBA 1NRKA 1Z2LA 1M5HA 1WOOA 3U1NA 2YNHB 4YMEA 5HLFA 2B5JA 3FEXB 2W9CA 1QAYA 3AH6A 3OXLA 4I6WA 4DQQA 3EGVA 2OEMA 4HEA9 1T03A 1WC3A 4ED0A 3FK4A 3U1LA 1WF1A 3NAHA 4LFBJ 2DO0A 3M30A 4B17A 4Y0FA 1VBZA 4PG7A 3PW2A 2XS2A 1L3KA 3FZBA 2KJVA 3CWJA 3NRBA 1OYDA 1GXUA 3NKYA 1RWKB 3J81j 2LEBA 4M5GA 2RHQB 4RUAA 3VVUA 1U6FA 2ZUGA 2AJQA 4DR1F 4WFYA 4H4OA 2HVEA 4C97A 1BQNA 1U49A 4Y6IA 2BACA 3H0PA 1KP6A 1RAEB 3H25A 1LW2B 3G8QA 2X1BA 3BQ0A 2IMWP 5BYQA 1VRUA 1O0PA 2F9JA 2B3TB 1VQ8S 3TUPA 3D0HE 3D6TB 4DR2F 5B0DA 1IR2A 4C8NA 4JV0A 3HHLD 3JB9k 3LP0B 1CEZA 3MPWA 2JEJA 3BGRB 4ZITA 2K1RB 3PW4A 1WHYA 3TO8A 2VL1A 4ETXA 2CQCA 1CJTA 1XMQF 3CJTA 2QE5A 4YS2A 5SZTA 3DCAA 1RT2B 3I4PA 3KUHA 1IBMF 2NXJA 4KKOB 3KLFB 5DLGA 4LSLB 2DNLA 3EM1A 4CLKA 2AU0A 3PEHA 3J81Y 1Y11A 5KG0A 1S10A 2MTLA 3BREA 4LF8F 1MROA 3D9BA 1K9MT 3ZTPA 5GAHU 1XEZA 4ENOA 4DV2J 3ILOA 1SKSA 1TK0A 3NEKA 3IWNC 1UEKA 1WHXA 1CQMA 4B02A 1UEVA 4XDCA 3K5NA 5J2PA 1LWCA 1UMJA 2KB2A 3RZAA 4F4AA 4EBDA 2XY7A 3CJ2A 4DUTA 1FNOA 4EYIB 2DEJA 1JLCA 3CTRA 1DY3A 2ALYB 2FPHX 4DF8A 1A7GE 3CC4S 2WVFA 3MUTP 4C6AA 3W1YC 2RF2B 2FVPA 3DDIA 4LBHA 4NZ6A 2ZNYA 3HHLB 4WE1B 4EBEA 3BO2A 4HHJA 4AUKA 2CA9A 1T94A 2ILYA 5B0EA 2FHMA 2GO9A 2KZZA 2FVRA 1F2HA 1N54B 4ZMMA 3R1LA 2JFKA 5J2NA 4OZLA 3EUNA 4IQXA 2OSRA 2YX4A 1XR6A 2BBEA 4ZVEA 4I6AA 2DXEA 2OMLA 2BX6A 4S0MA 1BD6A 2GX8A 1Q82T 4OX7A 3QSYB 1GT8A 1ZAVA 2OTJS 3TQ1A 3R5GA 2HPUA 1PBUA 3EGNA 1ZBTA 1V5IB 2AJ4A 1MMLA 3SFGA 4URQU 2ZZTA 5IV4A 3MPVA 1OPZA 4PPZA 4OLOA 2C3YA 4X84A 1SQEA 1F0XA 1VI7A 1T9TA 5KFOA 4JV2A 3ZZOA 4BWMA 4B3TJ 5CAAA 3EGWB 3TANA 2ALZA 1RT5B 4IFYB 2R4FA 4QWEA 4DR4F 4IUFA 3LWMA 1DZ5A 3DU6A 4FXDA 4I7FA 2M4MA 4GKKF 2JC0A 4WF9Q 2CJQA 2OGUA 2CZ4A 4NA3A 3MTJA 1NSPA 1RAIB 2HSEB 3E51A 3QGHA 4ID5A 2GHPA 4F7VA 4CH1A 4OV1A 5C25B 3IMQJ 3Q2SC 4K0KF 3S8SA 1S59A 1YDLA 1Q16B 5HVFA 4E2FB 2VFRA 3KJVB 1MW7A 4WXOA 3K57A 5L1JA 1TKDA 4OFZA 1UWAA 2EC0A 4DR1J 3IP0A 1EKSA 3UNGC 2J6TA 3E3XA 2ASLA 3M32B 3OTCA 1F3VA 4X2BA 4GMKA 3V6HA 4JYAF 2RVJA 2YX1A 3BO3A 2ZVSA 3QGGA 2MY7A 4PCQA 4QW8A 3NY0A 2UVRA 4J9UE 1S99A 4OZ1A 1S1XB 1TKXA 5IQ6A 1D9FA 2DTJA 1MWQA 4DR2J 1A9NB 4LF1A 4UUXA 2KT3A 2JWNA 1I94F 1H2UX 4OX6A 1B70B 3HSZA 5HI7A 3M8WA 2KYXA 1SJ1A 1RACB 1XMQJ 4URGA 2B8PA 4CNYA 1IBMJ 4NMLA 2RRAA 5DDPC 3SSSA 2GNKA 4IFVB 4BCAA 3QJLA 1J27A 3RBXA 5I42B 2CIMA 3ITHB 4DL7A 3MR3A 1SV5B 3SQOP 2XLIA 3I0SB 4IO9Q 3OXFA 4MKAA 3BGOP 4LF8J 2LP4A 4JB8B 2YH1A 3PX4A 1RDRA 5A8KA 4Q43A 2MYFA 2ZZNA 2JEIA 2KVIA 3T3FA 1FVSA 1VJWA 2V94A 4RUCA 4C0HA 4H4KC 3OHAA 3T6JA 2XGQA 1HBMA 1HMVA 1PCAA 3V81A 1JJ2R 5KG7A 3PO4A 4OQJA 1N4LA 1JNZB 5LOQA 4K2JA 2ZJPQ 4FYYB 3PJWA 1EETA 4QIFA 3VTIA 1UL3A 2WSCC 1OSDA 2HBZB 4A46A 1PJ6A 1YRTA 2XWYA 5AT1B 4O23A 5DGBA 3UD4P 4FF2A 2JLGA 2VG5A 4NLUA 3CXCR 2KM8B 1SH2A 3N5BA 2DNKA 2DNQA 1AXQA 4WPAA 1SJRA 3OSPA 3IAS9 3DRSA 2R7WA 1RZMA 2VQEF 3CD0A 1N6QB 2QA1A 5CYJA 3DOMA 2R2TA 4EZ9A 3ZNUA 2I1RA 3BO4A 5KFXA 1YBTA 5KG5A 3J7A1 2QA2A 1S76D 1SKRA 4KHMA 1VFJA 5K8OA 2BQ3A 2HNZB 3CCES 3N6NA 2LFVA 2J6UA 4UY8T 1KBRA 3L9ZA 