5LSLA

Crystal structure of yeast hsh49p in complex with cus1p binding domain.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
79
structure length
79
Chain Sequence
GNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRLIKVRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of U2 snRNP SF3b components: Hsh49p in complex with Cus1p-binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding domain
molecule keywords Protein HSH49
total genus 21
structure length 79
sequence length 79
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lslA00
4TU8A 4CH0S 1YTYA 2OJ3A 3S8SA 2MKHA 2LQ5A 2SXLA 4V19X 2CQ1A 1QVGR 3CCQS 4WKRA 2N82B 5D77A 3P5TL 3VAIA 4F26A 2QEXS 2ERRA 1WEYA 3VAJA 2JRSA 2L08A 3J7ZT 1VBZA 3EGNA 1YJWS 2HYIB 1H2UX 1H2TZ 2DNLA 5GVQA 4YB1P 3S7RA 1Q82T 1HA1A 2RRAA 2LCWA 3I55S 2A3JA 4W90B 2ADCA 1URNA 2YTCA 3CCRS 2CQPA 2MGZA 5IQQA 1YITS 3UCGA 3VALA 4IUFA 4PKDB 2DNOA 2QA4S 2HVZA 4IO9Q 3H2VE 3CCLS 4PR6A 2DITA 2DNYA 2D9PA 3UCUP 2KH9A 3G6ES 1X4BA 4C0OC 2KU7A 3TP2A 2LYVA 3CC2S 3NS6A 1PGZA 2EVZA 2I38A 2MHNA 2VOPA 1P27B 5JVHQ 3G71S 1SXLA 3G8TA 2D9OA 2F9DA 4Z2XA 1BY9A 5LXRA 3IRWP 1DBDA 3R27A 3MXHP 2LXUA 2MXYA 2HGNA 3L3CA 2KRRA 1X5PA 1X0FA 1VQ8S 3U1MA 2F3JA 1QM9A 2M8HA 2MJNA 1U6BA 3RW7A 3P3DA 2L9WA 4TLQA 2RRBA 5BJRA 1K73T 1H6KX 5LXYA 1WEXA 1FT8A 1WF2A 2RU3A 3V4MA 2EK1A 1X5OA 2RS8A 2V94A 3MI7X 1YJ9S 3HHNB 2LA4A 4Y0FA 1XN9A 2DH8A 3ZZZA 2MMYA 1N88A 3MDFA 2VOOA 4ERDA 1X5SA 1A7GE 1L3KA 2CPDA 1VQNS 1IQTA 2MKJA 2DGWA 3MUTP 1YI2S 3K0JA 1VQ4S 2MQNA 2FC9A 2KHCA 4CH1A 2RUGA 3S01A 1U1OA 3SMZA 4WCEQ 5LSLA 2PE8A 3R1LA 2HGLA 2D3OR 2RQ4A 1JJ2R 1U6FA 2B0GA 1WWHA 3LQVA 3CF5Q 2RQCA 3B4DA 3IWNC 4FXWA 5FJ4A 4CQ1A 1ZH5A 3JB9k 1JMTA 2DNQA 1VBXA 2N7CA 2LA6A 1FJEB 1R8HA 4C4WA 1X4AA 1R8PA 2CQ2A 1SJQA 2LEBA 1VQMS 2DO4A 1VQ5S 2YKAA 3NS5A 1VQKS 3BEGB 3THPA 1KD1T 2CPJA 2OTLS 1WG1A 2VODA 5GAHU 2OSRA 2KM8C 1HD0A 2LECA 2KT5A 2MZRA 1OPIA 1WI6A 2FC8A 1N52B 4WFNQ 1K9MT 2ZJQQ 4ZKAA 5DDOC 2MQMA 2X1AA 2CPYA 2MYFA 5DM6Q 5GAEU 3CCES 2OTJS 2N3OA 3VAHA 1KOOA 2CQIA 2MSTA 1ZZNA 2DIVA 3NMRA 1WI8A 2WBRA 4M5DB 1O0PA 2CQDA 2O3DA 2KI2A 1VQPS 2RVJA 4UY8T 2ZJRQ 3N9UC 2E5GA 1UW4A 2G4BA 4J5OA 2MPUA 2DK2A 1S72S 3H2UB 1G2EA 1VQ9S 5IFMA 2L41A 2DGUA 1WEZA 2KVIA 2LXIA 3MUMP 2F9JA 5IM0A 2MKCA 1WF0A 2YWKA 2ADBA 3G4SS 2NLWA 3BO2A 3P49B 2DNHA 3VAMA 1VQ6S 1WTBA 1M5VC 2J76E 2CPZA 3DLLQ 4C7QA 5IM0B 1FXLA 2HGMA 2LEAA 2K3KA 2JWNA 2DGTA 2MQLA 2GO9A 2MKIA 2CQ4A 2U2FA 1X4CA 1AUDA 2MZSA 2VONA 1SJRA 3CMES 3CPWR 3RW6A 3G9CA 2MQQA 2DNNA 1SJ3P 3CULA 1U1PA 2YH0A 2MZJA 2XS7A 2CPXA 2DNGA 4OZ0A 2KYXA 2DHGA 3UCZP 3G8SA 1DRZA 1D8ZA 3NNCA 4WIIA 4CIOA 1VQOS 1Q7YT 3S6EA 1DHMA 4QPTA 1KQSR 3MD1A 1UAWA 2E5HA 1VBYA 1VC5A 1JJHA 2OIHA 2DGXA 4EGLA 1FJ7A 5DDQC 3BS9A 2X1BA 1PO6A 2KFYA 1WHWA 2KXNB 2M9KA 3R1HA 3P6YC 2MGZB 5LJ5Y 1N54B 2BZ2A 5DM7Q 2MY7A 1U1RA 2AYEA 1X5TA 2CPFA 2M0GB 1FNXH 2E5JA 2RT3A 3MURP 1Q86T 2DNPA 2XNQA 1Q81T 1QVFR 2MSSA 3SDEA 2AYGA 3UWTA 1WF1A 2DHSA 1WELA 2MZTA 3CUNA 1U1QA 2RNEA 2MQPA 1M1KT 2XB2D 2PEHA 4F25A 3PIPQ 1X4GA 3BO4A 1FJCA 3SDEB 3B4MA 2DNKA 2M2BA 1RKJA 4WFAQ 3CCJS 2JX2A 1YJNS 1U1NA 2EK6A 4BS2A 2CQ3A 1X4EA 2UP1A 3PIOQ 2J0SD 2G0CA 2LKZA 4LIRA 4U67Q 3ULHA 1M5OC 2KN4A 1X4HA 4UQTA 3VF0B 5DDPC 2CJKA 2Q79A 1YIJS 2KXFA 4QQBA 4IOCQ 4QU7A 4W92B 1YWXA 1SJFA 5DETA 3Q2SC 3CCVS 1W2BR 2FHOB 1YHQS 1U1MA 5JVGQ 2CQ0A 5CXTA 3THTA 2K8GA 3LPYA 3J7YU 2BOPA 2E5IA 3CTRA 1ZZFA 1VQLS 3NNHA 4ED5A 2OSQA 1M5PC 2KG0A 1N8RT 2M4MA 5HL7Q 4WFBQ 2M70A 5GAGU 4OZ1A 4TU7A 3VAKA 3G96A 2E44A 1K8AT 1X4FA 1B7FA 1WHYA 1HL6A 4A8XA 2KG1A 2MKKA 2JVOA 2J0QD 1U2FA 1VC0A 3HI9A 1WG5A 3EX7B 2MKSA 2XS5A 3BO3A 3VAGA 2MB0B 3CXCR 4PRFA 1U1KA 5MLCV 1OWXA 3I56S 2N3LA 2MJUA 2DNRA 2MQOA 1UP1A 2J8AA 1FHTA 1OO0B 2M88A 3UD3P 2XNRA 3CC7S 1WG4A 2YH1A 2JVRA 3FEYB 3CCMS 1RK8A 2MY8A 1WHXA 3MUVP 2DGQA 1FO1A 2LMIA 2DGVA 2AYMA 2XSFA 1WHVA 4RU2A 1D9AA 3MD3A 2CPEA 2XS2A 5D78A 2CPIA 2M52A 1UFWA 2RS2A 1OIAA 2G1DA 2KRBA 1P1TA 2CQGA 3US5A 5LSOA 3ZZYA 3CMAS 2M8DB 1M5KC 1VC6A 2DISA 4QU6A 1M90T 2DH9A 2DHAA 4YOEA 2MZQA 2CPHA 3CD6S 1HD1A 2DIUA 2DB1A 1S79A 2AYBA 2AD9A 3UE2A 3TYTA 5LJ3Y 4P6QA 3CCUS 2CQCA 3EGZA 1VQ7S 1A9NB 1KOHA 1SJ4P 2DGOA 5HO4A 2CQBA 4WF9Q 3CC4S 1X4DA 5CA5A 3VAFA 2DGSA 1H2VZ 2HZCA 1NJIT 2DNZA 3TO8A 2CQHA 5GMKa 2DO0A 2KM8B 2FY1A 2X1GA 3UD4P 1DZ5A 4TU9A 2KXHA 3NNAA 1F9FA 3SXLA 3Q2TC 2NZ4A 5EN1A 3MOJB 4LJMA 3D2WA 1NO8A 1NU4A 2MZ1A 3OW2R 1JJ4A 4IOAQ 4LMZA 2DH7A 2ZJPQ 5CYJA 4FXVA 1U1LA 2QFJA 4YUDA 4F02A 3DXBA 2X1FA 2I2YA 2GHPA 1CVJA 5GADU 3U1LA 1KC8T 2U1AA 5DDRC 5H1SV 2DHXA 2DNMA 2FPHX 2M7SA 4Y00A 3FEXB 5ITHA 3CCSS
chains in the Genus database with same CATH superfamily
