5LVNA

Human pdk1 kinase domain in complex with adenosine bound to the atp-binding site
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
284
structure length
283
Chain Sequence
KKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARANFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bidirectional Allosteric Communication between the ATP-Binding Site and the Regulatory PIF Pocket in PDK1 Protein Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-phosphoinositide-dependent protein kinase 1
total genus 88
structure length 283
sequence length 284
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lvnA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lvnA01
2GNFA 3FI4A 2Z8CA 4FSZA 3RCJA 1DAWA 2RG5A 4O27B 3OC1A 5E7RA 4L43A 4ONAA 4JRNA 3AT2A 4BTJA 5L3AA 4TYHA 3ZSGA 4GVJA 3ZUTA 2UUEA 4FF8A 3EJ1A 3OY3A 4XS2A 4CZYB 4FV9A 4KNBA 2CLQA 1IEPA 4XG7A 4TWNA 1P4OA 2X7FA 4CFXA 2OO8X 3DZOA 3FWQA 4RC2A 4DG2E 2R3FA 4ZTNA 3CQEA 5HO7A 3W2PA 4Y95A 4IAKA 3Q4CA 4P7EA 3JR1A 5CF6A 1M52A 4CCUA 1K2PA 4W8DA 3LFEA 5HNGA 1Z5MA 4OTIA 3LQ8A 4FV5A 4JT3A 3GCSA 4ZSGA 3EL7A 4YTCA 4ZJVA 3PJCA 3ZFYA 3CBLA 5LVPA 3JS2A 1ZLTA 3A7IA 1ZMVA 3MY5A 4H3QA 3SX9A 5M4IA 2CN5A 1YXXA 2ITPA 1OL7A 2GQSA 2OJ9A 5DMZA 3NRMA 5IISA 5FDPA 2O63A 3AGMA 4ENYA 1ZYCA 3BU3A 5LMBA 3B8RA 2XF0A 4EH3A 3TUCA 4LRJA 1KE9A 3Q3BA 1YQJA 1S9JA 4KSQA 5BVOA 2G2FA 3Q96A 3Q4UA 4TYEA 5FUTA 3AD5A 4I23A 3NUAA 2P2HA 1GAGA 4EEVA 3PA4A 3PJ1A 3I5ZA 3VQUA 2C0OA 2WQMA 1ZOEA 4PMMA 3FHIA 5CU0A 5KKRB 3VO3A 3WF7A 4PTGA 3LXKA 4RPVA 4MNFA 3FL4A 3QZFA 2HCKA 3VBYA 4E1ZA 5ANDA 3JVSA 3DXPA 4FTTA 4RIWA 2O65A 4FG7A 3PUPA 4HGTA 4CZUA 4YTFA 1JOWB 2X0GA 4I4FA 4C36A 5DRBA 4AOIA 2YWPA 3HA6A 3KK9A 3UGCA 4UYAA 4HYHA 3FPQA 4YUQA 4FIHA 2ZB1A 3GP0A 5BVDA 1FPUA 3AD6A 3ZLYA 1JVPP 3IG7A 2DS1A 4ZXTA 4F0GA 1GIJA 3L9LA 2WQNA 3QTQA 3FZTA 3L9PA 5M56A 4FODA 3MBLA 4TT7A 4CD0A 3QC9A 3G51A 5C8NA 5HG9A 3RP9A 3LLAA 4RJ8A 4BDCA 1Q61A 2Y0AA 2I7QA 5KMKA 2Q83A 3GC9A 3WIGA 1O6KA 5GJFA 1KOAA 4O7WA 3D15A 4FTAA 2BZKB 2IJMA 2UW8A 3MPMA 2AC3A 2C47A 4GKHA 1HCKA 2X9FA 5DLSA 3UBDA 2YWVA 5T3QA 3UZRA 5A4LA 4W4YA 4QQTA 4UX9A 2C1BA 3WE4A 2F7XE 2HENA 4FSRA 4FYNA 1E1XA 5CI7A 4YO6A 3UYSA 3KXZA 2C0IA 2ESMA 2W9ZB 4WO5A 3UG1A 4C59A 4S33A 3T3UA 5IA2A 4PNKA 4DFLA 1YDRE 4YU2A 3OCTA 4JOAA 5EH0A 2UZBA 3CGFA 2C6TA 1H1RA 4O84A 3IW5A 3ZYAA 4FKTA 5B7VA 4QYGA 3G2FA 3EQFA 2O3PA 4AOTA 3SXSA 4RQKA 3VBXA 4NFMA 5C4LA 1QMZA 2Y4IC 1SMHA 2XK7A 1Q3WA 4X3JA 4DEGA 2EVAA 2ZV9A 5E8WA 2H8HA 5HVKA 4DCAA 4HYUA 3LFFA 4QO9A 2YFXA 2FSMX 5HVYA 3DOGA 4NKAA 4AA4A 2XIKA 4XMOA 4FTQA 3HP2A 3RKBA 4F9BA 4ZZOA 1U46A 3ULIA 4TNBA 3S2PA 4KIKB 2OJFE 3RNIA 4OW8A 3QKKA 1OZ1A 4EH8A 3FC1X 4FGRA 4UMUA 4NTSA 4ZSLA 4O7SA 3GCVA 1CTPE 3QTUA 4NIFA 3QX2A 3JY0A 4R7HA 3KRXA 2HIWA 4AA0A 2XNEA 4O0VA 3ZXZA 2XUUA 4G6OA 3QKMA 4GK4A 4K2RA 3NUNA 1QPEA 3CCNA 4A9UA 4R3RA 3DS6A 3C4FA 4EC9A 2CKEA 3H9FA 3KN6A 4KKHA 1XBAA 3U4WA 2DWBA 4O0XA 5G6VA 2V62A 5AIRA 2B53A 3FQEA 5CEPA 2JGZA 3SXFA 4FYOA 4EHVA 3V3VA 4C4FA 3O2MA 2OICA 3ODYX 3A7JA 4OTWA 4EK4A 1MP8A 3MI9A 1DI8A 4RG0A 3G0FA 2ERZE 4NM7A 4YTIA 4O21A 5A46A 3KU2A 4KS7A 4ZLZA 4BKJA 2C69A 4ZAUA 3VUIA 2YIYA 5IQIA 2CLXA 4BZDA 2WAJA 3GC7A 4QTCA 5ETAA 5TKDA 1BMKA 5DEWA 2XKEA 5LVOA 2J0MB 3F69A 4R1VA 1IAJA 2OFUA 4Q9ZA 4F1TA 3DB6A 4XLIA 4C4JA 1BL6A 3OT3A 3UP7A 5L6PA 4MXCA 5EW3A 2WMVA 3ATTA 3I6UA 5CASA 3PVGA 3CS9A 3R1YA 3UIMA 4DT8A 4NZWB 3TUBA 3SW7A 3FC2A 4HCUA 5FP5A 4BDFA 1OIYA 3DTWA 4Y46A 2FA2A 3UYTA 1W82A 3A4OX 5ANKA 1P4FA 5HICA 3QWKA 4QMLA 3QRJA 4IZ7A 4FKSA 5EM7A 5I5ZA 4I5MA 4BGQA 5E9EA 4EBVA 4GSBA 3W10A 3QQUA 3V6SA 1OL5A 4GFOA 4X0MA 4Y5QA 2IPXA 4N6ZA 3HVCA 4JR7A 4UYNA 3LPBA 2XKCA 4G6LA 3Q04A 5CYIA 3N51A 4D0XA 4NK9A 2CGWA 4O2ZA 4A06A 4FKIA 3CKWA 1LEWA 3DK3A 5CAPA 3R8PA 3QLGA 3VUGA 1FBNA 3BEAA 3CXWA 1SNUA 2Y7JA 4IVAA 5J95A 5EYMA 2VWYA 2B9FA 3IW4A 3ZS5A 5GZ9A 4Y85A 4E5BA 5EW9A 4BYIA 2NP8A 2XA4A 3UVPA 3QC4A 3KRRA 4FZ6A 3CPBA 4AQCA 5C8MA 2ITXA 4XG2A 5HBEA 3EFLA 1JSTA 1UV5A 2F9GA 4EHEA 1VEBA 1GIHA 2R0IA 3HUBA 2X7OA 5EHLA 3OOMA 4ZJJA 1P5EA 1KE6A 4FNWA 4CQGA 3KFAA 2QURA 1PXKA 2VTAA 4L45A 3W16A 2VV9A 3IW6A 3EYGA 3UP2A 1TVOA 5LCKA 5BVWA 3OW3A 4U81A 3PY0A 4IWPA 1OL6A 2ZJWA 3VUKA 3EN6A 3DU8A 2I1MA 3F5UA 4RIXB 3RPRA 3RWPA 2RFSA 5EM5A 2XEYA 4YO4A 4LUDA 2BMCA 4FKWA 3CSVA 2YIRA 3GNIB 4YJQA 4DH3A 2Z02A 2QLUA 2AYPA 4RA5A 3TV6A 3V5WA 3ZO4A 3W55A 4O0UA 3FI8A 2PE2A 2XIRA 4XG9A 1U54A 3TWJA 3VBQA 4XRLA 4ASDA 5K5NA 4S2ZA 3W32A 3GI3A 4EH4A 3C1XA 4QQJA 3KY2A 2J4ZA 1PY5A 2RFNA 4FVPA 4HVGA 3BBTB 2JAVA 4KIQA 3OROA 4WG4A 4V0GA 2VRXA 2ITYA 3KMUA 2HW7A 5HCXA 3FSFA 3TNHA 3LM5A 2ZV7A 4LYNA 3K3IA 5HHWA 2JLDA 2YM8A 4O91A 4EONA 5EQYA 1Q62A 3ZOSA 3PPJA 4FVQA 2HAKA 2RFDA 4FV0A 3QZHA 4BWXA 2UV2A 3G15A 3PWYA 4JG8A 4OTGA 2CKQA 4XUFA 3OCSA 5AP2A 3UDBA 4J7BA 5GZAA 3GCUA 5IQDA 4C58A 4BDJA 4CCBA 4Q2AA 2XCHA 3SLSA 3I0QA 2XH5A 1EH4A 3IDPA 3OP5A 3HV6A 4BF2A 5BMMA 2JIVA 4EYMA 5HE3A 3PXYA 3ZLSA 4NTTA 2QQ7A 4ZLOA 4L68A 3F2RA 3CP9A 3G90X 3R7GA 4ZTMA 1FMOE 4PQNA 1DI9A 3RZBA 