5LT5A

Carboxysome shell protein ccmp from synechococcus elongatus pcc 7942
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
204
structure length
204
Chain Sequence
VELRSYVYLDNLQRQHASYIGTVATGFLTLPGDASVWIEISPGIEINRMMDIALKAAVVRPGVQFIERLYGLMEVHASNQGEVREAGRAVLSALGLTERDRLKPKIVSSQIIRNIDAHQAQLINRQRRGQMLLAGETLYVLEVQPAAYAALAANEAEKAALINILQVSAIGSFGRLFLGGEERDIIAGSRAAVAALENLSGREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of beta-carboxysome shell protein CcmP: ligand binding correlates with the closed or open central pore.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transport protein
molecule keywords CcmP
total genus 68
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lt5A01
3.30.70.1810 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lt5A02
3I87A 4HT5A 5LT5A 3F56A 5SUHA 3MPVA 5LSRA 3FCHA 4HT7A 5L39A 3GFHA 3I82A 3U27A
chains in the Genus database with same CATH superfamily
2RH3A 2FHKA 4KJIA 2DGQA 1JMTA 1S6OA 1V3RA 2O3DA 4PG7A 1IXKA 5BXIA 5F9LA 5DG8A 3QSYB 4LF9F 4RUCA 2HPUA 2RKIB 1XEZA 5BR8F 3ZZ0A 4A8XA 1CPZA 4A8MP 4CO3A 1TKDA 3QGGA 4IRCA 3J7ZT 3H40A 3LTOA 2OFHX 4FYVB 4JI2J 3QRRA 2P9EA 3MD1A 2V0NA 4YDXA 3AJDA 3QZ7A 4NZ7A 2JH3A 4ECVA 1M5KC 3DLGB 2G13A 4QIWD 4TY9A 3NRBA 4O0NA 3BZQA 2HAIA 5L1IA 2G4BA 3X3UA 3DOKA 2DNHA 2BMBA 3OTDA 4ED8A 3H0PA 1OMSA 3GONA 2Z8QA 4UT4A 1ZTTA 1PG5B 1QJHA 4CLZA 3MUTP 3TQ1A 3G2XA 3HSZA 4RZRA 1TKZA 1SKUB 5IFMA 1UCNA 2XCAA 2JEFA 3CJQA 1OSCA 2EG2A 4PXBA 3T6JA 1XC9A 4DQIA 1FJEB 2KM8C 4JI8J 4ZPAA 3BGLA 1VYAA 4WTOB 2MQ8A 4DBQA 1U6FA 3UE2A 5HQMA 3NGSA 2YKNB 4PWWA 1KDNA 3VR1A 3J81j 1U2CA 4RNFA 4WP3A 4C11B 5KT7A 4DL3A 3MM5B 4ETZA 3MURP 1JNZB 2WW4A 3GP9A 1FRIA 3KHGA 1Y5NB 1XN9A 2HZAA 4NLRA 4PPZA 4R5PA 3VCDA 2HFVA 3AA9A 1JLGA 1N5VA 3RUBL 4P2XA 4C98A 1GX5A 1HNWF 3MOJB 3SDEB 1S1UA 3FSXA 1CEZA 4C8NA 1A6LA 2C3UA 3ENVA 5T7LB 2R7RA 4ZVTB 3QAEA 2KT3A 4HH0A 3C46A 3BGUA 3PX6A 4WTYA 5I3UA 6FDRA 3GCXP 3CDAA 4NLWA 4ED1A 4NRTA 1NAQA 3UN2A 5I42B 1MMDA 2HVZA 4KO0B 1Q16B 2RT3A 3MPUB 2HLTA 1TVRA 3J81Y 2ZVSA 4CRJA 3MR7A 4QIGA 4YFUA 5M2UA 2LEAA 3UDCA 1JLGB 3SQGB 4G3IA 2V2ZA 5KG1A 2AJ0A 2PA3A 2KT5A 3GTYX 4I68A 2VC0A 3FSIA 3QWUA 3OBIA 1BQMA 2YY3A 3PRBA 1J5OB 1T03B 4U67Q 3B82A 1RABB 2HVDA 1YZ7A 1CULB 3MM8A 4KGMA 4NEZA 4UZCA 5L38A 4BC9A 2AU0A 4LF4F 5FIIA 1A7GE 1FI4A 3R27A 4LF6F 3G6ES 2DHGA 1P9YA 2KHDA 4WIIA 2GHPA 5KFVA 4CLFA 1WEZA 3NG8A 5ETMA 2NPFA 9ATCB 3CCQS 2NPIA 3V81A 3MTJA 2MMYA 3THVA 1T9VA 1BC6A 1AROP 1H72C 2P9CA 5K9FA 4ECYA 2XMUA 4ZVFA 1X5TA 1WHYA 3NBPA 4O0IA 1I94J 2NYIA 5MLCV 2XS7A 3RBZA 2BW7A 3HZGA 4RJVA 1F9EB 1XMBA 3G86A 2E44A 1X31C 2I9SA 3EWGA 1HNIB 4RNHA 1W26A 1Q95G 1BGXT 2P5VA 3PFOA 3MAQA 4A8WA 4WYWA 1P1TA 2IRXA 2VU5A 5J2MB 3A1YG 4WFZA 1S97A 4ELTA 5K20B 3ZTOA 2DH8A 1VJQA 2CPHA 4L3NA 3NY0A 2RMLA 4JYAJ 3JSMA 3CMES 2EFQA 3EVMA 1FA0A 3I0SA 4RNNA 4KHPJ 4LF9J 2OMLA 1WG1A 2H54B 2MKIA 3DKDA 4EYIB 4RL1A 1DJ0A 5LMUJ 4QR0A 3B4DA 3K58A 4JI5J 1SJRA 3QLHB 1CJTB 1VOMA 2R8IA 1S0OA 5CCLA 4ZITA 3HZEA 4B02A 2L08A 3GIMA 3IO1A 3TVZA 3FFIB 2ZZNA 3D67A 2NS1B 2WSCC 3TA1A 5H9FJ 1RAAB 2DHXA 3ZC4A 4CYUA 4RU9A 4ZHRA 1NDCA 1KFSA 3EXCX 4B3SJ 3AJ2A 3W8PA 4C0OC 2LCWA 3M8QA 3J7AN 2PN6A 4DR3F 2FJXA 1ZM3A 3I5CA 1X4BA 2V4RA 3IRWP 4LVNP 3DLHA 1X4CA 1R8BA 1UVJA 4GMKA 1Q7YT 3W2WA 2V94A 3HCXA 2C3PA 2YWEA 5C24B 3PR5B 3KFWX 1G1XA 4LRDA 3HKZD 3UR3C 2Y8WA 4PXEA 3ADAC 1C1CA 3KLIB 2DIVA 2LQ8A 4PG8A 1RBLA 2PA8D 3IGVA 2LECA 5DJBA 1S9GB 4JI5F 3ET6A 4UOCA 1U1OA 2DYAA 3PKMA 4IRDA 2JZ5A 3HULA 2HGLA 2B43A 4X4TA 3SYZA 1ACMB 4OX9J 4OZLA 1B4SA 5HMYA 5EGYA 3W60A 4DV1F 4KGVB 1M5SA 1PBAA 1WOPA 4TXSA 1X0FA 3MZIA 4FXVA 1KRPA 1S1XA 4F26A 1VQKS 3CULA 3ISZA 2PD1A 4ED2A 1QTMA 1TZ0A 3MPVA 5CYQB 1XWLA 4JI6F 7FD1A 1LQ9A 2XCPA 4DFPA 3DRXA 4NRUA 5CYQA 6FD1A 2MY7A 1N88A 1IWAA 4R0EA 2ZHAA 1WWHA 2G9OA 2HVEA 2DRBA 5BYSA 2XO7A 2V9KA 3ISNC 4UOHA 1Q82T 4MFBB 4GC6A 2DHAA 1OIAA 2HBQB 3C15B 1M1GA 3NGUA 5GAEI 1AZSA 1I5OB 2JLFA 2EBGA 2B9EA 2IC3A 3F0NA 3KG0A 4LSNA 4Y28C 2AZ1A 3TUIC 4BLGA 3T9NA 2FJVA 2BDPA 2UUCF 2FHOB 2F40A 2J7UA 2K06A 3TO8A 3GIKA 4WWSA 1ZS6A 4DCPB 4QZVB 1QVGR 3D0GE 5LJ3Y 4RUAA 2EW9A 4AL6A 1PYTA 5ETVA 1S1TB 3VGUA 4AL5A 1MMLA 3CMAS 1J5OA 2HZCA 3V2UC 4HTIA 4M1KA 1X60A 4LBIA 4LIRA 2N82B 2V4JA 3LQVA 1JNRB 1M5VC 4A8KA 5A76A 3IBCB 4C8LA 1TV6A 2FD2A 4RW8A 3M8PA 4RX6A 3TJ8A 4IOBA 3MR2A 1R8AA 3HHLC 3KJFB 4NLQA 1U6BA 1TKXB 1FEEA 3WIUA 2QX0A 2CNLB 1EQ0A 4M5KA 2CPIA 3D66A 4ES2A 1N34J 1AFJA 5IT9Y 1K1QA 3OVAA 1IJFB 4DSIA 3NCPA 3ZZTA 4OZ0A 3RTVA 4OHWA 5EDWA 1VIOA 3CIMA 2ASLA 4KGZB 1HYSA 5AXNA 4UF4A 2ZH9A 1SH3A 4DPTA 3OTCA 3TA0A 2WVEA 3GG1A 4Y3CA 1D9AA 3O2IA 3BN4A 3K59A 1TV6B 4P7TA 2E7VA 2ROPA 2J7KA 1FFWB 1OY6A 3NGRA 4I64A 5K14A 4FF3A 2FJBB 3QIDA 2H9ZA 3DC2A 2GNKA 1HNZJ 1U1PA 1DQAA 4ZP6A 2QA4S 4JV2A 1R0BG 2XZDB 2XWYA 3MEGB 4KAIA 2E5LF 4B3OB 2DGOA 2AJFE 1O5JA 2OELA 4XPCA 1SBRA 1S9FA 1L3VA 1FESA 5IT0A 2BA9A 2K7JA 3N4WA 4BBYA 3VAFA 2L9DA 2LU2A 3HXMA 2V8PA 3DM2A 5I3QA 4MYUA 4D3GA 1S6QA 3RBDA 4ZP9A 3K8WA 3MF5A 1PC4A 1HWKA 3PEHA 4B9SA 2BJ3A 1NEEA 2H4WB 4U8YA 4RW7B 2Z2ZA 1HD0A 3MDFA 1WF2A 2FJWA 5GAHU 1N8RT 4JV5J 3H90A 3H59A 3IRXA 