5LSLA

Crystal structure of yeast hsh49p in complex with cus1p binding domain.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
b'GNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein HSH49
publication title Crystal structure of U2 snRNP SF3b components: Hsh49p in complex with Cus1p-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding domain
total genus 21
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lslA00
2F3JA 2RRAA 2D9OA 3L3CA 1A7GE 1U2FA 3SXLA 3S01A 4QQBA 2YWKA 2MQQA 3MUTP 3OW2R 1WTBA 3JB9k 2DNQA 2X1AA 3CCES 3FEXB 1FO1A 1X4EA 3R1HA 3P5TL 5HL7Q 2DB1A 1P27B 3CCMS 1WI8A 2MKCA 2DGOA 2CPIA 1URNA 2MPUA 1NJIT 2ZJPQ 3VAGA 2KG1A 2MKKA 1OPIA 2DIVA 1M5PC 3TO8A 1N8RT 2D9PA 2LQ5A 2LMIA 2FC8A 1K9MT 1SJ3P 1HD0A 2DNHA 1W2BR 1DBDA 2MQPA 2LYVA 2KT5A 3EGZA 2RU3A 4PRFA 2M2BA 2FPHX 3U1MA 2QA4S 2VODA 2M88A 2DH8A 2DGSA 1VC6A 2A3JA 2I38A 2U2FA 2MJNA 1S72S 3RW6A 4W92B 1WF0A 4OZ0A 2DHGA 1WF1A 1VQ9S 3G8TA 2Q79A 4QPTA 4CQ1A 1VQ7S 3IWNC 2LXUA 2CQIA 2DNLA 2MZTA 2BZ2A 1U1RA 2MQMA 1VBYA 2HYIB 3U1LA 4IOCQ 2X1GA 3VAMA 1X4BA 2LEAA 2DK2A 5FJ4A 1VC0A 5DDQC 1UW4A 3VAIA 2MY8A 2CQ1A 5LSOA 2ERRA 5LXRA 1Q7YT 3D2WA 1YJWS 2HGLA 2CPHA 3NS5A 2DGVA 1WEYA 1AUDA 1M90T 3V4MA 2XS7A 1KC8T 1HD1A 2DNZA 3NNCA 2DITA 2MQOA 4QU7A 3UE2A 1WHYA 4IO9Q 2X1FA 3B4DA 3CCUS 2RS8A 2FHOB 3I55S 1G2EA 2MY7A 2CQPA 2VOPA 1YI2S 4CIOA 2KXHA 2KXFA 2CPEA 3VAHA 3MD3A 3PIOQ 3CMES 4J5OA 4EGLA 2G1DA 3R1LA 3NNAA 1RKJA 2MMYA 3CXCR 2FC9A 1IQTA 1WG4A 2DGUA 1YHQS 2N3LA 2QFJA 2KI2A 5BJRA 1U1QA 2DIUA 2CQDA 3Q2TC 2KM8B 2YH1A 1X4AA 3CTRA 3VAKA 2CPDA 3BO2A 2DNRA 2KG0A 3MUVP 3VAJA 3J7YU 2MSTA 3VF0B 2KH9A 3S6EA 1U1OA 1S79A 4WFNQ 1N52B 3PIPQ 3NMRA 2N3OA 1F9FA 2OSQA 2N7CA 2DH7A 2E5JA 2EK1A 1M5KC 1X4GA 2UP1A 1FNXH 2DHAA 1QVGR 2LECA 2X1BA 2CPYA 3UCUP 2CQCA 2GO9A 2MXYA 4YOEA 3B4MA 5IFMA 3MI7X 4UY8T 4LJMA 1FXLA 1U1NA 3CULA 4LIRA 1HL6A 2DGXA 5CXTA 1BY9A 1VBZA 2K8GA 1OO0B 2OJ3A 1OWXA 1XN9A 2WBRA 2JVRA 1VQ6S 2O3DA 1WEZA 3ULHA 1N54B 2ADCA 4WFBQ 2DHXA 2LA4A 3G71S 1CVJA 1U6BA 4PKDB 1VQKS 2MQLA 3H2UB 2JX2A 2YKAA 1PO6A 1WG1A 1VQOS 4A8XA 2MZQA 4F26A 3P3DA 3VALA 3DLLQ 4YUDA 2RT3A 1SJFA 1YIJS 3DXBA 5JVGQ 2MHNA 2KXNB 1VQLS 1X5TA 1JJHA 1X4CA 2CQ4A 2MKJA 1ZH5A 1WHWA 3CC4S 2M52A 2LA6A 3IRWP 3BO3A 3MOJB 2VOOA 2J76E 1H2TZ 4LMZA 1U1KA 3J7ZT 1VBXA 2G4BA 2K3KA 5HO4A 3CD6S 3K0JA 3UD4P 2D3OR 1YWXA 2OSRA 1SJQA 2JWNA 2M0GB 5DM7Q 3HHNB 1DHMA 1B7FA 4BS2A 1X5OA 1QVFR 5GAGU 2ZJRQ 2E5GA 2CQGA 3R27A 1ZZNA 3CF5Q 2KYXA 1NU4A 1D9AA 5LSLA 5DDRC 3MXHP 5DDOC 2LKZA 1JJ2R 1NO8A 2XSFA 2L9WA 1FJ7A 3CC7S 5LJ5Y 1R8HA 2J8AA 2OTLS 2CPJA 5LXYA 2HZCA 5CA5A 1SXLA 2EVZA 2GHPA 1X0FA 4F02A 4QU6A 1YTYA 3SMZA 5H1SV 4U67Q 4C7QA 3UCZP 2KHCA 2KRBA 3EGNA 4WFAQ 1PGZA 1FJCA 2LXIA 2MZSA 5JVHQ 1YITS 1X4HA 5GADU 2NLWA 2EK6A 2XS2A 1U1LA 2CJKA 1Q82T 1DZ5A 4C4WA 3P6YC 2CPXA 4PR6A 2LCWA 5DM6Q 2AD9A 1VQ4S 1FJEB 1SJRA 1U6FA 2U1AA 2CPZA 2RUGA 2XNQA 1R8PA 2QEXS 5GVQA 2AYBA 2MQNA 3ZZYA 5ITHA 3FEYB 2E5HA 2V94A 1M5OC 1H2UX 2DO0A 2F9DA 4WIIA 4ZKAA 2PE8A 2OIHA 2YH0A 2RRBA 2DNOA 1JMTA 2E5IA 5EN1A 2MZJA 5MLCV 2MGZB 1WF2A 2DNNA 1QM9A 4TU7A 2L08A 3LQVA 4W90B 3CUNA 2CQ0A 4Y0FA 2HGMA 2RVJA 2KRRA 2I2YA 2MGZA 2ZJQQ 3MD1A 2M7SA 2MZ1A 2MKSA 5DDPC 1DRZA 1M1KT 4IUFA 2G0CA 2L41A 1K73T 2KFYA 2B0GA 4YB1P 3MUMP 1P1TA 2J0QD 4ERDA 1YJ9S 2JRSA 2RS2A 1FHTA 3NS6A 2YTCA 2MZRA 1Q86T 2RQ4A 1KD1T 1M5VC 5GMKa 2DNYA 1VQ8S 3BEGB 3H2VE 2M70A 2MB0B 4F25A 1WWHA 1X4FA 1U1PA 3VAFA 2KU7A 1WELA 3Q2SC 5DETA 5GAEU 2M9KA 2MKIA 2OTJS 2DGQA 2M4MA 1VQPS 1X5PA 2MSSA 4Y00A 2AYMA 2RNEA 5IM0B 2XNRA 2NZ4A 1L3KA 5LJ3Y 1U1MA 3UCGA 1VQMS 1VC5A 3SDEB 3CMAS 1D8ZA 3G96A 2N82B 2JVOA 1SJ4P 2PEHA 5IM0A 1OIAA 3NNHA 1WEXA 1YJNS 2LEBA 4WF9Q 2DNKA 4C0OC 4Z2XA 2J0SD 3SDEA 3CCQS 1HA1A 2XS5A 1Q81T 2AYEA 1H2VZ 3TP2A 4CH0S 4RU2A 2MKHA 2BOPA 2KN4A 3ZZZA 2DO4A 4TU9A 3UWTA 1H6KX 3N9UC 3THTA 1N88A 2M8HA 1KOOA 3G6ES 2RQCA 5IQQA 3I56S 2CQ2A 4WKRA 1WG5A 2XB2D 2HVZA 1X4DA 1FT8A 2CQBA 3BO4A 1VQNS 1UP1A 1WHXA 4CH1A 4IOAQ 1KQSR 5CYJA 5D77A 4P6QA 3CC2S 2CPFA 2F9JA 2DH9A 2CQHA 2VONA 3P49B 1K8AT 2CQ3A 4FXWA 3THPA 1RK8A 1A9NB 2DNPA 1WI6A 3G8SA 3BS9A 3CCJS 1WHVA 2KM8C 2DGTA 2KVIA 3LPYA 3S8SA 3CCRS 4V19X 1O0PA 2DGWA 3CPWR 3MDFA 2HGNA 3CCLS 1UFWA 2SXLA 3EX7B 3UD3P 2MJUA 3HI9A 2MYFA 4WCEQ 2FY1A 1JJ4A 3G9CA 3S7RA 4TU8A 1VQ5S 5D78A 2DNGA 4FXVA 2E44A 2DISA 3G4SS 1UAWA 1ZZFA 4TLQA 4ED5A 2DHSA 3MURP 3CCVS 4UQTA 2AYGA 4OZ1A 3RW7A 3US5A 5GAHU 1X5SA 4M5DB 2DNMA 2ADBA 2M8DB 3CCSS 3TYTA 1KOHA
chains in the Genus database with same CATH superfamily