4USVA 2HQCA 2FGOA 4C9DA 1IKVB 1FDNA 1RK8A 4QIEA 3G87A 5B0BA 3EPGA 5DZ6A 2XZWA 4DSFA 2ZM6F 1GX5A 2XO7A 3KK1A 2QT7A 4J37A 4HLBA 3CD7A 1TV6A 1LK7A 3UO0A 1SQFA 4FPIA 1N5SA 1HBNA 2B4VA 4DR4J 1RLDA 5G0RB 2VG7B 5IWAJ 2W2MP 4YP3A 2J9CA 3ZZ0A 3KUEA 1Q5VA 5F0WA 3Q8QB 2VBZA 3MMBB 1T11A 2IJNA 4GKKJ 1N52B 4DPTA 1WKKA 4X4QA 4U96A 4DR5F 2ZWOA 1RP5A 3H4BA 3WX8A 3HZEA 1ZM3A 5L1IA 4ZK7M 1U25A 1NU4A 1WELA 1FESA 2YNGB 4G3IA 2KZMA 1DTQA 3VV2B 5DQHA 2HKEA 4OV6A 1GX6A 2UVVA 1IN0A 2F4FA 2YWWA 1TU0B 2XQCA 4K0KJ 1YJVA 2CDRB 2VPWB 2YVSA 3MR2A 4DFKA 1YGYA 2RMLA 1HI1A 2R9LA 4EMDA 2HQIA 1KN6A 5E3RA 5JVGQ 5L9XA 1UKUA 4FNHA 4ETZA 3I5BA 2Q43A 3A1YG 4YUDA 5D0EA 2GV1A 1P27B 2WBMA 3FJ2A 3BBCA 3ICLA 5HMXA 1WNEA 4P10A 2BJEA 4Y3CA 1REVA 3TX0A 4JYAJ 1VLOA 3J7AN 2AEMA 2VF3A 2G13A 1HQUA 3H20A 4DV4F 4Z7YA 1VCTA 2QLXA 5FIIA 1RKIA 2ZH4A 1UWBA 1S1WB 3IBCB 3MI7X 1FKOA 4NLSA 2ACMA 1N5YA 1CG2A 3HD2A 4RL1A 1XNRF 1CJVA 2RQKA 4L75A 1RQ0A 1I94J 1B0TA 2WHOA 4YFUA 4KY3A 3B6BA 4ZCLA 2H48B 2XCPA 2ZH5A 5D15A 4OYZA 2XNRA 4DCJB 2JRSA 2JZ5A 1VQ9S 1NSQA 4RW7B 2DHAA 3MM6B 1TUGB 3GWCA 3E01B 2Q6BA 2CNOB 3GFZA 2NPFA 3A13A 3EJMA 2Z2ZA 3DRPB 2O67A 2UXDF 5B7WA 2LEPA 4ILLA 3GIMA 2R7RA 2FZCB 7FD1A 3B78A 1U2FA 2LMIA 2OUGA 2FYXA 4DG1B 5F8GA 5C24A 5H9EJ 4Q0BB 2E7XA 3OHBA 2KH9A 4H4KA 2M70A 4KO0B 4TYAA 1FNMA 4ZVPB 2YQ1A 2HS0A 4ZLPA 2KI2A 3MAQA 3ZZUA 5JVHQ 3OFGA 1S5ZA 3EICA 5G4DA 4ZDNA 4P52A 3R2DJ 2DITA 3FBCA 2MQOA 4KB7A 2HHWA 3HLUA 4ZP8A 5LMNF 2VOPA 1R7IA 3NGRA 1MN7A 2DNHA 2DR6A 2F40A 2PE8A 1QSYA 4USWA 2PFDA 1LKZA 2ZDOA 3C6UA 3CCSS 2OELA 5D4NA 3K8WA 3ELHA 3VCDA 4MT1A 4RJVA 2HGMA 1ITPA 3B8HA 4DS5A 2EFGA 5HJXA 2GFFA 2M0GB 3QT7A 4ZVOB 2ROGA 2VQEJ 4AL7A 5KFPA 4ALZA 1SL1A 5KFKA 2K7JA 1QUPA 2XCAA 1K1SA 4CLPA 4X64F 1AA1B 2YNFB 2QRRA 4M5MA 3POTB 3Q8SB 2QYGA 2UUAF 3DFEA 3W9IA 2PMHA 3RAMA 1G7CB 3JSBA 3PW5A 4ZVGA 3IS9B 3J7YI 3OUYB 3CT9A 4W92B 1NZAA 1IBKF 2CAJA 3FBBA 3M1VB 4B3MF 4N77A 4FF4A 4M5DA 1ZOTA 3FCWA 3ISZA 5KFLA 2VODA 3QO9B 2HS4A 1YTYA 5AE2A 1HL6A 1VQ5S 4H4MA 1IKYB 4NYZA 2PGCA 2W01A 3KG1A 2E5JA 5IXUA 3G86A 2HVZA 1VQKS 2XSJA 4IG0B 5KFYA 3UWTA 2IFXA 1HA1A 5KFIA 1YBAA 5KFWA 5KT7A 4CIOA 3Q8YA 2HMIB 4ECSA 2J8AA 1Q8IA 4DR5J 2MQQA 2FJVA 2GHVC 2XMUA 5L38A 3M8RA 2NQPA 1NH7A 1N56A 1RT7B 3M9MB 1G2EA 3MM9B 3MCSA 2DB1A 4DCPB 5EX0A 1KSPA 1AYEA 2W9BB 2CNNB 4IRDA 5HP1A 5B09A 2J7WA 1FDDA 2IVFB 3D66A 2XLJA 3CVKA 3A3NB 3FRZA 1JKHA 2XBPA 2DHGA 2N4CA 3KNGA 3T19A 4J9LA 4F4WA 4CT8A 2FJAB 2YKNA 2VONA 3W5XA 5DQIA 4U8YA 4ER8A 1H72C 2NUUG 1RHMB 2PA8D 5KG3A 3BSNA 4DV4J 1Y3JA 5ETRA 4IOCQ 4K4TA 4I2PB 5B0AA 3P5BP 4RW9A 4ZIWA 4RX6A 1RUSA 4Y2AA 4QIGA 1KVJA 2Y0BB 5KT4A 1XNRJ 3IC1A 2HQGA 2KG1A 4G1QB 4NLOA 3IWXA 5ETTA 1FKAF 4PAAA 3KWMA 1SL0A 5H9EK 2FLNA 1SVDA 2BVZA 3P3DA 3GIKA 1GMWA 4V19X 3QBCA 1MMDA 3D68A 2MGZB 4R5PA 2RD5C 5E0OA 1S9GA 1VYAA 2UXDJ 3LF0A 4ZIVA 3KK3B 2X1FA 1XJWB 3C19A 4ED1A 2ZBPA 1U1QA 3BGUA 1S7IA 4BWJA 2QV6A 1BWEA 4TQSA 1SL2A 4RW4B 4C8KA 2GQ2A 3HVAA 1S1UA 3GIJA 1F5CA 4NPOA 3KKFA 3HHDA 1FXDA 2F1FA 1S97A 1JB0C 5D78A 2O3DA 