2GS2A 2QKRA 3R22A 3IOPA 4I5HA 4FV2A 3F3UA 4AN9A 4F0IA 2W4OA 3FJQE 2ITOA 1OL1A 3ZO2A 3PPKA 2ZM1A 3A7HA 4G31A 3ROCA 1J1BA 4EHGA 5AAEA 4BYJA 3NIZA 1UNHA 4EOLA 4XV9A 1IA8A 2RGPA 4G3GA 2CKOA 4KIOA 5D41A 2OI4X 4TYJA 4U44A 2Y6MA 2XYUA 5CSVA 4EWQA 5AAGA 4IIRA 5KZ0A 3PG1A 3D5WA 3FZRA 3ZUUA 1NT2A 3UIUA 3KREA 3ENHA 2JEDA 4E4XA 2IWIA 1NW1A 4C57A 3R01A 4F08A 5LMKC 5AFVA 5EK7A 3AQVA 3TT0A 3VUMA 3I7CA 4FTKA 3E8EA 1W7HA 5CY3A 2ITVA 1J7UA 4F9AA 2CN8A 5LCJA 2EB2A 3PIXA 1H24A 3KGAA 3NCZA 4YHJA 5M44A 3VS5A 4NUSA 4NFNA 3P79A 3FHRA 5ANJA 3ZMMA 4JXFA 3RAKA 4I4EA 5IMEA 5AIKA 3R2YA 4AZSA 3D7TA 5IG1A 2OZAB 5BYZA 4ZS0A 3ORMA 3ZO1A 3LFAA 2Y9QA 4FZFB 3O51A 1YXUA 5A4EA 4FSYA 3V5JA 3OG7A 4U41A 2GPHA 4APPA 2KTYA 1OM1A 1UU9A 2YLEA 3OD6X 2BRGA 4PMPA 1V1KA 2J51A 2Z7RA 4D2WA 2CHLA 4JLCA 3ZXTA 3PXQA 2I0EA 2OIBA 2W1DA 3P1AA 3W33A 5B2MA 4QYYA 4I94A 4C4GA 4WBOA 4L7SA 2BTSA 3GQIA 1U5QA 4IBMA 3AT3A 4WG3A 4KBCA 1ZMUA 2ZVAA 1AQ1A 4QRCA 3VBVA 3ZBFA 4AT4A 3R8MA 5A4QA 5A6OA 3BHTA 4RIOA 5JZJA 5LMKA 3DNEA 3CPCA 5CTPA 3PZHA 1ZOHA 2VTLA 3QU0A 5CSHA 3PPZA 4GL9A 1WBSA 3FLWA 4OTPA 3VUDA 5HLWA 4YSJA 2I40A 1XH6A 5IUHA 2RG6A 1PHKA 3QBNA 1STCE 5AV1A 2IZUA 5BVEA 4I22A 4GW8A 4P2KA 5CF8A 2WPAA 4AGUA 3IW8A 1ZRZA 2X81A 3FQHA 4GYIA 4OBQA 3NPCA 3DA6A 4RC3A 3REPA 3FZPA 2PZ5A 5D7AA 3O7LD 4BVUA 4BWKA 2X6DA 2OF2A 1FVRA 3VVHA 3RI1A 5JFXA 4HVHA 4RC4A 1OB3A 3OW4A 1A48A 4OT6A 4II5A 4BCJA 3IK3A 3NDMA 3AC1A 1XHAA 3BLRA 4G9RA 2VO6A 4X7QA 4C8BA 3AMYA 5AUXA 4EORA 5KX8A 4RIWB 3RZFA 3WF6A 2W17A 5DYJA 4L6QA 1W0XC 3G5DA 5EOLA 3C4EA 3EFKA 4RZWA 5E1EA 3R7EA 3WYYA 4CT2A 4LI5A 5J5SA 1URCA 2PVKA 4K33A 4GJ2A 3VS0A 4D9UA 1Q8TA 4GT3A 4DFYA 3WZKA 4DGNA 2FYSA 3L8PA 4F9YA 3DDPA 3JPVA 2BAJA 4HNIA 3VS2A 1OPKA 1OKZA 1TQMA 1XBBA 4R7IA 4XCUA 4LG4A 4XRJA 5L2SA 1REJA 3UVRA 3RCDA 1H07A 3C0IA 3O8UA 3TKIA 5HBJA 4PTEA 4TZRA 2VTNA 2XK4A 3UO4A 3TKHA 4EHZA 4QYEA 3NEWA 4XP3A 2XJ2A 4ZIMA 3A4PA 3LMGA 2ITZA 3EQPA 3S4QA 3VHKA 2GNGA 4ZK5A 4Z3VA 2VAGA 2ZM4A 4IJ9A 3O0GA 3WZJA 2PVLA 2BHEA 4ERWA 4HZSA 4MD8E 5BVFA 2RFEA 2W96B 1OIQA 2XP2A 3AMBA 3PLSA 2GHGA 1TKIA 2R3OA 2QOOA 3DKFA 3DXNA 3EQHA 3ANQA 3NAXA 4PWNA 4S34A 5CNOA 3SV0A 3QCXA 5M55A 3IGGA 1KSWA 5BUEA 4PMTA 2BRNA 3TUDA 1JKKA 2C30A 2QNJA 3VWAA 4D55A 3H3CA 3JYAA 3TZ9A 4PDPA 4MH7A 5J1VA 3O7LB 1PXIA 1PXMA 1UA2A 2X9EA 4V01A 2GS7A 2FH9A 3LIJA 4XJ0A 4GV1A 5CSPA 5DVRA 4BCMA 3R8LA 1U54B 1B38A 5I9XA 3RHKA 1UU7A 4M97A 5GINE 5EHOA 5IA1A 4USDA 4IAIA 4X3FC 4UMQA 5F1ZA 5EG3A 2JAMA 3QAME 2EWAA 2BRMA 4TXCA 2BPMA 4FG9A 2QU5A 4JBQA 4BGHA 4DE4A 1Y8YA 3QHRA 4YJNA 1UKIA 4BCFA 4I92A 5J9ZA 5LWMA 2YM4A 1J7IA 1RJBA 4RFMA 4WNOA 1UWJA 3MIAA 3OF0A 4FE2A 5JEBA 3VS4A 5EQEA 3TV4A 4I5CA 2QR7A 5D7VA 5AMNA 5HU3A 2PVYA 4ZTRA 2C6IA 4NT4A 2P2IA 5F95A 3ZSIA 3DKOA 1JLUE 3R00A 4WSYA 2FO0A 4RVKA 4IVDA 5DG5A 5AR8A 3V8SA 1M7NA 3C9WA 4HVIA 4NCTC 3O8PA 3ZFXA 4YTHA 3TZ7A 3BELA 4HOKA 4BZOA 1PKGA 4EQUA 4R77A 3NAYA 1BYGA 3E3PA 1M2RA 3UZPA 2HZNA 3QUDA 4RFYA 4DGOA 1G8AA 2IVSA 2BAKA 2WFYA 4XLVA 4BTMA 5CAUA 3TNPC 3E93A 2JIUA 5AADA 5HQ0A 4U3YA 3QCYA 4USFA 3A60A 3Q6WA 4PDSA 2YERA 3NYVA 4AFEA 1IASA 3W2QA 4L67A 4IJPA 3NR9A 3IONA 4QTDA 2IVVA 3DAJA 5HO8A 3FV8A 4ANLA 4QMQA 3PXFA 3DY7A 1BL7A 5DT3A 4DGGA 5JGDA 3GU8A 3WF9A 5F4NA 4DEHA 4JDHA 4C38A 2YCSA 4RFZA 3UO5A 3HAVA 4G9CA 3GENA 4FTLA 1PMNA 4O6LA 1YXTA 5DR6A 3G9NA 3HDNA 4CFFA 3RJCA 4ZTHA 5ITAA 1T46A 4EI4A 3OEFX 4NM5A 2OLCA 3LE6A 4DC2A 2VWZA 3GXLA 4AZTA 2OJGA 1VYWA 4JDKA 3F88A 5EYDA 2XMYA 4JAJA 2JDTA 3VNTA 5KMOA 5E90A 2UZEA 4M8TA 2VD5A 5M4CA 1A06A 2XJ0A 2UZWE 2W0JA 2A19B 3OCGA 2X2MA 3UZTA 2F2CB 2VTHA 3QGWA 1R0EA 4WSQA 5E92A 3R9OA 3EN4A 2CKPA 2PVRA 5EM6A 5AR5A 5I0BA 3IOKA 1YOJA 3CLYA 3V8WA 1YW2A 3D5VA 1NVSA 5AX3A 2QO7A 5CEKA 5FBOA 1BX6A 1L8TA 1GY3A 5HBHA 1NY3A 2GNJA 1BKXA 5H8BA 5BYLA 3P5KA 4FEUA 4QNAA 4IDVA 2B52A 3CEKA 4OTFA 5FP6A 1H0WA 3HV3A 1YVJA 4LOQA 2XNMA 4QOXA 4U6RA 1KE5A 1CKIA 4H3BA 4JQEA 4P5QA 1H01A 2FSLX 3OXTA 4UY9A 5HESA 1YI4A 5HLNA 4K11A 3LLTA 2UZDA 4QMMA 5GHVA 5HG7A 3RVGA 1SM2A 5K3YA 3QQLA 2JFMA 3KVXA 5CEOA 1Q24A 2E9PA 3E63A 3FSKA 3LW0A 3R7YA 4M12A 3UTOA 2IZSA 5KHWA 4YJVA 4CTBA 4WRSA 3G6GA 3FKOA 5DNRA 2IW8A 5BQ0A 4A7CA 2E2BA 3DJ5A 4V0GB 5D9HA 1JBPE 4F0FA 3QWJA 3I5NA 5ANOA 2PUIA 3SOCA 3QD0A 4OBPA 4BWPA 4M7IA 4YJUA 1LR4A 5AA8A 1XWSA 4GRBA 5DOSA 3KF4A 3BV3A 3NUSA 3UPXA 4F1OA 4Y83A 3Q53A 2G2HA 1W84A 3CTJA 1HCLA 3B2TA 2YM7A 4FOBA 4J71A 3HAMA 3D5XA 4N70A 3LJ2A 4OTHA 5E8UA 3DTCA 1B6CB 2CCHA 2BDWA 2R7IA 2VNYA 5AUZA 4O0YA 3CC6A 3T3VA 4S32A 2GNLA 1O6YA 2ETRA 5HO6A 5IKWA 3DK6A 4EJ7A 5IA3A 4DYMA 3F3WA 3IKAA 3P7BA 2PVFA 4GYGA 4W4WA 5AX9A 2PE1A 5KE0A 4BHNA 3RK7A 4IFCA 4F9WA 4KBKA 2WTKB 2OIDA 5CNNA 3F2NA 5C1QB 2Q0NA 4RJ7A 4YNOA 3RALA 2A27A 2UW4A 3JVRA 4FL2A 2WEIA 4XOZA 4KKEA 3FZOA 4EOOA 5FM2A 2B7AA 2OWBA 3MFRA 1I44A 2GMXA 3RPVA 3L9MA 5J79A 5HI2A 3K5UA 4QMNA 3FMLA 3FMEA 3Q60A 3AMAA 4C3PA 1MQ4A 4JX7A 5C27A 3VF9A 3AC3A 3ORIA 3EIDA 3IO7A 1KV1A 3LZBA 2VTJA 3PXKA 4QYFA 4C3FA 5GZ8A 2VWVA 3BHHA 5KHXA 4H3PA 4EOSA 2OZAA 2P3GX 2I0YA 2PVMA 3KXMA 4HGSA 