1N36F 1VISA 2E5HA 3M8WA 3NOCA 5B0BA 3GIRA 2X51A 1S1UB 2IRUA 2JC0A 3M2UA 3N79A 2YKPA 2FLLA 5AJ3F 3MCOA 3TNVA 4JYAF 1BXNA 4F4ZA 4DF8A 4RU2A 4OYIA 1K9MT 2HMIA 1SUQB 1C1BB 2A2CA 2PFDA 1PYSB 1U8SA 2LMIA 3D6MB 1QAXA 3CJ5A 4ZCKA 3OFHA 2UVVA 1WF0A 1GAOA 1S6QB 4I56A 4AUKA 2CQGA 2ZUGA 4MK8A 4EBCA 3K89A 2NUUG 1VGYA 3QAUA 5LJ5Y 1U1RA 2OPPA 3M9OB 4LR8A 2QTWA 4FYWB 2HNYA 3TVYA 2DR8A 1B99A 1TK0A 1Y11A 1WOSA 4N56A 1N48A 5HP1A 5KFEA 2CZ9A 4USUA 4RNMA 1G2EA 4RUBA 1FHTA 4X62J 4OLPA 3KK3A 3THTA 4WU2A 3MCMA 4ZS6A 5HSPA 3E01B 4IH7A 2EKYA 1WC4A 5A0YA 1M1KT 4NOHA 1LOUA 2D3OR 3AJ1A 3AD7C 4NCGA 2BW2A 3RAMA 2BJ8A 1RT1A 3CMQA 3BGRA 1RLDA 3RRHA 2HHHJ 4M5MA 4GVBA 4LF1A 4ID8A 1YBTA 3FKBA 2X1AA 1R8HA 4J90A 3L4BC 1NCLA 2RF2B 1KTVA 3Q23A 4N8NA 2PI4A 3G82B 4N76A 5GAGU 3TQEA 2D3UA 5ETTA 4U95A 5FLXY 2GA7A 3PW0A 3NL0A 3TX8A 1CJTA 3GFYA 4EUVA 2A1BA 1RGVA 1N54B 1GMVA 3T19A 4OZJA 1OQ3A 3DLLQ 2PIIA 4IQXA 2XYGB 4C3MA 4ERDA 5BYRA 5JVGQ 1T0TV 1RA7A 2N7YA 2CNKB 3PW7A 3K57A 1VDHA 5ETRA 5J2MA 4LF5J 4QU7A 1OYDA 2CQ2A 1S72S 1IKVA 2JJ4D 1CJKB 1RDRA 4KKOA 4J9NA 1HI1A 1RACB 4ZJOA 3GSIA 4DR2F 2GIRA 4LRBA 2ZBQA 4ZN1A 3CD0A 1U4BA 1RWVB 5CZXA 3L7OA 2AIRB 4W90B 1RADB 1D8ZA 4IO1A 3M8PB 3HPOA 2Z30B 1RWUA 3D0HE 3HFZB 4Q2MA 4ECXA 2PI5A 1HW9A 2BJEA 1J27A 3EICA 4CT8A 3GJSB 2YVSA 3AY0A 3HLUA 3R6LB 2E1RA 4C3LA 1FD8A 3T6BA 1GNKA 1VRTB 4OYWA 3PYGA 1VHFA 4I4BA 4YN3B 1TR0A 1YLXA 1RTDA 4FNIA 4TLRA 4DUZF 3DLKB 1SIZA 4H54A 4ZPWR 5G0RB 1ZBTA 3ZNUA 5HN0A 1HR0F 1HNWJ 1KBRA 3PYEA 1IM4A 2R2RA 2MKYA 4WP9A 1HNVA 1K8AT 3T3FA 1D9DA 2E1AA 5EWGA 1BQMB 3SCKE 4DFKA 4EZ9A 2AZ3A 9RUBA 2ILYA 1VBYA 1FWKA 3I5AA 5CD4A 3UN3A 5DDPC 2UV8G 2C2EA 2FGCA 2HWHA 4PEOA 5C2GA 3F73A 3C16A 5L9XA 2MLXA 1WKLA 4C48A 2Y0BB 1HBNA 1JJHA 3PY8A 2GO9A 3OD2A 5I42A 4Y2KA 1TMMA 5KG3A 1FRJA 1U2RA 3AH6A 1T9UA 3D28A 1WKJA 2ZH3A 2QL7B 2OTJS 2CQIA 2ZNZA 2BE9B 4ZLLA 2C42A 3NS7B 3D3CJ 1F2HA 4NYZA 4TYAA 3J80Y 1XMOF 2AP6A 2C3MA 4ED5A 3GIJA 3W5ZA 3M2RA 1TK8A 2EWHA 2XHCA 4IH5A 1QY7A 1JLCB 1HKAA 3MGJA 4X4OA 1X5SA 2QT7A 1NSAA 3B54A 1CULA 2C3OA 2E5IA 3PJ9A 3MCNA 3CJSA 3W5YA 5CAAA 2IY5B 4KH1B 1FXRA 4L3KA 2WVDA 4DV6J 2J6TA 3EX7B 5LSOA 3MM9A 1UVKA 3LUYA 4NLUA 3SCLE 1NB7A 1KVIA 5AE3A 2ADBA 5CXTA 1YJVA 4DR3J 1VRUA 3M8QB 2IYIA 4PG5A 2OD4A 3RB3A 1F9FA 3KWMA 2AWZA 3I87A 5ETLA 2ZH4A 4JBCA 1S7HA 3TRGA 2BACA 4DX6A 2BM1A 2MY8A 1S99A 4ZCMA 4FS1A 4IRKA 2C2RA 3ZTQA 4X4SA 2JLEA 3U1NA 4URSA 2E1CA 1QAIA 1BY9A 4P52A 1WJ9A 4FYDA 4IYQA 2KG1A 4EU0A 4ETXA 4ECZA 1NK5A 3CCVS 1KOHA 2IAJA 3BDPA 1EKRA 4U7UK 3W9IA 1H74A 4DPOA 2ILZA 3OUYB 3M2UB 1KTQA 3GV7B 2J0QD 2JSXA 4PWDB 3LWLA 3VAGA 2GQQA 1REVA 2B3TB 2J7WA 5IT4A 4CO0A 5A2QY 2PMZD 3PXGa 2XMAA 1EQMA 4DR6F 2QLWA 4QW8A 2G0JA 1ZAVA 2M52A 2VG5B 3ELHA 2R3VA 3FCWA 4MH8A 5LXYA 3QPIA 2BUNA 4URQU 1KLMB 3DM2B 3MD3A 1EJ7L 4USMA 1E6YB 1MW7A 3FNNA 1UEUA 1R43A 1RT2A 2B9WA 2F5GA 4ZVRB 3QT8A 4AFFA 3ZZRA 2E9RX 1IVZA 5JXSA 3OJSA 3D68A 1VR6A 2P9GA 4DSKA 4FDFA 2LA6A 4Y65A 2W7OA 4ZPVR 3EPIA 2VG6A 3DRRA 3A3OB 2XM3A 2RU3A 2F3JA 2DEJA 2ZH6A 4LBPA 3K17A 4QYZK 5KFAA 3ITHB 1T02A 4YB5A 2E1PA 2R4FA 4GRSA 4MFBA 3QYYA 3AT1B 3OTOJ 3G8TA 1X7VA 3LP0B 4CLYA 3IP0A 4MKBA 2R7QA 3GZ7A 2WW8A 1FKPA 4HR2A 5BYQA 4ZVQB 3DRPA 3M9MB 3RR8A 4JP8A 4CO1A 4F3MA 2HURA 2Q66A 2DGSA 2OFGX 4M95A 2BRKA 1NK0A 2BM0A 2OMOA 3DFEA 4RPFA 3I0RA 1RYSA 1NK4A 3SSRA 3GYXB 4ZPCA 4J9QA 4UOFA 3ET6B 5L1LA 3ZXWA 1S0NA 2XTJP 2QLXA 2RHQB 3FEYB 3MMBB 1JLAB 1ZA1B 3SFUA 1URRA 3DLKA 2J8SA 5G0RA 5DETA 2UUBF 1AUSL 2F8MA 2MEWA 3L7PA 4OZ1A 1FWPA 1S6PA 2HSEB 3KXDA 2CQHA 1UA0A 1VRTA 2FVCA 3FZBA 5AXLA 2IIHA 2CPZA 2QC3A 4AT1B 2V2QA 1RBAA 1OS5A 4NLXA 5IS2A 5KFKA 5CZVA 2NZCA 2GQCA 2AEMA 3DOKB 3CCRS 3DHWC 4K2XA 4DPWA 4G1PA 5CABA 1DURA 3ETOA 2NREA 4P74A 1K47A 2Z2LA 2RQKA 3CGIA 3IR7B 4DL2A 4DR6J 3UCGA 1HLWA 4N77A 1H0HB 4DV6F 3BN7A 4RBTA 3A13A 1G7CB 2BZ2A 3TARA 1G6BA 3JSRA 1NKBA 4GKKF 3BR8A 2X1FA 1FO1A 1GMUA 3C16B 2WRMA 1SV5A 3HVTA 4GO7X 1KQKA 1HMVB 4B3MJ 2VD3A 3GJRB 4YOEA 4FYYB 2VC1A 2HNZA 1HPZB 1U24A 3KLGA 4O4RA 3OL9A 3FJ2A 3Q8SB 2GS8A 3J7YI 1IUJA 3HFVA 3PW5A 2LYVA 1F5BA 2LQBA 4N8OA 3UDVA 4USKA 1KC8T 1KS2A 4DG1B 1SH0A 1KKHA 2DEIA 2XWXA 2XS5A 2I2YA 2FUG9 5IQQA 2HMIB 1SL1A 2ZC4A 2ERRA 1BQNB 3OR2A 2IVYA 2BANB 3P3DA 3T1HF 4I7FB 5B0FA 3FDSA 4EGLA 3I96A 2Q6CA 1JJ4A 2R2UA 2DO0A 4KKOB 4FN5A 1GXUA 5HATA 4CT9A 3TUZC 2ZBPA 1AUDA 4WFNQ 3BPDA 3QIPA 4CH0S 2VH7A 1QE1A 4Z7YA 4PRFA 2CYYA 3EGVA 1N56A 1T05B 1X9SA 1F3VA 1OPZA 2NXEA 3FC9A 6AT1B 2PE8A 2CPDA 1EETA 3ILLA 2DPJA 1RTZA 3TVKA 2RDIA 3KTQA 1ZM4A 1N5SA 4CP5A 1URNA 2KFNA 4DL6A 4BWMA 1F6TA 4KQZA 3MEGA 4QJVA 4TNOA 2A6MA 3MEEB 3NXZA 1MN9A 4KIAA 2BRLA 5KFPA 4OHYA 4LJMA 3C14B 4Q0BA 1NSQA 3VWSA 4KHPF 4YR2A 1RWXB 4I69A 4LSZB 4CDIA 1JXLA 1VQ8S 2QRRA 1RAOA 2DNOA 3SQGA 3UFCX 2K8GA 2UUBJ 1LFPA 4DQRA 3JSYA 4Q8EA 1SIWB 1TKTA 3QBCA 4F8RA 1S1WA 1O6XA 3NBPB 2V2VA 1QTNB 3F41A 1XK8A 2MHEA 2HK3A 1TP7A 2E1MC 3C6UB 1E6VB 4Y2CA 5MAOA 3V6JA 2VFSA 3ISND 1HNXF 3QMQA 5GAGI 4YEAA 4F0MA 1KFDA 4YMEA 1BWEA 3IFEA 3OXFA 2VIHA 4J37A 4EBDA 2H51B 3OTEA 4NMXA 2PO4A 3RZAA 3CC7S 4EZ6A 4LUBA 2HHTA 2RRAA 2EPIA 3HD2A 3J7Z5 1S1VA 2YX1A 3VQSA 2MHNA 1H38A 2F4VF 2H5IB 