4YOEA 4BC7A 2PO4A 2R7SA 5I3QA 1FX2A 3VZHA 1JXVA 5BYSA 2QG9B 5A2QY 4IRCA 2P8IA 3NP5A 3GJTB 2FHKA 1DLOB 1NZ8A 2MZ1A 4CO4A 2QN6B 5LMNJ 1WORA 4ZVQB 5HL7Q 2CPYA 2BANA 2N7CA 1KWMA 3DN9A 1Y10A 3BBBA 3K7RA 2JJ4D 2IM3A 1MWZA 3HSDA 4JI7F 2XY6A 4NLRA 3SQGB 3OR2A 4L76A 4C11B 1QDUB 4DSKA 2XZDB 2LQ5A 3NGUA 2MKKA 1NB2A 2X3DA 1NDPA 1SQGA 2MZJA 1HWKA 4B9LA 2CADA 1C4AA 2W1BA 1BQMA 4PPDA 2ZVIA 4X64J 2M5YA 3KOAA 1RWOB 1C0TA 2RU9A 1APSA 1I6JA 1MLAA 5A0YB 4PWDA 1JMTA 2UUAJ 3R97A 1TMMA 1PAUB 1HI0P 1GXLA 1EP4A 1FCAA 1IBKJ 4NYOA 4OYIA 4B3MJ 4NLWA 3GE9A 5T7LA 2CJKA 4KH1B 1S6OA 4GRSA 2OHDA 4CLLA 3S01A 3PYGA 3TZYA 2ZJRQ 3R5DA 2NYHA 5EDWA 1VHFA 3SYZA 2BV3A 3TNVA 3G96A 4ZPCA 2JHEA 4PUOB 3PTWA 1RADB 2I9SA 5F8NA 4Z37A 1Y5NB 2I0XA 1T9VA 3IXQA 4TY9A 1HHQA 3KJQB 4FDFA 3AOBA 1RAOA 1UPPA 4WFAQ 2CNLB 1M5VC 1PSDA 2YPYA 3WQPA 1S1VB 2V4RA 4K5RA 1C0UB 3HVTB 2IHR1 3FKBA 4DU8A 3GU0A 2B43A 2B4OA 5K8MA 2LDYA 4JUZA 5KOXA 2FZKB 2G1DA 1RWPB 4ZPAA 2VBWA 1W2IA 1PYOB 4ES2A 3G6YA 1NLKL 4FVMA 1U02A 3M8QA 1TL3B 3BM7A 1TZ0A 2VG6A 1Q7YT 1HNZF 4KV8A 5E33A 5HQ8A 4QOTA 4KT0C 3CJRA 3F41A 1N88A 2DO4A 2N3OA 1FFSB 2Z0GA 1UZDA 1T05B 3GYGA 2LU2A 2KN4A 4LVOP 4EO8A 2R7OA 1FRKA 1QAXA 4DX6A 3QZ8A 2HWTA 3IRXB 2PEBA 1HW8A 1HHTP 5EWFA 5HSPA 3OFEA 2V2QA 1VR6A 1VISA 2HWIA 3CF5Q 1ZH5A 1Y9OA 1E6YA 1RWXB 3LTOA 2FJEB 3LQVA 1KQGB 2VPXB 3W63A 3G9CA 1IJEB 2J7KA 3M8ZA 3D7SB 4MK8A 2J9DA 3HZGA 4USUA 4CLYA 4Y2CA 4C8YA 4F3OA 2R8GA 2ATLA 4KJIA 2MB0B 1KQFB 1HWLA 2NYIA 1NK0A 4KGZB 3NNAA 2IVMA 1TKTB 3CGIA 4C3LA 2WRMA 1MWYA 2V4JA 4B9NA 3LPEA 2OD4A 4F04B 3BDEA 3I82A 3PG9A 3IA0A 3P5TL 2XMVA 2CJXB 4DSLA 2KFYA 4RW6B 1N5QA 2GJIA 4J9MA 2G2OA 1TAUA 5LT5A 4ECRA 2ZD1A 3PACA 3KLVA 2E1RA 3IGNA 5DG7A 3OL8A 1M0SA 1OPIA 4LF9F 2ZOMA 4KC5A 4GVBB 1GTHA 2LQ8A 2K3KA 1H74A 4WTYA 5HATA 1KEKA 3VGSA 4GC7A 4A8SA 2AKWB 5GAEU 5KFUA 3SV4A 4AL6A 4OHXA 4IG3A 1JLEB 3MEGA 4JI7J 3AXKA 3CD5A 3BN7A 4QIWD 2BXJA 1T0TV 4A8OA 1V9OA 2DHXA 1FT8A 5I3UA 3OPKA 2HNDB 2DIUA 1ZZNA 2JX2A 3DKDA 3PJXA 1WDDA 4G1PA 4MTPA 2KT2A 3NGKA 1AB8A 2PC6A 1VQLS 4LSZB 5JJBA 1FKPA 2D3O1 2ZBQA 3KG4A 2I8EA 3I87A 2E1CA 2F65A 1J5OB 4HACA 2CDQA 3CMQA 3CJ0A 1OY6A 4FN5A 4B9VA 1VQSA 4CO0A 4RUHA 4UW2A 2YKMB 4Z7CA 2BEFA 3J7ZT 1CSJA 3JYTB 4UOGA 2MQPA 4PQUA 1XTZA 3KLGA 1TL1B 2CPIA 3UFCX 4DR6F 2F8MA 4DEZA 3AJ2A 3QIDA 1RAAB 2B5JB 1Q8LA 1FO1A 2W9CB 3NLCA 1WOSA 2LQJA 3MD1A 3ZZRA 2E1MC 1T03B 3KFWX 1FWKA 4OHVA 2OP5A 1M1GA 2Y3YA 3CPWR 2LECA 3TJ8A 1WF0A 5HN0A 5DDQC 2WVDA 4YB6A 4XDDA 1SC1B 3TX8A 4G6VB 3FMWA 3QQCD 1HBUB 4JBCA 4BLGA 3CC7S 4IDKB 1WG1A 4DV6F 3T1HF 2ACYA 3K17A 1AT1B 2EBEA 4CO5A 3PM9A 3VAHA 4A4JA 1JJ4A 3BJYA 4UZCA 2W4CA 2ZBRA 3NMRA 4DPXA 2FY1A 4CZCA 1UAWA 1BQNB 1GEHA 1RJJA 2XMAA 3SFUA 5LMUF 2CQ3A 4PG5A 2P9EA 1HNZJ 2RJZA 1H73A 2IJRA 3UCUP 1WC4A 4KSEB 3TVZA 5AJ3F 3ILJA 5M2RA 1VRUB 4FF3A 2V67A 3RW7A 3SBMA 4CYUB 2FUG9 1WSRA 4OYWA 2DR8A 1S72S 3CMAS 2DCUB 3KHGA 3DGPA 2IA0A 3DLEA 3OL7A 4HKQA 4K8RA 1CJTB 4X4UA 2HRUA 1ZAWA 3K2YA 2FJDB 4X4RA 3CJ8A 3W62A 3R27A 1K8AT 4LF6F 1QY7A 1ZA1B 3BDPA 4I67A 