2YQ3A 2Z4PA 1U2FA 3AXMA 1HNIB 1H98A 1BWEA 1Q16B 2YWKA 3OW2R 4WFYA 3V6KA 3H5YA 4LFCF 4ID5B 3FEXB 1NDLA 3TZZA 1LK7A 1NK4A 1P27B 1T3OA 2DD8S 3D6HB 1JLCA 4FVCA 1OPIA 3AH6A 1Z2ZA 1ZA1B 1FI4A 4B3OB 3W7BA 1S7HA 4DN9A 4J9OA 5KT4A 2C3MA 2R7TA 1PC5A 1XBWA 2DGSA 2E5LF 3HPOA 2I38A 4U6PA 4DJBA 1B0VA 4ECSA 2ZC4A 2XQCA 4C0BA 3ENQA 2V68A 2AIRB 5EX0A 2JL9A 1RTZA 1IKXB 4Y28C 2VICA 2XYGB 4RNOA 2DNZA 4AD6A 1RHRB 4I6WA 3RB3A 4QIVA 4ZJOA 1QUPA 1NK0A 4QIGA 3N4WA 2YKNA 4RLEA 2IYIA 4DV0J 2DVIA 4GO5X 5BJRA 4X4OA 1TL1B 2CQDA 4KPYA 3CJ2A 2DNRA 2KG0A 3MUVP 2ILZA 3RRKA 2B43A 2BE9B 4ECVA 4RKUC 2J6SA 2DH7A 2CZ4A 3MGJA 1DTQB 1UVJA 3IR5B 2WZ1A 2KFZA 1HL6A 1VBZA 2ZH6A 4N7TA 5D6GA 4CLFA 5I4MA 3TOQA 4Y65A 1S77D 4M5HA 1HBMB 3G86A 2HIYA 2ZHBA 4RNFA 3BBCA 3VALA 1SJFA 2W4DA 4LVNP 4DFKA 5HQ8A 2WSCC 4IRDA 4FKXA 2RD5C 1U1KA 4GVLA 4K4TA 1KNZA 4WIQA 2BVZA 3M30A 3UD4P 4UW2A 3QO9B 1S12A 1Y7PA 3TZWA 3KLIB 1NHKL 1RT6B 2UXCJ 4TQRA 5DG9A 2LKZA 4NASA 4MK7A 1RA6A 4OZ2A 4JBCA 3HP6A 4WFXA 5H1SV 1IJEB 2POKA 2KHCA 1PGZA 4DV1F 4CLUA 2DY1A 2JEFA 5KG5A 4H4OB 4C4WA 3M8QB 1MW7A 3ENVA 1XNRJ 3MMCA 2Y8YA 3WHIA 3JAMY 2EI5A 3FEYB 1I94J 4NE9C 5MLCV 1MWYA 1KHWA 5DRKA 4O3NA 2YNIA 2H9ZA 5B0EA 5THWA 3RJMB 1NB2A 4HHHA 4PQUB 2MKSA 1IBKF 4HI2A 4IUFA 4NLTA 2B8PA 2B0GA 1G7CB 4K4XA 2VFTA 5H9EJ 2YTCA 2IBOA 2VA2A 2ZWPA 3GIRA 4WK3A 4N76A 3C15A 1CJVA 4OYOA 3I5AA 3BV8A 1UVIA 3OQ2A 4X4NA 2F8EX 3H5XA 2BRKA 1R43A 3BGFA 1A6LA 1PG5B 1U1MA 3H5UA 3MCSA 4RW6A 3W2WA 3MM8A 2BW2A 1HHQA 1OIAA 5F0WA 3LP2B 4CH7A 1R0AB 4KY3A 1NSPA 1U48A 3AQPA 1LFPA 2B5JA 5IWAF 1YRTA 3UDEA 1VMBA 4B9VA 1CQNA 1FT8A 5GMDA 3W5XA 2E1CA 1UVKA 4IYQA 1RT7A 2PIIA 4DL4A 1HHSA 3M2VB 4ZVPB 3Q23A 1WACA 1H0HB 5AE3A 1SKUB 4N8NA 4TY8A 2YNGB 2PA8D 3EX7B 4TU8A 2Q6BA 3D4JA 2ZKTA 1SUQA 3IBFB 4ZPDA 4TLQA 3QFWA 4WK1A 2DHSA 4Y34A 2RU9A 2ZH3A 2QFIA 1TVRA 1FEEA 3TX8A 1UTAA 1RABB 4P74A 3TAQA 5GAEI 3NLCA 1TP7A 2C2RA 1R0BG 4I0WA 1HBOA 3Q8SB 1JLCB 1GAOA 1FO1A 2QV6A 4F2SA 3EWGA 5D3GA 5KFXA 2YKPA 3OTOF 4NYPA 2MPUA 2BQ3A 4I2QA 3BGUA 4OYBA 4ZVUB 3PRDA 1N5YA 3UN5A 1NSKL 1S6QA 1U4BA 4ZLJA 3EUNA 5KFFA 4WTOB 4FS1A 1OY9A 1W25A 2FLLA 1SH3A 4UF4A 1S97A 4L73A 4CQ1A 2JLFA 2DNLA 1N5VA 3C3LA 2A2DA 1U1RA 1YBTA 5D4PA 4YEAA 5F8LA 4OX7A 1V9OA 2NUHA 2VB6A 3I4PA 3HJVA 5EHHA 4Y2KA 1YJWS 1LW0A 2WOMA 3NS5A 1WEYA 1HD1A 5CQGA 2HHQA 1SC3B 2JFKA 2YKNB 1UPMB 5C2CA 2IFXA 1ZA2B 1KQGB 1WKLA 3TQ1A 3LAKA 4JI5J 3KHLA 4C8YA 4DSEA 3VHQA 1KTQA 2UU9J 2KI2A 1J5EJ 5HN0A 2BA9A 3CJ0A 4MKYA 1HBUA 1N52B 3PIPQ 7AT1B 2UUBF 2BQUA 2Y1LB 3PTWA 4QWBA 1JLFA 9RUBA 1S0VA 4DR4J 4UT4A 3GIMA 2EFPA 3GJQB 1FESA 5ETLA 4OHYA 2K8GA 2VIHA 1APSA 1OO0B 4PPZA 4C8OA 1NMEB 3PKMA 4ZVSB 2B6AA 4OQJA 2DHXA 2LA4A 3PYEA 1N0UA 4PKDB 4U7UK 1EQMA 3C46A 3NCQA 3DC2A 4U7CA 2HFZA 1LWEA 2F65A 2H51B 3M30B 2R7SA 1LW2A 4URSA 5KT7A 1TL4A 4M5LA 1H2TZ 3D0GE 1KFSA 3FCVA 3FUYA 1SJQA 4PWWA 1OYDA 4OZLA 1BUXA 2VBWA 1X31C 2E5GA 1OQ6A 1V6HA 3GLJA 3C2PA 5DDRC 2WB4A 1FJ7A 4WJBA 1ZPWX 2XMAA 4OL8A 2HFNA 4Y6IA 2VQFF 2QYGA 2W01A 4RUBA 4OFZA 4CLSA 1IBLF 2XLIA 3MM6A 5ETVA 4ED8A 2MZSA 3MMCB 3GV7B 3JSBA 1PCAA 5HQMA 1T3NA 1MMLA 3SQOP 3OTEA 1QTMA 1VS3A 3KWMA 3QYYA 2CPZA 3PR4A 4FPIA 1QSSA 2XGQA 3KK3A 2HNZA 2HEKA 5HANA 3H20A 3ZZYA 4A4JA 4HKQA 2DO0A 4G65A 2YNIB 4WIIA 3TR5A 2UXDF 5F8GA 4CCHA 1SJ1A 2DRDA 3AOBA 3THVA 4EBEA 3CCTA 2ZJQQ 4JB8B 1M1KT 3QRPA 3TRGA 5F3ZA 3KK1A 4EUVA 2HZVA 3C15B 1FHTA 3A8IA 1CJVB 2CJYB 2CNLB 4DSFA 1NRKA 4FBTA 4AL6A 1WWHA 1U1PA 3VAFA 5KFVA 4B3SF 3RG6A 4DU7A 5E0OA 4ZVFA 2KJWA 4RW6B 3W2WB 3MM8B 3OSNA 1W26A 2EFGA 1UFKA 2MSSA 2XY5A 5HJYA 4J9QA 3QATA 2XNRA 3CDEA 2ZE2A 3G96A 3DGVA 2VU5A 1M1HA 2B5JB 1U45A 1O6XA 5AE2A 3MPVA 4CH0S 1SL1A 1V3ZA 4FNIA 1KOOA 5CAAA 4V19J 1RT7B 3CGIA 2IVFB 4IOAQ 4LQ3A 1TELA 4BWMA 3DOMA 2CAJA 4FXDA 4K4YA 4TY8B 2YWFA 5L9NA 3CB4A 1ZTWA 4PG7A 3KG0A 4M5MA 2Z0GA 1T03A 2AJ1A 2DGWA 2ZHOA 3CPWR 1SUQB 2HGNA 2XYHB 4K2XA 3GV5B 1NK7A 1TVRB 2Y1RI 1S1XA 4IOBA 3A13A 1CSJA 1WC5A 4ECTA 2QMWA 3MURP 5C5JA 4FF1A 5KFPA 4KSEB 2UVWA 2RRAA 2D9OA 3G87A 3L3CA 5D3GB 2NREA 4O0NA 4RX6A 4I2QB 5SUHA 4X62J 1WI8A 3V6JA 1N5YB 2AF6A 1ZM2A 1S6QB 3H59A 1K1QA 1VRTA 1SJ3P 2HHWA 1RISA 2WBMA 1URRA 2KT5A 3WQPA 3QGIA 2CYYA 2DBBA 2VODA 1O51A 2DEIA 3H7HB 2U2FA 4W92B 4IQMA 1JLQA 3HFZB 4ZA1A 2XC9A 3BBFA 1VBYA 1KVJA 2VDIA 3RR7A 3OXLA 3U1LA 4EEYA 1LW0B 2WOMB 3RR8A 4MKBA 5KFOA 4JI8F 1PJ6A 2CQ1A 1XK8A 4CTAA 3V4IB 3KOAA 2WVDA 5HK4A 3QJJA 5CHCB 2CPHA 3D1HA 3HD2A 1MN9A 2QX0A 4DZDA 3R97A 5CD4A 5KG6A 2PSZA 3NAHA 3U1NA 3AAWB 4J5OA 3QFHA 4LIWA 4DV0F 4OI0A 2MMYA 2FC9A 3MPUB 2HQGA 4MTPA 4DCOB 3BSAA 4USHA 4ZCLA 3JSYA 3HLUA 1HBUB 4FBUA 2B4UA 4QR0A 1W7WA 3VAJA 3K57A 4K4ZA 1JLFB 4JV1A 2K3IA 2MQ8A 4IR9A 1FFWB 2W24A 1KHVA 4FZVA 2MXYA 2A18A 2AT1B 1U1NA 3OT9A 1BY9A 4NI2A 1XMOJ 3ZC4A 2B6AB 3EXYA 4ZJQA 4PWDA 1X9SA 1XN9A 2ADCA 1CVJA 1S76D 1EIYB 2JC1A 1LWEB 3RB0A 1RA7A 5KFYA 4CWBA 1LW2B 2MZQA 1BQNA 3KUEA 3LF0A 3DLLQ 3NG8A 2V8GA 1FFSB 3GSIA 1X8DA 4ED7A 2HSEB 2KTQA 1WHWA 4DU8A 4ZVTB 4H4MA 2Y1IA 5DO2A 3OLAA 1FK9A 3CJKA 4K7QA 2HQIA 2UXCF 5LSLA 4C2MA 2XO6A 1D3WA 3W66A 2YBVA 5JMNA 3MM6B 2HZCA 4Z7CA 2FJDB 1F3FA 2OGUA 3D3BJ 4C7QA 1RT2A 3UCZP 3QSYB 2LXIA 2F63A 5LL6d 4WE1A 2ZHAA 2VA3A 2FHKA 1XNRF 1S9FA 3I5CA 1Q5VA 3KK3B 3MPDA 2HNZB 1XMQJ 2VD3A 5GMEA 1CULA 3JQKA 2GVZA 2QEXS 5GVQA 4FS2A 2DNOA 3VCDA 1KQFB 3ZXWA 3LO3A 3BSCA 4OYWA 3GQCA 2IJRA 3KK1B 3JYTA 3CUNA 2CNKB 1R27B 2ABYA 2R7QA 1DRZA 2MKYA 5E3PA 2YKMA 3GZ7A 3DI6A 2RS2A 1B0PA 3DXSX 3NY0A 1UETA 1KD1T 2RMLA 4D3GA 2CVIA 2DT9A 1DURA 2B9WA 2XY6A 4DV2F 2O01C 2ASYA 4F4XA 3H0PA 5GAEU 2M9KA 2MKIA 3CW2C 3BH6B 2ZE2B 3CE8A 5KFNA 2DR5A 4DR1J 3M6UA 2R2SA 2LEBA 4IRCA 1D9DA 2QLXA 4WU2A 