2JHEA 2LQJA 1TELA 3AD9C 4ES2A 4TU8A 1ZM4A 3W5YA 3W63A 1F3VA 1UPPA 2HVHA 1PILA 2HBZB 2GJFA 1FWKA 2MKHA 3BBCA 4C0BA 3GLJA 3PW5A 1LQ9A 9RUBA 2CQ1A 4P74A 5DQGA 4H4MB 5DQHA 1QVGR 4LF9J 3RB6A 1TKTA 2Q66A 1S9GB 3OR2A 4LBHA 4MKAA 2G0JA 3OFHA 4WU2A 4JP8A 4OLPA 3DI6B 3NAHA 4C2MA 4QR1A 2XY5A 4ZOSA 3R5BA 2B43A 1T9WA 1H7WA 3A1YG 1VBZA 1HYSB 4EZ9A 4O3RA 2C2MB 1RT1B 5ETVA 1Q82T 3LPEA 1U26A 4R25A 1M1GA 3I0SA 3I55S 2ADCA 4NLUA 1QE1B 2ZH7A 1D09B 2CQPA 4Y2AA 2HFSA 4LFCJ 2IMWP 3W66A 3VALA 4YHHF 4WIQA 3D6HB 1TKZA 1VQSA 1X60A 4IO9Q 1S1TA 4DR2F 2FJEB 2QV6A 4M8LA 5A76A 1GX6A 1W26A 2WSCC 1RHKB 3BQ1A 3FBCA 1CPZA 4NLDA 2DITA 3W5XA 3AAWB 2FHJA 4ZCLA 3C15A 3ILJA 2UUBJ 2E1RA 1RJJA 3K17A 3UCUP 2C3UA 3ENVA 1CBKA 4XTTA 3C19A 3OVBA 3W62A 4KR0B 5E41A 4C0OC 1S97A 3PX6A 4OI2A 3ZXWA 2LYVA 2KO1A 3CO0P 3FRYA 3H59A 2E29A 3EWGA 4WWSA 3QIPB 5L1KA 2VOPA 4JUZA 4IRCA 4KO0A 5JVHQ 4YS2A 2L48A 3UVJA 5GAEI 3TA0A 2AKWB 3GONA 3TX0A 5BYSA 5L46A 4DL2A 1Q5YA 4OYWA 3MPWA 1I94J 1IKVB 2IC3B 4DUYJ 3TJ8A 4K2JA 2CNOB 3MM8A 1R31A 3TZYA 1HBNA 3KUEA 3VVUA 4DUYF 1NCLA 1Y3KA 3IGVA 5T41A 3V6KA 2XM3A 4QYZK 2CXEA 4O44A 3W8PA 3I32A 4EYHB 2GNKA 1S0MA 3EPIA 4KBIA 1UEUA 2ACMA 3L3CA 3D6MB 3QQCD 2VL1A 3DOKB 5LMNF 3SSQA 1S4FA 3ZZTA 4FBTA 3KJNB 2F3JA 1QM9A 2ATCB 2BJ7A 3J7AN 2HEKA 2H3EB 4ECXA 1RT6A 3GJRB 4DG1B 1R0BG 2RRBA 1ZA1B 1P1LA 5LXYA 1BQNB 4ZHRB 3I96A 2BANB 3Q8UA 1WF2A 5ETSA 1QD1A 2RU3A 4DR5J 1JX4A 1FTCA 2V8VA 2F8EX 1YJ9S 4X84A 3JAMU 2V9KA 4EFAC 3HHNB 5KG1A 4PXDA 4P52A 2H5EA 4ZPDA 4J9RA 2PIIA 4LBPA 2NPFA 4M63A 3SV4A 1WORA 3BSOA 2Y8YA 3PV8A 3ZZZA 3TA2A 1WKJA 1FKOA 5E33A 5L8RC 4ERDA 5D0EA 2QLJB 3I87A 3IFEA 4O23A 1IN0A 2PO4A 1A6LA 3DHXA 2XHCA 5G0RA 2PA8D 5KFLA 1BE4A 3PO5A 1RUSA 2HBYB 4CT9A 4R0EA 1V5VA 4MFBA 3MUTP 2Y9HA 1Y10A 3K0JA 4B3OB 2M5YA 1KN6A 3R7SB 2OEJA 3DRYA 4OJGA 2OFGX 1VQ4S 2UXDJ 2CJYB 3I31A 4FYDA 3RB4A 5KFGA 1TUGB 2K3IA 2JEFA 2LEPA 2PI5A 4WP9A 4WJBA 3NGKA 3Q8YA 1CS4A 3KK1B 1N6QB 1YRXA 2GIFA 3MAHA 5LSLA 3VZIA 4NLYA 4OZNA 2RQ4A 2D3OR 1LFWA 2C3PA 1U6FA 1VGYA 2B0GA 3BREA 1WWHA 3M8PB 1ZAXA 3M8ZA 1KONA 2HLTA 2PMWA 4IG0A 3HULA 3UNYA 3SSSA 3D54A 1CJKB 2PMZD 1T0TV 4J37A 3CDUA 4X4PA 3U7JA 3GV7B 3KLIB 3M4XA 1S6OA 4YB6A 5KT2A 2ALYB 5KFDA 3T41A 1SBRA 5HN0A 3RRHA 1VBXA 3CCTA 3FQLA 1B64A 4WXOA 5KG6A 1FRIA 2LA6A 4DR4J 1WOOA 1FJEB 2ASYA 1HBMA 4X64F 5A2QU 2XY6A 4WU3A 1IJFB 2V4JB 4C8MA 3T6BA 4F67A 4C4WA 4PCQA 2FGCA 4PG8A 5HROB 1SJQA 4IH7A 3UDVA 2UU9F 1FTRA 5EWGA 3MMCA 4MK7A 5HVFA 2ZC4A 3NP5A 1TMJA 2GQCA 1NBEB 3NS5A 4QIEA 4AQYJ 4AQYF 3MMJA 1JB0C 4ALZA 2ROEA 3CEDA 3D66A 1VIOA 4WE1A 1C0TA 2Q6BA 4PUOA 2H4YB 1WC5A 2L3MA 3NBPA 1N33J 2GO8A 1HD0A 2LECA 1MLAA 2HS4A 2AP6A 4KHMA 1T8EA 3KOAA 4UQGA 4TY8A 4KFBB 2ZJQQ 1RE1B 4NWBA 5DDOC 3C16A 3DM2B 3FMWA 2NXCA 4WK3A 4UY85 2H65B 4P2MA 2BRKA 3EJMA 3IO1A 3V6DA 4TLRA 2DTJA 2KJVA 3WX4A 5M2UA 2E66A 3CSKA 3K5NA 2YQ3A 5KFNA 1JLFB 3VAHA 1S48A 4ED7A 3ILLA 2OLWA 4DFJA 1UFLA 1KOOA 1F5AA 2LDIA 1S6PA 3I4PA 4DDFA 1PYTA 2MSTA 3EM1A 1RTJB 4KKOB 4RW7B 4I69A 4O3PA 5HMYA 1GEHA 1ZZNA 3N5BA 4NPOA 4DV3F 1F9HA 1UJ5A 2HQDA 2WBRA 4J9OA 4B08A 4B3MJ 2ZUAA 4KJIA 3DRSA 2R42A 2FYXA 1AYEA 1ZM3A 2RVJA 3NRBA 4K8RA 4ZN1A 1TAUA 2MEWA 2E5GA 2VKRA 1JLEA 1UW4A 5DZ7A 1NK0A 2G4BA 2GGPA 4J5OA 5KT6A 4GO5X 4I1TA 4I2PB 3G6YA 3E3XA 3A3OB 3EGWB 1DTTA 1S72S 3ILOA 1AZSA 2L41A 1Y11A 3MF5A 4P7VA 2B51A 4GKJF 2KVIA 3GJQB 3SSRA 2C2DA 3E01A 4LF5J 3FVYA 5IM0A 4USMA 5HLFB 4ZPAA 4DS5A 4B17A 4PXBA 4F7VA 2J9DA 3D6TB 3IS9B 4QWAA 2NLWA 1SQGA 1RA7A 2PFDA 2QLWA 4OLOA 4DV1J 2P8IA 1CJUB 3PM9A 4OMFG 3T5LA 3DLLQ 4HYKA 1RT3A 1BD6A 4UF4A 4ZK7M 4F4ZA 4O4RA 1NK6A 2EFNA 1TTHB 2DVIA 3M2UA 2ZOFA 3BKTA 2LEAA 2ZNZA 4X4TA 1KWMA 3ILIA 2YKNB 4RX6A 1RT2A 3Q23A 2DRBA 4LT6A 3EDRB 3EZUA 4NCAA 1YBAA 5KFVA 2GO9A 1IKWA 4LR8A 5IS2A 2V8PA 3W8GA 2U2FA 1X4CA 4PZVA 3WHIA 3GV5B 4BLGA 3N01A 2VC1A 4L74A 2FJBB 3RW6A 3IBWA 1D8YA 1FDNA 1PJ7A 3GE9A 4F8RA 1JIHA 2I1RA 2KFZA 5KG3A 2EG1A 3BKUA 1BMQB 3CD7A 3M8QA 2C3MA 3M8SA 2DNGA 1R0AB 1Z4UA 1ZM2A 5CYQB 4TN2A 1NKCA 1S1VB 5E3RA 3KG1A 2EFPA 3IRXA 1KLMA 4KB7A 3RUBL 1L3UA 2UXDF 4A46A 4CYUA 3MFIA 3BDEA 4P7TA 2XO6A 2R7UA 1KVKA 4JV5J 2F63A 5FLXU 2EWHA 1KFSA 1FDBA 1Q53A 5E3QA 4ECZA 4ZMMA 2VQFF 3MMAB 2IAJA 1VLOA 3GTYX 4KH0B 2Z2ZA 4QPTA 4QWDA 1RU2A 5I3PA 4PWUA 1T3OA 4X65F 4UTGA 2YQ0A 1KQSR 2HFOA 2H4WB 1HWUA 4J90A 2RMLA 4ZP9A 2YWFA 2J9DE 1JJHA 3OXLA 1GMVA 4OI6A 1CQMA 3FMBA 3FEZA 4PXCA 4Y3CA 4RLEA 2FJXA 2YKPA 1YZ7A 2X1BA 3POTA 1PYOB 1RACB 2FB0A 5J1PA 2N4CA 3GJSB 4LF5F 2M9KA 4CLSA 1QE1A 1SB6A 3TEGA 3TEHB 2BVZA 3R1HA 1JNRB 4NYPA 1XMOF 3P6YC 2R2SA 2XMAA 3PVXA 3L7OA 4C97A 2ZH5A 2LXFA 2CVEA 5K8MA 1DLOA 1KKHA 3EYZA 4CLFA 1U1RA 2Z4PA 2AYEA 2CNKB 3QJPA 2BKOA 4X4VA 2VPXB 2OELA 3N6NA 1TKZB 3F56A 4KAIA 2W9BA 3K57A 5IQ6A 4RW8A 3K58A 1S1WA 5C24B 5LOQA 5J2NA 1YJRA 2Z2LA 3RG6A 1Q86T 2XNQA 4N5SA 2HFZA 3TOQA 1FK9A 4RUHA 5KG0A 2IYGA 4X4OA 3PRVA 1QVFR 2G13A 3QFWA 3QIDA 3EE3A 2CKWA 2L9NA 5KFIA 3I9V9 1TZ0A 4FYYB 1VRUA 3WIVA 2B6AB 1I1GA 4A8KA 2MQPA 2ILZA 2PFFB 3FDSA 3HXMA 2ZZMA 2WCXA 5KT5A 3K8WA 1TP7A 3LGHA 3Q0AA 1RKJA 3PCOB 5A2QY 1U1NA 2EK6A 2DY1A 4OIXA 4LF4F 3LWMA 3MPVA 1HBNB 2UP1A 4PUOB 5AXLA 4C0HA 4DOZA 3J81j 3LWLA 3BQ0A 4I2QA 2N4DA 4OJ3A 3DGVA 3KHGA 3GIKA 2ABYA 2LKZA 2NXNA 4DLGA 1P9QC 2B4VA 2IDLA 4L3NA 4A8SA 3AQPA 1G2EA 1VCTA 2KN4A 3BGRB 2W7AA 2VG6B 3DOKA 3VF0B 3ZTQA 5DDPC 2CJKA 2VA3A 3Q22A 5DJBA 2KXFA 4U7UK 4IOCQ 4NA2A 1DY3A 3NMAA 3QRPA 3TQ1A 3HSGA 2AX0A 2FHMA 1WC1A 4TNOA 1SJFA 1RHRB 3NCPA 1K0VA 4J9UE 3DRXA 4RW6B 3R8YA 3TRGA 1F0XA 5JVGQ 4DQRA 5CZVA 3P4UB 2CQ0A 3AJ1A 