1T9YA 4USHA 3I6PA 4BHQA 2O5DA 1ZPVA 1WTFA 1I3OB 3T9ZA 2HBRB 3A3OB 4OMFG 1MROB 3RU0A 3OFHA 4BC9A 1S9FA 5GMKa 3I0RA 4U9RA 3BEGB 3L7UA 5J2PB 1LWCB 5DG9A 4K4ZA 2ZH8A 2A0FB 2GW8A 3ZTSA 3QT5A 1NK9A 1LXJA 1JLQA 1JLCB 1WJ9A 4Y34A 4M94A 4OZJA 3HULA 1FRIA 2A18A 3UVJA 1IKXA 1RLCL 1PO6A 3PJ9A 2GVDA 2W9AA 3IM9A 4LF9J 1R0CB 2IJFA 3SEOA 2UU9F 3R5BA 3H98A 1X5SA 3A4TA 3SZ2A 4MAKA 2JVRA 2AEJA 3OW2R 3OXGA 2YNIA 3H2UB 1IBCB 2UV8A 3GV8B 1VQYA 1NJYA 4DV1F 1HNVA 1YJUA 1NJIT 3R1HA 3D6FB 3AHPA 5CXTA 2D3UA 2VQFF 4CQ1A 4ECYA 5J2NB 1SB6A 1D0EA 2BOAA 4PEOA 1RHJB 2VDIA 1L3VA 2GAHC 3EYZA 4YEAA 3EWGA 2QLFB 2FQQB 1ZM2A 3MF5A 2X51A 2C3PA 1X4DA 2EPIA 2KG0A 4USJC 5KFJA 3A8IA 3ZZYA 5CHCB 2OLWA 2W2NP 1NM2A 4CH0S 1UFLA 4WK3A 3L4BC 1TK8A 2YH0A 2JSXA 3CEDA 3SCJE 3KLHA 3D5MA 4CP5A 4IRKA 3OVSA 2JEGA 2Z4PA 3A8KA 4LJMA 1U1RA 5A8WA 2HLTA 4XO0A 2R3VA 4DR6J 4NLGA 1JJCB 4DN9A 3G2XA 5BR8F 1NH8A 4NLXA 3MUVP 2V8VA 5IM0A 2MZQA 4QWAA 2Y1RI 3FC9A 2V63A 2C2MB 3GMGA 1SJQA 3H5YA 4WU2A 4CWBA 5J1PA 5AXNA 4ID5B 5GVQA 3THVA 4LF7F 2RB7A 1WHWA 5ETVA 3C3LA 1X4GA 3EZ5A 2EG2A 3ZC4A 1FK9A 3T1HJ 1VC6A 2N82B 1F9FA 4OIXA 4URSA 4HDGA 4UUWA 3GZ7A 1U09A 2I38A 1T95A 1BC6A 1YQHA 1SCJB 4DL4A 2HZVA 3R2CJ 3VAMA 1BHNA 4MFBA 4YR3A 5D0GA 4Z2XA 3M2UA 3G8SA 5LMUJ 3B4DA 2R7QA 2WAQD 1S7HA 3B54A 4Q5VA 1HLWA 5AJ3J 2HAFA 2CWKA 1VIOA 2K1RA 4O3NA 1RKJA 2A3JA 3DOKA 1DRZA 1IKWA 1TKXB 4B3OB 1GTEA 2FJXA 4HR2A 5E3PA 5E3CA 2WBRA 2ZHBA 2IPOB 3MR7A 1M5KC 4PYAA 2E5LF 1M90T 3P96A 1AROP 3HFZB 2BM1A 4B3SF 3F44A 3RB4A 2CG8A 4CDIA 2RHSB 3TARA 4LF6J 3VGUA 2D41A 3A8EA 1RTHA 1LNQA 1Y3KA 2VKRA 2PDAA 3M8PA 4LBPA 4OJ3A 1YSJA 3GB0A 2QGFB 2AF6A 4TQRA 4FXWA 5ETLA 2JEFA 3OTDA 5A8KB 2P2CB 4F2RA 3WBZA 2DYAA 3UPFA 2VZ9A 3MAHA 4CLZA 1SJ4P 1RTIA 1N48A 5T41A 4NXNF 1EX8A 4PXDA 1ZETA 3HFKA 4WP9A 2LYVA 4LSNA 5AE1A 5A2QU 1BWVA 4K50A 1U26A 4ZVHA 1RT1B 1HMVB 1HBMB 3V81B 2AHOB 3CJKA 4OI6A 4LIWA 1D3WA 4DPYA 3W5YA 4O0NA 1EETB 3WDOA 5DO2A 1DURA 4R8UB 2UU9J 1EQMA 4Q2LA 2VG5B 2BJ8A 4KYZA 3CJ4A 2H4WB 5D4OA 2IYIA 3C16A 4LRDA 1FHTA 3ISNC 3NWRA 1RBOB 5HO4A 3DRSB 2NZCA 1RHRB 4DV1J 2GQQA 4LMZA 3R7SB 3BZQA 2VQFJ 4CO2A 3DOMB 2MSSA 2H5IB 1U48A 2BW7A 3CO9A 5ETQA 2EG1A 3I4HX 4KHPF 3PX6A 4Y65A 3DLLQ 1LQ9A 3MCMA 2R7TA 3LA0A 2JLEA 4OYMA 4K4UA 4O3QA 4Y2IA 1QAJA 1KHVA 2CJ9A 1JLBA 2YKQA 3GFHA 4F26A 2XMWA 1T9WA 4M5KA 3BSCA 4IR1A 4DI6A 4N47A 1U6ZA 3QATA 2FHJA 2GQCA 3NMAA 3KK1B 1R6YA 1WDTA 1UJ5A 2HQ3A 3CSKA 2U1AA 5EX3A 3FSIA 1X4EA 1HBNB 3Q8PB 3BBFA 5BR8J 4CLTA 5HROA 1C4CA 4NX9A 2HNYA 5LSRA 1QM9A 4DSEA 4F25A 2QX0A 1RA7A 4N41A 1WSVA 2O1PA 2Q3PA 2J0XA 4LF7J 2EVZA 1RSCA 1BUXA 1S9EA 1NHKL 3GYXB 2EFOA 1DTQB 2B8QA 4QPXA 1FDBA 4IO1A 1BLUA 2CQ1A 2X7IA 1JX4A 1DTTA 1YITS 4A8YA 2ZKTA 4FXVA 2BQUA 5JUMA 3QIPA 1IR1A 1I51B 3HKWA 3WIUA 3ZTQA 2MHEA 3PW0A 3SCIE 5M2PA 3WC0A 1ZZFA 3KDNA 5B0GA 2HWHA 4K4YA 5ADZA 3TA2A 1SIZA 2AWZA 1R0AA 2LA4A 3FSYA 3W2WA 4ZJQA 1BMQB 2VU5A 4X4TA 1MNEA 3TZXA 1REVB 3OT9A 2W2QP 3H40A 1W26A 1HQUB 4UZBA 2VB6A 4NLQA 1RT3A 4YB7A 3MWBA 1WG4A 1N36F 1UWBB 1YBUA 3DLJA 1FKOB 