4TPTA 4ENXA 4CKRA 4F6WA 2UZNA 3SRVA 3EQRA 1LUFA 2XNOA 5EKOA 4HZRA 3WF8A 3DJ6A 3L9NA 3VIDA 3HV4A 2XIZA 2HXQA 5A3XA 4F63A 2V55A 2B1PA 3A61A 4ITHA 4FG8A 3PXZA 4DLIA 4DFUA 3U87A 2J0IA 4Y8DA 4KWPA 2ZB0A 5IH4A 2ZDTA 4QTAA 3ZC6A 3M2WA 5C26A 1E1VA 4BCIA 2J50A 4YJOA 1GZNA 3LFQA 1B39A 1DM2A 2P33A 3QTXA 5HIEA 2YM3A 3OZ6A 5J1WA 3FXWA 3RK9A 5EDQA 3GU5A 4C0TA 3HZTA 2RL5A 3KKVA 4GVAA 2XRUA 3NIEA 4IXPA 5CEIA 2V0DA 5J87A 2BKZA 4MNEB 4FBXA 3FLNC 4MHAA 4FIIA 5IPJA 2I0HA 2FSOX 5J9YA 3C5UA 4WBBB 3R9NA 1SNXA 4BDAA 5HX8A 1BI8A 4M66A 1H1PA 2FB8A 2BKKA 2HYYA 2WTKC 3ORLA 2B9JA 1I09A 4XHKB 5EQPA 2X39A 3ZBXA 3ZCLA 3ALNA 4J1RA 5JT2A 3H30A 3U54A 3OMVA 2R3IA 2ZYBA 2F49A 2XS0A 4FL1A 4CT1A 4YURA 3SOAA 3NUUA 4B8MA 3COHA 4O96A 3ZSHA 4Q9SA 3FI3A 4D4SA 5FWKK 5DGZA 4RSSA 3AC2A 2B54A 3QZIA 4BDEA 1PYXA 2WQEA 4AGWA 3ZZWA 4U42A 4BKZA 4G5JA 3I6WA 3A7FA 4TYGA 4TRLA 4FEXA 3GU7A 4FTJA 4FV4A 4HYSA 3F5GA 4DH5A 3LQ3A 3R63A 3THBA 4QMPA 2VTQA 2YACA 3LFBA 4X6QC 4MK0A 3VBTA 3ZDIA 4PV0A 5CU4A 1YOLA 4FVRA 4DH1A 4YC3A 3D83A 3RTPA 3ORXA 5IZFA 4NJ3A 3M1SA 4U8ZA 4A9TA 4GT5A 3NYOA 5T68A 1OKYA 3ZHPC 5JRSA 3S00A 3D9VA 3K3JA 4YLLA 5TOZA 1XO2B 1KOBA 2IO6A 4MXYA 1PXPA 3ACJA 3QQKA 2EXMA 3MDYA 5A54A 4IM3A 4R5YA 3MY0A 5HOAA 4FT5A 5C9CA 3T9TA 5I9VA 2W1HA 4MNEA 4Z55A 1XKKA 1UU8A 1FVTA 3DFCB 4O7RA 4AN3A 5DT4A 4OAVB 5IH5A 2PHKA 2VO7A 3PJ3A 2WMUA 4IX5A 4P90A 4DGLC 5EI6A 2NO3A 1Q8ZA 2YM5A 3MVLA 4EQMA 2BR1A 3ZH8A 1M14A 3HMIA 5EOBA 3G0EA 4E4MA 4F9CA 2XK8A 2AUHA 5L6WL 5CT0A 3ZRLA 4EOKA 4BCHA 3QXPA 4YMJA 3WZDA 4U40A 2IVUA 2GHMA 3I60A 3PSCA 4BCKA 5FTOA 4J96A 2XYNA 2YM6A 5D1JA 4G5PA 2CGUA 5AUUA 3DPKA 4O7LA 1TQIA 5CANA 3NX8A 3O50A 3KB7A 4EOQA 1WBPA 3GC0A 2WO6A 4DG0E 4HPUE 4QP7A 4Y72A 1Q99A 4RQVA 5J7BA 1U59A 5IDNA 1W83A 2R7BA 4RVLA 3QD2B 3BWJA 2JITA 4BDGA 3ATSA 5BYYA 3ACKA 4F7JA 4YZDA 3LMHA 4V04A 4XP2A 2YAKA 3F82A 3L8SA 5K4JA 2X8EA 4J99A 3ELJA 2C5XA 4NWMA 1JKSA 4NW6A 3V5LA 2YDJA 3SG9A 4IX4A 4UXQA 3RBWA 5JH6A 3OWPA 4S30A 5L2IA 1XQZA 1U4DA 4ZZNA 3MSSA 2H34A 2WQBA 4ZSAA 3LJ0A 3LJ1A 4USEA 2QI8A 3TDVA 2OJJA 5M09A 4FTUA 3NW5A 3QD3A 1Q3DA 2W1IA 5FGKA 2JBOA 4BBFA 4E4LA 3DK7A 4M13A 5E8YA 3LKMA 2JDVA 2QO2A 4MEDA 2YAAA 3A2CA 1OL2A 1MQBA 4CFVA 4APCA 4O83A 2LGCA 2XRWA 4QP9A 2ZMDA 4RZVA 1ZY5A 4ZP5A 3DLZA 1YXSA 1V0PA 2PUUA 1IRKA 3R30A 5JGBA 4Z16A 2DYLA 4K1BA 4XBUA 3KC3A 3PY1A 1ZYJA 4E4NA 4FT7A 2GTMA 2WHBA 2UZLA 5M08A 4ZTSA 1PYEA 4FSQA 3UIBA 4X2KA 2Z60A 3Q32A 5IA4A 3SVVA 4LFIA 4GS6A 4O0SA 3TACA 3GOPA 4U45A 5E8TA 4FKPA 2BILB 2O8YA 3TJDA 5AEPA 4KUJA 2OJIA 3HKOA 2ZDUA 5ANEA 4K77A 3F3TA 1H28A 2RF9A 3Q4ZA 4G34A 4L52A 4RBLA 3UNZA 3RAWA 5CXZA 3IDCA 4MQ1A 2ITUA 4AZWA 1H1QA 4AGDA 2ZV2A 4DHFA 5BNJA 5IQHA 3BZ3A 3F5XA 4UEUA 3Q5ZA 5M57A 4BCOA 4YR8A 2X7GA 1CM8A 3B2WA 4YJRA 4XYFA 4MX9A 4PP7A 2C3IB 5LXMA 4IM0A 3GT8A 2W5AA 2YJRA 2ETMA 5AP6A 5IH6A 3L8XA 2QO9A 3OUKA 3KRJA 4HGLA 3U9NA 4IAZA 2PE0A 2H9VA 2QU6A 2Z7LA 3IGOA 2WMBA 3MY1A 3TZ8A 4BIBA 4BR3A 4FKJA 3RPOA 4E7WA 4FUYA 2R5TA 5TE0A 2GNIA 4LGDA 3PY3A 2A1AB 5L8JA 5HNBA 4Y73A 4FZ7A 4EOJA 1JSUA 2W4KA 2PSQA 2OZOA 3Q4TA 4BI0A 2R3GA 4EC8A 4R78A 5HNIX 2HWOA 2VWUA 4FSNA 2BFYA 1JSVA 5DT0A 3ROYA 5KBQA 3EQIA 3HV5A 4GKIA 1PMVA 4DEBA 3CQUA 2BDJA 3MTLA 4IANA 2NRUA 3C0GA 4G16A 5E8XA 4JX3A 4QMZA 2R3JA 4JG6A 4IZ5A 2HOGA 4O38A 5ANIA 2WMQA 4O0WA 3ZZEA 5FDXA 2B0QA 4KS8A 5A4CA 4JS8A 2P55A 5AUVA 2R64A 3MS9A 4CMUA 2C3JA 2J0KA 3BHYA 3FMKA 2QOBA 3FBVA 4B6LA 5DWRA 3UOJA 5E4HA 5J8IA 3BX5A 1MRUA 3C4WA 3HA8A 5HIDA 3R7OA 3DDQA 4O86A 4IW0A 1PMUA 4IEBA 3LHJA 2PVNA 4NEUA 4ORKA 3U9CA 3RHXA 1JAMA 5M53A 2PZPA 3HMOA 3NYNA 2XM9A 4ZJIA 4C02A 4CMTA 5JFVA 2YLFA 4TKSA 2CJMA 3M11A 3C4XA 4D5HA 3NZ0A 2Y4IB 2ZOQA 4W4VA 2W1EA 4M3QA 4L3LA 2XIXA 2ZMCA 2HZIA 4LL5A 3EFJA 4NU1A 2R3MA 4WNMA 4ZZMA 5JRQA 3QQJA 3PYYA 2O2UA 4MTAA 2Y8OA 3P7CA 4DGMA 4BIDA 2W7XA 4CV8A 3SKCA 3WZEA 1ERKA 4XBRA 1X8BA 4R8QA 4YZ9A 3RNYA 5HZNA 3QL8A 2RIOA 1JWHA 2C1AA 2NRYA 3KXXA 1OIUA 4DCEA 4UMPA 2O5KA 2AC5A 4U97A 1YDTE 4RWIA 4C4HA 3GOKA 4AP7A 4ANOA 1ZOGA 3D7ZA 4ACHA 1PF8A 3POOA 3V5TA 4AW2A 4PP9A 1WVWA 1BUHA 3TKUA 4D0WA 4O81A 3CJFA 5BUJA 2QR8A 4QPMA 2VTMA 4FKVA 4YGAA 4D1ZA 3W2CA 1KV2A 2ACXA 2V22A 4KRCA 1GNGA 4NSTA 4OR5A 3SHEA 5F20A 4Z7GA 5IQFA 2GHLA 4X3FA 2C6OA 3P23A 4JJRA 3TL8A 5BUIA 4J97A 2WTCA 4QP2A 1KE8A 4F7SA 2QHNA 2ITTA 5AUTA 4RJ6A 1FINA 4F6SA 2JDOA 4CSVA 4CFMA 4QP3A 2CGVA 3QUPA 4IE9A 2X8IA 3QHWA 3AXWA 1IG1A 5FQDC 2PK9A 1QL6A 2HZ4A 4TYIA 4BCQA 4OLIA 2BCJA 4EOIA 2OSCA 4AU8A 4EJNA 4HVSA 4E6AA 4HVDA 3TM0A 1F5QA 3MTFA 1BLXA 3NNUA 3NNXA 3PVWA 3VRZA 2F57A 4U43A 3COMA 1UVRA 2WU7A 3HYHA 1PKDA 4QMVA 3O71A 3OVVA 4IC8A 3DAEA 1CKJA 3FL5A 1O9UA 3FLQA 3KQ7A 5AR4A 4NL0A 4LMNA 5FXSA 4G3EA 2XCKA 4MD9E 3EFWA 4YBJA 2W1ZA 4KAOA 3W8QA 4MXAA 4D4RA 5H9BA 3B8QA 3ZU7A 4EH2A 4G3CA 3IQ7A 4YPSA 1Q8YA 3VS7A 5M07A 4H36A 4QMTA 3DBCA 2VN9A 4E3CA 5DI1A 2CPKE 1UNGA 1M17A 2C6LA 5FTQA 4D2VA 4HCTA 4FC0A 3E7OA 5EI8A 4CYIA 4EZ3A 2WTVA 1UWHA 3EWHA 2UVXA 2VWXA 2WMWA 4EWHA 3NUPA 2P0CA 4ALVA 4XX9A 4BRXA 3KMMA 4EH7A 4YPDA 4FIGA 2BHHA 4FV8A 3ET7A 