3OR1B 3OL7A 2P5VA 1X9MA 5CXTA 3K2YA 2HNYB 4DN9A 5C25A 3THTA 1PKUA 3LPYA 2WK4A 4OYXA 4RWWA 4JI6F 4QYZJ 2QT7A 3UD5A 3GV8B 1HMVA 4DCPB 1Q0NA 1X0PA 3EVOA 2H1YA 4DPUA 4CLUA 5KFPA 4B9VA 4E2FB 5AE2A 3NNHA 4ED5A 1JLCA 2DR6A 5FDLA 4KHRA 1JNZB 4IR1A 4ZLJA 2Y1JA 4NLVA 2KG0A 3AB4B 2OMLA 1MROA 3UN3A 1N36J 2QYGA 3M2VB 3BBBA 2IJFA 4L75A 4DL5A 1XMQF 3QZ8A 3KK2B 2IBKA 1HNWJ 4LSLB 4R8UB 2E44A 5A6PA 1WOSA 3JSYA 2ZH2A 1B7FA 3T1YF 4HTIA 2RJZA 5F8MA 4M5IA 1S57A 3KHLA 3EVWA 2IA6A 3NEKA 1JLBA 2J0QD 3HD2A 1HHTP 3GFXA 3EX7B 1QDUB 2MKSA 1U7LA 4F3QA 2GAHC 2XS5A 4PWWA 2B9EA 1CS4B 4JOUA 1IR2A 2B4UA 4USTA 5K14B 2GZOA 2J7WA 1FX2A 4DF4A 4ICLA 1NLKL 1DTQB 1XQIA 5CD4A 5KOWA 4CWBA 1R43A 4IG0B 4QR0A 1FHTA 4UOCA 2BJDA 1EKSA 1T95A 2HHPA 3UD3P 2XNRA 1MMNA 2YQ1A 1IM6A 3FC9A 3L95X 4A8FA 1NPKA 3KLIA 1OPZA 2JVRA 3FEYB 3CCMS 4F4KA 2XMKA 1ITPA 4OYZA 2HQ3A 2RH3A 4ID8A 4HI2A 2FVPA 3FJ2A 3GIMA 2PC6A 2XULA 3ETMA 2X7IA 4LRCA 2J9CA 3DRPA 1S77D 2CNNB 1RDRA 5KFWA 5HMXA 1WD6A 2F4FA 3C6UB 2BM1A 2VJUA 2WTFA 3QYYA 1RAOA 2W9CB 5D78A 3WDOA 2RS2A 2O67A 5B09A 1F2GA 1FFWB 4USWA 3NGUA 3B78A 3VR1A 2APOA 2R2TA 2ZZNA 4GVBA 2Q43A 2R3VA 3FQKA 3D4JA 2HG4A 2B5JB 2LU2A 3C6TA 4CLTA 3GQCA 4B9MA 1C2PA 4KC5A 3VTIA 1B0TA 2G2OA 3WX8A 1WACA 2WAQD 2QLBB 1NB2A 2DHAA 5BYQA 4CTAB 3OL6A 4ED8A 3R5DA 3PO4A 4FF2A 1DQ9A 1NPPA 2MZQA 5B0DA 2CPHA 4USUA 1WKLA 4X62J 2FVSA 3PDNA 2V34A 4B3TF 2V2VA 3NS7B 5D6GA 2AYBA 4DX7A 4NZ7A 2VG5A 4DPYA 2YKMB 5LJ3Y 3BGUA 5B0EA 5EX0A 3JYTA 2MLYA 2RDJA 4OYAA 2B4PA 1TL7B 3Q86A 3V5RA 2R9LA 1TUWA 1TVRA 2WBMA 4BC7A 3MM5A 1RBOB 2BE2B 1J27A 1UKUA 1TK5A 2B7CB 1XNRF 1KOHA 3CJKB 1SJ4P 2FLPA 1A9NB 1VI7A 1RAGB 1RAEB 2EKYA 2QMUB 3IAS9 4OHZA 1F5CA 3RRKA 3TAMA 1XNRJ 2CDRB 3Q89A 1RHJB 3RR7A 3JAMY 3EXYA 4P2XA 3DC2A 3TO8A 1ZA2B 4C3KA 3UPFA 2HRUA 1Q8BA 3DOMB 3DU6A 2DO0A 3ENWA 3PYEA 4MAKA 5DS7A 4L72B 2CIMA 5G4DA 2X1GA 4ZVQB 2HMIA 2RHQB 1M0SA 3LH2S 2KDOA 3UD4P 2LQ9A 1K44A 2YNGB 5KAKA 2RF2A 1NK7A 4ILRA 4TQRA 2NZ4A 2GVDB 2XBPA 3DHWC 1EKRA 4UOGA 5H9FK 2I5JB 4UW2A 3JSMA 4DV5F 1JJ4A 4IOAQ 3KK3A 4C8NA 2RKIA 3HVRA 2CRLA 4LQ3A 2K1RB 3PEHA 4FXVA 3H8YA 5FIIA 4YUDA 1O5JA 4ZPWR 4O0IA 2GJIA 1AB8A 1XJWB 3A8EA 1CVJA 1CJUA 4PG6A 4ZS6A 3U1LA 5E0OA 4F0HA 2U1AA 1NSKL 1XK8A 2EPIA 4ZLPA 5DDRC 2RDDA 4HTJA 2DHXA 2DNMA 1SKUB 3D1OA 4OZ5A 2M7SA 1RYSA 5IT4A 3FEXB 1T3NA 2NXEA 1SIZA 4I6AA 4TXSA 1RXOB 1VDHA 1TKTB 3EMTA 3KNGA 1RSCA 1YTYA 2UUAF 2BDPA 3R5JB 7AT1B 2BW7A 2LQ5A 2AT1B 3AOAA 4LFAJ 2HNDB 3A4TA 2XSJA 5U47A 1LKZA 4WKRA 2K2PA 5D77A 2MQ8A 1NDCA 4DL6A 2ACYA 3U27A 4I64A 7FDRA 1WEYA 4XIUA 1N5SA 1OY6A 3I5CA 2VJVA 4C11B 2I9SA 2PSZA 3IXQA 3EGVA 3VAJA 3QRRA 4H4MA 4NEYA 3OSPA 2EFQA 2UUWA 1RTHB 2VA2A 1YJWS 4Q0BB 4NZ0A 1H2UX 2DCLA 4MTPA 1REGX 1S10A 1HA1A 5AJ3F 2RRAA 4Q2MA 4KYZA 3UN5A 2A3JA 1KFDA 3BH7B 4LVNP 1URNA 3ENQA 5KT3A 4DV1F 2A6MA 2J7KA 2HS0A 1AUSL 2NCKL 3MMAA 2KHDA 4CLZA 2MGZA 3CCRS 5IQQA 3PW2A 4DJBA 4AL6A 3ISNC 1E6VA 1OY9A 5DG7A 1LXJA 2VDIA 3IM8A 4OZLA 3M1VA 4ED1A 5L1JA 4X64J 1ZETA 4ECYA 3OFEA 2YX1A 3UN2A 2HVZA 2VPZB 3R2DJ 3I4HX 3CT9A 3H2VE 4QIVA 4ZJOA 2ZKTA 3V81A 2VHGA 1KRPA 1FCAA 4USHA 4NLQA 2HWTA 5JXSA 2KH9A 4NXNF 2Z2MA 4DL0C 3R5GA 2DRAA 1VFJA 2KYZA 1X4BA 2VFTA 3ONQA 4OJ1A 3G6ES 3CNQP 1H73A 3M30B 2IC3A 4YY3F 4NLPA 2C3YA 3M9NB 1B4SA 1DLOB 1VS3A 3X3UA 1PGZA 4P10A 1HKAA 3MM8B 5AXKA 3MCMA 2AEJA 1IR0A 2JLFA 2LU1A 3ZNUA 2B9XA 1I3OB 4ZCKA 1FRHA 3O1LA 4BC9A 3RBZA 1MNEA 4H4KC 3MPUB 1BQMA 5C24A 2F9DA 2WW4A 4ETZA 4X4SA 2BQ3A 4JI8J 4JV5F 3A8JA 2BE7D 3QIPA 1K47A 2CJQA 1SKSA 3GG0A 3RR8A 3ZZUA 1DQ8A 1XNQJ 1ACMB 4KO0B 4DFPA 3G82B 3A12A 3R27A 4CP5A 3IRWP 4IR9A 1WTFA 2UUCF 4DS4A 1L3VA 1YDLA 2RQMA 3F73A 3W2WA 1IKVA 4C3LA 2J7UA 4ZP6A 4EO8A 4CM2A 4EEYA 4ZVHA 1X0FA 1VQ8S 2WVBA 1XERA 3OFGA 2VQEJ 5I3UA 3BB5A 3K5PA 4G6VB 2QZ8A 2IRXA 1OYDA 2CJAA 3RW7A 2L9WA 4WTOB 4G1QB 1UEKA 3QO9A 5BJRA 5HQ8A 4DR7J 1CJVA 3BZQA 4AXJA 1H6KX 1YX2A 2GW8A 3CDEA 3NAIA 1WEXA 3T19A 1FT8A 2XMMA 2CADA 4C98A 2VBYA 2FHJD 1U49A 2LFVA 3V4MA 3JTNA 5C42A 4XPCA 1SJ1A 3MI7X 4F4XA 3ZTPA 2UUTA 2HK3A 4YP3A 1HQUA 2J6TA 2FLOA 3KUGA 2HAIA 5A0YB 1NZAA 3MTKA 2AZ1A 2VG6A 1GAOA 2R4FA 1C1CA 2HNZB 5A8KA 5LSRA 1WC4A 3UI3A 5KFMA 3KLEB 5D4OA 2DH8A 2MMYA 5AXMA 3QGIA 3QJJA 3Q8SB 1V3RA 1X5SA 3TZWA 4DWIA 2OD4A 3H40A 1RWNB 2ZD1B 1VQNS 3TR5A 2VUGA 1IQTA 1HI8A 1APSA 2HNYA 2DGWA 3UO0A 4M1KA 3KK1A 2D69A 1N6QA 2VB6A 3KDNA 5GAGI 3AOCA 1BHNA 3MCSA 4C6AA 3D1QA 3Q8VA 4DFKA 1HQEB 3BR8A 5KFKA 5KG7A 2J5AA 2E9ZA 1SQFA 5IV3A 1UWAA 1HWIA 4ZA1A 2R8IA 2HHWA 4F4WA 4DUTA 3S01A 2R8JA 2YNFB 3QLHB 1UTAA 4MFBB 4EUVA 4ZLNA 2PE8A 4B3OA 3MTJA 3BDPA 5J2PA 1MROB 4DR6F 1KQFB 2YPZA 5L9NA 1OQ6A 3LQVA 4WFYA 3CF5Q 4RNNA 3NGDA 3C14B 1GTEA 2CG4A 1RU1A 4S0MA 5BR8J 4FXWA 3H5XA 4PPDA 1N5YA 2RUSA 2CWXA 1EETB 2EC2A 3HZEA 4EBCA 1JMTA 3RB0A 4Y2IA 4KPYA 4YN3B 1JLGB 2F65A 1RTZA 3SQGB 1GH8A 2B56A 1JLBB 2DD8S 1HWKA 1W2IA 1D3WA 3EUNA 1LW0A 2C1EB 1U48A 1C0UB 2Z30B 3BSAA 2FVQA 1B70B 3MGJA 3M8YA 4AD6A 4AXIA 1Z2LA 1IBLF 3M32B 1K1SA 5AXNA 4DV6F 4F3MA 2LEBA 1IVZA 3I0RA 4ZVTB 3FCVA 2YKAA 1VQKS 2AEMA 5DG8A 1NMEB 3BEGB 4IDKA 4TY8B 1HBMB 3OQ2A 4HR2A 4OI1A 3T9ZA 4OI3A 3UDLA 