1N5YB 3LAMA 4BS2A 2GMLA 4WBFA 3IBWA 4ZOSA 5E7OB 2Z2LA 3MCOA 2PMZD 1FX4A 1WC0A 1OIAA 5I42A 2J9EA 1SUQA 2E5LJ 3G82A 3C46A 3TZZA 3ILLA 1H7WA 3RBEA 4B3SJ 4OI4A 2FJWA 4PXEA 3DGVA 3ZFVA 2EKNA 1U6BA 2EFVA 3AQOA 4C8OA 1X31C 2YQ0A 4U8VA 5FLXY 2XMJA 3CDUA 5KG4A 3TZWA 4YHHF 2ZHOA 3T1AA 3QLHA 2MKSA 1S1TA 1HD1A 4CI0B 3MOZA 2WCXA 5DRKA 2GZOA 3AB2B 4NCBA 5C24B 1WOPA 3E8OA 4X66F 3M8YA 1HW9A 1U1OA 1DHMA 2OJ3A 4LVNP 2MZRA 3M2RB 4PXCA 3UI3A 1YZ6A 3RJMB 3VALA 1N32F 4NXNJ 1FTRA 2ZBCA 2SXLA 2KJWA 3K58A 4ED6A 1GMUA 1AUSL 3BR9A 2ZH7A 5B0CA 4OZ0A 3C6UB 4K2XA 5AXMA 2H3EB 2E9TA 3AY0A 2IA6A 4EYHB 1R89A 3P49B 3LWLA 1OO0B 1H0HB 1IQZA 2AP6A 1R8CA 4ZVSB 4KFBA 4V19J 2B4PA 2DNGA 1VBKA 2LXIA 2ZH1A 4Q2MA 4ZN3A 4CLUA 1QJHA 5GAHI 5C2CA 2VFVA 1KVKA 4KHPJ 3DLGA 3UCGA 3D54A 2V68A 3EDQB 1RGVA 4TXSA 4C2MA 2G0JA 1B0VA 1M5OC 2ZOGA 4ZVFA 2Y1LB 1WHVA 3MM7A 3FBEA 4KPCA 2R7UA 4AFFA 4L3KA 2CFXA 1B3TA 4PWUA 2WOMB 3LP2A 1FD8A 2G2YA 2NSCA 4M5DB 4ZS6A 1KONA 2OPSA 1X60A 5IT9U 2HURA 3R7NB 1KD1T 3SSRA 2IBKA 1NPKA 1Q53A 4H4MB 1RXOB 3R5AA 2ZJQQ 2PD1A 2QMXA 3DRRA 4PG6A 3HMJG 4UQGA 1S6UA 2XSJB 1C1BA 4ZPDA 3C8YA 3OVBA 3BS9A 3L09A 2HFUA 4DL0C 2D9PA 1U1LA 5K20B 1KFDA 4CO3A 5J1NA 2VV5A 3V6DA 1WTBA 1ZS6A 2DGSA 2LLZA 1GMWD 3M4XA 1B64A 2E29A 4LF2A 5D77A 1T02A 4HH1A 2MQMA 3RW6A 3MAAA 1O5JA 3IR5B 3KYLA 2DGTA 5HP1B 3W5ZA 2HFOA 4NLYA 3SCKE 3N5FA 1NK4A 1RA6A 3H2VE 1JKHB 1GNKA 3UNYA 2DK2A 1RYSA 3CNQP 5C42A 2M2BA 2Y8WA 4LR7A 4C3KA 1UP1A 2COLA 2V8GA 3RRHA 3T5JA 3D1QA 1CJUA 2YKNB 1JJHA 4AQYF 4CH7A 1WKJA 1U0HA 4UOHA 4DX5A 4L73A 2DGWA 2AIRB 2ZBIA 3CC2S 1N36J 2VIHA 4CCHA 2KL8A 3MM6A 2H65B 4DWIA 3E01A 4EGLA 5CH7B 2VFUA 3LAKA 4DCOB 3O2IA 2OO4A 2CJBA 3LGHA 2DHHA 4LR8A 2CQIA 2CQPA 4A8WA 4A8FA 2IRYA 4AXJA 4DDFA 3IO1A 2LKZA 3KMSA 1YJTA 4R5PB 2IIHA 3UR0A 1S9GB 8RUCA 2RQMA 2D7SA 3FEZA 3HVRA 2RRNA 4ILMA 4NLVA 1FEEA 4YHHJ 1UZHA 4NZ7A 3LPYA 1F60B 4NRTA 4N56A 2LVWA 5L8RC 1VC0A 1S1UB 4X66J 4LT6A 4Y2KA 1NKCA 2C22A 2HVHA 3BSAA 3QWUA 2Z56B 2XHCA 1TELA 5DJBA 2HRYA 4EWTA 3J80U 1SXLA 1N32J 1VQNS 5HMZA 1GMVA 2BYCA 1SC4B 1PBAA 1SKWA 3N4WA 2ZH2A 3PW7A 2A6OA 3RRKA 4E8UA 2GMHA 2UZAA 3LALA 1SKUB 1AZSA 2BANB 4C0OC 4OHYA 2FVSA 2AMCB 4F0KA 1EIYB 4DQSA 3MPDA 2VJVA 4F02A 3Q2TC 4QR1A 4MH8A 3AA8A 2V8DA 3EDRB 3GP9A 3KG0A 3HK2A 3CCZA 3W65A 3ZNJ1 4GKJF 3OR2B 4P71A 2HHSA 2D1CA 2GMJA 4KR0B 2FD2A 2YNFA 3R9LA 1CULA 1V3SA 1EHWA 4K59A 2X1AA 4QYZK 2BUNA 2DH8A 1FFGB 7AT1B 1PG5B 5E3QA 1R8HA 5LL6d 4EFAC 1C0TB 2DRAA 5IWAF 2AW0A 1UVMA 4PXBA 2QIFA 4J5OA 1Q81T 1SH0A 4NCGA 3QO9A 2V2KA 4NCAA 2HFZA 4U7UK 3RRGA 1HKAA 1EP4B 1FRMA 4KGVB 4CTAA 1NJWA 5T7LB 3IRWP 2HBQB 2P5VA 3DDKA 3OR1A 3LP1A 4ITSA 4Q44A 1L3SA 5KFGA 2L9DA 2HMIA 2ZOFA 2QEXS 1YG0A 2AV5A 4ZPTR 4HDHA 4DL3A 3G4SS 1DQ8A 3PR5B 1XMOF 1NHUA 2V9KA 4JI2F 1PC5A 4UOFA 4XAKA 4RNOA 2KXFA 4X4VA 2FHOB 2JDJA 2EK6A 5HJYA 4DLEA 4A8KA 3P8BB 4HVZA 4JV5F 3TJAA 4F36A 1TTHB 3JSMA 3Q23A 3C14A 4LFAF 2EC2A 3UD3P 4PZVA 3GV7B 1E6VA 3CB4A 3X1LB 1IR0A 2DISA 3EVMA 3K5OA 4OI2A 2JL9A 2C2KB 3AQPA 2HAIA 3R6LB 2IVYA 1WKLA 5SUHA 