1OPZA 3LALA 1S7IA 3RBEA 5K8OA 3DOMB 4OJHA 4C3MA 2QSFA 3M8WA 3HF5A 4DR2J 4UTGA 1T03B 2HS0A 1K8AT 3GFYA 1CJKA 1RWOB 4FPRA 1UWBA 3B82A 2IRYA 3LPYA 1S1XB 1CC8A 1NDCA 4HT5A 4N77A 4EZ9A 3VZIA 4L72B 4UQTA 2VBXA 2F3JA 2LQJA 1A0OB 4UQGA 1FTRA 3JB9k 4P72A 3R1HA 4Y2AA 3P5TL 1L3VA 1VRTB 4HACA 3T5LA 4OYMA 1NJXA 3DU5A 4LF9J 2KG1A 4HHUA 3LGHA 2DIVA 2FVCA 3TO8A 5D0GA 3PRBA 4MKAA 2RF2A 3MAQA 3FMBA 2CRLA 1FEHA 3D6FB 1LWFA 1JKHA 4FKYA 2BANB 2ZOFA 1JLQB 2M88A 4FF3A 1VC6A 1D0EA 1M1GA 3DOLA 3PJWA 4OZ0A 5H9EK 2ZH4A 3TEHB 4CTAB 3M6VA 2X1GA 4LSLB 4ZVEA 1MWQA 3ETMA 2E9RX 2E9TA 3D28A 4EO8A 4FYDA 3B4DA 2BRLA 4N8OA 1D1UA 3R8YA 4LFAJ 3OHAA 2BKNA 3HFKA 1FDNA 3TAMA 3BR8A 1IQTA 2UU9F 2XWYA 4KHRA 4NRTA 2OI2A 4FVMA 4IRKA 3W9JA 4Q44A 2YH1A 2BACA 3BN4A 3PRVA 3KMQA 4JI3J 1ULRA 5C24B 3S6EA 1FRXA 2QG9B 3T5HA 3B78A 1F9FA 1RT3A 2N7CA 5DQIA 2DHAA 4XDCA 4NI2B 3M9MB 2ZC3A 4DSIA 4YOEA 1FTCA 2A6OA 4PWDB 3A8JA 1ZTTA 3CJ8A 4QW9A 4QW8A 3FZBA 3Q8YA 5J1PA 4C3LA 2BXJA 3PX4A 4AE5A 5K5MA 1BQNB 4WFBQ 5F8NA 1LXNA 2JDJA 3H2UB 3C19A 2ZZTA 5F8JA 4B3RJ 4J91A 1U8WA 2B4OA 1YIJS 4H4MB 4EYIB 5JVGQ 2E9ZA 1NJYA 1VQLS 2CJAA 3H4BA 4CLYA 3CJKB 2ZH9A 3H2LA 2K3KA 3SBMA 2UV8A 4B9TA 4JUZA 4U9RA 5DLFA 2ILYA 4K50A 4RW8A 1UJ4A 1R8HA 3DGPA 2CPJA 3CMQA 1RT2B 2X3DA 5LXYA 3MHYA 5MAOA 4WE1B 2NZCA 3SMZA 2ZNYA 2RE1A 3BPSP 3PXGa 4ZLPA 3UR0A 1RB0A 1CULB 4JYAJ 4IH6A 4KPCA 1IBCB 3UDCA 1S6OA 5D4NA 2ZITA 2I0XA 4I7FA 2G0JA 4ITSA 1M5OC 4KBIA 1RU2A 2XMJA 3R5JB 3BSOA 1YQHA 2PE8A 3JYTB 4ZPBA 4JI6J 2MDAA 1QSYA 1H73A 4Q8EA 4TU7A 2YKMB 4Y0FA 3DI6B 1CC7A 4GO7X 2MZ1A 3VV2B 4XK8C 3MEDA 3TJ9A 2AKWB 1VRQC 1Y00A 2G0IA 1CS4A 1OSCA 1KDNA 1KRPA 4WXWA 1P6TA 5AT1B 2XO7A 3MWBA 1HFEL 1U8SA 4DSKA 3QQCD 1HLWA 2QMXA 2QL7B 4KRWA 3TNVA 1JJCB 3N6MA 4OZ5A 2NXUA 1X5PA 1JB0C 1L3KA 3KLHA 1VC5A 1DAXA 2XM3A 3N6LA 1FJGF 4E98A 3G6VA 1S1VA 1SJ4P 3Q0AA 4ZP7A 2RHSB 1IBMJ 2B7BB 3JTNA 3TP2A 3OL7A 1IWAA 2DO4A 4DL5A 3N9UC 3DKDA 3DRRA 4NYZA 1ELOA 3DRSA 4O23A 1F2HA 3PV8A 4PG5A 1ZM9A 1CJKB 1UWBB 1HR0J 1KP6A 3CO0P 1S1TA 4URQU 3HHEA 4DF4A 2L9NA 3AHPA 5KOXA 2ROPA 1MROA 2KM8C 4DZ6A 3HM9A 2HK2A 2A1BA 4IR1A 3O8WA 4MJKA 2MYFA 4X4PA 2JLGA 3EZ5A 3QWPA 3HDSA 2CFXA 2BYCA 3FMWA 2HQDA 3DRXA 3KUGA 3IR7B 2I9SA 3OHBA 1KTVA 1ZYQA 3KTQA 1RQ0A 3OXGA 4FYVB 2HW3A 4HACB 2PDAA 4X62F 4DDFA 1WTBA 5BYSA 3SQGA 4KC5A 4YR2A 2VBYA 2ZWOA 4NLVA 1FKOA 2RF2B 2V2KA 2IDEA 1URNA 1NJIT 3I0RA 1LWFB 1JKHB 2WCXA 2ZNZA 3DOLB 2IJFA 1U49A 4Q2MA 3QGHA 4ATNA 4X4VA 3OXFA 1S72S 3EVWA 2UUAJ 5CYQA 3I9ZA 3E51A 2CQIA 2AWZA 4YN3B 2MQMA 4DI6A 3HSZA 2WHOA 2W25A 2DK2A 2YWWA 1SL0A 3VAIA 3D2WA 4OX8A 3TA0A 1NK6A 4KB7A 2YNHB 4FN5A 4OJGA 3TAMB 1TK5A 4WU3A 3QT8A 1VLOA 3T1YF 5I42B 2RS8A 4URGA 3JQJA 5HP1A 2AX0A 1PYSB 1LNQA 2GX8A 2CPEA 3EDQB 1IKWA 4EWTA 1GNKA 4PPDA 2XI2A 3PACA 1U0HA 2K7KA 4LRAA 2W9AA 1U1QA 4QR2A 2WB1D 3D54A 1RT3B 4LRCA 4KHPF 1T9XA 1YRXA 4JI7F 1U2RA 4WFNQ 5B0AA 2OSQA 2FJWA 2EK1A 2Z2YB 1M5KC 1X4GA 2ZVIA 1PJ5A 1XEZA 2XMKA 3HFVA 4X4RA 4OYZA 1XMOF 2FJBB 2QA4G 3M8RA 5KFAA 2JVRA 2MQLA 4LFBF 4X66J 4DPXA 3KFWX 5L1LA 3M8YA 4A8XA 2ZH8A 3IM8A 4JI2F 5KFKA 2YX1A 1C4CA 5F8MA 3ILOA 3NXZA 1KONA 2W8KA 4A8KA 1B0TA 2NYIA 2OH2A 5HAOA 3IRWP 3BH7B 5A6WA 4U8VA 5HO4A 1RBAA 2DHHA 3L7UA 5DM7Q 4RO0A 4RW8B 4AQYF 4B02A 1U02A 5F0UA 2H48B 4P9SA 5F9LA 4O4GB 3DGPB 1GMUA 3E8OA 2RILA 2OP5A 2RDDA 3FRZA 4KTQA 1NUEA 4UZCA 1HHTP 3LTOA 3L4BC 2BBEA 2V8DA 3PHEA 4FYWB 1XMQF 1YDLA 4I7FB 5FLXY 5FD1A 3ZTOA 1HNZJ 2JFDA 1CLFA 2ZOGA 3T9ZA 3GE9A 1NK8A 1SC1B 2AEMA 3TUIC 1Q8BA 2CWKA 3CJRA 2RRBA 4DBQA 2MZJA 1WD6A 4TQSA 4DUZJ 4K0KF 4KKOA 2BV3A 2GW8A 1CS4B 2E7WA 2EWHA 3BQ1A 2NPIA 2D1CA 2KFYA 2ZBPA 1RWNB 5ETQA 1TUVA 4P71A 3VVTA 4J9KA 2R8HA 5KFQA 1VFJA 3O6QA 2OFGX 4KQZA 1P9QC 4JV5J 4ED0A 3F56A 4ZP8A 3VWSA 4ECRA 4BC7A 1F5AA 3CSKA 4EK2A 1QE1B 4XIUA 4DR1F 3KLHB 3W61A 2DGQA 4QYZJ 4IQXA 1FCAA 1S1VB 3BGOP 5AE1A 3CMAS 1T11A 2V2ZA 4USWA 5L39A 1P1LA 5CCLA 3DRSB 3ZZZA 4QWAA 2AX1A 4B9MA 3L7OA 1S1TB 2VKRA 2XB2D 2HVZA 4Q8FA 1XR5A 4EU0A 3ELHA 1KQSR 4D3HA 5D77A 1EB0A 1MROB 2F9JA 3AOCA 1T8EA 3GSDA 3BZQA 2HBZB 3SCLE 3QT7A 4V19X 4LF4J 2PFFB 2EEYA 3UW1A 2MJUA 2FY1A 1JJ4A 3S7RA 3QBCA 3IG1A 5D78A 1NK5A 2DISA 3G4SS 4OI1A 1Y5NB 4CLPA 1AFIA 1MLAA 2DNMA 3OTDA 1KOHA 3ADAC 3SQGB 5D8HB 5A8RB 1FKOB 2IHR1 1YZ7A 2H54B 1F5CA 3MPWA 1N33F 5HL7Q 1PYTA 2ZJPQ 2GMLA 2KYZA 3R9LA 1DBDA 4Q0BA 1NZ8A 4KGVB 3SSQA 3D3CJ 4S0MA 1YX2A 1NPPA 5CYQB 2V2VA 1WJ9A 1G3OA 1HNVA 2JEJA 1GTHA 3SV4A 1WORA 4JI1J 2B3TB 3HHLD 3AA9A 3G8TA 2R7UA 4YHHF 3KJQB 1N32F 2FVSA 4USKA 2CDQA 1RTIA 1EAYC 2I5JA 5BR8F 2YWEA 1UW4A 4TXSA 5JJBA 1R3NA 4LBPA 2QT7A 5HP1B 1HI0P 3K59A 1KC8T 3NNCA 2KFNA 2MQOA 3UE2A 3TUZC 2I6WA 1U2CA 4LR8A 1T9UA 2FHOB 3I55S 1CPZA 1YI2S 1U0HB 4GC6A 1WOSA 3OJUA 3A3OB 3NNAA 1C0UA 3NWGA 4BC9A 4QZVB 3L9ZA 3VAKA 3OL8A 2CPDA 4NLQA 3VF0B 2OPRA 3NBPA 5HMYA 2V50A 2E5JA 2WSFC 5T14A 1TU0B 5IFMA 2YY3A 4P73A 4U8YA 3HCXA 3CJ5A 4AXIA 2G13A 2DR8A 1RT4A 3MCOA 3ULHA 3SSRA 2J0XA 1B7YB 2LDIA 2R8IA 3GR0A 2HLTA 1Q8LA 3QZ7A 2RT3A 3QZ8A 1AROP 2VDHA 3L09A 1HPZA 5E3CA 3IA0A 1HWIA 3M8PA 2RDIA 2YQ0A 4RPFA 2NXCA 3GYNA 4LF7J 2PN6A 3H25A 2M0GB 