3F3VA 4IDTA 3RGFA 3UIXA 5G1XA 3MV5A 1H1WA 2QVSE 3BIZA 3LFCA 2B4SB 4JBOA 4X21A 5AV0A 5FXRA 5BPYA 2PVJA 3T8OA 3E62A 1XH5A 2B55A 2CMWA 4QP1A 3R1SA 2WMSA 5CSXA 2H96A 3CD8A 5JSMA 3CIKA 4I1ZA 4L46A 1Y91A 4IM2A 1R0PA 4C34A 4IAAA 3L8VA 4FKOA 1MUOA 5L2TA 3KL8A 3VJOA 2QOIA 4ITIA 4C2WA 2W5HA 4BBMA 3UQCA 1OMWA 4A4XA 3PE1A 2F7ZE 5LMAA 3PP1A 3VBWA 2OGVA 2G01A 4KKGA 5EDRA 3MJ2A 1V0BA 3MN3A 3Q52A 3R21A 2JKQA 3E87A 2WNTA 4U7ZA 2UZTA 4IHPA 3AGLA 4UN0C 3AC4A 4GUEA 4O7ZA 1G5SA 5EHYA 5KO1A 5FTGA 2JD5A 2YJSA 3V8TA 2VO0A 4L42A 2QOKA 1ZARA 3MVHA 4O2PA 3V04A 3MVJA 4PL5A 4UZHA 3QA8A 4I6QA 5AUWA 1SVHA 4Z9LA 4ZMEA 4J95A 5HCZA 4UMRA 4EZ5A 3R73A 4C4EA 4E73A 4AAAA 3D7TB 4D2SA 3E7VA 4U0IA 4OTRA 1RW8A 1Y8GA 2R2PA 4RWJA 4C33A 4MBLA 4NJDA 4B9DA 3ZLXA 4ASXA 1OUYA 3BYVA 4RX8A 3PE2A 4F6UA 2WOTA 4GH2A 2C5OA 3TDWA 4YNEA 5IEXA 1XH9A 5HKMA 2W1FA 3C51A 4MXZA 3IDBA 3SXRA 4I0SA 4YZCA 5A4TA 4YJSA 4I6FA 4FZAB 3PSBA 2IN6A 3VW6A 4F64A 5EKNA 5FM3A 5HTIA 1QPDA 3OT8A 1J91A 3EOCA 3EHAA 3HLLA 3ORZA 4LV5A 4PX6A 4R6VA 4L8MA 5KKRC 1CKPA 4ASZA 3D94A 2FGIA 3W8LA 4P4CA 3Q6UA 3FMHA 5IQEA 4GFMA 4IQ6A 2XEZA 3GGFA 5IQAA 5CF5A 2E9UA 2E9OA 2YHVA 3DAKA 1AD5A 1NA7A 3EZRA 3JUHA 4L9IA 5AWMA 3VC4A 1H27A 3JY9A 5IA5A 4DTAA 2VWWA 2UW5A 4K0YA 3EKKA 4GIIA 1ZZLA 5B0XA 3FMMA 5IQGA 3DV3A 5I9UA 2YABA 3NUYA 5HE0A 4GT4A 1YDSE 2GQGA 3DNDA 3FZSA 5JKGA 4ZMFA 1Q5KA 3C4ZA 2YIXA 4JIAA 5AP5A 5FD2A 4FV1A 4E20A 4CVAA 3NYXA 1OIRA 1HOWA 4PPAA 3VF8A 4FK3A 4E6CA 3SG8A 4LL0A 3PXRA 3SA0A 4WUAA 2XZSA 3QRTA 5CU6A 1ND4A 4GEOA 4ZY5A 2PMLX 3LCDA 2UZOA 3W18A 5ICPA 2Y6OA 4XG4A 1IR3A 3A62A 3QQHA 2IZRA 1J7LA 3EQCA 5HIBA 2R3PA 4U9AA 4JQ8A 2C6MA 3I79A 2JIIA 3C4CA 3GU6A 4I6HA 5E8SA 5EYKA 4BCPA 4U80A 1WBVA 5L2WA 4E5WA 3R9RA 3EQGA 4BDBA 1VYZA 1OI9A 2XNBA 4DLJA 4F4PA 4GUBA 5HVJA 1OPJA 4XOYA 3FLSA 3F66A 1ZWSA 3BHUA 4RT7A 2VO3A 1A9UA 3PRIA 3PSDA 3QXOA 1L3RE 4WD5A 4C37A 5IU2A 2QD9A 3ALOA 4R3CA 4H1MA 1GJOA 3BU5A 1F0QA 4GU9A 3QKLA 3TZMA 2QONA 3UC4A 4JVGA 3KA0A 1JQHA 1WZYA 3F7ZA 4E8AA 2PVHA 3FKNA 4BI2A 4B4LA 5GIOE 1WBWA 5GNKA 4IC7A 3UPZA 4FEWA 4R3PA 4TN6A 3QUEA 2UW9A 5C4KA 2WIPA 3PG3A 4FSUA 4EUTA 4BICA 1LPUA 3A7GA 5CVHA 3VW8A 3AC8A 1ZY4A 2XVDA 1Z57A 4FK6A 3KN5A 4MCVA 4L3JA 3GBZA 3ZUVA 1PXLA 4AX8A 3R7IA 4KRDA 4K18A 2E9VA 3K54A 4GU6A 2VWIA 4CV9A 2PMNX 3LFSA 2PYWA 4PY1A 4E6DA 3EN7A 2ITNA 4PTCA 3ZRKA 4U3ZA 2OFVA 1REKA 4CKIA 1M2PA 3QQFA 3HL7A 4D58A 3O23A 3ZRMA 4BDKA 4EH5A 3QZGA 4RLKA 4BTFA 4RLLA 4EBWA 4YJPA 5HG8A 3OWJA 3FYKX 2QOFA 5HD7A 3DQWA 3ORPA 4FT0A 3W2RA 3BE9A 2GNHA 4EL9A 1O6LA 4FNZA 3OWLA 5HGIA 4IX3A 4W9WA 5M06A 3CY3A 3U8WA 4ID7A 4RX9A 2QOCA 2PZRA 3QCSA 4A4OA 4RVTA 4DFZE 4CG9A 4LGGA 4QD6A 1QPJA 4YSMA 3BCEA 5E1SA 5EYCA 4ANQA 4C4IA 2ONLA 3RK5A 3VJNA 1SVGA 2C6KA 3DGKA 4P5ZA 5CZHA 4HW7A 1WMKA 3MIYA 3LCTA 3WBLA 1M7QA 3P08A 5K4IA 4J52A 3GC8A 3MPAA 1KWPA 3E8CA 4GK2A 4AF3A 3CKXA 5AV2A 3MESA 4FTIA 1GZKA 4L01A 3HDMA 5AR3A 5AV4A 3VS3A 4I21A 4E26A 1S9IA 4EQCA 4BDDA 2XK3A 3CE3A 4RGJA 4DEAA 3DBFA 2XNNA 3H4JA 3KRLA 3UVQA 4F7NA 5BMSA 4PDYA 2H6DA 4PL3A 3BLHA 5I3RA 4MXOA 4LRKA 3RPSA 4ERKA 2IW6A 2JC6A 3W2OA 3GEQA 3F2AA 3G9LX 1TQPA 3BYMA 3CD3A 4OBOA 4RJ5A 4MYGA 5ACBC 5KZIA 3FQSA 2QC6A 3OXZA 4JBPA 3U51A 3PA3A 5D10A 4FSTA 3V5QA 3ZEWA 4CYJA 4AFJA 3BE2A 3R7UA 5EM8A 3R8ZA 3HRCA 1JNKA 5LJJA 3C0HA 4J53A 3PJ2A 3CJGA 4J8NA 4IWDA 3MVMA 2BIYA 4PUZA 2QKWB 3PJ8A 3O96A 3MYGA 4IWQA 2DUVA 3Q2MA 3GCQA 4YHFA 5AJQA 3N4TA 4RWKA 3ERKA 2P4IA 3PVBA 4DN5A 4HCVA 4DINA 2W1GA 3H9OA 3WI6A 2CNUA 4FTRA 5HX6A 4PMSA 4F09A 3I7BA 4MVFA 5DA3A 4AXAA 4JG7A 5IUGA 1FOTA 4N57A 4JDIA 3ZC5A 3DBQA 2JFLA 4RX5A 2PZIA 2X2KA 3FE3A 5BVKA 3QD4A 2CGXA 2KULA 3KRWA 1SVEA 1GOLA 5H8GA 4BTKA 2REIA 5F94A 3MH1A 1H26A 3R1QA 4B8LA 4YZNA 3BGQA 2GFCA 4FZDB 2OBJA 3MH3A 3R28A 5AUYA 3OCBA 3OWKA 4NYEA 5AAFA 1YWVA 4B99A 2OH4A 3FY0A 3BGZA 5ETIA 1WBTA 4YP8A 3V5PA 2GTNA 5IF1A 1FGKA 3TNIA 1OECA 5KMMA 2JKKA 5AP3A 3F5PA 4I5PA 3BYUA 3BKBA 5ETCA 2IW9A 3Q9ZA 3LCKA 3K2LA 2A0CX 4FICA 4R1YA 5I9YA 3U4UA 2BFXA 3DZQA 4O7YA 4QP8A 2WMAA 5C03A 5H3QA 4AWIA 1ZZ2A 4C61A 4CTCA 1ZXEA 3AD4A 1ZYLA 3E8DA 3UQFA 4N0SA 2R3KA 4GJ3A 4YZMA 2JDSA 5KCVA 5E91A 3R8UA 5AR7A 1H0VA 2G9XA 3RAHA 2VX0A 4AE6A 5FXQA 4JQ7A 3MFSA 3QRUA 4PPCA 3HV7A 3WF5A 3C13A 3DKCA 1ATPE 5AV3A 2PUPA 3DBEA 2YZLA 4O1PA 3ZDUA 2VTRA 5H2UA 3V51A 3KEXA 1U5RA 5FBNC 3TXOA 3D2IA 4CMOA 4O0RA 1WBOA 1ZAOA 3FI2A 1H4LA 2YDKA 5L8LA 4FTCA 3TIYA 3CGOA 3HX4A 4A9YA 4K9YA 4JIKA 4IB5A 3H0YA 2X4FA 4FTOA 5FRIA 5LWNA 2O64A 4TY1A 1OKVA 3P0MA 4GCJA 3RM7A 2BDFA 1SZMA 2W06A 2Z7SA 4YLJA 4C7TA 3F61A 4QPSA 5ACKA 5I9ZA 1Y6AA 3GQLA 4FSMA 3AOXA 4JDJA 1ZYDA 4FI1A 3WOWA 5CEQA 4MBJA 4OTQA 3VQHA 2PULA 3EH9A 4BN1A 2W05A 3L1SA 2VUWA 4JRVA 4ASEA 3COIA 4D1XA 4X2GA 2HZ0A 2ZAZA 5FLFA 5ETFA 4M69B 2CCIA 4BB4A 2R3QA 4EOPA 5KBRA 4IADA 2GSFA 4QMYA 5B2KA 3NMUF 2VTIA 3WARA 2PZYA 2YEXA 3PFQA 2Y4PA 4MKCA 4QMWA 5CF4A 3E92A 4FT3A 4WIHA 3MPTA 4IVCA 3IPHA 4IWOA 4HNFA 3SC1A 2XBJA 4AS0A 2EUFB 3F7WA 2OIQA 4AW0A 4BHZA 3TN8A 1F3MC 5J9LA 4FKGA 5DN3A 2CSNA 2XNPA 3ODZX 4WRGA 4CNHA 5KNJA 