4DR1J 4YR2A 5CABA 2Y8WA 3M9MB 2C2NA 3EXCX 3R9LA 1B0VA 4OX7A 2OSRA 4CO3A 1KLNA 1BC6A 4P2FA 4DI6A 3V6DB 3BSCA 2QFIA 2KT5A 3W64A 1NDLA 1S4EA 1OPIA 1WI6A 2P6SA 1N52B 1FD8A 4GVLA 4U9RA 4ENOA 2EBGA 2GX8A 2VV5A 5IC4B 1K9MT 3J7YI 3Q8RB 1F3FA 2MQMA 3G86A 1V3SA 1RTJA 5CZXA 2W9CA 1SL1A 4ED3A 2B9WA 1B99A 1FDAA 3AB2B 5GAEU 3CCES 3ELHA 4IRKA 2OTJS 1REVB 3LO3A 3HO1A 3C6TB 1TUVA 2HFUA 1FVQA 3MM6A 2DIVA 1CULB 2DY9A 1UVIA 4EBEA 1WI8A 2KVQE 2CFXA 4M5DB 1RLCL 4RNMA 4I56A 4JYAJ 2O3DA 3IGNA 2A10A 4PAAA 2HS3A 4DQQA 2JEJA 3OJSA 1RTDA 4DSLA 1IQZA 1RKIA 5CQGA 2FVCA 2QA2A 4RW7A 2YKMA 2BJEA 3AQOA 4LSNA 3HF5A 2ZJRQ 2UVVA 2IA0A 3LUYA 2MPUA 4DV0F 2DK2A 1UCNA 5D3GA 1OJ4A 1H0HB 1U2RA 2V8HA 4P71A 2XEXA 1IBMJ 1S1XB 3D3CJ 2DGUA 3MM5B 2WVCA 3MOZA 2WVEA 4NXMJ 1ZYQA 2R8GA 2QMXA 5IT9Y 4PXEA 3MUMP 1S9EA 3M2RA 2YWEA 2JZ5A 1Q79A 1WF0A 4HT7A 3RJMB 1T9XA 3G4SS 4DV7F 2DNHA 2WB1D 1VQ6S 2ZH8A 4B3RJ 2WOMB 4OZJA 1T9VA 2MHEA 2HPUA 4KRWA 4ELUA 4RBVA 5KFBA 4NLSA 1NHKL 2YKQA 2K3KA 2OI2A 3IA0A 2JLEA 4MK9A 1TK8A 2R8KA 1AFIA 2JWNA 3BF4A 1L3SA 2ASLA 3IR5B 2XI2A 2JOQA 2MQLA 1UWBB 2CVIA 3MEKA 3JSMB 1RT7B 2QLXA 1BQXA 4DN0A 5DLFA 3M8QB 5HBMA 2FIUA 3J81U 3W1YC 2DCUB 1XC9A 5DLGA 1QUPA 2MZSA 2YKNA 3K8VA 3NCRA 4RBUA 1SJRA 2VONA 2HQFA 1RT2B 3THVA 2IM3A 3CMES 2HHTA 1GMUA 3FKBA 1NXIA 2DNNA 4J9VA 3BJYA 4Q44A 1U1PA 2W2OP 3CULA 1PSDA 5K8NA 3IWLA 4K2XA 3DI6A 3PFOA 5JMNA 2QSFA 1NJYA 3V6JA 2DHGA 1O51A 2EFGA 5DO2A 4X4RA 3G8SA 5T7LB 4HACA 1XMBA 4IOBA 2OD6A 2BUNA 4ID5A 2ZVSA 1U8SA 3I0SB 3JQMA 2PA3A 4NOHA 2D3UA 3R2CJ 1V9OA 4HDGA 2XWYA 3PX4A 2M8DB 2NUUG 1LXNA 1Y7PA 5B7WA 3AJ2A 1GXUA 4ZP7A 1X31C 3HFKA 1IWGA 2YWGA 5HMZA 1VJQA 2ZBPA 5K8PA 4CYUB 3RBDA 4RUBA 4FDFA 2ZM6F 1VBYA 3F44A 1U45A 4WBFA 2ZBRA 2ZOMA 1VC5A 2DGXA 4EGLA 2OPQA 3I82A 3BS9A 4CT8A 1T02A 4J9NA 2V4RA 2WRMA 3MMBA 2KFYA 3C15B 4U8YA 5DZ6A 4ZITA 2KXNB 3KLFA 1XEZA 5CHCB 3E8OA 3NKYA 3TA1A 4A8OA 1IBMF 3Q8QB 4J9LA 2DR5A 2V0NA 4E0DA 3BKFA 1N54B 2MY7A 1GXLA 3TVYA 1E6VB 5CCLA 3M1VB 1X5TA 2CPFA 2GMLA 2M0GB 5M2RA 2FJWA 1PBUA 2UUBF 2QJ3A 2OUGA 1R8AA 1S1UB 1T94A 4I6YA 2RT3A 4RPFA 4RW9B 1V3ZA 2XZDB 3W9JA 4CH7A 2V4QA 4I67A 1G1XA 2VU5A 2HHXA 2MSSA 2QX0A 3A3PB 1EAYC 4G1IA 2IY5B 4HLBA 2WB4A 2DHSA 5KFEA 2W2MP 1WELA 4BWMA 2MZTA 1F1BB 3CUNA 1ZBTA 2VF3A 3N6MA 5K8OA 1U1QA 2CYYA 4LREA 4ATNA 2B8QA 3GMGA 5K5MA 4F04B 2XB2D 1X4GA 3H20A 1ICEB 1N0UA 2D74B 1YGYA 4IYQA 3BGFA 4WYWA 3SDEB 4AE5A 1HQ2A 5KFQA 3MEDB 4DPTA 1RT6B 4DG1A 1VRUB 5DGAA 4B9NA 2W7PA 1BQMB 1YJNS 2WW8A 1Q8KA 1AFJA 3MCOA 5LSOA 1EQMA 4BS2A 4U96A 5ETKA 2CQ3A 2OEKA 1IKXA 1X4EA 3GPAA 3FBEA 4A48A 3T1YJ 1DURA 4C8YA 2J9EA 2YWHA 3DYAB 5CH7B 3ZZ0A 1ULRA 5F0WA 4U67Q 3ULHA 1M5OC 3CJRA 2EW9A 4K0KJ 3IG1B 3QWPA 5D4PA 2AJ1A 3OUYB 1QSLA 2XHWA 1PAEX 4ZVRB 3CD5A 3JQJA 5I3UB 1YWXA 3B82A 1N34J 5F8NA 5KOXA 3CCVS 1FKOB 3HFVA 2FHOB 1N5VA 2QRRA 5EUHA 1U8WA 4C8KA 4RR5A 1Q95G 3CJ0A 2V8DA 5C42B 3G6VA 2BACA 3KKFA 4L73A 3CJQA 3MWBA 2BOPA 2J6SA 5KFAA 2E5IA 2CZVC 4OJHA 4RUAA 2UU9J 1RP5A 3AD7C 4NLTA 4URSA 1GMWD 4HL9A 5A0YA 2P9EA 4XO0A 3CTRA 1ZZFA 3KK2A 1HNIA 2RQKA 3MAAA 4Z7CA 1LWCB 2OSQA 2VFUA 8AT1B 5GAHI 2EKNA 2C22A 1QSYA 2Q1LA 4OZ2A 3KG0A 4M95A 4K5RA 2FTRA 4WFBQ 1WC3A 1N33F 2W8KA 2M70A 4MKYA 2WSEC 3VAKA 4QIFA 2UXBF 2BW2A 3W9HA 2H5IB 1C4AA 5FDLB 4RWXA 3MEGB 4ILMA 1CJKA 1UJ4A 1WHYA 3JXOA 2HWHA 3GWCA 2JVOA 2VQEF 3WC0A 5SZTA 1UPMB 1Y00A 5ETOA 2CDQA 1CQNA 5AE1A 4LQ9A 4R8UA 1RAJA 1DJ0A 3W60A 2Q3PA 3R6GB 4LBIA 3VAGA 2NPIA 2ZVIA 4HH1A 1X9SA 4PRFA 3OVAA 1RTIB 1QAYA 4RBTA 5MLCV 5H9EK 5F41A 2C2EA 1OWXA 2KJWA 2UV8G 2MJUA 2DNRA 4TY9A 2IHR1 2J8AA 2VIHA 1OO0B 5EX3A 2QL9B 3E2EA 4MIBA 1EQ0A 1H98A 2YH1A 2ASJA 2A1BA 2ZWPA 1I6JA 3OTCA 1RK8A 2OPSA 1HHSA 3QAEA 4ICLB 1J5OB 2YX4A 1RWPB 3MUVP 2DGQA 3H2LA 1RCOB 1TK0A 1NRKA 4JI3J 4USJC 3D5MA 1AA1B 2DGVA 2ROGA 2ZH3A 1I94F 3DXSX 5HI7A 3R5AA 4GVBB 3GFZA 3QT6A 4I68A 4XAKA 1D9AA 5EWFA 3MD3A 2E9TA 3I0RB 4OQJA 1TV6B 1N34F 4ELVA 3QRQA 1JXVA 1OIAA 2Z56B 2W8LA 2PMHA 4DZ6A 4IDKB 1TL1B 5KFZA 2XY7A 1VQLS 1P1TA 1R6VA 2CQGA 4QOTA 2I0XA 2JNJA 3MR5A 3ZZYA 3CMAS 4KKOA 4QWEA 4DQPA 1G6BA 1VC6A 3SYZA 1FF2A 2HAFA 4GMKA 4C48A 1S0NA 2OP5A 4YOEA 3KLHB 1UVMA 2GCFA 3CD6S 3D67A 4DR6J 4J9PA 2NXUA 4J91A 4LRBA 2M3DA 4P72A 4ZPBA 2AD9A 3BYPA 2IJRA 1E6YB 3AOBA 3D0IE 2QL5B 1ZTTA 1FXLA 3BM7A 5D8HB 2HZVA 2BMBA 1QUVA 1EARA 2CQCA 1VHIA 3VZHA 3PW4A 1RYRA 2DGOA 1FESA 1CSJA 4ANEA 4WPAA 3KG4A 1SUQB 2RF2B 2CZ9A 6AT1B 3D0GE 3VAFA 1H2VZ 2HZCA 2ZC3A 3KXDA 2DNZA 3LP2B 2ZH6A 1NJIT 4M5KA 2BE2A 2CQHA 1HI1A 2FVRA 5GMKa 4E8UA 2FY1A 1IKYA 2C2OB 2YNIB 1U2CA 2RKIB 2PDAA 4N77A 4BBYA 3ISZA 2XCAA 2K1RA 2AJ0A 3M05A 1GT8A 3Q2TC 5EN1A 1NHVA 2JLGA 2D41A 4AUKA 3W9IA 1NO8A 5KG2A 3KMSA 1RT4B 3I5AA 4X65J 2MZ1A 3D2WA 3OW2R 1LW2B 4LFAF 2DH7A 2Y3YA 4ED2A 3TX8A 1Q78A 3GR1A 2AHOB 2V50A 1OMSA 2YNGA 4AT1B 1KNZA 3QWUA 4F02A 4DUZF 4CDIA 4G1PA 2I2YA 1LWFB 3DMJA 3ZFVA 4K4TA 5KFXA 2GVZA 2AJQA 3GJTB 4A8QA 3RZAA 4TQSA 1CC8A 5H1SV 3GIJA 1FE4A 1YSJA 2ILYA 5HJXA 4Y00A 4OHWA 3IR7B 4CO1A 3CCSS 1HPZA 2QL7B 1U0HA 4NI2B 4RL1A 3NCQA 2HZAA 4LF6F 3C2PA 1KLMB 2IVMA 1NB7A 2DEJA 1RT7A 1V5IB 4MJKA 1EJ7L 4WP8A 4QW8A 5F3ZA 