2MQMA 4A46A 5IZHA 4PKDB 3LAMA 4ANCA 1KLMA 3VAMA 1A9NB 4EO8A 4O44B 4DL0C 3SI8A 2OPRB 3CCES 1QDUB 3BJYA 4KRWA 1B64A 1T95A 2IJNA 3DN9A 2LU1A 4OYBA 3O5TB 3RG6A 4URGA 4F3QA 1SC3B 1VJWA 3H7HB 1OQ6A 1ZM9A 2C3YA 2OPSB 2WVFA 4KO0A 1U8WA 2VV5A 2YKMB 1F5AA 5A8WB 1TFYA 2RRNA 1Y3KA 1S1VB 1U26A 1SJ4P 1U0HB 1RZMA 3M4XA 2AYBA 4V19J 4X62F 2YNGB 1L3SA 1BQXA 1TELA 1LFWA 3PNIA 2Q6BA 4H4MB 3BPSP 3CEDA 3O3LA 2KXHA 3ZZYA 5DS7A 5HVHA 3M32B 4YR3A 1UZHA 3D1OA 2E5GA 1FKOA 2ZEJA 3CWJA 4K2JA 4ZP8A 3I56S 2VQFJ 4XK8C 1VQMS 2ALZA 4JI3J 2DCUB 5KFQA 3P49B 5IC6B 4J5OA 4F02A 3O8WA 4OL8A 4ZIVA 4WBFA 2OD6A 1AXQA 1UEKA 2I5JA 5C2CA 3KHHA 2JEJA 1PO6A 3DGPA 4WZMA 4ZVPB 1EIYB 3PO4A 2AYEA 1RP5A 3BKFA 2NUHA 2UUTA 3HSJA 1NO8A 3ZTRA 2E66A 3J80U 2B7CB 3KG1A 4KSEB 3RGIA 1IBKJ 4C8YA 4NZ0A 1MROB 2QG9B 4DUYJ 1J5EF 3H2UB 3KNAA 2YWWA 3HF5A 3UVJB 1SQEA 2IPOB 3H8YA 1PKUA 1JXVA 1VK8A 3JQKA 2ZH1A 3UN5A 1X9WA 3HSGA 4RW9A 4HDHA 2IM3A 1H6KX 3IWLA 3WDOA 1RAIB 3AQPA 3C15A 3EM1A 4J91A 2BX6A 4WYLA 4CNYA 1FE4A 3FCHA 2DGUA 2ZBRA 2DVIA 4DQPA 4RUHA 2BJ1A 5KG6A 3O6QA 5HJYA 2F8EX 3GMGA 1N5YB 1IR2A 1RWPB 3GILA 1JKHB 4DU7A 2U1AA 3THPA 4B3TJ 4LFBF 1BQNA 3OR2B 4ZP7A 1VRUB 1Y5IB 4R5PB 4ZLNA 3OVSA 2NLWA 4LRFA 1CQMA 1U25A 1PCAA 2KXFA 4IQMA 2H65B 1AFIA 2GMHA 4FP9A 3KG4A 2OKQA 1TL1A 4NLYA 5D15A 2CA9A 1XMOJ 5F8LA 1Z2ZA 3BREA 5HMZA 4DV7F 1VQPS 1N5TA 1RAFB 1JLAA 1ZPVA 2IVMA 2ZUAA 4DQQA 1TK5A 5SZTA 1RTDB 2FLOA 3JXOA 2DXFA 2NQPA 2M8HA 2CZ4A 3UDEA 4E2FB 1RHJB 3MPWA 3G6VA 3DXSX 5KOWA 1C4CA 1UMJA 2CPEA 2PMHA 4FPRA 5LL6d 1EP4A 1JLQA 3M8RA 3NS5A 4JI0F 4IOCQ 4F4AA 1KNZA 4X4PA 3R9LA 4MAKA 2KZZA 2CQ0A 3LPYA 4F67A 3BYRA 3EUNA 2Z2MA 3H4BA 4CLPA 2ZBIA 4FKXA 1TFWA 1CS4B 2IVFB 3VF0B 2YPYA 5F8GA 3HO1A 1FJGF 4RO0A 1R89A 4PUOB 2HBYB 3FMWA 1NZ8A 5D8HB 2QA4G 1MU2A 2RB7A 1DAXA 2K1RA 2H4YB 3QQCD 4EFAC 1KN6A 3HX9A 3CNQP 2K1RB 3N6NA 4AL7A 4NEYA 1RCXB 2IFXA 3L09A 4I6AA 4IFVA 5E3QA 4ECWA 4F3OA 5HMWA 2ZZTA 2FDNA 2WZ1A 5D3GA 2R7SA 2GZOA 2HFZA 3V4MA 1Q1KA 5K5MA 3FQLA 4PXCA 3S8SA 1JLEA 4MIBA 1CS4A 2ZM6J 2OLWA 3RR7A 4PWUA 4OYXA 2O67A 4B9LA 4W98A 4DR1J 3LP1B 4FF4A 1NDPA 4RW4B 5IC4B 4CM0A 4DDFA 3A4TA 4F36A 3CB4A 3DLEA 1FFSB 1SUQA 3SSQA 2MZSA 2UUAF 4PYAA 5J1NA 2HBZB 3SSSA 4TU9A 4X84A 2RQCA 2R2TA 3MMCB 4DR2J 4DUTA 1NJWA 3FSYA 4HTJA 5HANA 2C22A 4X65F 4LF7F 3MMCA 2VKZG 2DITA 2VPWB 2C2MB 5JJBA 1FT8A 3BKTA 3KNGA 2AEFA 1WKKA 2M3DA 4LT6A 3H42A 2E7XA 3M7VA 4ITSA 2DY9A 4RW7A 3W66A 5A8KA 1UVNA 1UL3A 1RHRB 3QGIA 4L74A 2EVZA 1KLNA 4TKTA 3QATA 2DR9A 2XMMA 3TAMA 1HQUB 4ECTA 3NGKA 2ASJA 5FDLA 2CQ1A 2PT0A 4RBVA 5KT4A 2RQ4A 2JFDA 2VFTA 4KGXB 3LA0A 2IBOA 4P2SA 2G1HA 3LW5C 3TUJC 5D4NA 3VAJA 1H7WA 1N0UA 3QT5A 1I3OB 4FS2A 5AE2A 4H4KC 2WBMA 3PFEA 1PJ6A 4DPXA 2VG5A 3FBEA 4JOUA 2DB1A 2MSSA 3PM9A 1UFWA 1WDDA 4WE1A 3V5RA 5EHHA 2U2FA 1NSKL 4JI7F 4GVBB 2GW8A 2A18A 4NA3A 4M94A 3O44A 4UUXA 4OHVA 2ZD1A 5KFDA 2RS2A 1NM2A 4YY3F 5KOXA 5ETKA 4P71A 2GGPA 3U02A 4DMZA 4WKRA 2VBXA 2RVJA 1RA6A 2JNJA 4RKUC 5LXRA 3KYLA 2M70A 2FHJD 3DDKA 4WFXA 5LSRA 4BS2A 3C3LA 2FZGB 1W7WA 3SDEA 1GMWD 4QR2A 3CE8A 1I6JA 2K2PA 2JFKA 1HA1A 2W25A 4NE9C 3MFIA 1FK9A 1S6UA 3CJ4A 4P7VA 3QJJA 3R1LA 4QWAA 1JJCB 2XGPA 2ZZMA 5CCMA 3MMAB 2XLJA 2Y1JA 3BH7B 3QNWB 4MKVA 2HQCA 2PDAA 1WTFA 4S0MA 4WFYA 2FB0A 3BGFA 2B5JB 2HEKA 3CT9A 3PTWA 5KTQA 2EG1A 4U9RA 2CG4A 5DDQC 5DQGA 4DF4A 3RU0A 4HHHA 3G8SA 1IQZA 2O5DA 4P9SA 2FC9A 2VPXB 4ZVGA 2MSTA 1LK7A 1TKXA 4MT1A 2OHDA 2QV6A 1PSDA 2IDLA 1D0EA 1FJ7A 1HBOB 1YIJS 2DNLA 4IFYB 3NGDA 4IR9A 3LANA 5C5JA 3Q83A 1U0HA 1OWXA 5E5NA 1T9YA 3V4IA 3EDRB 1KQSR 3UR0A 3PV8A 4JI1J 4X65J 2KXNB 4LF7J 2R8HA 3V81B 2GMLA 1WG5A 3DDNA 3FZ2A 3Q8YA 2HS0A 3P4UB 4Y34A 1R0CB 2VFUA 4B9TA 2R7OA 4FBTA 3G9CA 4K4UA 3FGVA 2QN6B 3GSDA 3W8GA 4CTAA 4XPEA 4DUZJ 3KLIA 4M8LA 5H1SV 2F65A 5GMEA 3C8YA 2RILA 3M8ZA 1XERA 1I51B 2CXEA 4DPUA 1IBCB 2XZWA 3R2CJ 3WZ0A 3JSBA 5D6GA 4DV5J 3DGPB 3OXLA 4R0JA 5D78A 5D3GB 5J1PA 1W2BR 2AJQA 1HMVA 1WD6A 2CPYA 3HHEA 4A8SA 2JLGA 3ETMA 3E2EA 3QJPA 2H5JB 1Z4UA 4QYRA 5J2QB 2QMWA 3CCWA 2RQMA 3GU0A 1ROFA 1DARA 4O3QA 4B9MA 2KYXA 3LP2B 3MEDA 4OYZA 1L3UA 4HHJA 4RW4A 4X64F 5T7LA 5FLXU 4QR1A 3POTB 4F50A 4O23A 2MDAA 3AOBA 3K5LA 1YWXA 1T11A 5L9NA 1IBMF 1SB6A 3POTA 4KGKA 1GXLA 2CQ3A 1NPRA 4UTGA 1HFEL 5E2QA 3QJLA 1UETA 2CVIA 2GFFA 1IR1A 5U47A 2AQ4A 3DI6A 1FX4A 2N4DA 1U1QA 3CJRA 5J2QA 5F3TA 4Y0FA 1MG7A 5FD1A 3NGTA 5KG4A 1N5QA 1SL2A 2FJAB 2AGOA 5KFBA 4LQ9A 3BV8A 1KR4A 2DXEA 5F0WA 4QWBA 3WC0A 5HROB 1ZZNA 4C9DA 4XAKA 4DU8A 2FJDB 3G8QA 2HK2A 5C42B 1S79A 3MECA 4DSFA 2HHHF 4C8KA 5C24A 5HQLA 4O3RA 2HQ3A 1RT3B 1N32J 2ZH2A 2W24A 1FTRA 3MWBA 2NR0A 3EZUA 1Y7PA 4UOGA 3I4HX 3TAQA 2BBEA 4RW6B 1SPBP 4RWWA 4DOZA 4LQ3A 1TAUA 4C3KA 3Q24A 2MZRA 3BGRB 5IXUA 3W65A 3OQ2A 4MK7A 1AT1B 2YH1A 4M5HA 4DV1J 3OW2R 2HRTA 2HNYB 2IA0A 2J76E 1F1BB 2FQQB 4OHXA 5KFTA 3UD5A 3DDIA 4J9MA 4B3SF 1FJCA 4DR4J 3U7JA 1GXTA 2PFFB 3MM8B 1KWMA 2H1YA 3NAIA 1LW0B 1KP6A 2MPUA 2VA3A 2UVWA 3EGZA 3HHLA 3QLHA 1W2IA 2X1GA 4ZCLA 4ES1A 3HFKA 3N0VA 1UVLA 2FJEB 2Z56B 4OJGA 1U47A 2Y8YA 2GJFA 2PEHA 3CJKA 4DR4F 1R6VA 4TY8B 1APSA 3M6UA 3KJVB 1YG0A 2QMXA 2BVZA 2CQBA 3AOCA 4NL5A 4B3OA 1MWYA 3P6YC 4ENOA 5A2QU 