1AGWA 2WB8A 4DF3A 2X4ZA 2C3LA 4IFGA 4FA2A 1RDQE 4PNIA 3MA3A 5CAQA 3IS5A 4CFWA 4H05A 2XBAA 3OXIA 3QLFA 4ALUA 2VX3A 3BBWA 3DT1A 2EU9A 2C68A 2HY0A 2R3RA 1CMKE 2SRCA 3FLYA 2HK5A 5A9UA 3QRIA 2NPQA 1E9HA 3LQ5A 4FNXA 3ITZA 4I6BA 4KSPA 5AP7A 2LAVA 3TCPA 1BI7A 2ERKA 1K9AA 1YOMA 4N4SA 4UMTA 3E3BX 5IMXA 2C3KA 3EN5A 3QYZA 1W8CA 3FZ1A 4ALWA 5M4UA 4O22A 4XNEA 5J7HA 2BAQA 2QG7A 3EB0A 3HP5A 3VS1A 4AACA 3FMDA 5I4NA 2XB7A 1XH8A 4C2VA 3IECA 4KIPA 3C5IA 3PRFA 4LV8A 2X6EA 2WELA 4IH8A 3BU6A 2OXYA 3KK8A 2I0VA 2WIHA 3F9NA 3UQGA 3LOKA 3HUCA 4WT6A 2PTKA 3D0EA 3RWQA 3FY2A 4C62A 2WZJA 4GG5A 1W98A 2UVZA 4I0RA 5ANGA 3P7AA 3FUPA 1WVYA 3ETAA 4EKLA 2QCSA 2V7AA 4MXXA 3S3IA 3P78A 4H58A 2BROA 4YLKA 4AUAA 4F1MA 3R2BA 4AN2A 4CXAA 2QODA 2W4JA 2YCFA 4WHZA 1PXOA 3VN9A 2VU3A 4UB7A 1PW2A 2BUJA 2W99B 2HY81 4FR4A 2YISA 4M0ZA 2XNGA 3MA6A 4TNDA 1FQ1B 2J5EA 3RM6A 2B9HA 2WOUA 3E64A 5GJDA 4CKJA 4U79A 1R1WA 3SQQA 3OUNB 2ITWA 2WTJA 4XV1A 3I0OA 5KUPA 2HELA 3UMWA 3VRYA 4AGCA 2UVYA 3LM0A 3K5VA 4BFMA 4D4VA 5KMJA 3UODA 4X6RA 3GFEA 4QP6A 5EI2A 2IZTA 4DTBA 4EZ7A 3V01A 5IQCA 2IVTA 4J8MA 4C35A 1VJYA 4MD7E 5DFPA 3R8VA 5DR9A 3FMJA 3II5A 3HEGA 3MWUA 3DB8A 4ACMA 4D1SA 1G8SA 3LXNA 3CQWA 4M67A 5JQ8A 3FEGA 2R4BA 1R78A 4ANBA 2C5NA 4UALA 1DAYA 3PTGA 5AA9A 4FT9A 5DPVA 5IQBA 4TL0A 4AT3A 5K0KA 3FXZA 3LVPA 2BVAA 2VTPA 3VS6A 5CVGA 1SYKA 5F9EA 3LAUA 4ZOGA 1PMEA 4G3DA 3UE4A 3N4UA 4OGRA 4OUCA 5AM6A 4IB1A 3R71A 4X2NA 4U5JA 4XG8A 4IAYA 4CFUA 2B9IA 2VTTA 2OF4A 3NSZA 3WYXA 4I3ZA 3TTJA 4FUXA 3I4BA 4LOPA 4DFNA 4WA9A 2C4GA 2PL0A 2QLQA 2X8DA 2VNWA 5CWZA 1R39A 1PJKA 5LVLA 5A14A 4X3FB 5KMNA 2J9MA 4ZLYA 1Y6BA 2R3HA 3S95A 4CEGA 3UOLA 2OXXA 2V7OA 3H9RA 1KE7A 2C5YA 1QPCA 4AA5A 1H1SA 5DH3A 2HW6A 4ZEGA 4XH6A 4F70A 3FXXA 2WXVA 1K3AA 1YXVA 2XM8A 4K6ZA 2QG5A 1WCCA 5EFQA 4NIFB 4EH9A 3KMWA 3GCPA 4OT5A 3O8TA 3DCVA 3ZM9A 3ZONA 1WVXA 3NW7A 4AT5A 2CNVA 5TT7A 4S31A 2PMIA 5TR6A 4DH7A 2O0UA 2YA9A 2A2AA 2OH0E 4MF0A 4ZSEA 2QHMA 3FYJX 4IZYA 3NVMB 3RINA 4G1WA 3GB2A 2YIWA 3D5UA 3GUBA 3POZA 3LCSA 4FTMA 5IEYA 5JQ5A 2BZJA 1Q41A 4ZY6A 4D9TA 3NCGA 4ZS4A 3KVWA 4L53A 3NW6A 3R9DA 1VR2A 4JR3A 1ZMWA 5CQUA 4I93A 2Q0BA 4F65A 3KXGA 4LGHA 5BVNA 3U6JA 2OU7A 3MGYA 5C8KA 5AP1A 1XH4A 4MQ2A 3ORNA 2XIYA 4A4LA 3ANRA 3FKLA 2J0JA 1OKWA 4GMYA 5JN2A 5HG5A 5FG8A 2UW0A 3BYSA 2J7TA 2PPQA 1FGIA 3ORTA 4BGGA 3BYOA 4K8AA 3FMNA 2JDRA 3TG1A 4EK8A 2J5FA 4YC6A 5CALA 2C6DA 3FAAA 3NS9A 3VUTA 1M2QA 3R6XA 4QTEA 3H10A 1QCFA 3NGAA 5CSWA 3S0OA 4LOOA 3ZFMA 3ID6C 1MRYA 2Z7QA 3FPMA 3WE8A 4W9XA 1XH7A 5CU3A 4Y5HA 3U55A 3OTVA 4IB0A 3LXLA 1RQQA 4TWPA 4QNYA 5D11A 3TNQB 3HMNA 4MF1A 5CX9A 3Q2JA 4NW5A 4FOCA 3BHVA 2EXCX 3TNWA 4ANNA 4D28A 3OBJA 2BIKB 4NM0A 5CT7A 2DQ7X 3BRBA 3A8WA 5HE2A 4ZTQA 2EXEA 3DQXA 3HMPA 3QTRA 1UU3A 3QTSA 1YWRA 3EQBA 4Z7HA 4DBXA 2VZ6A 4CRSA 1IAHA 1FVVA 3E5AA 5K5XA 4IACA 4N6YA 3NNVA 1PRYA 3QX4A 4D2RA 4AW5A 3AC5A 4UWYA 2WTDA 3R7VA 1OGUA 3UMXA 2GU8A 3UNKA 1OBDA 4W8EA 4WOVA 4D2PA 2WU6A 5HEZA 1Q8UA 3MFUA 5JGAA 4F99A 3R1NA 1OVEA 4OAUC 4EK3A 4O82A 1PXNA 2BZIB 4ANSA 5JZNA 3AG9A 2CNQA 1OBGA 3QFVA 1IA9A 5HLPA 1DS5A 2VGPA 1WFCA 3KULB 3QRKA 2GFSA 3C50A 3HGKA 5I9WA 4CZTA 4CGAA 4X2FA 3NWWA 4BY9E 4X2JA 4HYIA 4I0TA 4JAIA 1R3CA 4GK3A 4MWHA 3BEGA 4GFGA 4RIXA 4YZBA 5AP0A 5L2QA 1GIIA 4ACGA 4FKRA 4EKKA 3MH0A 4I20A 4KBAA 3HNGA 3P4KA 2C5VA 4TYHB 2WMTA 4WNKA 4IMYA 5T6KA 2UZUE 3QTIA 3G33A 3Q9WA 4O6EA 3QCQA 3OFMA 4KABA 4PF4A 4XV3A 5HCYA 3DFAA 3VAPA 4A9RA 3UNJA 3EMGA 3H0ZA 5K9IA 1CDKA 2WKMA 3WZUA 3D4QA 4TWCA 4XG6A 1Q4LA 4AZEA 3I81A 5CZIA 5DR2A 3UOHA 3V6RA 2PWLA 4FTNA 5HD4A 4DITA 4DA5A 3O17A 3PVUA 1XBCA 4ZY4A 5HTCA 2X2LA 1WAKA 4WUNA 3UC3A 2YN8A 3KCFA 3MFTA 4YBKA 5CXHA 3R9HA 4DEEA 2R9SA 2V5QA 3LCOA 4DFBA 1NVQA 1PXJA 4OTDA 1MRVA 4M14A 4DEIA 4AZVA 2C6EA 4F7LA 4M84A 2XK6A 4IB3A 4CLIA 4RMZA 5HU9A 1H25A 3BQRA 2ITQA 3D2KA 4QMUA 3ZLWA 4EOMA 1KUTA 3N4VA 4PPBA 3BWFA 2YITA 3HMMA 2WMRA 5DHJA 3GVUA 1CSNA 3IW7A 1NVRA 3RMFA 5M51A 3A99A 2QOHA 4JI9A 2FUMA 2XJ1A 1WBNA 5LQFA 3PIZA 5HE1A 2ZM3A 5GJGA 3T9IA 4M69A 2WMXA 3DKGA 4DAWA 1YI3A 3DLSA 4RJ3A 4YC8A 2YIQA 4UWCA 4IVBA 4QMXA 5HORA 2RKUA 4LQMA 3D14A 1GZOA 3PIYA 4FL3A 3HRFA 3JXWA 4ZSJA 3QGYA 2A4LA 4L7FA 4WG5A 5CU2A 4ACCA 4NH1A 3OEZA 4GG7A 4KB8A 2JKOA 3KF7A 2ONLC 4QPAA 2R3LA 4TWOA 4O7NA 3LXPA 3MH2A 5J5TA 4RVMA 5IEVA 2FVDA 3MB7A 4DBNA 2OG8A 2VX1A 2IG7A 2VWBA 3OS3A 3U6IA 5M4FA 4RJ4A 3ZEPA 1LEZA 2QOQA 4A07A 3MB6A 2VGOA 1J3HA 4J98A 4QMOA 5K0XA 4ACDA 5CENA 5DIAA 2VTOA 2UW6A 4M15A 2R3NA 5L4QA 3FLZA 4IX6A 4FNYA 4QP4A 4C3RA 2NNWB 1YKRA 3NNWA 1XJDA 2OK1A 1URWA 4UBAA 1UKHA 5IDPA 5L6OA 4ZTLA 4M0YA 4RIYA 1APME 5FEEA 4CQEA 2BTRA 3OOGA 3RAIA 4I41A 5JFWA 4BIEA 4R7BA 1OUKA 3PA5A 5B2LA 3LMIA 1JPAA 2F2UA 5E8ZA 3VHEA 2GQRA 3HECA 4O1OA 3ZTXA 4FKUA 3R0TA 4BCNA 3PZEA 3EYHA 5DBXA 3NLBA 4G3FA 4O0TA 4NM3A 4WNPA 4RWLA 3EL8A 4PDOA 3TEIA 4AG8A 4L44A 3OY1A 5CEMA 2RSVA 4ARKA 4MBIA 5L8KA 5CQWA 5I3OA 3FDNA 4CG8A 3R02A 4G17A 2YZAA 5EW8A 3BGPA 2JBPA 4IAFA 3UOKA 3SW4A 4QYHA 2GCDA 1Q97A 2J6MA 2XKDA 3TV7A 3E88A 4UXLA 3BV2A 3I1AA 4V05A 4NCTA 