4LF6J 4JI1F 3CE8A 5HBMB 3QZ7A 4LR9A 3OPKA 3M6XA 3TAQA 2SXLA 4Y2MA 3ET6B 1EP4A 2EFOA 4V19X 1JLAB 3KLGA 1O8BA 3CCQS 2QLFB 2Z2YB 4XDDA 4M5HA 4OI0A 2AZ3A 3JQKA 3MR2A 4OX9J 4CO5A 4M5GA 4PG5A 1PG5B 5F0UA 4PQAA 3VAIA 2QEXS 2ERRA 3LA0A 5A8RB 4O4GA 1FRLA 2L08A 5B0GA 1HNVB 1KS2A 3J7ZT 3IC1A 3EGNA 1RWWB 4HACB 4IQXA 5GVQA 2DNLA 2XWXA 5KTQA 4K4YA 4HH0A 1IR1A 1T9YA 1NJZA 2HW3A 4W90B 3FUYA 3QNWB 4PWDA 1F6TA 1T11A 2C2RA 2D3O1 3MPYA 1LNQA 4Q0BA 3V81B 1RTHA 2BQUA 1H3DA 1ZPVA 4M5NA 2HHSA 4IUFA 4IFYA 2UXCJ 4JI3F 4F2SA 3DOLB 2W9BB 2JFDA 3HHLB 2JJ4D 2DR8A 1XNQF 4DR3J 1S99A 5D15A 2AMCB 2IRYA 1XR6A 3MMBB 1FK9B 2FJDB 2DNYA 1KTVA 3T5HA 4RJVA 4UZBA 3V6HA 2VASA 5F9NA 1D9DA 3MM9A 4QR2A 3AD8C 3LANA 4ECRA 3MZIA 5IZHA 2KU7A 1UZDA 3L7PA 3TP2A 2Y1RI 4QZVB 3KUHA 2HFVA 1OSCA 2NUHA 3BGLA 2CA9A 3NS6A 1SIWB 2EVZA 2I38A 4NYZA 2E1AA 4OYBA 4JI8F 4RW4A 4HHUA 1HHQA 1P27B 5MAOA 3FFIA 3G82A 3G71S 4KGXB 4CO2A 3G8TA 1MWZA 4KE5A 2D9OA 1BGXT 3DNCA 1S1UA 4RW9A 5KFFA 1AT1B 1Y0HA 3CW2C 3M30A 3PEJA 4FYXB 2G0IA 3QBCA 4Z2XA 5LXRA 3QT8A 3OXGA 3ICLA 3T1HF 4KHPF 1NNDA 2ZUGA 2FLNA 4PG4A 3D1HA 2RILA 3PHTA 4OYIA 1IUJA 2C28A 3FSYA 4G1QA 1SKRA 2IRUA 2QYCA 1EB0A 2FD2A 2LXUA 5KFHA 5DG9A 3MXHP 2V2QA 2MXYA 3OV7A 2KRRA 1JXLA 1EHWA 2WSFC 1VBKA 3PYFA 1YBUA 3AJDA 3K59A 2GJ2A 2W24A 3U1MA 4DSIA 5E5NA 2MJNA 1URRA 1U6BA 1MN9A 3P3DA 4UUXA 4A8YA 1OY8A 2YWWA 1RB0A 4N8OA 5HVGA 2E1CA 2ZH1A 2O01C 1K73T 1S49A 4CO4A 4C8OA 2KZMA 5BR8F 2IJNA 2ZE2A 2J6UA 1G3OA 2BABA 3KLEA 3W3SA 1IKXB 1X5OA 3DN9A 8ATCB 3QFHA 1D1UA 1FJGJ 4YB7A 3HZGA 4DSJA 3NWRA 2ZFHA 4GRSA 3IMQJ 4DV7J 1FWLA 2QGFB 5HMWA 4ZN3A 2F5GA 3GYGA 4JI0J 1CG2A 3BYRA 3OD2A 4Y0FA 4QIGA 2W2PP 3WZ0A 1WUUA 3P5BP 3TJ9A 3UFCX 4ED0A 4OHXA 5CYMB 3PW0A 2FLLA 3AA8A 1MG7A 4O3QA 5IWAF 1A7GE 3QMQA 1PJ5A 5F8LA 2P9GA 5B0FA 4NYOA 4LSLA 4K4ZA 1C1CB 2HNZA 4EK2A 5A8KB 4B9LA 4DR2J 3OLAA 4KTQA 1FRXA 1KEKA 3CVKA 1QLNA 1W7WA 3N79A 4M5LA 1F5BA 3W65A 2E7XA 3LAKA 5LMUF 4P2SA 4Y6IA 3B6BA 4IFVA 2MQNA 2OH2A 2KHCA 4ZJLA 4YR3A 1S5ZA 1HNIB 3MAAB 4MIAA 3PJ9A 1OSDA 4DX5A 3TANA 3GU0A 1PBAA 3L7UA 4FKXA 3SMZA 5C7PA 2DKOB 2A2CA 3RBXA 2HGLA 4KGZB 3R1LA 1JJ2R 1MMDA 1JLGA 3B54A 3SQGA 4HKQA 1DTQA 1VQYA 1RZMA 3BGOP 3LP0B 3OTDA 5J1EA 1OQ3A 2GMHA 3HT0A 4I6WA 3H4BA 1C0UA 4U6PA 3PZPA 4I7FB 5D0HA 2YNFA 1WDDA 3TZZA 1HBOA 3TW0A 4CQ1A 5FJ4A 2COLA 1ZH5A 4FS2A 2YPYA 1FNOA 2IBOA 2GHWA 1U09A 3M6WA 5J2PB 3M9OB 4LFBJ 3CCWA 2OEMA 4JV2A 2W4CA 3C14A 2FHKA 2OPPA 3O8WA 4Q5VA 1DARA 1S9FA 1WDTA 4NCBA 1AXQA 1UL3A 1R8PA 5GMEA 5LM7E 1N5YB 1KVJA 2QE5A 6FDRA 3C6UA 3DLEA 4F3OA 1GK8A 2F4VF 4R0JA 1SL0A 1X7VA 4Q8FA 1G7CB 2JC1A 3C8YA 2AGQA 4MIWA 3OTEA 3SCIE 2WHOA 2IM0A 3THPA 2D7SA 3QT7A 4EZ6A 2CPJA 2KFNA 3M32A 2RIJA 3LF0A 2G1HA 2B5JA 1KQGB 1R8BA 5GAHU 3DCAA 5IC6B 4ZJQA 4BCAA 2KM8C 2E7WA 4CTAA 4RNFA 3SFGA 1KSPA 4AL5A 4NL5A 3HHLD 4IQMA 2RU9A 5E3CA 1Y9OA 1F60B 2GQ2A 5GADI 1ELOA 4Q8EA 1RHQB 2QN6B 2PEBA 2HIYA 1Q7LB 2I8EA 1VIXA 3PFEA 4OFZA 4GC7A 1UA0A 2XYPB 3TWZA 3DDKA 4OHVA 4R5PA 1M5KC 3AH6A 2MYFA 3PXGa 4NX9A 5E3AA 4EBDA 1TV6A 5EWEA 2F8MA 1S7IA 4CNZA 4ED4A 1TL7A 4JI7J 4LFCF 1CC7A 2FJAB 4N41A 2ZWOA 4G3IA 1QAIA 3VGSA 3DLBA 3DU5A 1KTQA 2W4PA 3CJKA 2AWZA 3ZTOA 5M2PA 3TAMB 3VGTA 3HSDA 3TUIC 5EDWA 3RRGA 3HVTB 2JFKA 3BN4A 4DSFA 1FA0A 1Q8IA 2N7YA 1NH8A 1TAQA 6FD1A 3DGPB 2CQDA 4WTYA 1REVA 4B3TJ 1RHMB 1IJEB 1U6ZA 2KI2A 2AGPA 1VQPS 1RA6A 4CLPA 4UY8T 4YEAA 4ECWA 3EVMA 3S1TA 4EMDA 3FSIA 3B8HA 1T05A 5L38A 3O3LA 2BKPA 1E6YA 1VLYA 2FZGB 1FDDA 4K4WA 2XMJA 1VYAA 1TKXB 2KTQA 5H9EJ 1VQ9S 5IFMA 3V4IB 1FKPA 4FBUA 3D7SB 1GNKA 2JH3A 1G4CA 2LXIA 3CDWA 1SH3A 2F9JA 2H5JB 3FCWA 4CRJA 2JSXA 2EFVA 2MKCA 4LF2A 5J2QA 2YWKA 4YR0A 2ADBA 4FF3A 4P73A 3N6LA 5D3GB 3R6LB 1JLQB 5E2QA 3UDEA 3DLKA 4NRUA 5B0CA 3BO2A 3VAMA 3P49B 1WTBA 1M5VC 4DV2F 3IWXA 2FZCB 4C7QA 1HR0J 3PX0A 1S9EB 3M2RB 2HBRB 4L6V3 3PHEA 4WP3A 2A18A 1LWEA 1Z2ZA 2HGMA 5LMNJ 3C3LA 3TQEA 2QSWA 1C1BA 1FFGB 4HHJA 5KFTA 3D68A 5L39A 4DCJB 1SC6A 1Q81T 1PYSB 5EGYA 1SKWA 1UVLA 2H51B 4K7QA 1RAIB 1RT5A 2C2ZB 2VG7B 3HHKA 5A8WB 1MSWD 2YXLA 2HSEB 3FNNA 3T3FA 3N28A 2HRYA 3KJQB 4WXWA 5T7LA 4U7CA 3Q8PB 2YY3A 2MQQA 4FYWB 4ID5B 1UWBA 3ZZRA 2AW0A 2HWIA 2OMOA 1KHWA 3HCXA 4EWTA 1U4BA 3H0PA 2DPIA 3I5BA 1NPRA 1O6XA 2VZ9A 2CPXA 1U24A 2DT9A 5ETRA 1RAHB 1ZOTA 4C11A 1QTMA 2EXUA 2ZEJA 4OZ0A 1S0VA 1HPZB 4OYOA 4UZCA 3UCZP 1NK4A 2JEIA 1DRZA 4U95A 1Q1KA 3QAUA 4F0MA 2VH7A 4F4AA 3SQOP 3TUJC 4TYBA 4ECQA 4QCLA 2F8HA 4JI5F 1FRKA 1VR6A 1Z1ZA 1HWJA 4NEZA 4CIOA 3GSDA 2OHDA 5F8HA 2QMWA 4ECTA 2E1MC 1EP4B 3GFHA 4ZIVA 1JLAA 3S6EA 1VQOS 1UMJA 1Q7YT 3HX9A 1QY7A 1MW7A 1VMBA 2LQ8A 4KPCA 5SUHA 3KLFB 1CJTA 2IDEA 2WONB 4LVOP 1F2HA 1SV5B 4DV3J 2E5HA 3G9CA 3MECB 3NWGA 4O3SA 3AA9A 2BJ1A 5A8RA 1HNXF 2OIHA 2EC0A 3MR6A 4NLWA 4Q2LA 3E51A 5DDQC 3ZTSA 1PO6A 3KYLA 2BRLA 3DDNA 1WHWA 2BA9A 2YBVA 1D9FA 2BJ9A 3ADAC 4X66J 1NZ8A 1NSAA 3J81Y 3RTVA 4KV8B 4X66F 4PWDB 2IIHA 2DXFA 3BR9A 4K50A 2OFHX 2BZ2A 1L5UA 2RB7A 3R7NB 4FF4A 5F8IA 1IXKA 1WC0A 4IFYB 1HNWF 1FNXH 3GB0A 2AJ2A 3PR4A 1NJWA 1S76D 2QTWA 4MKVA 4ES3A 3MURP 1YRTA 2L9DA 4DL3A 2ZHBA 3KHHA 1KDNA 2GAGC 4K59A 2ZDOA 1Y4ZB 2RAQA 1JK9B 3SDEA 3AODA 