4MYTA 3JTOA 3MMAA 2ZDPA 5GAEU 3AXKA 1N5YA 1FXLA 1LXJA 1SJQA 3N5BA 5KFWA 3NAHA 4OI3A 3P45B 3DRSB 4K0KF 3VQTA 1K0TA 5DGBA 1FVSA 4O4GA 4PCQA 7FDRA 2WVBA 4DFJA 2VA2A 4ILRA 5CYJA 1N32F 4NLOA 3OUYA 2Y1LB 3D9BA 4CYUB 3VZIA 3EYZA 4W4MA 4PQUB 2XG8A 4RW6A 3Q2SC 2J0SD 2ZJRQ 3OHAA 1YTYA 4U7UD 1IWGA 1RHMB 3AD8C 5GADI 2UU9J 3BBFA 3QRPA 4KB7A 1FEHA 1TUVA 2VICA 1R31A 4K0KJ 3UQSA 2POKA 3FMBA 1UJ5A 1P1LA 1YVFA 2X1BA 1VLOA 3UCZP 2O1PA 2J9CA 1RT4B 4DLEA 1NHKL 1CBKA 1TL7A 3OTBA 5KFCA 3EVWA 2W1BA 2VBWA 1GK8A 5HO4A 3ENQA 1Q0NA 1UW4A 4OI6A 4DX7A 5E3PA 4N7TA 2CQCA 1GQEA 3R5BA 3PX4A 2K3KA 3M8YA 3GJQB 3MEKA 2XC9A 3DMJB 3TZXA 2NXUA 3OV7A 3VVTA 3TANA 2XEXA 5B0GA 1NNDA 3HT0A 4AQYF 1TKZB 2XY7A 4ZMMA 4ELVA 3RB6A 4MIAA 5A0YB 5KFNA 1JXEA 1RT5B 2MGZA 2KG0A 2IRYA 3G4SS 2DH9A 4J9PA 4CLWA 1R0AB 4OZ5A 2NXCA 3QZ8A 3CXCR 3TEHB 5D0EA 2MKJA 4BWJA 4X4UA 3CCZA 4X66J 4LF6J 4U7CA 2ATCB 1S1TA 3DRRB 3I6PA 3Q8RB 2D1CA 2EKNA 4MMOA 3TYTA 3HJFA 3RBXA 3KDOA 2C2OB 2E29A 4ED3A 3M8SA 2D3O1 2MYFA 2OEKA 5KFRA 3FBFA 2B4OA 5ADZA 5GAHI 2OEMA 4N5SA 1YITS 1TAQA 1RSCA 1WORA 1RTJB 3MTKA 3I82A 1QM9A 4G1QA 3G6XA 1CQNA 5J2NB 1LV5A 2CJKA 2R8GA 2MKSA 4IFVB 4J9VA 1QD1A 2GAGC 1YJ7A 5KT2A 1X8DA 4HVZA 4OI0A 4LMZA 2R7WA 1YJNS 2BR0A 1QE1B 4DX5A 3JAMY 4JI6J 2V69A 1D9FA 5RUBA 4IG3A 1SJ3P 1VQSA 1FKAF 2NYHA 4DSJA 5I3PA 1EETB 2XNQA 4USWA 1WHWA 3I5BA 5AE1A 1S76D 2ROGA 1K44A 2VG7B 4WXOA 4I1TA 3UNYA 1S49A 2E7WA 2XMWA 1RU1A 1RJJA 1PILA 2R7UA 1C0UA 2XSJB 2CIMA 5EN1A 2AJ1A 2CZVC 1YDLA 2GO8A 1FDDA 3E01A 2Y0SD 3CJTA 4QPXA 2BKPA 2ZC3A 4JI2F 3M2VB 5D4PA 4X4QA 3AQOA 1HHQA 2CNNB 3CW2C 4OX8A 5LMNJ 4DUYF 1MLAA 2HAFA 4K4VA 4L6V3 1XTZA 2NSCA 2OAUA 4FYXB 5HROA 1PAUB 1T9XA 3DOLB 3HK2A 1VQNS 4NI2B 2ZH7A 1IKXA 2I38A 2QLFB 2G2OA 2HS4A 1FD2A 2YKAA 1FRHA 2YWFA 4DCJB 2QL9B 4Z7CA 5J1EA 1RWNB 4ICLB 1MU2B 4MK9A 4ZCIA 4YY3J 2RNEA 4YP3A 4W92B 2MJNA 1HWJA 3RBEA 1XIQA 3V6DB 2ASDA 4LBHA 3PR4A 4ECUA 5DO2A 3DRPB 4ZKAA 1KVJA 2CNOB 2VDHA 1S57A 2CJQA 3OR1B 1RT6B 1RWMB 5HAOA 3JYTA 4GKKJ 3FUYA 3US5A 2XBPA 1NJZA 2EFVA 2F9DA 1Y0HA 1J2VA 1IBLJ 1E6VA 2GIQA 2MKCA 4KH0B 4Z37A 3I55S 2ZWPA 3CF5Q 4TLQA 2V9WA 5A8RA 4R8UA 2L3MA 5HVGA 1S48A 3BYPA 3CSKA 5ETPA 3ZZUA 1HNIA 2Y9HA 2FY8A 1CJUA 1Y00A 3IXQA 3LGMA 2CDQA 2P8IA 3TA2A 4C7QA 4DR5J 1NK6A 4JI7J 1AW0A 1FNMA 1GFWB 1LNQA 3NWGA 4ES3A 3H20A 2QA1A 4MTPA 1AB8A 1NH7A 3U27A 3I31A 1EB0A 5E3RA 1ZETA 2QLJB 4USIA 4NXNJ 2IHR1 3D1HA 5A8KB 1RHKB 1KQGB 1ZTWA 3NEKA 1YZ6A 4GO5X 1S10A 5L39A 4G1IA 1WI6A 5E3CA 3M32A 4TYBA 4C6AA 2R8JA 2GGPB 3Q86A 5ETOA 1X4GA 3LPEA 1LWXA 4C8ZA 1XR5A 4Z2XA 2WTFA 2IAJB 2OP5A 2PGCA 4OI2A 2D41A 4ZIWA 2P6TA 1R0AA 3HMJG 2RUGA 3R5JB 4IFYA 4LF4J 2DXDA 2HFUA 2XSFA 3K8VA 3CJ3A 3BSNA 2UXBJ 2WHOA 2FC8A 3LAKA 3EMTA 3D6FB 4OLOA 5E7OB 4Y6IA 3N6MA 3K5OA 4J9UE 1CLFA 3K7RA 1RAGB 4WIQA 4JV1A 2VOPA 1U0SA 3NOGA 3EPGA 2B56A 4L72B 1WDTA 1CG2A 2BYCA 3IWNC 1SCJB 4RLEA 1SKSA 3CJKB 8AT1B 3KHLA 5I3UB 4G65A 3QT7A 1BHNA 4IKAA 1F2GA 1X5OA 1WTBA 1NBEB 5KFXA 4LF8F 2UXCJ 3W1YC 2D3ZA 2HIYA 3H2VE 4AXIA 4ED4A 3V4IB 3T5JA 2DTJA 3KK1B 5DG7A 1VBXA 3HVAA 4Y2AA 2GC8A 4CIOA 2VODA 2Z57B 3PJWA 1RXOB 3HKWA 3PCOB 2DR7A 1PIEA 3SV3A 2GIFA 3KOAA 4WF9Q 1SJ1A 2R7VA 2YNHB 1HARA 3R5DA 3S01A 2AGPA 1G4CA 2GVDB 5CYMA 1V9OA 3ZO7A 4YQWA 3MM6B 4UW2A 1YSJA 2RDDA 3FK4A 1YJUA 2YXLA 4A48A 3D2WA 4UQGA 4Q5VA 4F4WA 4B9VA 2RRBA 4WPAA 1ULRA 2QEXS 4X4NA 1TL1B 5D77A 4ED7A 1RBOB 2NXNA 1UVMA 4F0HA 2LQ9A 3PX0A 1M5PC 4HEA9 4NLGA 1HPZA 4OV6A 5KG5A 2CG8A 4HL9A 4F2RA 4IO9Q 1RE1B 2HGNA 4PQAA 4DV7J 2EBEA 1T05A 3TZYA 5L46A 1RWKB 3IC1A 3OFEA 5B7WA 1R8PA 3HP6A 3H4DA 2EXUA 2D69A 2HBRB 4LFAJ 1T7PA 2AT1B 3GJTB 3RJMB 3ZZZA 4B3RJ 4K4ZA 1Q79A 2ASYA 2MZJA 2SXLA 2IJFA 3IM9A 1ELOA 4FXWA 3BQ1A 2AYGA 4ZJQA 4P6QA 1HW8A 2BANA 1C4AA 2Z0GA 5HBMA 2MQQA 4CNZA 4UZBA 2OJ3A 3T1AA 4O3SA 2OPQA 3OXGA 1YHQS 3DGVA 4QOTA 1WI8A 2HHPA 3VHQA 2VFRA 3IS9B 3AB4B 3BKUA 3BO3A 4I7FA 3MFHA 1S1WB 2WONB 4EBEA 1VC0A 1VRQC 5E0OA 2DBBA 1LKZA 4LFAF 2VQFF 1IN0A 4NLPA 2W4DA 4F25A 3KUGA 1UAWA 4ZPTR 2AX0A 2IC3B 2VF3A 4OYPA 2YNFB 2AHOB 4DZ6A 1ZH5A 3L7UA 1NK9A 2UXDF 3D5MA 4A8OA 4DHVA 2F7VA 2HQFA 2L9NA 3DI6B 2RJZA 1Z1ZA 3QGHA 5HQ8A 2Z58B 3L9ZA 1OO0B 2Q3PA 1YQHA 1NDLA 2LEPA 3GPAA 2HQDA 4PR6A 2BQRA 2KFYA 1HI8A 2A2DA 3EGWB 4KV8A 1CC8A 4QQBA 1IKWA 7AT1B 3MR5A 2KKHA 3LGNA 4K8RA 2W7PA 1VK3A 2KVIA 4RBUA 4O4GB 4NX9A 4CLLA 4FXDA 1YBAA 1LK5A 3ILJA 1S0VA 1Q8IA 2FZCB 2A3JA 2N3OA 4F4KA 3HHLD 2M5YA 1RTHA 4LFCF 4KFBB 4LSLB 4NLVA 3SXLA 3IR5B 3CDBA 4F7VA 2WSEC 3VGSA 5J1EB 3Q8PB 4X2BA 1HI0P 3BO2A 3UD4P 1Q7LB 4NXMJ 1RAEB 4PAAA 4CZCA 2ZHBA 2MXYA 4LFCJ 1LWCB 5K8PA 4WP8A 5E41A 1RT2B 4KTQA 1VQ6S 2UXBF 1VIXA 1YJ9S 2B8QA 2ZNYA 1YX2A 2CVEA 5C25B 2W2MP 2HZVA 1MMNA 5EUHA 3CCMS 4USJC 2CAJA 1H2UX 3NP5A 2MB0B 4GKJF 3CIZA 3OFGA 1UTAA 4WK3A 1ITPA 3WX4A 3P96A 3W2VA 2UP1A 1T9TA 3CJ8A 1EARA 2XO6A 2QL5B 3AA8A 4PG4A 5KG7A 2WAQD 2YNGA 5DG9A 1Y9OA 4CCHA 4NXNF 3A8JA 5DQIA 2W2OP 2QFIA 2HHVA 4UQTA 3IMQJ 4H4MA 2F4FA 1RKIA 5DDRC 1FKPB 3NCRA 2X3GA 5KAKA 2N3LA 2W2NP 2OSRA 1I1GA 1P6TA 4DQSA 4XDCA 1OJ4A 1ICEB 4DV0F 1NRKA 3FEZA 2V4JB 2HFNA 2A0FB 3MR6A 1U2FA 2HRYA 2JVRA 1C2PA 3I0RB 4EK2A 4XIUA 2KU7A 2PEBA 2HKEA 