5KG3A 3KG4A 4PG6A 1VGYA 3WX8A 1ZZNA 3JSMA 1M5SA 3T5KA 2IC3A 3QWUA 1NO8A 1FWKA 5RUBA 2J8AA 8AT1B 2OTLS 5CCMA 2PC6A 3HSGA 2V67A 2DEJA 3V81A 3W62A 2HQ3A 4WFAQ 4JYAF 3FBBA 4XPCA 3FSXA 1AA1B 1NHUA 2EK6A 4WYLA 5FLXU 1RHUB 3W2VA 1E6YA 2GGPA 3IWXA 1FJEB 3DLJA 4DV6J 4K59A 2U1AA 4EBDA 4Y2CA 5A0YA 3LWMA 1MMNA 2DPIA 2DRBA 2GC8A 2BOAA 4KKOB 8RUCA 2OIHA 4ED4A 3TW0A 2UUCJ 2GJIA 1TKTA 4DSJA 2FD2A 4KO0A 4MFBA 5K14A 1YJUA 3UN3A 5F41A 2RVJA 3MECA 2KRRA 2V63A 1OMSA 3KHHA 3H90A 2QLFB 2L41A 1FDBA 3CD0A 3KHRA 1D09B 3CIZA 3N0VA 5J2NA 2E1MC 2V5HG 1N36J 3OFGA 3GJTB 2XEXA 4KGZB 1WELA 2CG4A 1UVLA 3IC1A 3RBDA 1SI9A 4G1IA 3Q8VA 1ACMB 2Z56B 1D8ZA 1TL5A 1KN6A 1IBMF 1WEXA 2WK4A 4CDIA 4TYBA 4RUCA 2P6SA 1SQFA 4XAKA 2ZD1A 4FYYB 3BJYA 3TZXA 2NQPA 1RLCL 5D0RA 1HR0F 2L48A 1UP1A 1NDKA 2KDOA 2CPFA 5I3QA 1WUUA 1S4EA 2DNPA 1QDUB 1Y5IB 1N48A 4ZVRB 2Q1LA 3IG1B 4WZMA 3HI9A 2Y9HA 4WCEQ 2HWHA 3CDAA 1F2GA 2FGOA 2DNGA 3ITHA 3WIVA 4ED5A 2O5DA 3H5SA 3DU6A 1UZDA 3AJDA 4USIA 4LUBA 3OFEA 3MUTP 3UQSA 3W8GA 4IDKA 1F1BB 1TQLA 3NCPA 3GYXB 4Q0BB 1NK9A 4OIXA 2HRYA 3MZIA 2MQPA 3KJVA 3LGNA 1HNVB 5K8PA 1QSLA 4B3TJ 4ZOSA 3PFEA 1FRMA 2A3JA 2I5JB 1TZ0A 1S49A 2ZDOA 4UY85 2MZTA 2BZ2A 1SH0A 1U24A 3QGGA 2ZDPA 1EARA 5HQLA 2YWHA 1QAIA 2MY8A 1KWMA 3V4MA 4L76A 4ECZA 2W7OA 3CCUS 2EFVA 1G2EA 5DGAA 3KLVA 1C0UB 3W5ZA 3CMES 4PAAA 4B9UA 1RKJA 1SH2A 4DV5F 1Q1KA 4FDFA 2OPRB 4E0DA 4OX9J 3W60A 2DIUA 3Q2TC 4AT1B 2JSXA 3NBPB 2XBPA 3P45B 2GCFA 1RT5A 1U1OA 2GA7A 3NKYA 4Q45A 5D0HA 3IWLA 1Y9OA 1HIYA 8ATCB 2C2OB 2DPJA 1RT4B 4RUHA 1ZAXA 5IT9Y 3EDRB 2G2OA 1JXEA 2WBRA 3OBIA 4X66F 3IAM9 3G71S 3HK2A 4F2RA 4F0HA 4GKKJ 1ROFA 4USMA 4LF5F 4WP3A 1PO6A 4N56A 4B9NA 1HPZB 3UFCX 4KHMA 4LRDA 4F3MA 1TK0A 3M8PB 2UUTA 2KXNB 4TKTA 1JJHA 1XC9A 2MKJA 4DV3J 3QLHA 4TYAA 2LA6A 4LF6F 3T19A 3CVKA 3J7ZT 2QLWA 3K0JA 4U96A 3JSMB 3GTYX 1DHMA 2IC3B 3JTPA 2ZJRQ 2A2CA 4YB5A 2CQGA 5E7OB 3LANA 3MXHP 1REVA 1XNQF 1MNEA 3V81B 4F04B 4M5NA 2NYHA 5BYQA 4ALZA 4PYAA 1SXLA 2NXEA 4U7UD 2OD4A 3N6NA 3NGSA 3W2VB 1E6YB 4NA1A 2BE7D 4B3MJ 4A46A 2GGPB 3ZZPA 5I3UA 2VHGA 5A0YB 2OUGA 1HNZF 3EZUA 3RB4A 3P6YC 3IR6B 1U6FA 1I51B 2DXEA 4M95A 2ZM6J 3TI0A 3K7RA 1TKTB 1K0TA 2HHTA 2FVPA 3K5PA 4KO0B 4MFBB 5K14B 3G82A 3ONQA 3LW5C 1WSRA 5EN1A 1N34J 2E1PA 4GKJJ 4LBHA 4MYTA 4ENOA 4OI6A 4DQIA 4K5SA 3AD8C 1GXTA 5J2NB 4B08A 3DDNA 5GAGI 4A8OA 4QWEA 3W1YC 1RE1B 3BEGB 4DLEA 4G3IA 5J2QA 2ZBQA 2KU7A 3K2YA 5DETA 4WZQA 3PEHA 1VQPS 5G0RA 2H5IB 2PI5A 1RTJA 5GADI 4CNYA 3T6BA 2ZD1B 4ZPVR 4NMLA 3CCQS 2G2YA 3HSDA 2BOPA 1TUGB 3PJ9A 3PW7A 4K4VA 3HD1A 3F73A 3R6LB 1NEEA 4BWJA 3SZ2A 1RWWB 3B8HA 3D0HE 2CQBA 2XSJA 4PWUA 5CYJA 4ECXA 6AT1B 1LWCA 2CZ9A 2FHJD 4LF4F 2YPZA 2ZBCA 2Y1JA 4NXMJ 2IMWP 4LVOP 3ITHB 2HVDA 4JI4J 1J5OA 3G9CA 4P7TA 4LR9A 5ADZA 4YY3J 2M3DA 3ENAA 3C6UA 4PG8A 2R7RA 3D1QA 5B08A 4ZLNA 4IDKB 2J9CA 3CIMA 3BPDA 2FGCA 3S01A 3OPKA 3SI8A 3DRPA 3CCES 3CCMS 2MKCA 3KJVB 3BN7A 3W64A 2LQ5A 4USTA 3V2UC 3B54A 4ZVGA 3PW5A 4Z37A 2LYVA 1FRKA 2IA0A 4DLGA 3R5DA 4AUKA 3BSNA 1F3VA 4EI2A 1GXUA 2DH8A 2XULA 3AJ1A 3OUYA 1IUJA 2JC0A 1AZSA 3M2RA 3FBFA 4PG4A 2Q79A 2H3EB 2W9BA 2J9DE 1KVIA 4CO3A 4XDDA 5F9NA 2I1RA 3ETOA 1FX4A 3A12A 1VC0A 1F9HA 4OZNA 5D4OA 2B51A 1NPKA 1S57A 1V3RA 2PMHA 5LXRA 4QYZK 1S0NA 1ZPVA 3OR1A 2DGVA 2CIMA 5ETRA 1IKYA 4QU7A 2RKIA 2IYGA 2VUGA 4QPXA 2MY7A 4HTIA 2CQPA 5IQ6A 4WKYA 1KBRA 3SFGA 3VAHA 1T9VA 3MEGA 3R1LA 2NXJA 4A8QA 1WG4A 3WZ0A 4AL5A 3PHTA 4F4ZA 4CT9A 2IRXA 4ID8A 4IH7A 4RWXA 1UFLA 5EWEA 3BO2A 1BQXA 4X65J 4EO6A 2W1BA 3MM5A 1N5SA 1Z2LA 2P8IA 1R8CA 5HVGA 3HZEA 4G1QA 5KFBA 2LU1A 3UCUP 2CQCA 2V8PA 5IT9U 1AT1B 1IR2A 5IV4A 4NWBA 3KNGA 5KG0A 4FNHA 3EYZA 1RAAB 5CXTA 5BXIA 4OLOA 5KFSA 2R8KA 2V4JA 4NCBA 2RQMA 4DXLA 4RZRA 3HHLA 2UZAA 1RTHA 3CCZA 3HVRA 4KIAA 2LXFA 4I6AA 1F60B 3QLHB 4ER8A 1EKSA 2CA9A 4ECUA 2E5LJ 2AQ4A 4DFPA 5KT2A 2VG6A 4IG3A 3BYPA 2CQ4A 2AGPA 3BO3A 3M32A 4LF7F 1VBXA 1QAXA 3RAXA 2H5JB 2EPIA 1REVB 2NCKL 4CZCA 3OVSA 3DCAA 5IT4A 3TJ8A 1D9AA 3R3TA 1HKAA 3VGSA 5HMXA 4PQAA 1ZETA 1Q0NA 1KLNA 4YR3A 5CA5A 2AMCB 2IPOB 5I3UB 2FY8A 3EGNA 4JI0F 5JVHQ 2DXDA 4DUYF 2P2CB 3MEKA 4DV4F 3IRXA 1T05A 2PA3A 2KJVA 1U1LA 4DV6F 4HI1A 4M1KA 2XY7A 1RTDA 1TKXA 1AW0A 4MAKA 3G82B 5ITHA 2OPSA 3CWJA 2XHWA 2YH0A 3HHKA 1UPPA 1VQYA 3MM7A 3J7AN 1QM9A 1FXDA 4HTJA 5DQGA 1XTZA 2HGMA 2HIQA 4A8SA 4W98A 3ZZ0A 2FYXA 4M94A 1IJFB 1C1BA 4MIWA 5AJ3J 4ERDA 3KJFB 2J0WA 1SCJB 5J2QB 2R8GA 3R7BB 1Q86T 4HT7A 2CJXB 4CLTA 2M70A 1UA1A 4F25A 3M4XA 4OHWA 4NZ6A 2LEPA 2HMIA 5G0RB 3DOKA 2V0NA 5E5NA 3GYGA 4R0JA 2L3MA 2M4MA 1RTJB 3BKFA 3KJNB 1SIZA 1LK5A 2XWXA 1AFJA 2BJEA 1UEVA 4EBCA 3R7NB 4WF9Q 2YNFA 2QLBB 5HSPA 2VBZA 3ILLA 4IH5A 3EXCX 3QT5A 2XSJB 2HS3A 5L46A 5ETSA 2CQ2A 1HWLA 1LWCB 4Z7YA 4DQSA 4J9RA 4J9MA 2GQQA 3M6XA 1UKUA 1XQIA 3LA0A 3MOZA 3D0IE 2ROGA 1YLXA 1J5OB 3QJLA 1UEKA 3OFFA 3FCHA 3AODA 1DJ0A 3C6UB 1VLYA 5M2RA 2Z2LA 1FD2A 1JIHA 2FHMA 1E6VA 4G6VB 4QIEA 1FKPA 2ADBA 3DRPB 3TYTA 1NZAA 4ANCA 3I96A 4NZ7A 4C8KA 3U7JA 3ISNC 2XYPB 3W9HA 1IBKJ 3D1OA 3UO0A 3HMJG 2ZH2A 1NAQA 1NH8A 1X9WA 3VAGA 1EETA 4BDPA 2O67A 2JHEA 3OUYB 5DQHA 1HWUA 1AZSB 3M2RB 3JTOA 