3VVTA 3NGTA 1NSQA 3UWTA 5K9FA 3D28A 1FVSA 3PNIA 1SC1B 2DXEA 2ZBIA 3W7BA 5JJBA 2E5LF 2QIFA 4FNIA 5THWA 3BQ2A 2RNEA 3KFWX 4Q7AA 3W2WB 4B02A 1R8CA 2PEHA 1OYEA 4F25A 3PIPQ 3BO4A 4DX8H 1N56A 1EX8A 3B4MA 3CJSA 4RW4B 2H9ZA 1S59A 2V68A 5HP1A 1SCJB 3DYAA 2GQQA 3QO9B 5KG5A 4WFAQ 4NCGB 4DBQA 1SH0A 4LSZB 4U8VA 3H98A 2R8HA 3T9NA 1Y3JA 1NSPA 4KIAA 3ISND 2FJVA 3MEDA 3FSXA 1NUEA 2G0CA 4LIRA 3JTOA 4N76A 4W4MA 4Q45A 4NE9C 4M5MA 2ZHOA 3PW7A 3QJLA 2RE1A 1NK8A 3OL9A 4X2BA 1RWXB 1H74A 4K4XA 4DR3F 4W92B 1FWPA 1LK7A 2HVEA 3DRRA 5DETA 3Q2SC 4YMEA 4XPEA 2ZH9A 4U7UD 1MMLA 2UZAA 4ITSA 2W01A 2YKOA 5ETPA 4QW9A 3AT1B 2X3GA 3IG1A 3OUYA 3EPGA 4ECUA 1NHUA 1RABB 1LWCA 4O0NA 1Q4RA 3BSNA 2BR0A 2UUCJ 4ELTA 1P8GA 2AV5A 2LVWA 3NGSA 4PABA 4EU0A 2K8GA 4MT1A 3HPOA 2OGUA 4XK8C 3KJVA 3DFEA 1YJTA 1K1QA 1ZPWX 1N0VC 3H5UA 4Y34A 3SBMA 4DUZJ 1HQEA 2OPRB 1FX4A 2NYHA 2WVDA 5ETMA 3MR3A 2LP4A 2VBZA 4WFZA 1MN7A 3R3TA 3KLVA 4IG3B 4OV1A 1NKEA 3KTQA 2V5HG 2XG8A 3SCJE 4DQSA 1RGVA 5HL7Q 1NEEA 4ZPCA 1QJHA 3ETOA 3RB3A 4LF8F 5GAGU 5C2GA 1ZM9A 3GIIA 4C9DA 3CIZA 3K5OA 3M8WA 5J2MB 4X4QA 1K8AT 4NLRA 2KB2A 3HFZB 4KQZA 4NA1A 4FS1A 2HLUA 3GCWP 3SFUA 1FD2A 2IYIA 2XZWA 1HL6A 1T9TA 2NYIA 2PD1A 1T7PA 2KG1A 3H42A 2MKKA 3VV2B 1QTNB 4JI1J 3CB4A 4FKYA 1LW0B 4DU7A 1VHFA 2KKHA 3DLGB 3MM7A 3UR3C 1IBCB 3Q24A 3MEGA 2E9RX 4PEOA 1Y5NB 4OX6A 3CXCR 3H5YA 1B3TA 2OPSB 5DGBA 1J5OA 3ITHA 1U1KA 1SC4B 2DYAA 2MTLA 1UVNA 3I56S 1VK3A 4LRAA 5LT5A 1TFWA 1UP1A 4UUWA 2IM2A 1FJGF 2M88A 1XBWA 2R7QA 3RU0A 1WG4A 5CAAA 2GFFA 1R6YA 2ASDA 4PYAA 1RTIA 2MY8A 1WHXA 2BV3A 4QWBA 3H4DA 3QSYB 1FO1A 3UR0A 2XLIA 1H7XA 1GMWA 2BXJA 1YJ7A 5DQIA 1TL1A 3U02A 3GP9A 2Y0SD 3SI8A 2VBXA 2NREA 2V4JA 3TNVA 4PPZA 2NS1B 2XSFA 3K89A 5H9FJ 3I9ZA 5C5JA 4RU2A 2XO7A 2CJXB 2CPEA 1GTHA 3NG8A 1JJCB 2CPIA 1I51B 1UFWA 2M52A 2YNHB 3VHQA 3PG9A 1U02A 5B08A 2G1DA 1IBLJ 2AX1A 3OXFA 3DKDA 3TVKA 3HSZA 2RSQA 1C0TB 1R27B 2MLXA 3JS9A 1VRTA 1HBUB 2DISA 3HM9A 3I6PA 3NBPB 2DH9A 4FPRA 3ZC4A 1KVIA 2PGCA 3CJ4A 4M5DA 3OTOJ 4GKKJ 4NA3A 2B3TB 1YVFA 3D6FB 4XDCA 2ALZA 1HD1A 3OTBA 1JKHB 2DIUA 1RQ0A 1N48A 4K4SA 4B3MF 1XMOJ 1WSRA 4GKJJ 5J1NA 3UE2A 3TYTA 3DLJA 2V9WA 3IR6B 4P9SA 4LSNB 1SUQA 4DPXA 1F9EB 1UZHA 2V6AA 3KLHA 3W2VA 4WZQA 1BWEA 2QA4G 4P6QA 5I42B 5FLXY 4LF8J 3G87A 1VQ7S 3AHPA 1N36F 1WKKA 3T5KA 1IKYB 2YNIA 4ZPVR 3HVTA 1X4DA 3CJ5A 4IH5A 5CA5A 1SVDA 2DGSA 4FNHA 3G8QA 3QPIA 1HW9A 3PACA 5BYRA 2V63A 4RUCA 4ZPTR 4YB5A 4QIWD 2Z57B 1RT4A 5HAOA 4C8ZA 2KM8B 1T05B 2WOMA 2ZBCA 2NZCA 1JLEB 4LIWA 4CLLA 1FRJA 4DHVA 5KFOA 1ZTWA 4NXNJ 2XI3A 1K0TA 4I2PA 2KXHA 2F7VA 1F9FA 3SXLA 3NNAA 1LWFA 3DMJB 3LP2A 3MOJB 2XTJP 5KFCA 4WK1A 4A47A 3MR7A 1TFYA 3MCNA 2HFNA 5CYJA 4DV0J 1NDKA 1U1LA 1T9UA 4QWCA 1BLUA 2QFJA 3TARA 4OHYA 2HQIA 3LW5C 1LWXA 1U0HB 4NI2A 2HHHF 2X1FA 1M1HA 5GADU 2OAUA 4ZDNA 1N4LA 1WJ9A 3IN5A 4JI7F 5I4MA 5KT7A 3D3BJ 4P75A 1LWEB 2Y1IA 1T03B 5HQMA 1R0CB 5IV4A 4TYAA 2POKA 2D3ZA 1FEEA 4KH1B 1CEZA 4AL7A 3T5JA 2NSCA 4IH6A 4UOFA 4CH0S 2GVZB 4B3SF 1C4CA 3OR2B 1TL3A 4DV6J 1VISA 1RISA 2C3OA 4HVZA 4OX8A 5D4NA 1HW8A 2P9CA 3S8SA 2OJ3A 3SZ2A 2B7BB 2K06A 2HHQA 4H4OA 4ILLA 5IT9U 4I0WA 2HHUA 3BH6B 4DMZA 3CWJA 2N82B 3GSIA 1FNMA 3P5TL 1RT1A 2MDAA 3J7Z5 2WZ1A 3IAM9 1LFPA 4NASA 4F26A 1NK9A 2EI5A 4HT5A 2GIRA 4IKAA 2JRSA 4ETXA 1H72C 2OPQB 2A6OA 3R5CA 4TKTA 1RLDA 4NRTA 3KLGB 1MWYA 4G65A 2HYIB 3IRXB 1H2TZ 1BXNA 1S9GA 4YB1P 3S7RA 2AJ4A 4IRDA 2LCWA 1N5TA 3PR5B 2FGOA 1L3TA 2YTCA 1YJVA 4MYTA 2AGOA 3A8IA 4PQUB 2IAJB 1ZAVA 1YITS 3UCGA 1XMQJ 3JSRA 3LGMA 3NOGA 1Y5IB 4V19J 2XS2A 3AXMA 2R7SA 4UT4A 2GMJA 2VKZG 4PKDB 4DPOA 2E1PA 2C42A 2DNOA 3MM9B 2QA4S 3GZ7A 2QO3A 4OYMA 4RKUC 4N8NA 2ROPA 4B9SA 3FBFA 4M5JA 5IT0A 1RAFB 2AJFE 3PTWA 4PR6A 5BXIA 3CCLS 3SIPB 4URQU 9ATCB 1LEOA 3GIRA 1YZ6A 2D9PA 3IBCB 3PYDA 4KGMA 4JYAF 3FFIB 3DOLA 4V1Ak 3UVJB 4KV8A 2ZM6J 1PC5A 1QAJA 3HJFA 1MU2B 3EDQB 3LP1B 3R7BB 1RCXB 4O3NA 3CC2S 1YK9A 4NXMF 2Z58B 4HDHA 2MHNA 4WZMA 4JI4J 1N32J 4X4UA 1SXLA 3IM9A 4RW8B 4DXLA 5JUMA 2NQPA 1S1WB 2BYCA 4ZCIA 5CD4H 4CLKA 2RHSB 1BY9A 1QAXA 1RWOB 2UV8A 4ZVFA 5K20B 3PY8A 4F4YA 4BWJA 3IP0A 2AIRB 1DBDA 3QGPA 4FN5A 3SV3A 3PYGA 8RUCA 3D0HE 2W25A 4LF4J 4YFUA 3J7A1 1U0SA 4YQWA 1JQGA 2B6AA 2HGNA 2P2CB 1X5PA 2XYGB 4KGKA 3TUPA 1YQHA 4FVMA 1AW0A 4JV1A 2M8HA 2ZDPA 2J0WA 4O44B 4TLQA 4NCGA 2GC8A 3FBBA 3GFYA 4X4NA 4WFXA 3J80Y 3SCKE 2G2ZA 4MH8A 5D0GA 3ZO7A 1KP6A 2EK1A 1AROP 4MMOA 2G9OA 1NM2A 2RS8A 1UJ6A 1UVKA 2V94A 4I2QB 4QPXA 1UVJA 3BV8A 3GG1A 4DU8A 4FF1A 1N5QA 1YJUA 2LA4A 2NSBA 5ETTA 1S12A 4KY3A 5AT1B 3TUZC 1BQNA 4ZHRA 3FGVA 3HHEA 2CUYA 2ZE2B 3IBFB 2BANA 3PRBA 3VWSA 3FZBA 2I6WA 3RAMA 1XN9A 2B4OA 5ETLA 1MWQA 5C2CA 2VOOA 1N88A 3MDFA 4A4JA 2X51A 4Y2CA 4RW6A 4IFVB 4HHHA 1L3KA 2CPDA 4DF8A 1IBKF 2XGQA 1VK8A 2VBWA 2XLKA 2MKJA 3FCHA 5F8GA 1IBKJ 1FEHA 1TU0B 1UW9A 1YI2S 2ATLA 4ZVSB 5B0BA 3OHAA 4ER8A 2GS8A 1FE0A 2O1PA 3CD0A 3P96A 4EI2A 1KHVA 2FC9A 3M7VA 4FVCA 5G0RB 3HKZD 1QSSA 1GX5A 2RUGA 4IG3A 5KG4A 2UVUA 1U1OA 2ZZTA 4LF9F 3MPDA 3BBFA 1HBOB 4WCEQ 2UVRA 1TL4A 5CCMA 4YY3J 4K4UA 1WSVA 4MKBA 3UNGC 2DPJA 3KMQA 1YLXA 2KT3A 4QJVA 5RUBA 2DR9A 1S6UA 4OYPA 1EIYB 2R7VA 2RQCA 