2N4CA 4ED0A 4A8YA 2QMUB 3Q22A 3KJQB 1JJ2R 4QBUA 2W01A 1RB0A 2FGOA 1X4FA 1RT1B 3H5UA 5HLFA 3M6VA 3F44A 2OI2A 1B7FA 2ZD1B 1A0OB 2APOA 2FHMA 2C2DA 3K0JA 4LIWA 3Q8QB 1H2VZ 1D09B 2GQ2A 1WEYA 2W4CA 3MM7A 4J9OA 4JI4J 2WVCA 4TU7A 4YDDB 2XB2D 4YS2A 4OIXA 1JQGA 2ZITA 3FRYA 3SMZA 1RU2A 3TX0A 3V6KA 3QSIA 1LW2A 1HBUA 2W7AA 2E5JA 3IAS9 5KFGA 3CUNA 2C1EB 4DV4F 2YKQA 4DG1A 1Q86T 2HYIB 1RTJA 1DTTA 4ZDNA 5ITHA 1XNQF 1YK9A 3PYDA 3NCQA 5DQHA 2CWKA 2ZE2A 4AE5A 1BE4A 1VFJA 4C11A 2HIQA 1TL3B 5DLGA 3CD6S 3AHPA 1IJEB 2YKNA 2XY6A 2FVSA 5J2PB 2X7IA 4DV4J 5AXMA 4BDPA 3RAXA 2DNNA 2RSQA 2F63A 2R2SA 4ZLJA 3CCUS 2V8VA 3MHYA 5SUHA 1JB0C 4LR7A 4ANEA 4YUDA 2B9XA 2YNIB 1JLCA 4JI4F 4C4WA 3C6UA 2J9EA 2PSZA 2VPZB 3LOUA 2IMOA 2GHWA 4OZ3A 2Y1RI 4NCAA 1P8GA 2BKNA 3CD5A 3LH2S 1KHVA 2KJVA 1LEOA 3NMRA 3R3TA 5DM7Q 1NJYA 1FRLA 2GX8A 2I1RA 5H9EK 2FLNA 4DJBA 1CSJA 2CUYA 2B5JA 4BHQA 4Q0BB 4DS5A 4ZLPA 3LP2A 4A4JA 1CVJA 1EP4B 1JLQB 1UZDA 3LP1A 2MQNA 1IM6A 2J6SA 3MXHP 3EXYA 2OH2A 3L95X 1F60B 4NI2A 4QWEA 3I4PA 2VONA 3NNAA 2ACYA 2JX2A 1WSRA 1VQYA 3G6YA 4Y2MA 2NZ4A 3OT9A 1PC5A 3MEEA 1HYSB 3QWPA 1S4FA 1TL5A 2MZTA 2R7XA 5LSLA 1V5IB 3JTPA 3HJVA 3PIOQ 1QLNA 3BF4A 5JMNA 2B4UA 1NHUA 4IDKA 2GCFA 4MJKA 4NLTA 4RWXA 2I6WA 1RT6A 1SC6A 4ZOSA 1RISA 3KKFA 2DNPA 4M5LA 3R5GA 2CJAA 1FXDA 2V50A 3OTOF 4QU6A 4QCLA 4DL4A 1TMJA 4DCOB 2KB2A 3BR9A 4NPOA 5ETQA 5T41A 5KFJA 1JX4A 5HK4A 4USHA 2VQEF 4M5NA 4H4OB 2AEJA 4JI1F 4LF5F 3ICLA 4ID5A 2DH7A 1YRXA 3UVJA 2HHQA 4H4OA 2L48A 2RU9A 1NXIA 3OL8A 5G4DA 3UD3P 3U1MA 3GG0A 1UFLA 3QO9A 3CO0P 3KJVA 3SEOA 1AA1B 4J9RA 3BS9A 4OI4A 2DNZA 2YQ0A 3M1VB 2DR6A 2O01C 3DHXA 3IGNA 4M5GA 3BGOP 4OZ2A 2H5EA 5EX0A 3T41A 1CJKA 3BSAA 2OPPB 2V2KA 5DDOC 2LFVA 3H5YA 3VAKA 4DL5A 2W9CB 1KONA 1SH2A 2B4VA 3A12A 1E6YA 3DNCA 3CCJS 2GJ2A 4QIEA 4I0WA 4K5RA 3ZNJ1 2W9CA 2J8AA 1U49A 2GV1A 3FBCA 3Q8UA 2XLKA 4DN9A 1LXNA 1HIYA 2Y3YA 4TVAB 3I9ZA 2VOOA 2DHSA 4Q44A 2ADCA 4PWDA 3ULHA 2CPXA 4OYOA 4WJBA 4XDDA 4JV0A 2NXJA 4DV3J 3QT6A 3A8KA 5AJ3J 3QFWA 2M2BA 3GWCA 5E3AA 1IKVB 5CQGA 1XMQF 1IBLF 1IKYA 3AD9C 3GYNA 2MQPA 2UU9F 3BBCA 1N36J 4V1Ak 5F8MA 3HHKA 5C42A 2LQJA 3BO4A 1UWBB 5L8RC 1LWEB 2RS8A 4OYMA 2ZKUA 1RTIB 3TZZA 1S12A 1WHVA 4YB1P 1BUXA 2VASA 2ACMA 3B8HA 4Y2IA 1RI7A 5F8IA 2MLZA 2Z4PA 4QWDA 3JQJA 3KK3B 1VMBA 3TZWA 1VQ7S 2UXCF 1NUEA 1GH8A 1QVFR 2AMCB 4M5DA 2V63A 3EVOA 3C19A 3SCIE 3TJ9A 1B3TA 4UY85 1FK9B 5KT3A 1QSLA 1PAEX 3I0SB 5J2PA 1ZYQA 3GQCA 5KG0A 5LOQA 4Q8FA 5IOLA 4I2PB 2ZE2B 2MQLA 4NMLA 5IM0B 4ELUA 1JLBB 1NHVA 5FJ4A 1BMQB 4EMDA 1WC1A 2HQIA 2LDIA 2HFSA 2YNIA 5CYMB 4ZA1A 1X4AA 2KYZA 3G87A 4IUFA 4ED6A 2QJ3A 3PRVA 2A10A 2EFPA 3C66A 3JSMB 1T3OA 1AYEA 3Q0AA 3RW6A 2HG4A 3I9V9 4G1QB 2AF6A 2YWGA 2BABA 4P10A 1GT8A 1FDAA 5B0DA 2KTQA 2V34A 4Q7AA 4IH6A 4A47A 4HHUA 3T5LA 2G2ZA 4OQJA 4DL7A 2E9ZA 2D9PA 1SQGA 1EHWA 2EI5A 2XI3A 3DCAA 2OUGA 3T9ZA 1M5HA 5D0HA 2KT2A 1TQLA 2J9DA 1FRXA 1KHWA 3J7A1 1N52B 4TQSA 1V6HA 4OJHA 4TN2A 5F8JA 4PG6A 3GR1A 1R8CA 1H7XA 5D0GA 5K14B 5THWA 5F9NA 5DLFA 3DLEB 2CWXA 2QIFA 4K4WA 3C2PA 1JLBA 4PABA 1KSPA 2ZKTA 1RHUB 5D4OA 2AW0A 3PHTA 2HHWA 2DHHA 1O51A 1RWWB 1Y10A 1JK9B 2DGVA 1XQIA 2NSBA 2ZDOA 3MCSA 4KYZA 4LRCA 4F4XA 3AXMA 4TQRA 4A8FA 2IYGA 1QSYA 4B9UA 1P27B 1FVQA 4JI0J 1NK8A 1RQ0A 1S5ZA 3ZTSA 3GB0A 2ZFHA 4KR0B 3H25A 4HYKA 3LO3A 2UV8A 1RUSA 2VG6B 5KG2A 4IG0A 3KLHA 2LP4A 3NNCA 4TY8A 1QSSA 4Y00A 2YWHA 3DOLA 1Q8KA 3KLVA 1HQEB 2CQDA 3HHNB 2D9OA 3M1VA 5J2NA 2JL9A 2DPIA 2DNGA 1Y4ZB 2JVOA 1SV5B 3HVTB 3OVBA 4B9NA 3OL6A 4F2SA 3M2VA 1WHXA 4K5SA 3PYFA 2ALYB 4CLKA 3K5MA 2R8KA 2HNZB 1HL6A 1OPIA 2GHVC 3HD1A 4YHHF 2VJVA 1DZ5A 4CO4A 3M2RB 3M6XA 3J81U 3MUMP 4NASA 1VQOS 2HVIA 4BC7A 1AZSB 5EX3A 5GMKa 3DU6A 2FZKB 3FCVA 4KFBA 4LSLA 5B0AA 3A8IA 5HVFA 2GVZA 1YJTA 2AJ2A 2YX7A 4CLTA 3C6TA 2EFGA 4QYZJ 2MTLA 3GV5B 4ANDA 4DLGA 4NCBA 3W5XA 1HBOA 2ZOMA 1JLEB 2BJ9A 4Q45A 4UY8T 2LXFA 3HDSA 4IDKB 4E0DA 5KFIA 2HS3A 3TAMB 1J5EJ 1C1CB 2LVWA 4C8OA 4DN0A 2VJUA 2WSFC 4IG0B 3W61A 3KMSA 4K4SA 1IKXB 1PBUA 5BJRA 2CJ9A 2N7CA 1S9GA 2ZOFA 1HHTP 5BR8J 1VHIA 4A8QA 1PJ5A 2QLBB 2RKIA 1RTIA 3MAAB 4ID5B 1C0UB 2XSJA 5M2PA 3CCLS 1SC1B 4J7CA 3NMAA 4JV5F 2X3DA 5L1JA 1HWIA 2BOAA 4DR7J 1DQ9A 2DRAA 2DJWA 3K2YA 3H98A 4KPYA 1IQTA 2YTCA 4E8UA 2QFJA 1EZZB 3LALA 1NPKA 2V6AA 4P2FA 2BXJA 3I32A 1X4HA 4E98A 1RT7B 1SXLA 3KK2B 3D6HB 2CDRB 5HMXA 4OJ3A 3NLCA 3VAHA 3TW0A 3EZOA 1TKTB 1TL4A 4QIVA 2V68A 2G2YA 4CLUA 2Q1LA 1F9HA 3PG9A 2YKOA 2DRDA 4KY3A 1JIHA 2EEYA 2KI2A 4EYHB 1NK7A 2DR5A 1HNZF 4B08A 4C2MA 5F8HA 2LQ5A 3ZTPA 5KFMA 4CI0B 5T14A 4WK1A 5EWFA 1N4LA 1N6QA 4USVA 2FHJA 3P8BB 4DV3F 2VPYB 4FF1A 1GEHA 2OSQA 1VQ5S 5LMNF 2KZMA 4HDGA 4WE1B 2CQ4A 2YKMA 5A8WA 3SV4A 1UEVA 1C0TA 2B51A 2FTRA 2Z2YB 1IBMJ 1CJVB 2XLIA 2HHXA 3PACA 3ZFVA 1WSVA 1Q5YA 3ENWA 4K7QA 2KRRA 4K4TA 1WACA 2E5LJ 2FIUA 4NYOA 2XMKA 4FBUA 2WB1D 5CD4H 3QIPB 2HRUA 3DYAA 3LGHA 1G3OA 3DLBA 4J9SA 3UPFA 3IG1B 2MKKA 3M30B 1YI2S 1FKOB 1UKUA 2F4VJ 3MEDB 1RWOB 1T9WA 1NMEB 2B4PA 3FFIA 3FEXB 3MM6A 2LLZA 3JB9k 1DFDA 4D3HA 2IDEA 4C0BA 3TP2A 4C0HA 2K7KA 2YNHA 3UWTA 1NH8A 4DV5F 2FYXA 1U1KA 1NZAA 5JVHQ 1UW9A 2LA4A 2RIJA 2OIHA 3WHIA 2XGQA 5HLFB 2H48B 3KJNB 3NS6A 4RNOA 