4Y00A 3UDLA 2HQFA 2WW8A 4CM0A 4WU3A 3M9NB 4NEYA 3S7RA 1EARA 2Z30B 3KHRA 5CYMB 5B08A 3QRRA 3M8QB 4NYPA 3R8YA 4C4WA 5D8HB 2VG6B 1WWHA 4HHUA 4KV8B 3BKFA 2FVCA 4ZVTB 2BRKA 3PKMA 4CNZA 4AQYJ 3B4MA 2X1GA 1Q1KA 1WUUA 4JI6F 1QE1A 4HH0A 2HHVA 4ZA1A 4JI3F 5A76A 3PRBA 4WKYA 4J9QA 3OLBA 3UN2A 5J2MB 3QYYA 5KFFA 2W8LA 5KFNA 5EUHA 2Q6CA 4WFZA 3MPUB 3I9ZA 1U1MA 1E6YB 2MGZA 4QZVB 3BYPA 3T1YF 1I5OB 2O66A 2EK1A 1QUVA 5MAOA 1FJGF 2HZCA 3MPYA 3HM9A 5CD4H 4KGMA 3HHEA 1VHIA 1VBYA 1GQEA 3VVTA 2CVEA 1P1LA 3SSQA 3DXSX 4EEYA 1HQEA 1XQIA 3VAFA 2V4JB 3ET6A 3OVAA 2CNKB 2QTWA 3SDEA 5FDLA 4F4YA 2CPHA 2NXEA 4I68A 3RTVA 1YJRA 1TL4A 1FFWB 1R27B 3PR4A 2DNNA 4RUBA 1JWWA 1VRQC 4JI8F 1SC3B 2CQHA 2ZD1B 9RUBA 1KRPA 1WEZA 1S0MA 4DL2A 4KE5A 4PG4A 1L3TA 2D74B 4E0DA 3NCQA 1X7VA 3WZ0A 4C11A 3FFIA 3NS6A 3VAIA 3OLAA 2D69A 4B9TA 1RTJA 4YDDB 3W7BA 2BKPA 3TVKA 3O5TB 4LRFA 2MQ8A 2UP1A 4IG3B 5F0UA 4MK7A 3DI6B 3MEGB 1YIJS 2OAUA 3IFEA 1HR0F 1F5BA 3CDEA 4GKJJ 2XYHB 5IS2A 4CLSA 3Q86A 1RAGB 1RT6A 5ETNA 4U7CA 3CUNA 5F41A 5I3UB 1VQ7S 4ES1A 2IY5B 4LRBA 1VQMS 2PFFB 2EI5A 5DDOC 1N33F 3OSNA 4RNMA 4PQAA 4OYPA 3TAPA 3EZOA 2R8JA 1RWMB 4PYDA 2LQBA 1K0VA 1FKPB 1OSCA 4OZNA 1PGZA 2EWHA 3EZUA 4WXWA 2WK4A 1UJ6A 2VHGA 4C48A 3LGNA 1M1HA 3PZPA 4HACB 1FE0A 2YWKA 1TAQA 4DX8H 3MOJB 1B99A 3BYRA 4OLPA 2XMKA 1RHKB 2MKHA 1O6XA 4LF5F 5DETA 4PQUB 3D6MB 4USIA 3V4MA 2R8KA 3KLGB 2XO6A 2VDHA 3QGIA 3KJFB 3IG1A 3GSIA 1VQPS 5B0FA 1IBLJ 1HI8A 1V3RA 1JLGA 2OFHX 3QNWB 1HQ2A 3H8YA 1XMOJ 3HPOA 1X4CA 1YZ7A 4JI2J 3OL9A 5E2QA 2HW3A 1FXRA 4DV3F 5HMYA 4DL5A 3DLBA 3MEKA 3GIIA 5J2QA 4JV5J 1NK8A 1RAHB 4AT1B 1S57A 4LFAJ 3HD1A 1YWXA 5THWA 1TVRB 1X8DA 2W2OP 4K5SA 2E7WA 4JP8A 1HNIA 2IAJA 4DFJA 3UN5A 3P45B 2BR0A 1S6QB 4YN3B 4K4WA 2KYZA 1LOUA 1BY9A 4NI2A 5U47A 2HVIA 1P1TA 1OQ6A 3NBPA 3D4JA 3W9HA 3BPDA 1REGX 1JK9B 3IRXA 3BV8A 2EFNA 4FZVA 4HT5A 3PFEA 2MY8A 1D09B 2YQ3A 1Y7PA 3AJ1A 4JI6J 4YR0A 4O3RA 4NASA 4JI3J 1N0UA 4F0MA 3DM2A 1NHVA 2KTQA 2GGPA 3FQKA 3GR1A 5EHHA 3CMES 3JAMU 3NOGA 4D3GA 2IYGA 5JXSA 4IOAQ 1K47A 2DNZA 4MKBA 5KT5A 1URNA 2XG8A 2YKAA 3DGPB 2WVCA 4J9KA 4AXIA 1RBLA 3DLEB 4QPTA 2QJ3A 1TUVA 4I1TA 2H5JB 3LH2S 1VGYA 2BE2A 3T1YJ 3D28A 2WVBA 2ADCA 3GJRB 1RAFB 5CZVA 1JXEA 1J5EF 4NA1A 5E3AA 1TFWA 1FJGJ 2DT9A 3KLEA 2K06A 1GXTA 3HX9A 2AZ3A 2ZWPA 5KT2A 1S0NA 3M2VA 1JLFA 3W3SA 3FVYA 2JVOA 4C8MA 1LV5A 2ZH3A 2M9KA 4F3QA 5K14A 1NPPA 1RE1B 5I4MA 1NSAA 3GILA 1JLAA 4I2QA 4DOZA 1R8BA 3ZZPA 4KGKA 1RBAA 3US5A 2VH7A 3HT3A 2ZC4A 3I0RB 2XYGB 2VC1A 4QCLA 5C5JA 1RI7A 2F9DA 2ZC3A 3TEGA 1X5OA 5GMEA 4W90B 2DRBA 4QWDA 4F4ZA 2NSBA 3U1MA 2BDPA 2AZ1A 2W7AA 5KAKA 4M5IA 2OEJA 4JI8J 3PIOQ 1JLQB 1TL5A 1X9MA 2PIIA 3MMCB 1MU2A 2ZKUA 3UVJB 2LXFA 1IKXB 2B9WA 4P7VA 4LIRA 5C2GA 5KFMA 2GVDB 2X3GA 2DD8S 3KUGA 3BH7B 2GA7A 3D2WA 2M3DA 4ZPBA 2MZTA 2Y9HA 4U7UD 4O4GA 3G6VA 2UVUA 2YNIB 3IR7B 3L3CA 1FWLA 1Y00A 1EQ0A 3HO1A 3V2UC 1HNVB 1HR0J 1TFYA 5H1SV 3CCVS 1NSKL 2PN6A 3HF5A 3HXMA 1UVKA 2DVIA 2QSWA 1VRTA 4USMA 2HGNA 4FYDA 1EJ7L 4UTGA 1N33J 1J5OA 2ZFHA 1Q78A 4ZLLA 1DQ9A 3SIPB 