3CCWA 3FDSA 2BEFA 3HX9A 4OZJA 3RW6A 3R5AA 3T1HF 1S48A 2CXEA 1BD6A 3V5RA 4GC7A 4RNNA 2HRTA 3TVZA 2HZAA 4IOCQ 3TARA 3OR1B 2LEAA 4YR0A 3NRBA 1FFGB 1IKYB 2C1EB 2HFOA 2BJDA 2E1AA 5IWAJ 5LSOA 2RKIB 3H98A 2W7PA 4GVBA 3NCRA 4DCPB 1AUDA 4E8UA 3UNGC 4IO9Q 4ELUA 2X1FA 3MEGB 1REGX 4YS2A 1F9EB 3FFIA 4OZ3A 4OX9F 4OI4A 2HQFA 3T41A 3U27A 3MM5B 3M7VA 2OPQA 2R2UA 2ZVSA 1X4AA 3ZNJ1 1RZMA 2G9OA 3LP1A 2F7VA 4G1QB 5CD4H 1S79A 4F4YA 3PYFA 4F8RA 1S5ZA 1H72C 3PM9A 2MEWA 2ASDA 3P8BB 3HSJA 1PILA 2V4JB 2CPYA 1TL3A 3FEZA 3HHLB 4QWDA 2XMWA 4CM2A 1RTHB 1FA0A 3JS9A 4OMFG 3OTOJ 3M1VA 4K2JA 2D7SA 3LOUA 1VQ6S 2VPXB 2B4PA 5E3AA 1FWLA 5LT5A 4DPWA 1YJ7A 2VG6B 4IG3B 3HVAA 4HDHA 1QJHA 2IIHA 3Q22A 3M32B 1IM4A 4DV3F 4O3RA 5IC6B 2Q66A 3GG0A 1KLMA 3SV3A 1PYOB 5CH7B 1WC6A 3UI3A 2HURA 5GAGU 4ZDNA 1TMMA 2GHWA 4OHXA 1I1GA 3CF5Q 2XSFA 5LJ5Y 4NXNF 1GMVA 2F8HA 2J7WA 1DARA 2GHPA 1RHMB 3AB2B 2D3O1 4OYAA 4ZVQB 3IRXB 1T05B 4EYHB 3OVAA 2KRBA 1FJCA 1KVKA 1X4HA 5GADU 1RTDB 4ECYA 4I4BA 1TKXB 1P8GA 2WAQD 4ELTA 2QC3A 4ANDA 1VQ4S 3MTKA 2OPSB 4ZHRA 2ZM6F 1RXOB 2NXNA 1OY8A 2ZFHA 4CYUA 3MM7B 4ED1A 3GILA 3ZTSA 4GKJF 2GJ2A 1RAEB 1HBOB 1UVNA 2N4CA 3UDLA 1C1BB 3MD1A 2BKPA 2M7SA 4USUA 3TJAA 2FLOA 1NJZA 2G0CA 1T9YA 2K1RA 1DLOA 2IJNA 4C3KA 3EJMA 3NS6A 2H4WB 2HMIB 5AXLA 1HQUA 2RQKA 1M5VC 2DNYA 1Q7LB 3OV7A 1JNZB 3D6MB 5DLGA 4DX5A 4L74A 5B0GA 1RHKB 4PXEA 2HLUA 1XJWB 1CJUA 2YNFB 4NYOA 3MEEA 5K9FA 5KFEA 4NCAA 3LAMA 2J0SD 2AYEA 4TVAB 4AXJA 5DZ6A 2YPYA 4R0EA 3E01A 1T7PA 3BREA 3BO4A 4Q43A 1IBLJ 3K5MA 1ZAWA 2KZMA 1TTHB 3FGVA 4ES3A 2W2MP 2QN6B 4K8RA 1X60A 1QD1A 2J7KA 2ASLA 4NXMF 2CDRB 2DGTA 3UN2A 3VZHA 2XMUA 1E6VB 2QA1A 5T7LA 1FKPB 3R7SB 2B8QA 1D9FA 2CUYA 4DMZA 7FD1A 2KT3A 2Z2ZA 2RRNA 1A7GE 2FJAB 3D68A 4FP9A 1HYSA 1FVSA 1VQSA 2J7UA 4PQUA 1EETB 2DGOA 4ZN3A 2AW0A 1R8BA 4IKAA 3A1YG 4J9VA 1WOOA 5EX3A 1W2BR 2ZBRA 2KB2A 5I3PA 4B3SJ 4PRFA 2M2BA 3IAS9 1MN7A 2QA4S 3TWZA 1U26A 1V5VA 3AD7C 4WBFA 2C2MB 1DY3A 3J80U 3BKUA 3CD5A 2PMWA 3BR9A 3HULA 1RSCA 2OO4A 3LP0A 3K5NA 1YGYA 1PBAA 2O66A 3I4HX 3FFIB 3FK4A 4RU9A 5SZTA 3PKYA 2OPQB 1RAHB 2DYAA 3MR3A 1BGXT 2DGUA 4DWIA 3LP1B 2QFJA 2D41A 5KT3A 4X65F 3C66A 3FNNA 4X64J 3IBWA 4J9SA 2RJZA 5J2PA 1ZS6A 3NGDA 1TL3B 3I5BA 2VV5A 1I94F 2V8VA 4ZLLA 2W9CA 4DN0A 3M1VB 4UY8T 1JLGA 1YSJA 2XCPA 2DGXA 2IAJA 3DLHA 4U95A 1OWXA 2A0FB 3GIIA 1O8BA 1U25A 1RBLA 3A3NB 1Y10A 3FJ2A 2P9CA 4ANEA 2VG5A 2VKZG 3KLEA 1VQKS 3MCNA 5KFRA 2YKAA 2W8LA 1KLMB 4M63A 1X5TA 5EWFA 1ZH5A 2QMUB 1X7VA 5J2MA 2F8MA 4LMZA 2G4BA 3CD6S 1LQ9A 4CLZA 3VGTA 2XGPA 1WOPA 2OSRA 4F4AA 3CDBA 3WBZA 3P5BP 1C1CA 4JI8J 1EQ0A 3IO1A 3J7YI 1HARA 2HFSA 4A8YA 3OL6A 2AP6A 3KMSA 3BB5A 4ZCMA 4RL1A 1P9YA 1FRJA 1MSWD 4RW7A 1HQ2A 2V9WA 2NLWA 4ZHRB 4X4SA 4YB6A 2L9DA 2CJKA 3PYGA 3KG1A 4CYUB 3BBBA 2X51A 1YG0A 4PR6A 2HFVA 3AT1B 3MTJA 2Q43A 2XNQA 1Y11A 2AYBA 3ZO7A 3K8VA 1QAYA 2V34A 3DHXA 1RHJB 1R6YA 1WF2A 1TAQA 1WSVA 4CI0B 5ETTA 2K1RB 3LQVA 1DLOB 3C14A 2CVEA 1YJTA 3DLEA 3QIDA 1HQUB 5AJ3F 1RWPB 1LEOA 1P1TA 5K8MA 3KUHA 4BCAA 1VI7A 2BJ7A 1WNEA 2GIRA 3GP9A 3S1TA 4LSZB 1CJUB 3WC2A 1QUVA 3MEEB 3BKTA 2DR7A 5E3RA 5LJ3Y 4USJC 2WONA 2VQEJ 2LQ9A 4NEYA 1QTNB 3QMQA 1YJNS 4HEA9 3UR3C 4C48A 3E2EA 3E01B 1HMVA 2HHUA 1NPRA 3FVYA 4RU2A 2MKHA 2P9GA 1Q78A 5HVFA 3THTA 2UXBJ 1WG5A 1EJ7L 3QT6A 1RKIA 1VOMA 1GEHA 2FZKB 3N79A 1IN0A 3PDNA 4OHVA 2ROEA 2GVDA 2R3VA 4Y3CA 4WP8A 3AJ2A 1KR4A 4K5RA 2BKOA 1WHVA 4ZPTR 2KVIA 1BLUA 2QRRA 5T7LB 1QY7A 4JI5F 5L1JA 1J5EF 3GIJA 3BM7A 3H40A 3I6PA 2EFOA 4LREA 5DG7A 1HNXJ 4C9DA 3ZNUA 4RW9A 1M0SA 1HYSB 2GV1A 4DR4F 1NXIA 1JNRB 1Y3KA 2HHPA 5L8RC 1PJ7A 1X4EA 2Q3PA 2MKKA 1OSDA 2D9PA 1ZBTA 2FC8A 2GFFA 1IR0A 5HMZA 3KDNA 2DNHA 4DV2J 3W3SA 2QA2A 4A8WA 3U1MA 5HJXA 3AD9C 3N01A 2WVBA 2W2PP 4KFBA 1H74A 3MR7A 2MJNA 2F4VJ 2E7VA 4DPTA 3Q8PB 1FK9B 2HQCA 3F44A 4KAIA 3ZTQA 4EFAC 3J81j 3R5GA 3VVUA 5DDQC 3LP0B 1WC4A 2HGLA 3X1LB 2HFUA 2IY5B 3Q8RB 1R6VA 1WHYA 2ZKUA 4FYXB 1IR1A 1JLBA 4R5PA 3MF5A 2DR9A 2AJ2A 1SVDA 3AXKA 1F5BA 2G1DA 1YJVA 1YBAA 1JQGA 3FCWA 2PGCA 4PABA 4CO4A 4DS4A 3R2DJ 1HNWJ 1T0TV 5J2PB 2FQQB 2GVZB 1LKZA 4A48A 3CTRA 1R31A 4E2FB 3CJTA 5A6PA 5IC4B 2VG7A 3PNIA 5KFJA 2N7YA 2W9CB 2W4CA 5KT6A 1JLGB 1HWJA 4J9LA 1I3OB 1RUSA 2IAJB 1FNXH 1QVGR 2LECA 4C8MA 3MI7X 4LJMA 1RGVA 2VG5B 3KLEB 2OJ3A 2EBGA 4WPAA 1J27A 3H42A 1SB6A 5EGYA 4P2XA 2RB7A 3RB6A 3V6HA 1YK9A 5D0EA 3R5BA 5J2MB 5HATA 3DXBA 4GRSA 1VJQA 4OHZA 2VOOA 2YKOA 2WW4A 3IN5A 1K47A 1GMWD 2D3OR 1OQ3A 1YWXA 1C1CB 2JWNA 3AQOA 1RT1A 3BQ2A 4OYXA 1SKWA 3ICLA 2KYXA 3Q89A 3Q83A 1J2VA 5DDOC 4OYIA 4QYRA 2L9WA 3C6TA 3EGWB 1JK9B 5K8NA 3ISZA 3V4IA 1UWAA 3D6TB 4RW7B 2DJWA 1X0PA 4F02A 2GO8A 3I32A 2NSBA 2ZOMA 1TFWA 1TR0A 1G4CA 3O2IA 1GX6A 3ZZOA 2XS2A 5HMWA 3KLGA 4P2MA 2UV8G 2FJVA 3O3LA 3KYLA 2RSQA 3FBCA 4L75A 2MQNA 1RI7A 3LGMA 2K2PA 5A8KA 3C14B 2GAHC 3MR2A 1OJ4A 4KH1B 1EZZB 3DLEB 4PXBA 4QBUA 3JQMA 3MCMA 2L08A 3D66A 7FDRA 2CJQA 1K73T 2CWXA 4YB1P 1YBUA 2J0QD 2HHVA 1YJ9S 2JEIA 1Z1ZA 2XMTA 4X4TA 4L3KA 3H2VE 3ET6A 4LF2A 2CNOB 1NNDA 3SIPB 2H65B 2BW7A 5CZVA 4OLPA 1Z4UA 2FIUA 3OTBA 4ES2A 2WONB 2HG4A 4Y00A 4K4SA 2YVSA 3UCGA 1HMVB 4KV8A 1FE4A 