4G2FA 2HXLA 1UNLA 1RE8A 3HRBA 5DE2A 2PMOX 3QQGA 4QT1A 5DRDA 3Q9YA 4JL9A 2I6LA 3EQDA 4XV2A 2WD1A 4XP0A 5CAOA 2GS6A 3VUHA 4CRLA 4EH6A 3F3ZA 2OKRA 3NVKI 4FEQA 4QQ5A 3ENMA 3WILA 5LARA 4AZFA 2HWPA 4H39A 3ZO3A 4CFNA 2YCRA 4W4XA 3BQCA 1P2AA 3SD0A 3SGCA 3QF9A 1NXKA 4HPTE 4DFXE 2WTIA 3QALE 4RIYB 5CLPA 3PWDA 3PLAE 5IUIA 5JFSA 5KMIA 4AE9A 4XG3A 4UV0A 1H8FA 4ANMA 1G3NA 2E9NA 4DTKA 2PUNA 3EZVA 4AW1A 4FX3A 3Q9XA 2BALA 2EB3A 2YCQA 3E8NA 3ULZA 4BBEA 3M42A 4RX7A 1V0OA 4A9SA 4EK5A 5EDPA 4EYJA 4UWBA 3CTHA 1P14A 4FEVA 5FEQA 2UW7A 4HJOA 4BDIA 4FKQA 1OPLA 2BZHB 4UZDA 4DEDA 5LVMA 4B0GA 4O7TA 5TO8A 3EKNA 1H00A 2VTSA 4YHTA 1Y57A 2OW3A 3BPRA 3LFDA 4BCGA 5DEYA 3TJCA 1YRPA 3KCKA 4RA4A 4AOJA 4BI1A 3R04A 4XEYA 4BC6A 3GFWA 3N9XA 4KINA 4QMSA 1JKLA 2UZVA 4TW9A 1ZYSA 3KXNA 3CTQA 4M68A 4FIEA 3NUXA 4TTHB 2F7EE 4EUUA 4FV3A 4I24A 2G1TA 2WTWA 3CY2A 3UJGA 1LP4A 4KIKA 1GZ8A 4ITJA 3MJ1A 4BDHA 4PL4A 5LVNA 3A8XA 3PP0A 4KA3A 4L00A 4D2TA 4FKLA 3SDJA 5HTBA 4MAOA 2PY3A 2BRHA 2W5BA 3UG2A 1XR1A 2YDIA 3U6HA 4D4YA 2ETKA 5IA0A 3MW1A 4FMQA 2G2IA 3R83A 4GIHA 4JNWA 5AM7A 1YWNA 4IZAA 3QTZA 3WIKA 4CLJA 2J90A 3QA0A 5AR2A 4PRJA 2F4JA 4LUEA 3COKA 3AT4A 4G6NA 4BKYA 3ZM4A 1J1CA 5LOHA 2W9FB 1OITA 1Z9XA 3G6HA 4FIJA 3QTWA 3QYWA 1YHSA 3UO6A 4BZNA 1Q8WA 1T45A 4JBVA 2XKFA 3KXHA 2OXDA 2J2IB 3RPYA 2XK9A 3ORKA 3C7QA 5C01A 5A6NA 3LFNA 4FGBA 2BRBA 3EN9A 4FIFA 4QQCA 2G15A 1YHWA 4YJTA 4DH8A 2Z2WA 5KMLA 1JKTA 3CR0A 4Q5HA 4LRMA 4HGEA 2PU8A 2FSTX 3BLQA 3BI6A 4FSWA 4WKQA 3W2SA 4E6QA 5CAVA 1VZOA 4L3PA 4DG3E 5JK3A 5TF9A 3Q5IA 2WGJA 3SRVB 4FV6A 4D5KA 2UW3A 3OTUA 3DJ7A 4Q5EA 2ZV8A 1YHVA 3DBDA 5AP4A 2R0UA 5JMSA 5CVFA 4R5SA 4LMUA 3TTIA 5FEDA 2JKMA 3W1FA 4O7VA 5H8EA 2X1NA 4EK6A 4KD1A 3SAYA 3P9JA 2W1CA 2WEVA 4BL1A 3TI1A 4H1JA 4E5AX 2CDZA 4FV7A 3KULA 4B7TA 4MWIA 5CS6A 5D12A 3PDTA 3F6XA 4QTBA 3P86A 5CI6A 5BX0A 3OHTA 4RRVA 2J0LA 4NKSA 3TIZA 3S1HA 3DXQA 4LM5A 1YI6A 3VULA 4DT9A 5GIPE 2WQOA 5E8VA 1H08A 3OBGA 2GDOA 1FMKA 4E93A 2QOLA 2C0TA 3GU4A
chains in the Genus database with same CATH superfamily
2GNFA 3FI4A 2Z8CA 4FSZA 3RCJA 1DAWA 2RG5A 4O27B 3OC1A 5E7RA 4L43A 4ONAA 4JRNA 3AT2A 4BTJA 5L3AA 4TYHA 3ZSGA 2A98A 4GVJA 2UUEA 3ZUTA 4FF8A 3EJ1A 3OY3A 4XS2A 2X0QA 4CZYB 4FV9A 4KNBA 2CLQA 1IEPA 4XG7A 4TWNA 1P4OA 2X7FA 4CFXA 2OO8X 3DZOA 3FWQA 4RC2A 4DG2E 2R3FA 4ZTNA 3CQEA 5HO7A 3W2PA 4Y95A 4IAKA 3NFFB 3Q4CA 4P7EA 3JR1A 5CF6A 1M52A 4CCUA 1K2PA 4W8DA 3LFEA 5HNGA 1Z5MA 4OTIA 3LQ8A 4FV5A 4JT3A 3GCSA 4ZSGA 3EL7A 4YTCA 4ZJVA 3PJCA 3ZFYA 3CBLA 5LVPA 3JS2A 1ZLTA 3A7IA 1ZMVA 3MY5A 4H3QA 3SX9A 5M4IA 2AEGA 2CN5A 1YXXA 2ITPA 1OL7A 2GQSA 2OJ9A 5DMZA 3NRMA 5IISA 5FDPA 2O63A 3AGMA 4ENYA 1ZYCA 3BU3A 5LMBA 3B8RA 2XF0A 4EH3A 3TUCA 4LRJA 1KE9A 3Q3BA 1YQJA 1S9JA 4KSQA 5BVOA 2G2FA 3Q96A 3Q4UA 4TYEA 5FUTA 3AD5A 4I23A 3NUAA 2P2HA 1GAGA 4EEVA 3PA4A 3PJ1A 3I5ZA 3VQUA 2C0OA 2WQMA 1ZOEA 4PMMA 3FHIA 5CU0A 5KKRB 3VO3A 3WF7A 4PTGA 3LXKA 4RPVA 4MNFA 3FL4A 3QZFA 2HCKA 3VBYA 4E1ZA 5ANDA 3JVSA 3DXPA 4LV7A 4FTTA 4RIWA 2O65A 4FG7A 3PUPA 4HGTA 4CZUA 4YTFA 1JOWB 2X0GA 4I4FA 4C36A 5DRBA 4AOIA 2YWPA 3HA6A 3KK9A 3UGCA 4UYAA 4HYHA 3FPQA 4YUQA 4FIHA 2ZB1A 3GP0A 5BVDA 1FPUA 3AD6A 3ZLYA 1JVPP 3IG7A 2DS1A 4ZXTA 4F0GA 1GIJA 3L9LA 2WQNA 3QTQA 3FZTA 3L9PA 5M56A 4FODA 3MBLA 4TT7A 4CD0A 3QC9A 3G51A 5C8NA 5HG9A 3RP9A 3LLAA 4RJ8A 4BDCA 1Q61A 2Y0AA 2I7QA 5KMKA 2Q83A 3GC9A 3WIGA 1O6KA 5GJFA 1KOAA 4O7WA 3D15A 4FTAA 2BZKB 2IJMA 2UW8A 3MPMA 2AC3A 2C47A 4GKHA 1HCKA 2X9FA 5DLSA 3UBDA 2YWVA 5T3QA 3UZRA 5A4LA 4W4YA 4QQTA 4UX9A 2C1BA 3WE4A 2F7XE 2HENA 4FSRA 4FYNA 1E1XA 5CI7A 4YO6A 3UYSA 3KXZA 2C0IA 2ESMA 2W9ZB 4WO5A 3UG1A 4C59A 4S33A 3T3UA 5IA2A 4PNKA 4DFLA 1YDRE 4YU2A 3OCTA 4JOAA 5EH0A 2UZBA 3CGFA 2C6TA 1H1RA 4O84A 3IW5A 3ZYAA 4FKTA 5B7VA 4QYGA 3G2FA 3EQFA 2O3PA 4AOTA 3SXSA 4RQKA 3VBXA 4NFMA 5C4LA 1QMZA 2Y4IC 1SMHA 2XK7A 1Q3WA 3BL9A 4X3JA 4DEGA 2EVAA 2ZV9A 5E8WA 2H8HA 5HVKA 4DCAA 4HYUA 3LFFA 4QO9A 2YFXA 2FSMX 5HVYA 3DOGA 4NKAA 4AA4A 3W0MA 2XIKA 4XMOA 4FTQA 3HP2A 3RKBA 4F9BA 4ZZOA 1U46A 3ULIA 4TNBA 3S2PA 4KIKB 2OJFE 3RNIA 4OW8A 3QKKA 1OZ1A 4EH8A 3FC1X 4FGRA 4UMUA 4NTSA 4ZSLA 4O7SA 3GCVA 1CTPE 3QTUA 4NIFA 3QX2A 3JY0A 4R7HA 3KRXA 2HIWA 4AA0A 2XNEA 4O0VA 3ZXZA 2XUUA 4G6OA 3QKMA 4GK4A 4K2RA 3NUNA 1QPEA 3CCNA 4A9UA 4R3RA 3DS6A 3C4FA 4EC9A 2CKEA 3H9FA 3KN6A 4KKHA 1XBAA 3U4WA 2DWBA 4O0XA 5G6VA 2V62A 5AIRA 2B53A 3FQEA 5CEPA 2JGZA 3SXFA 4FYOA 4EHVA 3V3VA 4DHJA 4C4FA 3O2MA 2OICA 3ODYX 3A7JA 4OTWA 4EK4A 1MP8A 3MI9A 1DI8A 4RG0A 3G0FA 2ERZE 4NM7A 4YTIA 4O21A 5A46A 3KU2A 4KS7A 4ZLZA 4BKJA 2C69A 4ZAUA 3VUIA 2YIYA 5IQIA 2CLXA 4BZDA 2WAJA 3GC7A 4QTCA 5ETAA 5TKDA 1BMKA 5DEWA 2XKEA 5LVOA 2J0MB 3F69A 4R1VA 1IAJA 2OFUA 4Q9ZA 4F1TA 3DB6A 4XLIA 4C4JA 1BL6A 3OT3A 3UP7A 5L6PA 4MXCA 5EW3A 2WMVA 3ATTA 3I6UA 5CASA 3PVGA 3CS9A 3R1YA 3UIMA 4DT8A 4NZWB 3TUBA 3SW7A 3FC2A 4HCUA 5FP5A 4BDFA 1OIYA 3DTWA 4Y46A 2FA2A 3UYTA 4QDVA 1W82A 3A4OX 5ANKA 1P4FA 5HICA 3QWKA 4QMLA 3QRJA 4IZ7A 4FKSA 5EM7A 5I5ZA 1VLRA 4I5MA 4BGQA 5E9EA 4EBVA 4GSBA 3W10A 3QQUA 3V6SA 1OL5A 4GFOA 