2OPQB 1MSWD 3T5HA 4DV5F 3EE3A 1RU2A 2XNQA 7FDRA 2CQ4A 3AODA 3OFFA 3K8VA 4AE5A 5RUBA 2E9RX 2QA4S 1FRJA 2CQ0A 3KLHB 4FBTA 3SCLE 3TW0A 4K7QA 4FYVB 4K4SA 2OPRA 3L95X 4LF5J 4Y28C 5I3PA 3W2VA 2RU3A 2IM2A 2XS5A 1FI4A 5A8WB 1RB0A 3A8JA 2J5AA 2B7CB 2QL5B 3SXLA 2OD6A 4QYRA 2AGPA 4X62F 5IM0B 1EKRA 1SPBP 1HBUA 4IDKA 1XBWA 1T3OA 2MKJA 3EGZA 5GMDA 5D6GA 2AGOA 1HWJA 3BB5A 5F9LA 3N01A 4DUYF 3IR6B 4DV3J 3DMJB 4UF4A 1RTDA 1T3NA 1U7LA 1U47A 1U8SA 2NLWA 2I5JA 3PDNA 3PIPQ 1FK9B 5A6WA 1CS4A 3EMTA 3MMJA 2OIHA 1CJKA 1YRXA 4ECQA 3TOQA 1IVZA 4EK2A 2YWEA 3OTBA 4R0EA 5CQGA 1XMBA 2EEYA 3JS9A 1UW9A 4MFBB 1DBDA 5E5NA 3J81U 3M2UB 3SI8A 4CYUA 3NNHA 5D3GA 5JMNA 3BGLA 1JQGA 2I6WA 4NWBA 3EX7B 1ZTTA 1U0SA 1G6BA 2XYPB 2MLZA 3DOKB 8AT1B 1IKWB 3CCUS 1OWXA 4RW8A 4XPCA 3HHNB 4BBYA 2R42A 5DDRC 3GLJA 5CA5A 4P72A 3CCWA 1WC6A 3GIRA 1NKBA 3PHTA 3DYAA 2DGOA 4JV1A 1OQ3A 1NKEA 2ZHAA 3DDNA 3GFXA 3T5KA 1J5EJ 1FERA 1Z1ZA 4MYUA 5K5MA 1YKWA 4DHVA 5L46A 4XTTA 4B08A 4QWBA 3JTNA 1RTHB 3ZTOA 2C42A 2M52A 2QLWA 1Y5IB 3M8PB 1J2VA 2DR9A 1RABB 3TUZC 3W61A 2AYGA 1HYSA 3V4IA 5AE3A 4F3MA 3FGVA 4L74A 3JQJA 2W4DA 2XZTB 3V6KA 4MKYA 3L7OA 2E66A 1HIYA 4AD6A 1SI9A 1EB0A 2UUCF 1Q5YA 1RCOB 2DNPA 5IV3A 2GCFA 2DY1A 2ASJA 1RTIB 4OX9F 4O4RA 4X4NA 2ZH6A 2RDDA 3MEDA 5IFMA 2FHJD 4LSNB 4Q8FA 3OV7A 2WONA 2MKYA 3NGSA
chains in the Genus database with same CATH topology
4IOBA 2EBGA 4Q0BA 3I5BA 1QLNA 2Q43A 1P8GA 4RW8B 2FHJA 3A1YG 5CCLA 3CJKB 4YUDA 2GQCA 3MXHP 2GV1A 1P27B 2WBMA 3FJ2A 3NMAA 3ICLA 5M2UA 5HMXA 1WNEA 3KK1B 1R6YA 4KO0A 2BJEA 4Y3CA 1REVA 2AQ4A 2QSFA 1Y5LB 1S0OA 1UJ5A 2HQ3A 3BQ2A 2OFGX 4JOUA 2J0QD 4OL8A 3ENQA 1KVIA 2GO8A 4EO6A 2F4VF 1QSSA 4GC6A 2G13A 1HQUA 3H20A 3CSKA 4DV4F 2U1AA 2XSFA 5EX3A 4TU8A 2QLXA 3FSIA 1X4EA 1HBNB 4JI4F 4UQTA 3Q8PB 5FIIA 1XC9A 1RKIA 2ZH4A 1UWBA 2R2UA 1S1WB 3DYAB 5D4PA 5HROA 1MMNA 3MI7X 1FKOA 4NLSA 1C4CA 4NX9A 3CCTA 2GC8A 1M5PC 1N5YA 1CG2A 1S79A 2H5EA 2HNYA 3OJSA 5LSRA 2EFQA 1QM9A 5K8NA 4DSEA 4DQPA 4MIAA 4TU9A 1XNRF 4RNNA 2AJ0A 2RQKA 2U2FA 4F25A 2G0CA 1RA7A 1CPZA 1KOOA 1RQ0A 1B0TA 2WHOA 4ZP7A 2B6AA 1ZTWA 2B56A 4DN0A 4YFUA 4N41A 3BQ1A 3TI0A 2O1PA 1ZYQA 2Q3PA 4ZCLA 3SV3A 4A47A 2XCPA 2ZH5A 1X4HA 2J0XA 4I4BA 2XNRA 2JRSA 4ELVA 2JZ5A 2QFJA 3EXCX 2EVZA 3Q22A 1VQ9S 4RW7B 2VASA 3U7JA 1S9EA 1VQOS 2DHAA 3MM6B 4WIIA 4C98A 3GWCA 3GYXB 4J9OA 1HYSB 2EFOA 2P6SA 1DTQB 3V4IB 3E01B 4QPXA 2MSTA 5L1KA 1FDBA 4IO1A 2Q6BA 4XK8C 5GADU 4A8QA 1BLUA 2CQ1A 3KK2A 3GFZA 2NPFA 1XNQF 1QTMA 1JX4A 1LFWA 2ERRA 1DTTA 1YITS 4A8YA 2ZKTA 4FXVA 5LSLA 2BQUA 5JUMA 2QZ8A 3DRPB 2KU7A 2O67A 3MMCA 2UXDF 5B7WA 2LEPA 2DHSA 2CRLA 4ILLA 3QIPA 1F5AA 2IRUA 3HKWA 3R5CA 3J80Y 2MHEA 2C3UA 3GIMA 3PW0A 1JLBB 2R7RA 4I64A 3B78A 3FNNA 1IM4A 1TQLA 1ZAXA 3SCIE 7FD1A 1U2FA 2LMIA 5M2PA 4CO1A 3WC0A 3K5LA 1ZZFA 2J0WA 3MEDB 5B0GA 1U45A 1GH8A 2HWHA 4K4YA 2WONB 1WI8A 5ADZA 4GO7X 3TA2A 3RB0A 4DG1B 2RH3A 3V5RA 1SIZA 3POTA 4P2SA 4I56A 5F8GA 2AWZA 5C24A 2LA4A 5H9EJ 1R0AA 4N8NA 3FSYA 4Q0BB 2Z2MA 2E7XA 3W2WA 1RWUA 4X4TA 2YX7A 4F4KA 1S77D 3OHBA 2KH9A 