3B4DA 3NY0A 3IWNC 4JI5J 4NMLA 4QYRA 2XMUA 1Y5LB 3JB9k 1NAQA 2V8GA 2XMTA 2DNQA 3M8PA 3OVSA 2QA1A 2RDIA 3MMCB 3H5SA 5L1IA 3G6XA 2DR7A 3DLHA 5J1EB 2DJWA 3HVWA 3HHDA 5KFRA 2N7CA 4ECSA 1R8HA 4YHHJ 3BN7A 1X4AA 3UDCA 2CQ2A 1S6QB 4J9QA 2V67A 3RBEA 1HIYA 3LGNA 1VQMS 2DO4A 1VQ5S 1HNXJ 4J7CA 2O5DA 4JI2F 2HQGA 3JSBA 2FY8A 2OPPB 4ANCA 4F36A 2B9YA 1HNZJ 2ZOGA 3RGIA 1KD1T 3DM2A 4DL4A 1HNZF 2OTLS 1WG1A 4WKYA 4NMXA 2XZTB 2HK2A 4ZP8A 2VODA 1R7IA 4KSEB 5HROA 4YDDB 5KFYA 3TZXA 3HK2A 2Q6CA 3NXZA 2MZRA 2FC8A 4WFNQ 2AU0A 4N47A 1JLFA 4ZKAA 4GC6A 3K7RA 5EHHA 1HR0F 3GYNA 3QGHA 4USVA 2FUG9 2MKYA 2KL8A 2X1AA 3TAPA 2QC3A 2CPYA 4USKA 2YNHA 3CDAA 5DM6Q 1KQKA 1FKAF 3L09A 1WNEA 2ZKUA 3MHYA 1NJXA 1VOMA 3DGPA 1BWVA 5KFUA 4KFBA 3DRSB 2N3OA 3O6QA 3C16B 3ZZOA 2HURA 3QATA 2CQIA 1J2VA 4OL8A 2R7RA 4R5PB 3NMRA 3ENAA 4FPIA 3TI0A 1TQLA 2GA7A 3MEEA 4DSEA 1O0PA 1DTTB 5D4LA 5F9LA 3EZ5A 1JKHA 2R7OA 1U47A 1FFSB 3Q83A 5A6WA 4LRDA 1ZAWA 1W25A 1RWKB 2XGPA 4AYBD 5HLFA 3N9UC 1IWAA 2VC0A 3TVZA 5HSPA 3PJXA 3N0VA 3W2VB 2ZITA 2P6TA 3H2UB 4ANDA 4DV4F 4PYDA 1PJ6A 1WEZA 1FRMA 4OI4A 1HI0P 1RT3B 1LW2A 2AF6A 2AEFA 2PT0A 3M6UA 2VFSA 1P6TA 1XTZA 3UW1A 4DR5F 4EO6A 3LOUA 3OFFA 4WYLA 2GGPB 4DFMA 1PAUB 3AY0A 1Q5VA 5F3TA 4JBCA 4M94A 3HHLC 1YBTA 3CGIA 4RZRA 3V4IA 2VFRA 4RNOA 5E7OB 2J76E 2CPZA 1IKWB 3E01B 4A8MP 4D3GA 5IM0B 3VGVA 2UUAJ 1RI7A 4DCOB 5A8WA 5HQLA 1Q16B 5J2QB 5ETNA 2CZ4A 1JLQA 4ZVEA 2J0XA 2V2ZA 1YRUA 2Y0BB 3DLKB 4Y2KA 4X62F 2DGTA 2AQ4A 1R89A 3K5MA 3PKYA 5HVHA 2MKIA 2W9AA 4JB8B 5KT4A 2CQ4A 5LL6d 2OO4A 3QGGA 4MYUA 4RNHA 1PC4A 2R2UA 1AUDA 3HP6A 3ET6A 1TR0A 1NK5A 1C1BB 3C66A 3CPWR 1S1VA 1SJ3P 3M8RA 4ZVGA 2YH0A 2MLZA 2IVFB 3FK4A 1EZZB 2EBEA 2KT2A 4F50A 3H25A 2MZJA 2BQRA 2XS7A 1SC3B 1WOPA 5HATA 2RRNA 4O4GB 3CJTA 1ZS6A 2XMVA 4PG7A 1HNVA 2KYXA 2BE9B 1HYSA 2KZZA 4FYVB 1D8ZA 3FRZA 4CM0A 3NNCA 1WC6A 1SV5A 2R7XA 1SI9A 4WIIA 2W4DA 2A0FB 4D3HA 4UOHA 3HD1A 1R0AA 4H4OB 4B3RF 2HNDA 1NH7A 2HIQA 4J9KA 4Q43A 2E5LJ 1DHMA 1HLWA 2GV1A 3O2IA 3GR0A 3O44A 3POTB 3QT5A 3WC2A 4DQIA 3VQSA 4K5SA 4DV5J 4DR4F 2VDHA 1UAWA 3MD1A 4KGVB 1KR4A 2XYHB 3CJ3A 3HHLA 2O66A 1S1TB 1RAAB 4BDPA 1XR5A 3CJ8A 1SH2A 1FJ7A 1SQEA 5D0RA 2FDNA 3KWMA 2VPWB 5B0AA 3KDOA 1B7YB 4GO7X 2XQCA 1CJTB 2WONA 4OX9F 1PCAA 3F41A 3OL8A 4HI1A 1B0PA 1VRQC 4DV4J 1VJWA 2HBQB 3MECA 1SL2A 1YG0A 3OSNA 2E7VA 4PQUA 2V2KA 5ETQA 4CO0A 1M5SA 2MGZB 5GMDA 5LJ5Y 3O5TB 5DM7Q 2X3DA 1FXRA 2UXCF 4N7TA 3CJ2A 4N56A 2HQCA 4K4VA 4I4BA 1TKDA 4NLOA 4FXDA 1NDPA 2D1CA 1A0OB 2BKNA 2E5JA 1KBRA 2LLZA 3HKWA 4C3MA 3NOCA 4DX6A 1X9WA 1HARA 4CZCA 3OJUA 2DNPA 2HKEA 2OKQA 2B8PA 2VPYB 3U1NA 4KT0C 2UVWA 1UETA 3A13A 4LUBA 2AYGA 1WF1A 3N4WA 4JV0A 2Z8QA 4J9SA 4LRFA 3LALA 3ZNJ1 4BHQA 1MU2A 4ZVUB 3LP1A 5J2NB 4DR1F 1M1KT 1HFEL 4DR7F 1PIEA 5F8JA 4FZVA 4USIA 5AE3A 3OLBA 1FJCA 3J80U 3OHBA 3FZ2A 3TJAA 5AJ3J 2BOAA 2DNKA 4NLXA 3QSIA 2M2BA 4OV6A 4TVAB 2R2RA 1XR7A 2BBEA 1UFKA 2CWKA 2XMWA 3CCJS 2JX2A 3P8BB 4HEA9 4DLEA 4ES1A 2DBBA 3G2XA 3HVAA 4DZDA 3OTOF 4L76A 4GKKF 2W2NP 3UQSA 3PIOQ 5IXUA 5HP1B 3DRRB 1M5HA 1RADB 2RD5C 2J0SD 5E3PA 2W2QP 3RYLA 2HVDA 3ZZPA 4LR7A 3T1HJ 2LDYA 1X4HA 4UQTA 4B3SJ 1GFWB 4ZCMA 2Q79A 2JDJA 3OR1A 3CO9A 4QQBA 3WQPA 3ZTRA 1YIJS 2JEGA 1I5OB 2LQBA 3KNAA 3AFGA 4QU7A 1TL5A 3LTOA 3HMJG 3PJWA 5CYMA 1W2BR 2PI4A 4H54A 1X8DA 3HT3A 1HMVB 1YHQS 1CJVB 4LFBF 2OPRA 1U1MA 3BGRA 3GCXP 3SEOA 4URGA 1JLCB 2EEYA 2NR0A 4Z37A 2Z0GA 4DPWA 3J7YU 4YDXA 3NGRA 3BPSP 1HQUB 2F4VJ 5HK4A 2HHHJ 1IM4A 2FQQB 2XC9A 3OT9A 3AXKA 4QBUA 3VCDA 4CI0B 7FD1A 2HHVA 4CH1A 5J2MA 2CJBA 5C25B 4J9MA 1RWVB 1M5PC 3KJVB 3X1LB 4W98A 2JL9A 1N8RT 3A8KA 2M4MA 2DEIA 2W7OA 3WBZA 4F2RA 3CMQA 3GYXB 3LP0A 1LOUA 4L3KA 2H48B 4LF1A 1HWLA 2BJ8A 2ZD1A 2CG8A 3M6VA 4OZ1A 4TU7A 3DLGA 3G96A 1J5EJ 2DHHA 1D0EA 4I7FA 1X4FA 4CLYA 5ADZA 2F1FA 2IMOA 3PRDA 4A8XA 2W1BA 1XIQA 2ZH4A 1ROFA 2IM1A 3EZOA 1H38A 3ITHB 4B9TA 4NZ6A 1FI4A 1S7HA 2CJ9A 1U2FA 3M2VA 5DRKA 5IWAJ 3HI9A 1VC0A 4CCHA 3P45B 1WG5A 1DQAA 2VQFJ 3V2UC 4RU9A 1RBLA 4JI6J 4DSKA 3QLHA 3BO3A 4AFFA 3W61A 2MB0B 2EG2A 4ED6A 2K7KA 5LMUJ 2DRDA 3DLEB 2BEFA 4EYIB 2VD3A 2XCPA 1RHUB 2PN6A 2HRTA 1P9YA 2N3LA 3JTPA 2MQOA 1RWMB 4ECVA 3MM7B 3NL0A 3A3NB 1U25A 3OBIA 4JI2J 2CAJA 4F0KA 3DRPB 3CC7S 4CLWA 5K14A 5L9XA 1EETA 4MK8A 4WE1B 4B9UA 3W5ZA 2H54B 2VFVA 4ZVOB 2J8SA 2Y1LB 2WVFA 1XWLA 1JXEA 2LMIA 1GXTA 3BPDA 2ZHAA 3SCLE 1LV5A 4KHPJ 2AYMA 2F40A 2VICA 1RBAA 1S6QA 1WHVA 1Q8LA 2FZKB 1HBUA 1DFDA 4LF7J 4ZVPB 3LAMA 3HSJA 3NLCA 3VGUA 4Y65A 4LF7F 1R3NA 2KRBA 3RAXA 2GHVC 2NXJA 1BUXA 3US5A 4DV2J 4E98A 1S6PB 4IO1A 2R7WA 1CLFA 4QU6A 2VG5B 4DEZA 4FP9A 1DAXA 4RO0A 1NKBA 1M90T 2HVIA 3JYTB 1FERA 4JI4F 1N32F 2IFXA 3CIMA 2DB1A 1S79A 2YVSA 5I3QA 1VRTB 3HDSA 3H7HB 3N5FA 4H4KA 1J5EF 1TKXA 3CCUS 1AZSB 1FKPB 3EGZA 3WIUA 3DOMA 5HANA 2HMIB 5HO4A 3D9BA 4JI0F 2CQBA 3MM6B 3CDBA 1CULA 1OS5A 4O3OA 3K5LA 3CC4S 4WF9Q 1JWWA 4NLGA 3H90A 2BX6A 3IS9A 3MEEB 5T14A 3R97A 5I42A 1TVRB 2CNLB 4ZIWA 3L9ZA 1V6HA 2A2DA 2BM0A 2I5JA 4CNYA 4ZLLA 2UXBJ 2R7TA 1RTDB 2DXDA 3KK3B 3MAQA 2ZNYA 3T6JA 2C2KB 5IOLA 3M2UB 5HJYA 3KHRA 5KFSA 1DZ5A 4Y28C 4TU9A 1FXDA 2GIQA 3T1AA 2JC0A 1S1XA 4LJMA 3VQTA 5KFJA 3MFHA 1NU4A 4A8WA 1YKWA 4LMZA 3GILA 1GQEA 3HJVA 1UEVA 2ZJPQ 3C46A 2XLJA 3CCZA 1RT5B 2VG7A 2IVYA 1T03A 1LK5A 2G2YA 2IPOB 2ZBQA 2BJ3A 3RAQA 3PKMA 5FD1A 3DXBA 3L4BC 2GHPA 2GVDA 2QG9B 1S0OA 1SPBP 5L1LA 1KC8T 4C8LA 1TL3B 3DDIA 2V69A 1UA1A 4Z7YA 1RWUA 3F0NA 3HLUA 3KJFB 4K0KF 2YX7A 4OZ3A 2FPHX 4DL7A 5ITHA 5CYQA 2XSJB 2K7JA 3EICA 1TMMA