1YVFA 3D5MA 3GPAA 4Z2XA 4DQQA 1Q81T 3J81Y 1VRUA 3HVTA 2QTWA 3NGTA 2BJ1A 3P4UB 3C16A 2RQCA 1Q95G 3A8KA 3I56S 2LQ8A 4QIWD 1VJWA 3I31A 2BQRA 2AJ0A 2GVDB 3BYRA 2ZH7A 4DL2A 4XO0A 5KT5A 3EPIA 4N5SA 1N4LA 1A9NB 1AXQA 1SQEA 3JAMU 1O0PA 2QYCA 4DX6A 1VDHA 5KFDA 2YWGA 1V5IB 1PKUA 2RIJA 4RW9B 4C6AA 2DR6A 2OMOA 2HVHA 1RWUA 5ETMA 3RU0A 4QJVA 1DQAA 1RWXB 3CEDA 1WC1A 2UVRA 3P96A 2KZZA 2D74B 2ACYA 2JOQA 2KL8A 3M8SA 1TV6A 3T3FA 2EFQA 1R7IA 4BLGA 2V6AA 2ZBIA 3HT0A 3OLBA 2OEJA 1FD8A 1U7LA 2F5GA 3NP5A 4KFBB 2CKWA 1SKRA 2FJXA 4P2SA 3NEKA 2DRAA 1NHVA 2RH3A 1PC4A 2H4YB 3HVWA 9ATCB 1FJGJ 3CD7A 4DR7J 5DG8A 4CP5A 1TKDA 4DCJB 2HYIB 3AFGA 5E3QA 4AFFA 3AA8A 2GMJA 6FD1A 1JWWA 4FF4A 2HKEA 4C8NA 5F8HA 2ERRA 1JLBB 5IZHA 3FBEA 4R5PB 4CLKA 2OPPA 5KG4A 3LWLA 1D8YA 1VHFA 1VCTA 2VOPA 3I9V9 4BBYA 3PIOQ 4J37A 4DS5A 1FNOA 2UUWA 3LH2S 1YHQS 4DX8H 2VG7B 4X64F 1VHIA 3NGRA 3QRQA 3J7YU 2MSTA 3K8WA 1O5JA 6FDRA 2ZUGA 2PD1A 4J9PA 3FQKA 1RAJA 2X1BA 3KK2A 4F4KA 4N41A 3CULA 3MEDB 1C4AA 3RZAA 2HRUA 3JXOA 3M2UA 3FC9A 1HI8A 4ZIWA 5M2UA 2FUG9 2VC0A 4I6YA 5F8IA 4L6V3 4F7VA 1Q8KA 3KXDA 3TUPA 5H9FJ 1SC6A 4XPEA 3HZGA 2MHNA 2BANA 1H3DA 2ZH5A 1RT1B 2LLZA 3F0NA 4F3OA 2G1HA 1MMDA 2AJ4A 4DSLA 2HHSA 2VFUA 1QVFR 3WDOA 3C6TB 3T9NA 4A47A 4ZPCA 1K0VA 3B6BA 1GT8A 1NU4A 1ZM4A 3K17A 4LSLA 3DRRB 4F4WA 3OTCA 4BHQA 3T1YJ 1GK8A 5CABA 4LRBA 2XZWA 1X0FA 1AB8A 4QU6A 2IM1A 1X9MA 4IFVA 3I0SA 4DR2F 3BF4A 4KJIA 4IG0A 5C42A 4RJVA 3KLGB 1WDTA 1BXNA 2F40A 1T9TA 2OMLA 1UEUA 4YFUA 5LMUJ 1SJRA 3GB0A 1C0TA 2R7OA 3DLGA 5A8KB 4KHPJ 4JI7J 2E5HA 2V94A 1H2UX 5C24A 4ED2A 1V3SA 2EG1A 1R8AA 1Q8IA 2W2NP 2GJFA 4WXOA 2CQ0A 2XMMA 3FSIA 3D67A 2MGZA 4ELVA 4ED3A 3I0RB 2C28A 1LOUA 4LF9F 3ET6B 4EZ6A 2QSWA 3GWCA 4LFBJ 2GIFA 1VIXA 2R7WA 4JI2J 2OKQA 3D9BA 2JNJA 4KV8B 4HHJA 1JX4A 4H4KA 2AYMA 4B9LA 3TA2A 4DPYA 2VQEF 1VIOA 4USVA 4A8MP 1RAFB 2V9KA 1VRUB 2PEHA 3IGVA 4AQYJ 4DR6J 3HVTB 3GFXA 2PO4A 4MIAA 4MK8A 3J81U 1HA1A 3DLKA 2XS5A 3TZYA 4GMKA 3C16B 3PYDA 3RAMA 2UXBF 2GQ2A 1OS5A 1TAUA 4TY9A 2IBKA 2N4DA 3GJSB 1HWKA 2E1RA 1B99A 4LFAF 1S6PA 1QLNA 4LBIA 1IKWB 2VC1A 3P49B 4R8UA 4OV1A 4FXWA 4IFYA 3RUBL 4UOHA 2XLJA 4OI2A 2RAQA 4CNZA 2OEKA 1KFDA 3T6JA 4UOFA 4CO1A 1W2IA 3MDFA 1UFWA 1NKEA 5FIIA 5B0CA 3UD3P 3CDUA 4JI3F 1HNXF 2E44A 3NAIA 5ETOA 4ZITA 2AYGA 1N56A 2EC0A 4K0KJ 4CM0A 1GTEA 4P10A 5IXUA 1TV6B 1NSAA 2AZ1A 3C8YA 1ZOTA 3PR5B 2Z58B 3KHGA 4WFZA 2J6UA 2HVIA 1Q4RA 2B4VA 1XMBA 2NR0A 3IMQJ 3FSYA 5AXNA 1K9MT 4NL5A 3BDEA 3EGZA 4B3RF 4DF8A 2Y0BB 2PI4A 2W4PA 3GR1A 2F4VF 4DR3J 2UVVA 2K7JA 3A3PB 1FDDA 1WF1A 1VQ7S 2CG8A 3IWNC 2LXUA 3QSIA 4LSNA 1LWXA 3DDIA 3VR1A 2KHDA 3X3UA 2VJUA 5A76A 2OPPB 3TUJC 1Q7YT 2BX6A 2DITA 3WX4A 4I69A 4J9NA 1HBNA 3KDOA 4L3NA 5GAHI 1IVZA 4CIOA 3DFEA 1B3TA 1GFWB 1RLDA 2EBEA 1AYEA 4RUAA 4NLYA 3GCXP 1HNWF 5KFTA 3AOAA 2DCLA 2N3LA 2HK3A 2R8JA 4ZCIA 2KM8B 4K4WA 4ECQA 2WVCA 4LR7A 4RBUA 4MT1A 3T1AA 2VZ9A 3QIPA 2KH9A 4ED6A 1JLAA 5E2QA 3KK2B 1RBOB 3SEOA 4HYKA 3MMBA 3K89A 4JI6F 3MAAA 1XR7A 3G6YA 3M2UB 1UVMA 2MLYA 4ZCKA 2OHDA 2GZOA 1FXLA 3CJQA 2ZUAA 2FB0A 1HQEA 1N33J 5KFZA 4MH8A 1WDDA 1U47A 2Z8QA 4NLWA 1B64A 4PYDA 1BQMA 5KFGA 2LQBA 5DJBA 2FVRA 1BC6A 1WEZA 4X2BA 3HHDA 1N54B 5KTQA 2JX2A 4NA2A 1S9EA 1VQOS 4YUDA 2BMBA 1T94A 2CNNB 4ZN1A 4JP8A 3OL9A 4DUTA 1XR6A 3M9OB 2J9DA 4YHHJ 2V4RA 1N32J 4MMOA 3HHNB 1G1XA 1VYAA 5KFMA 5BR8J 4NLDA 5FDLA 2M5YA 4ETZA 2AGQA 1WKJA 2IM0A 1SL2A 3N5FA 4IFVB 3I0SB 2YNHA 4IG0B 4NCGA 5C42B 2BM0A 3POTA 5E41A 5I42A 3LPEA 4U67Q 4A8FA 3J7Z5 2V4QA 1C0TB 1OY6A 4Q5VA 1Q82T 3I82A 3DLGB 2JLEA 4IO1A 4LQ9A 2C3YA 4RW4A 1TFYA 2HWIA 3Q8UA 1IWGA 2B56A 2JZ5A 2AV5A 1DFDA 3EPGA 1UJ5A 3H8YA 2MGZB 2BABA 2FLNA 1K44A 4M5GA 4PCQA 2AJFE 5J1EA 2Q6CA 1RCXB 3ZTPA 4ILLA 4YDDB 4UZBA 1JXLA 2DY9A 1S1UA 3A4TA 1NLKL 3MUMP 4EMDA 1CG2A 1GX5A 3PO5A 1PIEA 1GMWA 2MZRA 3A8EA 1FE0A 4TNOA 4HR2A 3HT3A 2R4FA 1ZAVA 4V1Ak 3Q2SC 5LOQA 1WKKA 3ILJA 4DQRA 4DL0C 2NZ4A 2UUAF 1Y4ZB 1H7WA 1VQMS 3DLKB 2BUNA 2FDNA 2JVOA 5EUHA 1RTIB 4CLWA 4P7VA 1NCLA 2DNKA 4MIBA 1L3TA 2HVEA 2COLA 2BJ3A 4O4GA 4TU9A 4B9SA 1N88A 2XCAA 2P9EA 3G6ES 2XZTB 3QPIA 5ETPA 5HVHA 2E7XA 4F0MA 3N5BA 4LF8J 4NX9A 2MTLA 1S6PB 5T41A 4WKRA 2JEGA 5CYMA 3IGNA 1H38A 4C11A 1Q79A 3RBZA 4R8UB 4I2PA 4IFYB 5HLFA 4CH1A 1IM6A 1UA0A 4P6QA 3MPYA 4ZPWR 3DLBA 2BJ9A 3PZPA 3BS9A 4O3PA 1ZM3A 3UVJA 3RBXA 4NA3A 3DDKA 2QGFB 2SXLA 3O1LA 3EM1A 2HHHJ 2Z2MA 4DFMA 1Y3JA 2M8DB 3CCSS 3TA1A 4UUXA 3QGPA 1RU1A 4I68A 4X84A 1RYRA 3ILIA 1GXLA 3EMTA 4ICLA 4Y2MA 2P6TA 1TMJA 2CPIA 2GS8A 3MFHA 4OX6A 5IOLA 2ZZMA 1N8RT 2LMIA 5M2PA 3L7PA 1HD0A 1T02A 3PCOB 2ATCB 4ZJLA 2RU3A 2P5VA 4ILMA 2PFDA 1DQ8A 1QE1A 3PFOA 4XTTA 3IS9A 2K06A 4LSNB 4DR7F 3MMAA 3DYAA 1RWMB 1VQ9S 3ISND 2C3OA 4HH1A 4QCLA 5DZ7A 5B7WA 4CT8A 4F50A 2HHXA 1HBNB 4MYUA 4J9UE 2YKQA 4DPUA 2HBRB 1PBUA 2HS4A 3K58A 2KXFA 3MD3A 4NOHA 4EGLA 2JH3A 5KG7A 4F3QA 1YRUA 3TVYA 3MM9A 2AZ3A 3QIPB 1JLAB 2IM3A 4KH0B 3OSPA 1LV5A 3MMBB 3MAAB 4DQPA 2VFRA 3NMRA 3DHWC 4ZPAA 4F67A 3D7SB 2HAIA 1HQEB 4KR0B 4HLBA 3MR5A 1VBKA 5J1NA 4DUZF 1CQMA 3B4MA 3MECB 3E3XA 1BQMB 5A8RA 1RAIB 3EZOA 3CO9A 4DR5J 4NLGA 5KOWA 3DRYA 3W5YA 4ZMMA 