1MNEA 4PR6A 4H4KA 2OH2A 2HLUA 2M70A 4KO0B 4TYAA 1REVB 1BQMB 3IS9A 3OUYA 1FNMA 2R2RA 4OI1A 2HS0A 3H40A 4MMOA 2WTFA 2UXCF 1HQUB 3O8WA 3M1VA 4ZLPA 2VB6A 2KI2A 3BR8A 3TAMB 3LANA 3G6XA 3T9NA 4NLQA 3R3TA 3MAQA 1RT3A 4YB7A 3ZZUA 3MWBA 1WG4A 5JVHQ 1N36F 4PWDB 2XI2A 3AA9A 5GAEI 1UWBB 3OFGA 4ED5A 3PV8A 3KTQA 5HROB 3DLJA 1FKOB 2MJUA 5DS7A 5G4DA 4ZDNA 3CIZA 4MK9A 1N5YB 2DITA 2MQOA 2AYMA 2HNYB 4KB7A 3LAMA 3PXGa 4BS2A 2LCWA 1BQXA 1O51A 2GMLA 2HHWA 1HWUA 3HLUA 4ZP8A 2RDIA 3IBWA 4ZOSA 5E7OB 2Z2LA 5LMNF 1IKYA 2PMZD 1JNRB 5J1EA 2ZZMA 2VOPA 2V8HA 1XR7A 1OIAA 1R7IA 2B6AB 2DNHA 4ZP9A 2F40A 5HBMA 2PE8A 3G71S 2RT3A 4RZRA 2J9EA 1SUQA 3MM5A 4FS2A 5I42A 1QSYA 2E5GA 5DM6Q 2OPQA 2YKOA 1LKZA 4WYWA 1HPZA 4ZHRA 4IG0A 3CCJS 1YJ9S 2BA9A 2ZDOA 1HNWF 1S9EB 1K1QA 2G4BA 3C6UA 3CCSS 5D4NA 4LUBA 4DQRA 3K8WA 3VCDA 3C46A 2HGMA 3M6WA 2I2YA 1YJWS 1H7WA 3RBEA 2DGUA 1QVFR 3B8HA 4DS5A 4X4PA 3KK2B 4OI4A 2EFGA 5KG2A 2FJWA 5KT6A 3ZZTA 4PXEA 2GFFA 1DTTB 2M0GB 1UVJA 3F56A 5F3TA 4FP9A 4AL7A 2ROGA 4U6PA 1U1KA 1IBLF 5F3ZA 3QZ7A 2CQBA 5KFPA 3ZFVA 3DRYA 5E41A 3DNCA 4ZPWR 4NLDA 4OHZA 4ALZA 1SL1A 1U6BA 3JSYA 3FDSA 3QIPB 1FRHA 1RT7A 5KFKA 4QQBA 3DU5A 3MM9A 2EFVA 3VQTA 2VA3A 3AQOA 5CZXA 2K7JA 4C8OA 2L3MA 5KFAA 5FLXY 2DCLA 1QUPA 3PFOA 2XCAA 2XMJA 1K1SA 2AGQA 3CDUA 4ICLA 5KG4A 4YHHF 4X64F 4FPRA 2ZHOA 3T1AA 3QLHA 2MKSA 1S1TA 2YNFB 3KLIA 2QRRA 3PHEA 4CI0B 1CVJA 2A2CA 2WCXA 3DC2A 2F7VA 3MOZA 5DRKA 1UA1A 2W9BA 3AB2B 3KMQA 2CPEA 3DXBA 3POTB 3Q8SB 4NCBA 3AB4B 3QGPA 1UVIA 5C24B 1R8AA 1R0AB 1DJ0A 2UUAF 3O6QA 1UVLA 3DFEA 3W2WB 2MXYA 4TN2A 1RT4A 2MKCA 3E8OA 4O3OA 4X66F 1HW9A 2PMHA 4RNFA 3RAMA 1U1OA 4B3OA 1DHMA 2ROPA 2C2DA 2OJ3A 2XY5A 4LVNP 1G7CB 1D9AA 3JSBA 2MZRA 1SBRA 3M2RB 4ZVGA 3PW5A 3IS9B 3J7YI 3OUYB 4PXCA 3CT9A 4W92B 1NZAA 1IBKF 3UI3A 1UEUA 2ABYA 3HDSA 3VALA 1N32F 2CVIA 1FTRA 3M1VB 3PVXA 2ZBCA 4B3MF 2SXLA 4N77A 1SJFA 2F8EX 1RAJA 3C6TB 2M7SA 1RT3B 4FF4A 4M5DA 1A6LA 4B3RF 1Z2ZA 1ZOTA 3ISZA 3H2LA 4B9SA 2HG4A 1ZM4A 3DMJA 5DLFA 5KFLA 2KJWA 2B9YA 1U2RA 2HHHF 3QO9B 2VODA 2PSZA 4DV7F 2HS4A 3L7PA 2DJWA 3K58A 1YTYA 4UOCA 5AE2A 1HL6A 1VQ5S 3VR1A 4H4MA 1IKYB 4ED6A 5J1EB 3KHLA 4NYZA 2PGCA 5HBMB 1HARA 3KG1A 5KFSA 2E5JA 2JOQA 3DHXA 3ISND 5IXUA 3PY8A 4DR3F 3MM5B 1SUQB 2ILZA 4I2PA 3BR9A 3G86A 2ZH7A 1FXLA 2HVZA 4NL5A 5B0CA 2XGPA 1VQKS 4QU6A 2XSJA 1HPZB 4ZHRB 4IG0B 5KFYA 3UWTA 2IFXA 1HA1A 2YKPA 4OZ0A 3C6UB 2RS8A 4K2XA 5IQQA 5AXMA 1QVGR 5KFIA 1YBAA 5KFWA 5KT7A 2L9WA 1UJ4A 4CIOA 2J7UA 2W7OA 2HMIB 1VS3A 3AY0A 2E9TA 4RU2A 1CLFA 1CQNA 4WK1A 2IA6A 3M05A 5L1LA 2FC8A 1R89A 4G1QA 4J9NA 4EYHB 3P49B 2IM1A 3LWLA 3RR8A 4ECSA 2Q66A 2FGCA 2CQDA 1OO0B 2J8AA 1KNZA 1H0HB 1LWFA 1Q8IA 1IQZA 2A2DA 2AP6A 1NEEA 1R8CA 4KFBA 2MQQA 2FJVA 4ES3A 4F4XA 4FF1A 2GHVC 4V19J 2B4PA 2DNGA 2XMUA 5L38A 3Q8RB 4O44A 3M8RA 5EGYA 2NS1B 2KDOA 3RAXA 1NH7A 1TKZA 1N56A 4ELUA 1RT7B 2LXIA 2NQPA 3M9MB 4Q2MA 2ZH1A 1C2PA 3MM9B 1G2EA 3MCSA 1P9QC 2DB1A 5LJ3Y 5GAGI 1QJHA 3JTOA 3LUYA 5EX0A 5GAHI 2VFVA 4ICLB 3U02A 2XI3A 3DLGA 1NK6A 3UCGA 1KSPA 3QLHB 1S1TB 2XMMA</