chains in the Genus database with same CATH topology
2JHEA 2LQJA 4ES2A 4TU8A 1ZM4A 2HVHA 1PILA 2MKHA 4C0BA 3PW5A 1LQ9A 5DQHA 2CQ1A 1QVGR 5DQGA 4H4MB 1TKTA 2Q66A 1S9GB 3OR2A 4MKAA 3OFHA 4WU2A 4OLPA 3DI6B 3NAHA 4C2MA 4QR1A 2XY5A 4ZOSA 3R5BA 2B43A 1VBZA 1H7WA 3A1YG 1HYSB 4EZ9A 4O3RA 1RT1B 1Q82T 1U26A 4R25A 3I0SA 3I55S 2ADCA 4NLUA 1QE1B 2ZH7A 2CQPA 4Y2AA 2IMWP 3VALA 4YHHF 1TKZA 1VQSA 4IO9Q 1S1TA 4DR2F 2FJEB 2QV6A 4M8LA 1GX6A 2WSCC 3BQ1A 1CPZA 4NLDA 2DITA 3AAWB 2FHJA 4ZCLA 2E1RA 1RJJA 3UCUP 2C3UA 3ENVA 3OVBA 4KR0B 5E41A 4C0OC 1S97A 3PX6A 4OI2A 2LYVA 2KO1A 3H59A 3FRYA 2E29A 3QIPB 5L1KA 2VOPA 4JUZA 4IRCA 4KO0A 5JVHQ 2L48A 5GAEI 3TA0A 5BYSA 4DL2A 3MPWA 1IKVB 2IC3B 3MM8A 4DUYF 1R31A 1G1XA 1HBNA 5T41A 1Y3KA 3IGVA 3V6KA 4O44A 1S0MA 3I32A 4EYHB 2GNKA 3EPIA 4KBIA 1UEUA 3L3CA 2VL1A 3DOKB 5LMNF 3SSQA 1S4FA 3ZZTA 4FBTA 2F3JA 1QM9A 4ECXA 1RT6A 4DG1B 2RRBA 1P1LA 5LXYA 1BQNB 4ZHRB 3I96A 2BANB 1WF2A 2RU3A 1JX4A 1FTCA 2V8VA 2F8EX 1YJ9S 4X84A 2V9KA 4EFAC 3HHNB 5KG1A 4PXDA 4J9RA 2H5EA 4ZPDA 2PIIA 2NPFA 4M63A 3SV4A 3BSOA 3PV8A 3ZZZA 3TA2A 5L8RC 1FKOA 5E33A 4ERDA 3I87A 3IFEA 4O23A 1IN0A 2PO4A 1A6LA 3DHXA 5G0RA 2PA8D 5KFLA 3PO5A 4CT9A 3MUTP 4R0EA 4MFBA 4B3OB 3K0JA 1KN6A 2M5YA 3DRYA 4OJGA 2OFGX 1VQ4S 4FYDA 3I31A 3RB4A 5KFGA 2JEFA 2K3IA 2LEPA 2PI5A 4WJBA 3NGKA 3KK1B 1N6QB 1YRXA 3MAHA 5LSLA 3VZIA 4NLYA 4OZNA 2RQ4A 2D3OR 1LFWA 1U6FA 1VGYA 2C3PA 3BREA 2B0GA 1WWHA 3M8PB 1ZAXA 1KONA 2HLTA 4IG0A 3SSSA 3D54A 2PMZD 4X4PA 4J37A 3CDUA 3U7JA 3GV7B 3KLIB 3M4XA 1S6OA 4YB6A 5KT2A 5KFDA 1SBRA 5HN0A 3RRHA 1VBXA 3CCTA 3FQLA 1B64A 4WXOA 5KG6A 1FRIA 2LA6A 1FJEB 2ASYA 1HBMA 4X64F 2XY6A 4WU3A 2V4JB 1IJFB 4C8MA 3T6BA 4F67A 4C4WA 4PCQA 2FGCA 4PG8A 5HROB 1SJQA 4IH7A 2UU9F 1FTRA 5EWGA 3MMCA 4MK7A 2ZC4A 3NP5A 2GQCA 3NS5A 4QIEA 4AQYF 3MMJA 1JB0C 4ALZA 2ROEA 3CEDA 1VIOA 4WE1A 1C0TA 2Q6BA 4PUOA 2L3MA 3NBPA 2GO8A 1HD0A 2LECA 2HS4A 4KHMA 2AP6A 1T8EA 3KOAA 4UQGA 4TY8A 4KFBB 2ZJQQ 4NWBA 5DDOC 3FMWA 3DM2B 4WK3A 4UY85 2BRKA 3IO1A 3V6DA 4TLRA 2DTJA 2KJVA 3WX4A 5M2UA 2E66A 3CSKA 3K5NA 2YQ3A 5KFNA 1JLFB 3VAHA 1S48A 4ED7A 4DFJA 2OLWA 1UFLA 1KOOA 1F5AA 2LDIA 1S6PA 3I4PA 4DDFA 4KKOB 2MSTA 5HMYA 1RTJB 4O3PA 4RW7B 4I69A 1ZZNA 4ELTA 3N5BA 4NPOA 4DV3F 1UJ5A 2WBRA 4J9OA 4B08A 4KJIA 3DRSA 1ZM3A 2RVJA 3NRBA 1TAUA 2VKRA 2E5GA 1NK0A 1JLEA 1UW4A 2G4BA 2GGPA 4J5OA 5KT6A 4GO5X 4I1TA 4I2PB 3G6YA 3E3XA 3EGWB 1S72S 1DTTA 4ILMA 2L41A 3MF5A 4P7VA 2B51A 4GKJF 2KVIA 3SSRA 2C2DA 3E01A 3FVYA 5IM0A 5HLFB 4ZPAA 4DS5A 4B17A 4PXBA 4IR1A 2J9DA 3IS9B 4QWAA 2NLWA 2QLWA 1RA7A 4OLOA 3PM9A 4OMFG 3T5LA 3DLLQ 4HYKA 1RT3A 1BD6A 4ZK7M 4F4ZA 1NK6A 4O4RA 2EFNA 2DVIA 3M2UA 2ZOFA 2LEAA 2ZNZA 4X4TA 2YKNB 4RX6A 1RT2A 3Q23A 2DRBA 4LT6A 3EZUA 4NCAA 1YBAA 5KFVA 2GO9A 1IKWA 5IS2A 2U2FA 1X4CA 3GV5B 3N01A 2VC1A 2FJBB 3RW6A 3IBWA 1D8YA 1FDNA 3GE9A 4F8RA 1JIHA 2I1RA 2KFZA 5KG3A 2EG1A 3CD7A 3M8QA 2C3MA 3M8SA 2DNGA 1R0AB 1Z4UA 1ZM2A 5CYQB 4TN2A 1NKCA 1S1VB 5E3RA 3KG1A 2EFPA 3IRXA 1KLMA 4KB7A 1L3UA 2R7UA 2UXDF 4A46A 3MFIA 3BDEA 4P7TA 2EWHA 1KFSA 1FDBA 1Q53A 5E3QA 4ECZA 4ZMMA 2VQFF 3MMAB 2IAJA 4QPTA 4QWDA 5I3PA 4PWUA 1T3OA 4X65F 1KQSR 2HFOA 1HWUA 2RMLA 4ZP9A 2YWFA 2J9DE 1JJHA 3OXLA 4OI6A 4PXCA 1CQMA 3FMBA 3FEZA 4Y3CA 2FJXA 4RLEA 2YKPA 3POTA 2X1BA 2FB0A 5J1PA 2N4CA 4LF5F 2M9KA 1QE1A 1SB6A 3R1HA 2BVZA 1XMOF 1JNRB 4NYPA 3P6YC 2R2SA 3PVXA 3L7OA 4C97A 2ZH5A 2LXFA 2CVEA 5K8MA 1DLOA 3EYZA 1U1RA 2Z4PA 2AYEA 3QJPA 4X4VA 2VPXB 3N6NA 1TKZB 3F56A 4KAIA 2W9BA 3K57A 5IQ6A 4RW8A 3K58A 1S1WA 5C24B 5J2NA 1YJRA 2Z2LA 1Q86T 2XNQA 4N5SA 2HFZA 3TOQA 1FK9A 4RUHA 5KG0A 2IYGA 4X4OA 1Q81T 1QVFR 2G13A 3QIDA 2CKWA 2L9NA 5KFIA 3I9V9 1TZ0A 1VRUA 2B6AB 1I1GA 4A8KA 2MQPA 2ILZA 2PFFB 3FDSA 3HXMA 2ZZMA 2WCXA 5KT5A 3K8WA 1TP7A 3Q0AA 1RKJA 5A2QY 1U1NA 2EK6A 4OIXA 4LF4F 3LWMA 3MPVA 1HBNB 2UP1A 5AXLA 4C0HA 4DOZA 3LWLA 3BQ0A 3RB6A 4I2QA 2N4DA 4OJ3A 3KHGA 3GIKA 4DLGA 2ABYA 2LKZA 4A8SA 1P9QC 2B4VA 4L3NA 3AQPA 2KN4A 3BGRB 2W7AA 2VG6B 3DOKA 3VF0B 5DDPC 2VA3A 2CJKA 4DSJA 3Q22A 5DJBA 2KXFA 4U7UK 4IOCQ 4NA2A 3NMAA 3TQ1A 2AX0A 2FHMA 4TNOA 1SJFA 3NCPA 1K0VA 3DRXA 4RW6B 3TRGA 4DQRA 1F0XA 5JVGQ 5CZVA 2CQ0A 3AJ1A 3OR1B 3OL7A 2P5VA 1X9MA 5CXTA 3K2YA 2HNYB 4DN9A 5C25A 3THTA 3LPYA 2WK4A 4RWWA 4JI6F 4QYZJ 2QT7A 3GV8B 1HMVA 1X0PA 5KFPA 4B9VA 5AE2A 3NNHA 4ED5A 1JLCA 5FDLA 4KHRA 1JNZB 2Y1JA 4NLVA 2KG0A 3AB4B 2OMLA 1MROA 3M2VB 2IJFA 4DL5A 1XMQF 2IBKA 3QZ8A 3KK2B 4LSLB 4R8UB 2E44A 5A6PA 3JSYA 2ZH2A 1B7FA 3T1YF 4HTIA 2RJZA 5F8MA 3KHLA 2IA6A 2J0QD 1JLBA 1HHTP 3GFXA 3EX7B 2MKSA 1U7LA 4F3QA 2XS5A 4JOUA 2B4UA 5K14B 2J7WA 4DF4A 4ICLA 1DTQB 5KOWA 1R43A 4IG0B 4QR0A 1FHTA 4UOCA 2BJDA 1T95A 2HHPA 3UD3P 2XNRA 1MMNA 3L95X 4A8FA 3KLIA 1OPZA 2JVRA 3FEYB 3CCMS 4F4KA 2XMKA 2HQ3A 2RH3A 4ID8A 4HI2A 2FVPA