1S9EB 2O3DA 2DTJA 5L1KA 2BDPA 3TAPA 4C8ZA 4JV5F 5L9XA 1FRIA 2GQCA 4NZ0A 1X4CA 4H54A 1FDAA 2YQ1A 3BDPA 5FDLB 5A8WA 1VK3A 4NRUA 1X5OA 4OJ3A 1XERA 2HBYB 3RAQA 3M9NB 4NCGB 3POTB 2WTFA 3CC7S 4RWWA 2F4FA 1WC0A 3K5LA 1NB7A 4O3OA 3FKBA 3F41A 2EVZA 5K20B 1YJRA 4YDXA 4DL3A 5DS7A 2WVEA 2CJ9A 4HDGA 3QNWB 4UUWA 2APOA 5KAKA 5C2GA 5F3TA 4RW4B 4DV5J 5LMUF 1S0MA 1Q53A 2E66A 5HROA 1RYSA 4KYZA 2EG2A 1FERA 4O0IA 2XHCA 1R8PA 4KE5A 4ZP6A 4CRJA 5B0DA 4PXCA 2Y0SD 3DMJA 2AJQA 2F9DA 4ZKAA 4CO5A 3CT9A 5J1EB 1RADB 2YX4A 4O3QA 4M5KA 1S1UB 2PMZD 1OYEA 1M5HA 1XWLA 1EHWA 1NH7A 2KO1A 4H4KC 1NJWA 3GJRB 5KG2A 4ZS6A 2UVUA 1SKSA 1EKRA 1RAGB 2RQ4A 5GMKa 1VQ8S 4LF5J 4WYWA 2BE2A 2MB0B 3CJ3A 5LMNJ 3Q86A 2E29A 3UDVA 3RTVA 4I1TA 3HXMA 3TX0A 2X7IA 4TLRA 4N47A 1T9WA 5D15A 2VFVA 2IDLA 5CZXA 4JV0A 1RWKB 4LF6J 2BR0A 2F1FA 3QAUA 2J5AA 5EDWA 3H4DA 2XZDB 4C97A 3GFHA 4JI1F 1DTTA 4DR6F 2C2DA 3SCJE 2EKYA 1IQZA 3KLFA 3SDEA 3PO4A 1RCOB 1H2VZ 3VQTA 1XNQJ 5H9FK 4JOUA 3U02A 5A2QY 5CYMB 3UWTA 3HJFA 4Q2LA 3VGVA 1R89A 4TN2A 4C11B 2M8HA 4I2PB 5HLFB 4UOGA 3WIUA 1FXRA 4RNMA 4HL9A 1S99A 3EVMA 5B0BA 1X4DA 4LRFA 4P52A 4C8LA 1MU2A 4ZP9A 3TVKA 2VL1A 3HO1A 1RWVB 2ATLA 3UVJB 2CQHA 2ZH1A 3CJSA 3G6XA 2PT0A 2CQ3A 1TUWA 3PJXA 1WI6A 2D69A 4YB7A 4X4QA 3S8SA 2VFSA 1NBEB 4DV7J 3CCLS 2FZCB 1N0VC 4ILRA 1FF2A 2AEFA 1RT5B 2GMHA 1WC3A 1I6JA 4FXVA 4RBTA 1N5QA 4UOCA 4NPOA 5U47A 4M5IA 4OZ1A 3RW7A 4ICLB 5GAHU 1L3UA 4OV6A 4LT6A 3SXLA 2B9YA 4KGXB 4QQBA 4M5DA 4WTYA 2QZ8A 2VPZB 3ZZTA 3HKZD 4LFCJ 2DB1A 1VK8A 2NPFA 1S1WA 2IMOA 2V8HA 2XI3A 3OFHA 1KKHA 2AGOA 3IS9B 1N6QA 3Q8QB 2FPHX 3ZZRA 4DR3F 3MMAB 3DYAB 3BQ0A 3PEJA 3EVOA 2OFHX 3R2CJ 1DQ9A 1WF0A 3SSSA 5EWGA 4QPTA 3MR6A 4CO0A 1S6UA 2HAFA 2A6MA 3FQLA 2QLJB 3K5OA 3ENWA 3VAMA 1X4BA 4OYPA 2EKNA 1ITPA 1XIQA 2C2KB 1WTFA 2Y8WA 1L5UA 5KG1A 2LP4A 2W7AA 3NOGA 5IS2A 5HBMA 3TANA 3NMAA 2H5EA 4JV2A 3MM9B 3PG9A 1CBKA 4R25A 3CXCR 1S9GA 1F0XA 2WVFA 3V6DA 2LU2A 1VR6A 4ZIVA 2LDYA 4O44A 3ZTRA 5C25A 3NWRA 2RHQB 3T5JA 1CEZA 2D3UA 2MLXA 2OELA 2N3OA 5HI7A 2UUCF 2OD6A 2DXFA 4M8LA 4PEOA 1EX8A 2GO9A 4DG1A 2A10A 2MLZA 4OJ1A 4DPOA 2VASA 1SV5A 2CADA 2LFVA 2G2ZA 2VJVA 4NLXA 1N36F 4MKVA 1FX2A 1WG1A 4F26A 4O4RA 5A8WB 5C7PA 2M52A 3SFUA 2HNYA 2J76E 2VF3A 1HI1A 3DM2A 2IRUA 3HKWA 3RRGA 2QL9B 4I64A 2HNDA 1RAOA 1UW9A 1NKCA 3RYLA 5G4DA 1S4FA 3IXQA 2HPUA 1BMQB 4WWSA 5KFCA 3RGIA 3CNQP 2QO3A 1UJ6A 3OD2A 3KKFA 1BE4A 1PSDA 1U09A 3W9IA 1CJTA 1PAEX 2XG8A 2QIFA 5HROB 2OLWA 3BGLA 4DV1J 2CPXA 2AD9A 2LCWA 3G2XA 3DMJB 1SC4B 2RUGA 1BHNA 4F0KA 3SCIE 1SQGA 1AUSL 2B7CB 3TEGA 1QAJA 5LM7E 5JXSA 3JSRA 1YKWA 3GV8B 3DNCA 2E5IA 3R5CA 4NLUA 1G6BA 5KFIA 2DNNA 2I8EA 4P2FA 2ALZA 1NKBA 2EXUA 1HW9A 2FTRA 2B9EA 5KFWA 3GCWP 5DDPC 1IKVA 2V69A 3OR2A 2BE2B 2PEBA 1I5OB 2QJ3A 2Y3YA 2CJBA 2ZZNA 1LXJA 2HWTA 2WRMA 3I87A 3IFEA 2Z30B 2H1YA 4B3TF 2C2EA 4YP3A 1DTTB 2OTJS 5B0FA 1UZHA 3GU0A 4ZK7M 2RNEA 3UNYA 2W9BB 3RRHA 3KLFB 3SDEB 3KNAA 2JJ4D 2R42A 5IM0A 3NNHA 3MFIA 2AU0A 3M8ZA 4WP9A 1TL7A 1FVQA 1FNMA 3M05A 5A2QU 1NSQA 2YXLA 4LF8F 2WW8A 1MU2B 3J80Y 2KVQE 2IVYA 4DHVA 1VQNS 3O5TB 5ETKA 5KFHA 1SIWB 2AEJA 3NS7B 1IXKA 3CC2S 1GH8A 4JI0J 2R7XA 4DUYJ 3BGRA 2VONA 4F36A 4DV4J 3THPA 2ZEJA 4YQWA 3G8SA 3CCJS 2FJEB 1UL3A 3N28A 2QL5B 2FVQA 4C0HA 3PW0A 4W4MA 2BM1A 4HVZA 1T95A 2HHHF 2J6TA 1VQ5S 1TKZA 4KGMA 5JUMA 4PUOA 3QAEA 1R0CB 1UAWA 1EP4A 1ZZFA 4B17A 3PX0A 2C42A 4NLOA 3US5A 4M5DB 3GFZA 3GONA 1JLEA 1ICEB 1GQEA 2MQQA 1S1WB 3OJSA 2DNQA 4ES1A 2X1AA 4KGKA 4DL7A 4MK9A 1FRLA 1HNIA 3AB4B 2RUSA 3SYZA 2EW9A 1M5PC 2C22A 4ID5A 1N6QB 1MWZA 4QOTA 3PX6A 3O44A 5L38A 4GKKF 2IM2A 4LF1A 4Y2IA 4M5JA 3ZZUA 4B3OA 1FWPA 2DCUB 3QJPA 5LSRA 4I67A 2VH7A 5AXKA 1SPBP 2DHGA 4J7CA 1Y0HA 4DX7A 3IBCB 3R6GB 4P75A 5FJ4A 4CLLA 1TK8A 1L3SA 3UD5A 1FRHA 2C3UA 5HBMB 1IKXA 1M90T 2XS7A 3VQSA 4PZVA 4DEZA 2XTJP 3IP0A 1C2PA 1S9GB 2KXHA 3OVBA 3V6DB 2R9LA 5D4LA 4B3MF 4Q7AA 4O44B 5C25B 5ETNA 3PVXA 2HBQB 4NMXA 1KS2A 2XMVA 3ZFVA 1N5TA 1H7XA 3G8QA 1TL1A 2R2TA 4PXDA 5E33A 4J90A 1N34F 4DG1B 2UP1A 2UUBJ 1FKAF 3W63A 4OI3A 4HH0A 1SV5B 4LIRA 4DR5F 4NLPA 1DTQA 3WC0A 2IVMA 4FF2A 1U6BA 3J7A1 1NDPA 3W65A 1HBMA 3DOKB 3P3DA 1S10A 3NGKA 2HNYB 3MAHA 2AHOB 2WSEC 2J8SA 3DN9A 3DM2B 3T1HJ 3CC4S 3MOJB 4DFJA 4ECWA 2HNDB 2XLKA 4G1PA 5B09A 3PW2A 1B7FA 1PAUB 4BS2A 2C2ZB 5IT0A 1B4SA 4KT0C 5BYRA 3R27A 1VISA 2Z57B 3QO9A 4RR5A 1BWVA 2R7VA 3NOCA 5L1IA 4NLRA 1JJ2R 3KLIA 3GIKA 1RT6A 1UCNA 4DOZA 3CJ4A 1S0OA 1CJTB 1F6TA 4O3SA 3VGUA 4RNHA 1YTYA 2W2OP 1KQKA 2VQFJ 1YITS 2ASJA 2V2QA 1RHQB 1DZ5A 2GIQA 5DM6Q 5KFLA 3Q24A 1UMJA 2D3ZA 2DKOB 3EGVA 4DL6A 4JI4F 1RACB 4H4OA 5KFUA 3M8QA 2J9EA 4AYBD 5IV3A 4C98A 1JXVA 4YY3F 2NS1B 1JMTA 2VPWB 2ALYB 3NL0A 4NLSA 2UXDJ 1IKVB 4ZVHA 3LUYA 4NEZA 4W90B 2BJ8A 3OR2B 2I2YA 3PY8A 4K4UA 3EICA 2O1PA 1B70B 2JRSA 4QWCA 5AXMA 5LMNF 2C2NA 3QRRA 3CDWA 1U0SA 1X4FA 1RDRA 2NSCA 3UPFA 2VPYB 1LFWA 2ACMA 2OEMA 2R2RA 4AL7A 2KT2A 2NUUG 2MHEA 2GAGC 1SBRA 5IM0B 2C3PA 2RDJA 2OAUA 3EE3A 1KEKA 3GMGA 3AY0A 1TL7B 3IM9A 2N82B 3SCKE 1Y5LB 4C0OC 1NM2A 4RBVA 3FRYA 2EC2A 2X3GA 2KN4A 4GVBB 3LP2A 1K1SA 2IA6A 1H6KX 1Q5YA 2GHVC 1KSPA 1R0AA 4NXNJ 2KKHA 3M6WA 2FHJA 5IQQA 1U6ZA 3BGRB 4X4UA 5DGBA 1HW8A 1WHXA 1RJJA 2CZVC 3W8PA 4CO2A 1S59A 4I56A 3MMJA 2DH9A 4QR1A 2FZGB 4QIFA 4ZVOB 1RP5A 3VTIA 1RK8A 3NGUA 4YMEA 2B9XA 4DV7F 3CCRS 3FZ2A 1YZ6A 3TQEA 2YX7A 3PW4A 1TKZB 4PUOB 3M2VA 2FLPA 1EP4B 2GNKA 2W2QP 2EFNA 4ETXA 3L95X 2YNGA 2LVWA 1JLEB 3CCVS 3GG1A 1MG7A 1X5SA 2QE5A 3HHLC