2V67A 2YX4A 2K3IA 2P6SA 1N34F 1RT5A 3AFGA 1T8EA 2DCLA 3VZHA 3GR0A 3RAQA 1QUPA 2GAHC 3MMJA 4ZPBA 2VKRA 5IM0A 4B17A 2UUCJ 2W2QP 4JB8B 4CTAB 4ECSA 1TTHB 1V3ZA 3ENAA 1V3SA 1MSWD 2WBRA 2CJYB 2KRBA 3IM8A 4I67A 3ZZPA 5HJXA 3RB0A 4X4VA 2BE2B 2UVUA 1UJ4A 4LR9A 4DS4A 5KFYA 3FQKA 3D3BJ 3WC2A 3TI0A 4L75A 4DWIA 1NU4A 4C97A 5DGAA 2C28A 2MQOA 3A3NB 3L3CA 2KFZA 2DGTA 1S59A 2KL8A 1DY3A 3IWXA 5F41A 5A6WA 2C2KB 3CO9A 3R7NB 1MWZA 1OSDA 4I2PA 3BSOA 2E9TA 3GFZA 4F4YA 3R6GB 2J9DE 2B8PA 2M8DB 3MPDA 2H3EB 3DRSA 4J9LA 1DTQB 1FJGJ 1U6ZA 3IAM9 4FPIA 2IJRA 3J7YU 4IG3B 1YKWA 1GTEA 4QW9A 3TOQA 3R1HA 3BQ0A 3PW2A 1K73T 4MIWA 4AYBD 4HT7A 1WELA 1REGX 5LT5A 1UPPA 1RHQB 4LREA 4TU8A 4NWBA 2ZVIA 3SBMA 5EWEA 4B3TF 4WZQA 1TVRB 2XZTB 4DZDA 4ALZA 5K8NA 2IA6A 4OX9F 4JUZA 3GIIA 3PZPA 4FVMA 2WONA 4NZ6A 1DTQA 5AXKA 2O66A 4NA1A 2G1DA 3PHEA 3OLBA 3N5FA 1RYRA 1R3NA 3CJ2A 4CO2A 3W9JA 1LWEA 3SQOP 2Q43A 4X4RA 4HLBA 2AV5A 1D8YA 3HHLB 3GYGA 2ZJPQ 3TUPA 1YJRA 3D6TB 3R7SB 1JWWA 1X4DA 3CD7A 5HBMB 5JUMA 2JEGA 1F0XA 2VG7A 3HVRA 2VUGA 3V6DA 1RTHB 2HHUA 2VB6A 1IBKF 2PC6A 3ITHA 4LFBJ 2FY1A 1HQ2A 1DLOB 2LKZA 2L9WA 1HNVB 4U96A 4EI2A 2R9LA 2KJWA 3OJUA 3FBBA 3NWRA 2UVRA 2RAQA 2J0XA 2VDIA 3JS9A 5K8MA 1IR0A 3GE9A 2OPRA 2EFNA 4CWBA 1PJ7A 2XHWA 5CH7B 2QSWA 5A8RB 2AGQA 4I6YA 3IN5A 3QFHA 1ZZFA 3W7BA 3SZ2A 2DNYA 2YNFA 4NLSA 4N47A 2HW3A 1FNXH 3RYLA 5LMUF 2AYMA 1N6QB 2GVZB 4DPYA 1HQEA 2D74B 3R2DJ 3R5CA 2I5JB 4XTTA 4DI6A 2F8HA 1FDBA 2DT9A 2IM0A 4HI1A 2C2ZB 2DD8S 4LSNB 5KFUA 1XMQJ 3H5XA 2QGFB 1IKWB 3HSDA 4NCGB 1IKYB 1YRUA 2NCKL 3G82A 1WC3A 3MAHA 4KC5A 1RT7A 2W4PA 1NLKL 3IG1A 2QSFA 3OFFA 4YHHJ 2DIUA 3OR1A 1H2TZ 3VTIA 4PQUA 2W9BB 1M0SA 1BLUA 5HP1B 1CC7A 1I94F 3H2LA 2GMJA 2J6UA 2F9JA 3MMBA 4WU3A 1U7LA 2UUAJ 3QRQA 2EC2A 4M5DB 3MR3A 5IT9U 2DNRA 4K4XA 2HLUA 3M9NB 1EX8A 1GX6A 1NPPA 3MI7X 1TL7B 2MLYA 2ZM6F 3B4MA 2LEBA 2B9YA 2DGWA 1B0VA 2KDOA 5F0UA 4LF2A 4ZN3A 1T3NA 1FRKA 1NSPA 3RRKA 2UZAA 2VQEJ 4DR7F 1FCAA 1N33J 3ILOA 1FDNA 5GMDA 5F3ZA 4X64J 3QGPA 3Q8VA 1LWFA 2B7BB 2BKOA 1HBNB 1HBUB 3CPWR 2RD5C 1S0MA 1WG4A 2OPQB 4MKYA 4PPDA 2XS2A 1DBDA 2EK6A 2YH0A 1UJ6A 4OI1A 3S1TA 3U1LA 3W64A 3K5PA 3WQPA 1Q81T 3RW7A 1S1XB 1R7IA 4U8VA 1HWLA 4LRAA 2MZ1A 2KN4A 5KFZA 4HH1A 4ZVHA 3ZZOA 4JI8F 1WC5A 4ZVUB 3BBBA 3PEJA 3KDNA 3R8YA 3JQMA 4BCAA 2BOPA 5IQ6A 3DYAB 4OX7A 1QAYA 3P5TL 5KFHA 2I0XA 1BWVA 3DRYA 4FZVA 3SFGA 3HVWA 4Q2LA 3WIVA 5L1KA 2WOMB 2DNKA 4HACB 1R27B 2AD9A 5D0RA 3KLHB 3KUHA 1SC4B 2JEIA 3X1LB 2FLPA 2IM1A 1JKHA 1C0TB 3BH6B 2ABYA 4L76A 3IBWA 3IS9A 5C7PA 1VQ4S 2WB4A 1Q4RA 1Q5VA 4G6VB 3HM9A 3PVXA 5F8NA 1Y5LB 2QO3A 1RCOB 4O3NA 1TU0B 2M9KA 2JWNA 8ATCB 4Q43A 1B0PA 1XNRF 1B0TA 1HWUA 4ZVSB 5B0CA 5KFOA 1U1NA 3OLAA 2GJIA 2LXUA 4OV1A 1FRMA 3Q89A 2HNDA 1QUVA 3KLEB 3KHRA 3NKYA 3ONQA 5KFSA 1WC6A 1S6PB 2M0GB 1RT3A 2MKHA 4NLDA 3GLJA 4P73A 8RUCA 4CQ1A 3T5KA 1VBZA 1F3FA 4ECQA 1UWAA 1N33F 3TWZA 1DHMA 1K1SA 2DGXA 2RHSB 1LWCA 2Y1IA 1U48A 4L73A 4JI3F 2HQGA 2WCXA 3EGNA 3MM9B 1KOOA 5IV3A 2JRSA 1X4EA 3OPKA 1FWLA 3C14A 3OSNA 2DO4A 2IMWP 5DZ7A 3G96A 5CHCB 5C25A 3K5NA 1NJIT 4LF8J 3VV2B 2BV3A 1RAHB 2JHEA 3W3SA 4F0KA 2HNDB 3KLEA 4ILLA 4J9KA 4OJ1A 1XBWA 4PZVA 4V19X 2B0GA 4R25A 3E51A 2FVPA 1KVKA 2JDJA 3CCTA 3ILIA 4RR5A 5FDLB 3UI3A 5HL7Q 3SIPB 1HR0J 4PUOA 1D1UA 4USTA 4DV0J 1Q78A 3VAIA 4H4KA 2BEFA 2G0CA 1TUGB 3D4JA 3P5BP 1H98A 3S7RA 2VBYA 1HD1A 2EC0A 3GFHA 4NA2A 1YBUA 1ZA2B 1W25A 3CDWA 3TJAA 4DV2F 3F56A 5DM6Q 2OEJA 3DLJA 4HKQA 2OO4A 3HT3A 4KV8B 1DQ8A 3HI9A 1EKSA 3E3XA 1VC5A 1KQFB 2CRLA 4ECRA 2XYPB 3CVKA 4O44A 5K8OA 1SQFA 4M63A 5IWAJ 1D3WA 2P2CB 4OYAA 2EK1A 3PDNA 3QO9B 3D7SB 5GADU 2XMJA 4CH7A 2CADA 1U1LA 1C1BA 1N0VC 1FTCA 3G71S 1ZM2A 2PMWA 2ZH5A 1CJUB 3GCWP 3VGVA 1REVB 1NKEA 2DKOB 3LWMA 1OY9A 4U6PA 3D54A 2XMTA 2KH9A 2YWKA 3O1LA 5I4MA 2W9AA 1HNXJ 1Q8BA 1Q8LA 2VBZA 2ROEA 4KHRA 1YJWS 4PYDA 4I2QB 1VCTA 3KMQA 1X0PA 3MM7B 1FERA 4QPTA 4CLSA 3DOMA 3TAPA 2RF2A 4WCEQ 1VI7A 2R7TA 1O0PA 4NYPA 5ETSA 3DOMB 2F1FA 3VGTA 2MZQA 2V4QA 4DR1F 4MKAA 1KEKA 2W9BA 2HHSA 2HFOA 3W9HA 5B0EA 1SKWA 2M4MA 2XI2A 3JAMU 2YQ1A 3MPYA 1GMWA 4PXDA 2HVHA 3W62A 4FKYA 4ZK7M 3UDLA 3A3PB 1U09A 3EJMA 1O8BA 1ZAWA 3E8OA 1VBKA 4I2QA 5D4LA 3TEGA 1M90T 1WF1A 4NXMF 4FF2A 4ZVOB 4P75A 4ZJLA 3KLGB 1EAYC 2M88A 3N6LA 3W2WB 4DFMA 3BSCA 1RT4A 2DNMA 3R5AA 2XY5A 1V5VA 3AB2B 4DSEA 3S6EA 2CQPA 3SCJE 1PYOB 3FRZA 1UPMB 4KHMA 2KM8B 1RLCL 3T1HJ 4F04B 1MWQA 2QYGA 4ZHRB 3KUEA 3AOAA 4OZNA 3VVUA 1DTTB 2YBVA 3PW4A 1GTHA 1SVDA 4O3OA 3EZ5A 3KK1A 1RK8A 4P72A 2IBKA 3RB4A 3LF0A 2MGZB 5H9EJ 3IR6B 1DRZA 1VC6A 4UUWA 2FVQA 2WK4A 1SL0A 4OHZA 4LVOP 1S7IA 2HWTA 1K0VA 2UXDJ 3CC4S 3AAWB 3OSPA 2D7SA 1XNRJ 3T1YJ 1H73A 2DY1A 2OTLS 3M30A 3RRGA 2BJ7A 4K59A 4YB7A 3MUVP 2ZWOA 1SJFA 2OPSA 4CH1A 1T03A 2I8EA 4B3RF 1XR6A 1JLFA 2AJ4A 3BB5A 4FVCA 3BDEA 2FPHX 2BE2A 2HGMA 2MJUA 1U1MA 3DMJA 5KT6A 2J5AA 3UO0A 1OYEA 1WOOA 1XNQJ 2WOMA 4HACA 4IOAQ 2B6AA 3T1YF 2JOQA 1TL3A 1HHSA 1L3TA 4C8MA 5KFLA 5KFFA 5KT5A 5LM7E 3N01A 3KLFB 2KO1A 1SKRA 1U02A 3PIPQ 4WKYA 4GC7A 1X9MA 2ZOGA 4KBIA 1VQ9S 3W63A 1FX2A 5HI7A 5M2RA 2BE7D 4DXLA 3CC2S 2GVDA 1H3DA 2M7SA 5DRKA 2DK2A 2RE1A 4CO5A 1FFGB 2ZJQQ 4RW9B 3IA0A 4B3MF 1Q53A 