4X0MA 4Y5QA 2IPXA 4N6ZA 3HVCA 4JR7A 4UYNA 3LPBA 2XKCA 4G6LA 3Q04A 5CYIA 3N51A 4D0XA 4NK9A 2CGWA 4O2ZA 4A06A 4FKIA 3CKWA 1LEWA 3DK3A 5CAPA 3R8PA 3QLGA 3VUGA 1FBNA 3BEAA 3CXWA 1SNUA 2Y7JA 3NFGB 2NYAA 4IVAA 5J95A 5EYMA 2VWYA 2B9FA 3IW4A 3ZS5A 5GZ9A 4Y85A 4E5BA 5EW9A 4BYIA 2NP8A 2XA4A 3UVPA 3QC4A 3KRRA 4FZ6A 3CPBA 4AQCA 5C8MA 2ITXA 4XG2A 5HBEA 3EFLA 1JSTA 1UV5A 2F9GA 4EHEA 1VEBA 1GIHA 2R0IA 3HUBA 2X7OA 5EHLA 3OOMA 4ZJJA 1P5EA 1KE6A 4FNWA 4CQGA 3KFAA 2QURA 1PXKA 2VTAA 4L45A 3W16A 2VV9A 3IW6A 3EYGA 3UP2A 1TVOA 5LCKA 5BVWA 3OW3A 4U81A 3PY0A 4IWPA 1OL6A 2ZJWA 3VUKA 5GZ8A 3EN6A 3DU8A 2I1MA 3F5UA 4RIXB 3RPRA 3RWPA 2RFSA 5EM5A 2XEYA 4YO4A 4LUDA 2BMCA 4FKWA 3CSVA 2YIRA 3GNIB 4YJQA 4DH3A 2Z02A 2QLUA 2AYPA 4RA5A 3TV6A 3V5WA 3ZO4A 3W55A 4O0UA 3FI8A 2PE2A 2XIRA 4XG9A 1U54A 3TWJA 3VBQA 4XRLA 4ASDA 5K5NA 4S2ZA 3W32A 3GI3A 4EH4A 3C1XA 4QQJA 3KY2A 2J4ZA 1PY5A 2RFNA 4FVPA 4HVGA 3BBTB 2JAVA 4KIQA 3OROA 4WG4A 4V0GA 2VRXA 2ITYA 3KMUA 2HW7A 5HCXA 3FSFA 3TNHA 3LM5A 2ZV7A 4LYNA 3K3IA 5HHWA 2JLDA 2YM8A 4O91A 4EONA 5EQYA 1Q62A 3ZOSA 3PPJA 4FVQA 2HAKA 2RFDA 4FV0A 3QZHA 4BWXA 2UV2A 3G15A 3PWYA 4JG8A 4OTGA 2CKQA 4XUFA 3OCSA 5AP2A 3UDBA 4J7BA 5GZAA 3GCUA 5IQDA 4C58A 4BDJA 4CCBA 4Q2AA 2XCHA 3SLSA 4QDEA 3I0QA 2XH5A 1EH4A 3IDPA 3OP5A 3HV6A 4BF2A 5BMMA 2JIVA 4EYMA 5HE3A 3PXYA 3ZLSA 4NTTA 2QQ7A 4ZLOA 4L68A 3F2RA 3CP9A 3G90X 3R7GA 4ZTMA 1FMOE 4PQNA 1DI9A 3RZBA 2GS2A 2QKRA 3R22A 3IOPA 4I5HA 4FV2A 3F3UA 4AN9A 4F0IA 2W4OA 1TFFA 3FJQE 2ITOA 1OL1A 3ZO2A 3PPKA 2ZM1A 3A7HA 4G31A 3ROCA 1J1BA 4EHGA 5AAEA 4BYJA 3NIZA 1UNHA 4EOLA 4XV9A 1IA8A 2RGPA 4G3GA 2CKOA 4KIOA 5D41A 2OI4X 4TYJA 4U44A 2Y6MA 2XYUA 5CSVA 4EWQA 5AAGA 4IIRA 5KZ0A 3PG1A 3D5WA 3FZRA 3ZUUA 1NT2A 3UIUA 3KREA 3ENHA 2JEDA 4E4XA 2IWIA 1NW1A 4C57A 3R01A 4F08A 5LMKC 5AFVA 5EK7A 3AQVA 3TT0A 3VUMA 3I7CA 4FTKA 3E8EA 1W7HA 5CY3A 2ITVA 1J7UA 4F9AA 2CN8A 5LCJA 2EB2A 3PIXA 1H24A 3KGAA 3NCZA 4YHJA 5M44A 3VS5A 4NUSA 4NFNA 3P79A 2ZFYA 3FHRA 5ANJA 3ZMMA 4JXFA 4O4DA 3RAKA 4I4EA 5IMEA 5AIKA 3R2YA 4AZSA 4O4BB 3D7TA 5IG1A 2OZAB 5BYZA 4ZS0A 3ORMA 3ZO1A 3LFAA 2Y9QA 4FZFB 3O51A 1YXUA 5A4EA 3W0OA 4FSYA 3W0QA 3V5JA 3OG7A 4U41A 2GPHA 4APPA 2KTYA 1OM1A 1UU9A 2YLEA 3OD6X 2BRGA 4PMPA 1V1KA 2J51A 2Z7RA 4D2WA 2CHLA 4JLCA 3ZXTA 3PXQA 2I0EA 2OIBA 2W1DA 3P1AA 3W33A 5B2MA 4QYYA 4I94A 4C4GA 4WBOA 4L7SA 2BTSA 3GQIA 1U5QA 4IBMA 3AT3A 4WG3A 4KBCA 1ZMUA 2ZVAA 1AQ1A 4QRCA 3VBVA 3ZBFA 4AT4A 3R8MA 5A4QA 5A6OA 3BHTA 4RIOA 5JZJA 5LMKA 3DNEA 3CPCA 5CTPA 3PZHA 1ZOHA 2VTLA 3QU0A 5CSHA 1XMLA 3PPZA 4GL9A 1WBSA 3FLWA 4OTPA 3VUDA 5HLWA 4YSJA 2I40A 1XH6A 5IUHA 2RG6A 1PHKA 3QBNA 1STCE 5AV1A 2IZUA 5BVEA 2XAMA 4I22A 4GW8A 4P2KA 5CF8A 2WPAA 4AGUA 3IW8A 1ZRZA 2X81A 3FQHA 4GYIA 4OBQA 3NPCA 3DA6A 4RC3A 3REPA 3FZPA 2PZ5A 5D7AA 3O7LD 4BVUA 4BWKA 2X6DA 2OF2A 1FVRA 3VVHA 3RI1A 5JFXA 4HVHA 4RC4A 1OB3A 3OW4A 1A48A 4OT6A 4II5A 4BCJA 3IK3A 3NDMA 3AC1A 1XHAA 3BLRA 4G9RA 2VO6A 4X7QA 4C8BA 3AMYA 5AUXA 1W2CA 4EORA 5KX8A 4RIWB 3RZFA 3WF6A 2W17A 5DYJA 4L6QA 1W0XC 3G5DA 5EOLA 3C4EA 3EFKA 4RZWA 5E1EA 3R7EA 3WYYA 4CT2A 4LI5A 5J5SA 1URCA 2PVKA 4K33A 4GJ2A 3VS0A 4D9UA 1Q8TA 4GT3A 4DFYA 3WZKA 4DGNA 2FYSA 3L8PA 4F9YA 3DDPA 3JPVA 2BAJA 4HNIA 3VS2A 1OPKA 1OKZA 1TQMA 1XBBA 4R7IA 4XCUA 4LG4A 4XRJA 5L2SA 4AXEA 1REJA 3UVRA 3RCDA 1H07A 3C0IA 3O8UA 3TKIA 5HBJA 4PTEA 4TZRA 2VTNA 2XK4A 3UO4A 3TKHA 4EHZA 4QYEA 3NEWA 4XP3A 2XJ2A 4ZIMA 4BJJB 3A4PA 3LMGA 2ITZA 3EQPA 3S4QA 3VHKA 2GNGA 4ZK5A 4Z3VA 2VAGA 2ZM4A 4IJ9A 3O0GA 3WZJA 2PVLA 2BHEA 4ERWA 4HZSA 4MD8E 5BVFA 2RFEA 1W2DA 2W96B 1OIQA 2XP2A 3AMBA 3PLSA 2GHGA 1TKIA 2R3OA 2QOOA 3DKFA 3DXNA 3EQHA 3ANQA 3NAXA 4PWNA 4S34A 5CNOA 3SV0A 3QCXA 5M55A 3IGGA 4F78A 1KSWA 5BUEA 4PMTA 2BRNA 3TUDA 1JKKA 2C30A 2QNJA 3VWAA 4D55A 3H3CA 3JYAA 3TZ9A 4PDPA 4MH7A 5J1VA 3O7LB 1PXIA 1PXMA 1UA2A 2X9EA 4V01A 2GS7A 2FH9A 3LIJA 4XJ0A 4GV1A 5CSPA 5DVRA 4BCMA 3R8LA 1U54B 1B38A 5I9XA 3RHKA 1UU7A 4M97A 5GINE 5EHOA 5IA1A 4USDA 4IAIA 4X3FC 4UMQA 5F1ZA 5EG3A 2JAMA 3QAME 2EWAA 2BRMA 4TXCA 2BPMA 4FG9A 2QU5A 4JBQA 4BGHA 4DE4A 1Y8YA 3QHRA 4YJNA 1UKIA 4BCFA 4I92A 5J9ZA 5LWMA 2YM4A 1J7IA 1RJBA 4RFMA 4WNOA 1UWJA 3MIAA 3OF0A 4FE2A 5JEBA 3VS4A 5EQEA 3TV4A 4I5CA 2QR7A 5D7VA 5AMNA 5HU3A 2PVYA 4ZTRA 2C6IA 4NT4A 2P2IA 5F95A 3ZSIA 3DKOA 1JLUE 3R00A 4WSYA 2FO0A 4RVKA 4IVDA 5DG5A 5AR8A 3V8SA 1M7NA 3C9WA 4HVIA 4NCTC 3O8PA 3ZFXA 4YTHA 3TZ7A 3BELA 4HOKA 4BZOA 1PKGA 4EQUA 4R77A 3NAYA 1BYGA 3E3PA 1M2RA 3UZPA 2HZNA 3QUDA 4RFYA 4DGOA 1G8AA 2IVSA 2BAKA 2WFYA 4XLVA 4BTMA 5CAUA 3TNPC 3E93A 2JIUA 5AADA 5HQ0A 4U3YA 3QCYA 1G8JA 4USFA 3A60A 3Q6WA 4PDSA 2YERA 3NYVA 4AFEA 1IASA 3W2QA 4L67A 4IJPA 3NR9A 3IONA 4QTDA 2IVVA 4AQKA 3DAJA 5HO8A 3FV8A 3UDZA 4ANLA 4QMQA 3PXFA 3DY7A 1BL7A 5DT3A 4DGGA 5JGDA 3GU8A 3WF9A 5F4NA 4DEHA 4JDHA 4C38A 2YCSA 4RFZA 3UO5A 3HAVA 4G9CA 3GENA 4FTLA 1PMNA 4O6LA 1YXTA 5DR6A 3G9NA 3HDNA 4CFFA 3RJCA 4ZTHA 5ITAA 1T46A 4EI4A 3OEFX 4NM5A 2OLCA 3LE6A 4DC2A 2VWZA 3GXLA 4AZTA 2OJGA 3AKKA 1VYWA 4JDKA 3F88A 5EYDA 2XMYA 4JAJA 2JDTA 3VNTA 5KMOA 5E90A 