chains in the Genus database with same CATH topology
1RQ0A 2YQ3A 3I96A 1GTEA 2Z4PA 3OXGA 4NZ7A 1U2FA 5IXUA 1TV6B 4C8KA 3U7JA 3ISNC 1HNIB 2HW3A 1H98A 2PDAA 1Q16B 1ZOTA 3C8YA 3PR5B 2YWKA 4X62F 3OW2R 4WFYA 3V6KA 4DDFA 3D1OA 1WTBA 5BYSA 3KHGA 3H5YA 4LFCF 3SQGA 4KC5A 4WFZA 4ID5B 3HMJG 3FEXB 4YR2A 2ZH2A 2VBYA 1LK7A 4NLVA 1NK4A 1FKOA 2RF2B 2V2KA 1NAQA 1P27B 1T3OA 2J6UA 1NH8A 2HVIA 1X9WA 1URNA 1Q4RA 2DD8S 1NJIT 1JLCA 3I0RA 3VAGA 2B4VA 4FVCA 1OPIA 1XMBA 3AH6A 2NR0A 1Z2ZA 1LWFB 1JKHB 4B3OB 3FSYA 5AXNA 3W7BA 1K9MT 1EETA 2WCXA 4BDPA 2O67A 2JHEA 1S7HA 3OUYB 4NL5A 2ZNZA 5DQHA 1HWUA 3BDEA 3EGZA 4B3RF 3M2RB 3DOLB 2IJFA 3JTOA 4DN9A 4J9OA 4DF8A 4Q2MA 5KT4A 1U49A 3CCWA 3QGHA 2C3MA 3FDSA 2R7TA 1PC5A 2PI4A 2W4PA 3GR1A 2F4VF 1XBWA 2DGSA 3HX9A 4ATNA 2E5LF 3HPOA 4OZJA 4X4VA 2I38A 4U6PA 2UVVA 4DJBA 3OXFA 2K7JA 1S72S 3RW6A 1FDDA 1B0VA 3R5AA 1S48A 4ECSA 3T1HF 2ZC4A 5CYQA 1BD6A 3I9ZA 1WF1A 3V5RA 4C0BA 3ENQA 1VQ7S 3IWNC 3E51A 2LXUA 2CQIA 4GC7A 4LSNA 4RNNA 2AWZA 5EX0A 2MQMA 2JL9A 3VR1A 3TVZA 4IOCQ 3TARA 2KHDA 2WHOA 3OR1B 2LEAA 2W25A 2DK2A 4YR0A 3X3UA 1IKXB 1SL0A 3NRBA 1IKYB 4Y28C 2HFOA 2OPPB 2BJDA 3TUJC 3VAIA 2E1AA 5LSOA 2RKIB 3H98A 1Q7YT 3D2WA 4OX8A 2W7PA 3TA0A 3NCRA 4RNOA 1NK6A 4KB7A 2YNHB 4FN5A 4OJGA 1AUDA 2DNZA 3TAMB 1TK5A 2DITA 4WU3A 4E8UA 3UNGC 3T1YF 4IO9Q 3WX4A 4I6WA 4ELUA 2X1FA 5I42B 3MEGB 2RS8A 4I69A 4J9NA 1HBNA 4L3NA 4URGA 3RB3A 5HP1A 5GAHI 2AX0A 4QIVA 1QUPA 4CIOA 3DFEA 2GX8A 2CPEA 1NK0A 2EBEA 4QIGA 3N4WA 2YKNA 1IKWA 4EWTA 4RUAA 1GNKA 4NLYA 4RLEA 4PPDA 2XI2A 2IYIA 3FFIA 1HNWF 3PACA 4OX9F 5KFTA 4OI4A 2DVIA 2DCLA 2K7KA 2N3LA 4GO5X 3U27A 3MM5B 2R8JA 5BJRA 4X4OA 2OPQA 4ZCIA 2W9AA 1TL1B 1U1QA 2R2UA 2CQDA 2ZVSA 2KM8B 4KPYA 4K4WA 1X4AA 4QR2A 2WB1D 4ECQA 3CJ2A 2DNRA 2G9OA 3D54A 2KG0A 4RBUA 3LP1A 2ILZA 2F7VA 3RRKA 3MUVP 1RT3B 3T1AA 2VZ9A 4KHPF 2B43A 4G1QB 3QIPA 2KH9A 1YRXA 4ED6A 5CD4H 1JLAA 5E2QA 4JI7F 1U2RA 1S79A 4WFNQ 4F4YA 3KK2B 4ECVA 4F8RA 4RKUC 5B0AA 3SEOA 2OSQA 4HYKA 2J6SA 2DH7A 3MMBA 4JI6F 2FJWA 3PM9A 2EK1A 1M5KC 1X4GA 1XR7A 3G6YA 2ASDA 3M2UB 2CZ4A 1PILA 3MGJA 2V4JB 1DTQB 2CPYA 1UVMA 1XEZA 2XMKA 4ZCKA 1UVJA 1TL3A 3IR5B 4X4RA 3FEZA 1XMOF 1FXLA 2FJBB 2QA4G 2KFZA 3HHLB 4QWDA 1HL6A 2FB0A 2XMWA 1HQEA 1RTHB 5KFZA 4MH8A 1VBZA 2ZH6A 1FA0A 3M8RA 5D6GA 1U47A 2Z8QA 4NLWA 4OMFG 5I4MA 3M1VA 1BQMA 3TOQA 1B64A 5KFGA 2D7SA 4Y65A 2LQBA 5KFAA 1S77D 5DJBA 2FVRA 2JVRA 3LOUA 1BC6A 1VQ6S 1WEZA 4X2BA 3HHDA 1N54B 2VPXB 1HBMB 2B4PA 3G86A 5E3AA 5KTQA 2MQLA 5LT5A 2ZHBA 4LFBF 2JX2A 4NA2A 3KFWX 5L1LA 2VG6B 4RNFA 1S9EA 4IG3B 1VQOS 4A8XA 3HVAA 2ZH8A 3VALA 4YUDA 4JI2F 4HDHA 2W4DA 4LVNP 1T94A 5KFKA 4DFKA 1QJHA 1C4CA 2YX1A 5F8MA 3Q22A 3M32B 1IM4A 4DV3F 4O3RA 5HQ8A 3OL9A 2WSCC 1KONA 2W8KA 4A8KA 1B0TA 1XR6A 2Q66A 2NYIA 3GG0A 3M9OB 2OH2A 4IRDA 3IRWP 2J9DA 2RD5C 1KLMA 1U1KA 4K4TA 5A6WA 3SV3A 1KNZA 5HO4A 2BVZA 3M30A 5CH7B 2V4RA 3UD4P 4UW2A 3QO9B 4MMOA 1Y7PA 5DM7Q 3HHNB 1G1XA 5KFMA 4RW8B 4AQYF 3KLIB 3UI3A 1RT6B 5GAGU 4ZDNA 4B02A 2GHWA 4NLDA 4OHXA 1I1GA 5F0UA 3CF5Q 5FDLA 2M5YA 4O4GB 4ETZA 5F9LA 4TQRA 3E8OA 5DG9A 2RILA 2AGQA 2LKZA 2OP5A 2IM0A 2XSFA 4MK7A 1SL2A 5LJ5Y 1RA6A 4NXNF 3FRZA 3N5FA 4IFVB 4KTQA 3I0SB 2F8HA 2J7WA 1DARA 2YNHA 4IG0B 2GHPA 4NCGA 2BM0A 5C42B 3POTA 5E41A 3AB2B 4JBCA 3HP6A 4WFXA 3IRXB 5H1SV 1IJEB 5I42A 4U67Q 1T05B 4A8FA 1HHTP 4EYHB 2POKA 3OVAA 2KHCA 2KRBA 2BBEA 2V8DA 3PHEA 4DV1F 1PGZA 1FJCA 3J7Z5 2JEFA 1X4HA 5GADU 2V4QA 1RTDB 1C0TB 4ECYA 1BWEA 4I4BA 1XMQF 1TKXB 1P8GA 4Q5VA 1Q82T 2WAQD 4I7FB 5FLXY 4ELTA 3I82A 5KG5A 4H4OB 3DLGB 4C4WA 3M8QB 5FD1A 1VQ4S 1MW7A 3ENVA 2JLEA 4IO1A 4LQ9A 2C3YA 3MTKA 2OPSB 4ZHRA 2ZM6F 3MMCA 2JFDA 4RW4A 1CLFA 1TFYA 2ZOGA 3JAMY 2ZFHA 3T9ZA 2EI5A 2HWIA 3GE9A 1NK8A 3MM7B 3FEYB 4ED1A 3TUIC 2B56A 3GILA 1Q8BA 4GKJF 2GJ2A 2JZ5A 2RRBA 2AV5A 4DBQA 2MZJA 5MLCV 1MWYA 1DFDA 1KHWA 1WD6A 5DRKA 1UJ5A 3H8YA 2MGZB 3EPGA 2BABA 4TQSA 1HBOB 4O3NA 2FLNA 4K0KF 1UVNA 2YNIA 4KKOA 2N4CA 2H9ZA 5B0EA 5THWA 4PCQA 2AJFE 2BV3A 5J1EA 3UDLA 1C1BB 2GW8A 2E7WA 2Q6CA 3MD1A 2M7SA 4ILLA 2MKSA 4YDDB 1IBKF 2EWHA 4PQUB 2FLOA 1JXLA 4HI2A 4IUFA 1NJZA 2G0CA 4NLTA 1S1UA 3BQ1A 2NPIA 2D1CA 2K1RA 2B0GA 1G7CB 1DLOA 2KFYA 4K4XA 2IJNA 3MUMP 4C3KA 1TUVA 1CG2A 1GX5A 4J9KA 3NS6A 2R8HA 5KFQA 2VFTA 5H9EJ 3PO5A 1VFJA 3O6QA 2OFGX 2YTCA 2IBOA 5AXLA 2MZRA 2HMIB 2VA2A 1HQUA 3A8EA 2RQKA 4KQZA 1P9QC 1M5VC 2DNYA 4ED0A 3F56A 1FE0A 1Q7LB 4ZP8A 3VWSA 3OV7A 4ECRA 4BC7A 1F5AA 4WK3A 4N76A 4TNOA 1JNZB 3HT3A 2R4FA 1ZAVA 3CSKA 3I5AA 1QE1B 5DLGA 4XIUA 3Q2SC 4DR1F 3KLHB 2DGQA 5B0GA 1UVIA 3OQ2A 4QYZJ 4X4NA 2F8EX 3H5XA 2BRKA 4IQXA 1FCAA 4DQRA 1S1VB 4DL0C 4PXEA 2HLUA 2NZ4A 1R43A 3BGFA 1A6LA 1U1MA 2UUAF 5AE1A 1Y4ZB 2YNFB 1H7WA 1VQMS 3H5UA 3MCSA 4RW6A 4NYOA 3MEEA 3DLKB 5K9FA 2BUNA 2FDNA 3MM8A 3W2WA 2JVOA 5EU