2VL1A 4ATNA 2ATLA 1MN7A 3N9UC 4EO6A 1XJWB 1Y3JA 1RAJA 1SI9A 3D0IE 1HBMA 1R6YA 3DU5A 2XULA 3M05A 3N28A 2XQCA 2BQ3A 1LWFB 2G0IA 4WXWA 1HBMB 1ZOTA 3CTRA 2JC1A 2LXIA 3BEGB 4ZPDA 3Q2TC 3A8EA 3BM7A 4OMFG 3KLFA 1WC0A 2L41A 3B6BA 1WEXA 1S9EB 1B70B 2IM2A 4P2MA 3CCSS 4O3PA 4ZVEA 4DEZA 1S4EA 1T94A 1X5PA 2W2PP 1L5UA 4ILMA 1FE0A 2CPFA 4DSLA 2J0WA 3MOZA 2COLA 4HI2A 4KT0C 3H5SA 3IBFB 2EFOA 3HHDA 4QIFA 3KK2A 1JLFB 3UCUP 3MM5A 2YPZA 5B09A 4CM2A 4X66F 3VALA 3PO5A 2UUWA 1UA1A 2A6OA 2CPJA 1OY8A 2B6AB 2LDYA 1NB2A 5IV4A 1FNOA 5DZ6A 3OHBA 2DISA 2BJDA 3BQ2A 1VLYA 1NJXA 1M1HA 3AODA 3WBZA 2W8LA 3V6HA 4IR1A 1S9EA 3T5HA 2V8HA 2VHGA 4EWTA 3W2VB 5A6PA 4WFBQ 2ZBCA 3UW1A 2CFXA 1MNEA 1ZPWX 1B7YB 2DNQA 1DLOA 4DX8H 3UNGC 1Z2LA 3PKYA 2CJXB 3C6TB 3OL7A 4GKJJ 1NDKA 1UFKA 2R42A 3DXBA 2ZH8A 2KVQE 3R97A 3CJ0A 2XYHB 1U45A 2FVRA 3CDEA 2BQUA 3JYTB 4WFAQ 1UVIA 4AXJA 4AD6A 3MECB 2V8GA 4RW8B 4N41A 1TUWA 1ZAXA 5AT1B 3EDQB 5ETNA 3D1QA 3MAAA 4M5IA 1WUUA 1HQUA 2YQ3A 2VFVA 1RKJA 4YB6A 2XNRA 4KPCA 4R8UB 4ICLA 2W8KA 2QA2A 2RDJA 4AQYJ 5E33A 4I6WA 4QWCA 5H9FK 2V8DA 1NKCA 4HT5A 1LW2B 4DV2J 2Q79A 1WNEA 3NNHA 5B08A 3JTNA 1YRTA 2VZ9A 4K4YA 3PRDA 4EEYA 3GFXA 4OFZA 4XO0A 1UWBA 2ZHOA 5CA5A 4DR5F 3CDUA 1FF2A 1LW0A 3DLGA 3IRXB 2AX1A 3EE3A 5GVQA 5IWAF 2C2NA 2AKWB 1F5CA 1BD6A 2OGUA 3M6WA 1YGYA 4FNHA 4YR0A 3GV8B 4K50A 4GVLA 4M5JA 4OX6A 2XMVA 2V5HG 3WX8A 1PGZA 1L3KA 1QAJA 1UP1A 1M5OC 3FVYA 1S77D 2QZ8A 3PJXA 4ER8A 1KD1T 1P9QC 2CJBA 2QYCA 1VQLS 3LP0A 1CJVA 2RUSA 4KE5A 3TR5A 3B78A 1MROA 2CKWA 2HWIA 2KHCA 2QE5A 1VS3A 1XR7A 3R7BB
chains in the Genus database with same CATH topology
2RH3A 2FHKA 4KJIA 2DGQA 1JMTA 1S6OA 1V3RA 2O3DA 4PG7A 1IXKA 5F9LA 5DG8A 4LF9F 4RUCA 2HPUA 2RKIB 1XEZA 5BR8F 3ZZ0A 4A8XA 1CPZA 4A8MP 4CO3A 1TKDA 3QGGA 4IRCA 3J7ZT 3H40A 2OFHX 2P9EA 3MD1A 2V0NA 4YDXA 3QZ7A 4ECVA 4NZ7A 2JH3A 1M5KC 3DLGB 2G13A 4QIWD 4TY9A 3NRBA 3BZQA 2HAIA 5L1IA 2G4BA 3X3UA 3DOKA 2DNHA 3OTDA 4ED8A 1ZTTA 2Z8QA 1QJHA 3MUTP 3TQ1A 4RZRA 1TKZA 5IFMA 2XCAA 2JEFA 4DQIA 1OSCA 2EG2A 4PXBA 3T6JA 1XC9A 1FJEB 2KM8C 4ZPAA 3BGLA 4DBQA 1U6FA 3UE2A 2YKNB 3VR1A 4RNFA 4C11B 5KT7A 4DL3A 3MM5B 4ETZA 3MURP 1JNZB 1FRIA 3KHGA 1Y5NB 1XN9A 4NLRA 4PPZA 4R5PA 3T5KA 3VCDA 3AA9A 1JLGA 1N5VA 4C98A 1HNWF 3MOJB 1GX5A 3SDEB 1S1UA 3FSXA 1CEZA 4C8NA 1A6LA 2C3UA 3ENVA 5T7LB 2R7RA 3C46A 3QAEA 2KT3A 4HH0A 4WZQA 3BGUA 3PX6A 4WTYA 5I3UA 6FDRA 3CDAA 4NLWA 4ED1A 4NRTA 1NAQA 5I42B 1MMDA 2HVZA 4KO0B 1Q16B 2RT3A 3J81Y 2HLTA 1TVRA 2ZVSA 4QIGA 4YFUA 5M2UA 2LEAA 3UDCA 1JLGB 3SQGB 4G3IA 5KG1A 2AJ0A 2PA3A 2KT5A 4I68A 2VC0A 3FSIA 3QWUA 3OBIA 1BQMA 2YY3A 3PRBA 1J5OB 1T03B 4U67Q 3B82A 4KGMA 3MM8A 5L38A 4LF4F 4BC9A 2AU0A 5FIIA 1A7GE 3R27A 4LF6F 3G6ES 2DHGA 2KHDA 4WIIA 2GHPA 5KFVA 3CCQS 1WEZA 3NG8A 2NPFA 3V81A 2NPIA 3MTJA 2MMYA 3THVA 1BC6A 1AROP 2P9CA 5K9FA 4ECYA 2XMUA 4ZVFA 1X5TA 1WHYA 3NBPA 4O0IA 2NYIA 5MLCV 2XS7A 3HZGA 1XMBA 3G86A 2E44A 2I9SA 4RNHA 1HNIB 2P5VA 1BGXT 3PFOA 3MAQA 4A8WA 4WYWA 1P1TA 2IRXA 5J2MB 3A1YG 4WFZA 1S97A 4ELTA 2DH8A 2CPHA 4L3NA 2RMLA 3JSMA 3CMES 2EFQA 3I0SA 1FA0A 4RNNA 2OMLA 1WG1A 2MKIA 4EYIB 3OL9A 1DJ0A 4QR0A 3B4DA 3K58A 1SJRA 3QLHB 1VOMA 2R8IA 1S0OA 5CCLA 2ZZNA 3HZEA 4B02A 2L08A 3GIMA 3IO1A 3TVZA 3FFIB 2NS1B 2WSCC 3TA1A 5H9FJ 2DHXA 3ZC4A 4RU9A 4ZHRA 1KFSA 3EXCX 3AJ2A 4C0OC 2LCWA 3M8QA 2PN6A 4DR3F 2FJXA 1ZM3A 3I5CA 1X4BA 2V4RA 3IRWP 4LVNP 3DLHA 1X4CA 1R8BA 1UVJA 4GMKA 1Q7YT 3W2WA 2V94A 2C3PA 2YWEA 5C24B 3PR5B 3KFWX 1G1XA 3HKZD 3UR3C 4PXEA 1C1CA 3KLIB 2DIVA 4PG8A 2PA8D 3IGVA 2LECA 5DJBA 1S9GB 4JI5F 4UOCA 1U1OA 3PKMA 4IRDA 2JZ5A 2HGLA 2B43A 4X4TA 3SYZA 4OZLA 5HMYA 5EGYA 4DV1F 4TXSA 1M5SA 1X0FA 3MZIA 4FXVA 1KRPA 1S1XA 4F26A 1VQKS 3CULA 3ISZA 2PD1A 4ED2A 1QTMA 1TZ0A 3MPVA 5CYQB 1XWLA 4JI6F 7FD1A 1LQ9A 2XCPA 4DFPA 3DRXA 4NRUA 5CYQA 6FD1A 2MY7A 1N88A 4R0EA 2ZHAA 1WWHA 2G9OA 2DRBA 5BYSA 2XO7A 2V9KA 3ISNC 1Q82T 4MFBB 4GC6A 2DHAA 1OIAA 5GAEI 2JLFA 2EBGA 2IC3A 4LSNA 4Y28C 3KG0A 3TUIC 2FJVA 2UUCF 3NMAA 2BDPA 3T9NA 2FHOB 2F40A 2J7UA 3TO8A 3GIKA 1QVGR 4QZVB 3D0GE 5LJ3Y 4RUAA 2EW9A 4AL6A 1S1TB 4AL5A 1MMLA 3CMAS 1J5OA 2HZCA 3V2UC 4HTIA 4M1KA 4LIRA 2N82B 3KK2B 3M8SA 2V4JA 3LQVA 1JNRB 1M5VC 4A8KA 4C8LA 1TV6A 2FD2A 4RW8A 3M8PA 4RX6A 3MR2A 4IOBA 1R8AA 3HHLC 4NLQA 1U6BA 1TKXB 1FEEA 2CPIA 4ES2A 1AFJA 5IT9Y 1K1QA 3OVAA 1IJFB 4DSIA 3NCPA 3ZZTA 4OZ0A 3RTVA 4OHWA 5EDWA 1VIOA 3CIMA 2ASLA 1HYSA 5AXNA 2ZH9A 1SH3A 3OTCA 3TA0A 3GG1A 4Y3CA 1D9AA 3O2IA 3BN4A 3K59A 1TV6B 4P7TA 2ROPA 2J7KA 5K14A 4I64A 4FF3A 2FJBB 3QIDA 2H9ZA 3DC2A 2GNKA 1U1PA 1DQAA 4ZP6A 2QA4S 4JV2A 4B3OB 2XWYA 3MEGB 4KAIA 2E5LF 2DGOA 2AJFE 1O5JA 4XPCA 1SBRA 1S9FA 1L3VA 1FESA 5IT0A 2BA9A 2K7JA 3N4WA 4BBYA 3VAFA 2L9DA 2LU2A 3HXMA 3DM2A 5I3QA 4MYUA 4D3GA 1S6QA 3RBDA 4ZP9A 3K8WA 3MF5A 1PC4A 1HWKA 3PEHA 4B9SA 1NEEA 4RW7B 3MDFA 1HD0A 2FJWA 1WF2A 5GAHU 1N8RT 3H59A 3IRXA 1N36F 2E5HA 5B0BA 2X51A 1S1UB 2IRUA 2JC0A 3M2UA 3N79A 2YKPA 2FLLA 5AJ3F 3TNVA 4JYAF 4F4ZA 4DF8A 4RU2A 1K9MT 2HMIA 1SUQB 1C1BB 2A2CA 1U8SA 2LMIA 1QAXA 3CJ5A 4ZCKA 3OFHA 2UVVA 1WF0A 1GAOA 1S6QB 4I56A 4AUKA 2CQGA 2ZUGA 4MK8A 4EBCA 2NUUG 1VGYA 3QAUA 5LJ5Y 1U1RA 2OPPA 3M9OB 2DR8A 2HNYA 3TVYA 1TK0A 4N56A 1N48A 5HP1A 5KFEA 4RNMA 1G2EA 1FHTA 4OLPA 3KK3A 3THTA 4WU2A 4ZS6A 3E01B 4IH7A 2EKYA 5A0YA 1M1KT 4NOHA 1LOUA 2D3OR 3AJ1A 4NCGA 2BW2A 3RAMA 1RT1A 3BGRA 3RRHA 4ID8A 2X1AA 1R8HA 2RF2B 1KTVA 3Q23A 4N8NA 4N76A 5GAGU 2D3UA 5FLXY 2GA7A 3PW0A 3TX8A 3GFYA 4EUVA 2A1BA 1RGVA 1N54B 3T19A 4OZJA 1OQ3A 3DLLQ 2PIIA 4IQXA 4ERDA 4C3MA 2PFFB 5BYRA 5JVGQ 1RA7A 2N7YA 3PW7A 3K57A 5J2MA 4QU7A 2CQ2A 1S72S 1IKVA 2JJ4D 1RDRA 4KKOA 4J9NA 1HI1A 4DR2F 2GIRA 3CD0A 1U4BA 5CZXA 3L7OA 4W90B 4IO1A 1D8ZA 3HPOA 3M8PB 1RWUA 3D0HE 4Q2MA 1HW9A 2BJEA 4CT8A 2YVSA 3AY0A 3HLUA 2E1RA 4C3LA 1FD8A 3T6BA 1GNKA 1VRTB 1VHFA 4I4BA 1TR0A 1RTDA 4FNIA 4TLRA 4DUZF 3DLKB 1SIZA 4H54A 4ZPWR 5G0RB 1ZBTA 5HN0A 1HR0F 1IM4A 2R2RA 1HNVA 1K8AT 3T3FA 1D9DA 2E1AA 5EWGA 1BQMB 3SCKE 4DFKA 4EZ9A 1VBYA 2ILYA 3I5AA 5DDPC 2UV8G 2C2EA 2FGCA 2HWHA 3F73A 5L9XA 1HBNA 1JJHA 3PY8A 2GO9A 5I42A 4Y2KA 5KG3A 1FRJA 1U2RA 3AH6A 3D28A 2ZH3A 2OTJS 2CQIA 2ZNZA 2C42A 4NYZA 4ED5A 4TYAA 1XMOF 3J80Y 2AP6A 2C3MA 3GIJA 3M2RA 1TK8A 2EWHA 4IH5A 1QY7A 1JLCB 3MGJA 4X4OA 2QT7A 1X5SA 3PX4A 2C3OA 2E5IA 1FXRA 2J6TA 3EX7B 5LSOA 3MM9A 1UVKA 3LUYA 4NLUA 3SCLE 1NB7A 1KVIA 5AE3A 2ADBA 5CXTA 1YJVA 1VRUA 3M8QB 2IYIA 4PG5A 2OD4A 3RB3A 1F9FA 3KWMA 2AWZA 3I87A 2ZH4A 4JBCA 1S7HA 3TRGA 2BACA 4FS1A 2BM1A 2MY8A 1S99A 4IRKA 2C2RA 4X4SA 2E1CA 2JLEA 3U1NA 4URSA 1QAIA 1BY9A 4FYDA 1HD1A 4IYQA 2KG1A 4EU0A 4ETXA 4ECZA 1NK5A 3CCVS 1KOHA 2IAJA 3BDPA 4U7UK 3OUYB 4DPOA 3GV7B 2ILZA 3M2UB 1KTQA 2J0QD 2JSXA 4PWDB 3LWLA 3VAGA 2GQQA 1REVA 2B3TB 2J7WA 5IT4A 4CO0A 5A2QY 2PMZD 3PXGa 4DR6F 2QLWA 4QW8A 2M52A 1ZAVA 2VG5B 5LXYA 4MH8A 3QPIA 2BUNA 4URQU 1KLMB 3DM2B 3MD3A 1E6YB 1MW7A 3FNNA 1UEUA 1R43A 1RT2A 2B9WA 4AFFA 2E9RX 3ZZRA 5JXSA 3OJSA 2P9GA 4DSKA 2LA6A 4Y65A 2W7OA 4ZPVR 3EPIA 2VG6A 3DRRA 2RU3A 2F3JA 2ZH6A 5KFAA 3ITHB 1T02A 4YB5A 2R4FA 4MFBA 3QYYA 3G8TA 1X7VA 3LP0B 4MKBA 2R7QA 3GZ7A 2WW8A 1FKPA 5BYQA 3DRPA 3M9MB 3RR8A 4CO1A 4F3MA 2Q66A 2DGSA 2OFGX 4M95A 2BRKA 1NK0A 2BM0A 2OMOA 3DFEA 3I0RA 1RYSA 1NK4A 3SSRA 3GYXB 4ZPCA 4J9QA 5L1LA 1S0NA 4ECXA 2QLXA 3FEYB 3MMBB 5DETA 1JLAB 3SFUA 1URRA 3DLKA 5G0RA 2UUBF 3L7PA 2F8MA 4OZ1A 1S6PA 1UA0A 2CQHA 1VRTA 2FVCA 3FZBA 5AXLA 2CPZA 1OS5A 4NLXA 5IS2A 5KFKA 5CZVA 2GQCA 3DOKB 3CCRS 3DHWC 4K2XA 4G1PA 1DURA 3ETOA 2NREA 2Z2LA 4DL2A 2RQKA 3CGIA 3IR7B 3UCGA 4N77A 1H0HB 4DV6F 3BN7A 4RBTA 3TARA 1G7CB 2BZ2A 1NKBA 1G6BA 3JSRA 4GKKF 3BR8A 2X1FA 1FO1A 2WRMA 1SV5A 3HVTA 4GO7X 1KQKA 1HMVB 2VD3A 4YOEA 2VC1A 2HNZA 1HPZB 1U24A 3KLGA 4O4RA 3FJ2A 3Q8SB 3J7YI 1IUJA 3PW5A 2LYVA 1F5BA 2LQBA 4N8OA 1KC8T 1KS2A 4DG1B 1SH0A 2XWXA 2XS5A 2I2YA 2FUG9 5IQQA 2HMIB 1SL1A 2ZC4A 2ERRA 1BQNB 3OR2A 2IVYA 2BANB 3P3DA 3T1HF 4I7FB 5B0FA 3FDSA 4EGLA 3I96A 2Q6CA 1JJ4A 2R2UA 2DO0A 4KKOB 4FN5A 1GXUA 4CT9A 1AUDA 3TUZC 4WFNQ 3QIPA 4CH0S 2VH7A 1QE1A 4PRFA 2CYYA 1N56A 1T05B 1X9SA 1OPZA 2PE8A 2CPDA 1EETA 2DPJA 3TVKA 2RDIA 3KTQA 1ZM4A 1N5SA 1URNA 2KFNA 4DL6A 4BWMA 4KQZA 3MEGA 4QJVA 4TNOA 3MEEB 4KIAA 2BRLA 5KFPA 4OHYA 4LJMA 4Q0BA 3VWSA 4YR2A 1JXLA 4I69A 1VQ8S 2QRRA 2DNOA 3SQGA 3UFCX 2K8GA 1LFPA 4DQRA 3JSYA 4Q8EA 1SIWB 1TKTA 4F8RA 1S1WA 3NBPB 3F41A 1XK8A 2MHEA 1TP7A 2E1MC 3C6UB 1E6VB 4Y2CA 5MAOA 3V6JA 2VFSA 3ISND 1HNXF 3QMQA 5GAGI 4YEAA 1KFDA 4YMEA 1BWEA 3IFEA 3OXFA 4J37A 4EBDA 3OTEA 3RZAA 2PO4A 3CC7S 4EZ6A 4LUBA 2HHTA 2RRAA 2EPIA 3J7Z5 1S1VA 2YX1A 3VQSA 2MHNA 1H38A 2F4VF 2MQMA 4A46A 5IZHA 4PKDB 3LAMA 1KLMA 3VAMA 1A9NB 4EO8A 4O44B 4DL0C 3SI8A 2OPRB 3CCES 3BJYA 4KRWA 1B64A 1T95A 2IJNA 3DN9A 2LU1A 4URGA 3O5TB 4F3QA 1VJWA 1OQ6A 1ZM9A 2C3YA 2OPSB 1TFYA 4KO0A 2VV5A 2YKMB 1F5AA 5A8WB 2RRNA 1Y3KA 1S1VB 1U26A 1SJ4P 3M4XA 4V19J 2AYBA 4X62F 2YNGB 1L3SA 1BQXA 1LFWA 3PNIA 2Q6BA 4H4MB 3CEDA 3O3LA 2KXHA 3ZZYA 5DS7A 3M32B 4YR3A 3D1OA 2E5GA 1FKOA 3CWJA 3I56S 1VQMS 4ZP8A 2ALZA 4XK8C 2DCUB 5KFQA 3P49B 4F02A 4J5OA 3O8WA 4OL8A 2OD6A 1AXQA 2I5JA 3KHHA 2JEJA 1PO6A 3DGPA 4WZMA 3PO4A 2AYEA 1RP5A 2NUHA 2UUTA 1NO8A 2E66A 2B7CB 3KG1A 4KSEB 4C8YA 4NZ0A 1MROB 1J5EF 3H2UB 3KNAA 3HF5A 1SQEA 3H8YA 2ZH1A 1VK8A 1X9WA 4RW9A 4HDHA 2IM3A 1H6KX 3IWLA 3WDOA 3AQPA 4WYLA 4CNYA 1FE4A 3FCHA 2DGUA 4DQPA 4RUHA 5KG6A 3O6QA 2F8EX 3GMGA 1N5YB 3GILA 1JKHB 2U1AA 3THPA 4LFBF 1BQNA 3OR2B 4ZP7A 1VRUB 1Y5IB 4R5PB 3OVSA 2NLWA 1CQMA 1U25A 2KXFA 4IQMA 1AFIA 2GMHA 4FP9A 3KG4A 2OKQA 1TL1A 4NLYA 5F8LA 1Z2ZA 3BREA 5HMZA 4DV7F 1VQPS 1N5TA 1JLAA 1ZPVA 2IVMA 4DQQA 1TK5A 5SZTA 1RTDB 2FLOA 2NQPA 2M8HA 2CZ4A 3MPWA 3G6VA 3DXSX 5KOWA 1C4CA 1UMJA 2CPEA 2PMHA 4FPRA 5LL6d 1EP4A 1JLQA 3M8RA 3NS5A 4JI0F 4IOCQ 1KNZA 4X4PA 2KZZA 4MAKA 2CQ0A 3LPYA 4F67A 3EUNA 2Z2MA 3H4BA 2ZBIA 1TFWA 3HO1A 2IVFB 3VF0B 5F8GA 1FJGF 1R89A 4PUOB 3FMWA 5D8HB 2QA4G 1MU2A 2RB7A 1DAXA 2K1RA 4EFAC 1KN6A 3HX9A 2K1RB 3N6NA 4AL7A 4ECWA 2IFXA 3L09A 4I6AA 4IFVA 5E3QA 4F3OA 2R7SA 5HMWA 5D3GA 2FDNA 2HFZA 3V4MA 1Q1KA 5K5MA 3FQLA 4PXCA 3S8SA 1JLEA 4MIBA 2OLWA 3RR7A 4PWUA 2O67A 4B9LA 3LP1B 4FF4A 4RW4B 4DDFA 3CB4A 3DLEA 1SUQA 3SSQA 2MZSA 2UUAF 5J1NA 2RQCA 3SSSA 4TU9A 4X84A 2R2TA 1UVNA 3MMCB 1NJWA 3FSYA 4HTJA 2C22A 4X65F 4LF7F 3MMCA 2VKZG 2DITA 2VPWB 5JJBA 1FT8A 3KNGA 4RW7A 4LT6A 2M3DA 2E7XA 4ITSA 5A8KA 1UL3