2UZEA 4M8TA 2VD5A 5M4CA 1A06A 2XJ0A 2UZWE 2W0JA 2A19B 3OCGA 2X2MA 3UZTA 2F2CB 2VTHA 3QGWA 1R0EA 4WSQA 5E92A 3R9OA 3EN4A 2CKPA 2PVRA 5EM6A 5AR5A 5I0BA 3IOKA 1YOJA 3CLYA 3V8WA 1YW2A 3D5VA 1NVSA 5AX3A 2QO7A 5CEKA 5FBOA 1BX6A 1L8TA 1GY3A 5HBHA 1NY3A 2GNJA 1BKXA 5H8BA 5BYLA 3P5KA 4FEUA 4QNAA 4IDVA 2B52A 3CEKA 4OTFA 5FP6A 1H0WA 3HV3A 1YVJA 4LOQA 2XNMA 4QOXA 4U6RA 1KE5A 1CKIA 4H3BA 4JQEA 4P5QA 1H01A 2FSLX 3OXTA 4UY9A 5HESA 1YI4A 5HLNA 4K11A 3LLTA 2UZDA 4QMMA 5GHVA 5HG7A 3RVGA 4DHZA 1SM2A 5K3YA 3QQLA 2JFMA 3KVXA 5CEOA 1Q24A 2E9PA 3E63A 3FSKA 3LW0A 3R7YA 4M12A 3UTOA 2IZSA 5KHWA 4YJVA 4CTBA 4WRSA 3G6GA 3FKOA 5DNRA 2IW8A 5BQ0A 4A7CA 2E2BA 3DJ5A 4V0GB 5D9HA 1JBPE 4F0FA 3QWJA 3I5NA 5ANOA 2PUIA 3SOCA 3QD0A 4OBPA 4BWPA 4M7IA 4YJUA 1LR4A 5AA8A 1XWSA 4GRBA 5DOSA 3KF4A 3BV3A 3NUSA 3UPXA 4F1OA 4Y83A 3Q53A 2G2HA 1W84A 3CTJA 1HCLA 3B2TA 2YM7A 4FOBA 4J71A 3HAMA 3D5XA 4N70A 3LJ2A 4OTHA 5E8UA 3DTCA 1B6CB 2CCHA 2BDWA 2R7IA 2VNYA 5AUZA 4O0YA 3CC6A 3T3VA 4S32A 2GNLA 1O6YA 2ETRA 5HO6A 5IKWA 3DK6A 4EJ7A 5IA3A 4DYMA 3F3WA 3IKAA 3P7BA 2PVFA 4GYGA 4W4WA 5AX9A 2PE1A 5KE0A 4BHNA 3RK7A 4IFCA 4F9WA 3ML1A 4KBKA 2WTKB 2OIDA 1OGYA 5CNNA 3F2NA 5C1QB 2Q0NA 4RJ7A 4YNOA 3RALA 2A27A 2UW4A 3JVRA 4FL2A 2WEIA 4XOZA 4KKEA 3FZOA 4EOOA 5FM2A 2B7AA 2OWBA 3MFRA 1I44A 2GMXA 3RPVA 3L9MA 5J79A 5HI2A 3K5UA 4QMNA 3FMLA 3FMEA 3Q60A 3AMAA 4C3PA 1MQ4A 4JX7A 5C27A 3VF9A 3AC3A 3ORIA 3EIDA 2X0OA 1KV1A 3IO7A 2VTJA 3LZBA 3PXKA 4QYFA 4C3FA 2VWVA 3BHHA 3PUFC 5KHXA 4H3PA 4EOSA 2OZAA 2P3GX 2I0YA 2PVMA 3KXMA 4HGSA 4TPTA 4ENXA 4CKRA 4F6WA 2UZNA 3SRVA 3EQRA 1LUFA 2XNOA 5EKOA 4HZRA 3WF8A 3DJ6A 3L9NA 3VIDA 3HV4A 2XIZA 2HXQA 5A3XA 4F63A 2V55A 2B1PA 3A61A 4ITHA 4FG8A 3PXZA 4DLIA 4DFUA 3U87A 2J0IA 4Y8DA 4KWPA 1TZDA 2ZB0A 5IH4A 2ZDTA 4QTAA 3ZC6A 3M2WA 5C26A 1E1VA 4BCIA 2J50A 4YJOA 1GZNA 3LFQA 1B39A 1DM2A 2P33A 3QTXA 5HIEA 2YM3A 3OZ6A 5J1WA 3FXWA 3RK9A 5EDQA 3GU5A 4C0TA 3HZTA 2RL5A 3KKVA 4GVAA 2XRUA 3NIEA 4IXPA 5CEIA 2V0DA 5J87A 2BKZA 4MNEB 4FBXA 3FLNC 4MHAA 4FIIA 5IPJA 2I0HA 2IEWA 2FSOX 5J9YA 3C5UA 4WBBB 3R9NA 1SNXA 4BDAA 5HX8A 1BI8A 4M66A 1H1PA 2FB8A 2BKKA 2HYYA 2WTKC 3ORLA 2B9JA 1I09A 4XHKB 5EQPA 2X39A 3ZBXA 3ZCLA 3ALNA 4J1RA 5JT2A 1ST0A 3H30A 3U54A 3OMVA 2R3IA 2ZYBA 2F49A 2XS0A 4FL1A 4CT1A 4YURA 3SOAA 3NUUA 4B8MA 3COHA 4O96A 3ZSHA 4Q9SA 3FI3A 4D4SA 1ST4A 5FWKK 3UDSA 5DGZA 4RSSA 3AC2A 2B54A 3QZIA 4BDEA 1PYXA 2WQEA 4AGWA 3ZZWA 4U42A 4BKZA 4G5JA 3I6WA 3A7FA 4TYGA 4TRLA 4FEXA 3GU7A 4FTJA 4FV4A 4HYSA 3F5GA 4DH5A 3LQ3A 3R63A 3THBA 4QMPA 2VTQA 2YACA 3O5AA 3LFBA 4X6QC 4MK0A 3VBTA 3ZDIA 4PV0A 5CU4A 1YOLA 4FVRA 4DH1A 4YC3A 3D83A 3RTPA 3ORXA 5IZFA 4NJ3A 3M1SA 4U8ZA 4A9TA 4GT5A 3NYOA 5T68A 1OKYA 3ZHPC 5JRSA 3S00A 3D9VA 3K3JA 4YLLA 5TOZA 1XO2B 1KOBA 2IO6A 4MXYA 1PXPA 3UDTA 3ACJA 3QQKA 2EXMA 3MDYA 5A54A 4IM3A 4R5YA 3MY0A 5HOAA 4FT5A 5C9CA 3T9TA 5I9VA 2W1HA 4MNEA 4Z55A 1XKKA 1UU8A 1FVTA 3DFCB 4O7RA 4AN3A 5DT4A 4OAVB 5IH5A 2PHKA 2VO7A 3PJ3A 2WMUA 4IX5A 4P90A 4DGLC 5EI6A 2NO3A 1Q8ZA 2YM5A 3MVLA 4EQMA 2BR1A 3ZH8A 1M14A 3HMIA 5EOBA 3G0EA 4E4MA 4F9CA 2XK8A 2AUHA 5L6WL 5CT0A 3ZRLA 4EOKA 4BCHA 3QXPA 4YMJA 3WZDA 4U40A 2IVUA 2GHMA 3I60A 3PSCA 4BCKA 5FTOA 4J96A 2XYNA 2YM6A 5D1JA 3KIOC 4G5PA 2CGUA 5AUUA 3DPKA 4O7LA 1TQIA 5CANA 3NX8A 3O50A 3KB7A 4EOQA 1WBPA 3GC0A 2WO6A 4DG0E 4HPUE 4QP7A 4Y72A 1Q99A 4RQVA 5J7BA 1U59A 5IDNA 1W83A 2R7BA 4RVLA 3QD2B 3VONA 3BWJA 2JITA 4BDGA 3ATSA 5BYYA 3ACKA 4F7JA 4YZDA 3LMHA 4V04A 4XP2A 2YAKA 3F82A 3L8SA 5K4JA 2X8EA 4J99A 3ELJA 2C5XA 4NWMA 1JKSA 4NW6A 3V5LA 2YDJA 3SG9A 4IX4A 4UXQA 3RBWA 5JH6A 3OWPA 4S30A 5L2IA 1XQZA 1U4DA 4ZZNA 3MSSA 2H34A 2WQBA 4ZSAA 3LJ0A 2AQXA 3LJ1A 4USEA 2QI8A 3TDVA 2OJJA 5M09A 4FTUA 3NW5A 3QD3A 1Q3DA 2W1IA 5FGKA 2JBOA 4BBFA 4E4LA 3DK7A 4M13A 5E8YA 3LKMA 2JDVA 2QO2A 4MEDA 2YAAA 3A2CA 1OL2A 1MQBA 4CFVA 4APCA 4O83A 2LGCA 2XRWA 4QP9A 2ZMDA 3W0RA 4RZVA 1ZY5A 4ZP5A 3DLZA 1YXSA 1V0PA 2PUUA 1IRKA 3R30A 5JGBA 4Z16A 2DYLA 4K1BA 4XBUA 3BL7A 3KC3A 3PY1A 1ZYJA 4E4NA 4FT7A 2GTMA 2WHBA 2UZLA 5M08A 4ZTSA 1PYEA 4FSQA 3UIBA 4X2KA 2Z60A 3Q32A 5IA4A 3SVVA 4LFIA 4GS6A 4O0SA 3TACA 3GOPA 4U45A 5E8TA 4FKPA 2BILB 2O8YA 3TJDA 5AEPA 4KUJA 2OJIA 3HKOA 2ZDUA 5ANEA 4K77A 3F3TA 1H28A 2RF9A 3Q4ZA 4G34A 4L52A 4RBLA 3UNZA 3RAWA 5CXZA 3IDCA 4MQ1A 2ITUA 4AZWA 1H1QA 4AGDA 2ZV2A 4DHFA 5BNJA 5IQHA 3BZ3A 3F5XA 4UEUA 3Q5ZA 5M57A 4BCOA 4YR8A 2X7GA 1CM8A 3B2WA 4YJRA 4XYFA 4MX9A 4PP7A 2C3IB 5LXMA 4IM0A 3GT8A 2W5AA 2YJRA 2ETMA 5AP6A 5IH6A 3L8XA 2QO9A 3OUKA 3KRJA 4HGLA 3U9NA 4IAZA 2PE0A 2H9VA 2QU6A 2Z7LA 3IGOA 2WMBA 3MY1A 3TZ8A 4BIBA 4BR3A 4FKJA 3RPOA 4E7WA 4FUYA 2R5TA 4O4EA 2GNIA 4LGDA 5TE0A 3PY3A 2A1AB 5L8JA 5HNBA 4Y73A 4FZ7A 4EOJA 1JSUA 2W4KA 2PSQA 2OZOA 3Q4TA 4BI0A 2R3GA 4EC8A 4R78A 5HNIX 2HWOA 2VWUA 4FSNA 2BFYA 1JSVA 5DT0A 3ROYA 5KBQA 3EQIA 3HV5A 4GKIA 1PMVA 4DEBA 3CQUA 2BDJA 3MTLA 4IANA 2NRUA 3C0GA 4G16A 5E8XA 4JX3A 4QMZA 2R3JA 4JG6A 4IZ5A 2HOGA 4O38A 5ANIA 2WMQA 4O0WA 3ZZEA 5FDXA 2B0QA 4KS8A 5A4CA 4JS8A 2P55A 5AUVA 2R64A 3MS9A 4CMUA 2C3JA 2J0KA 3BHYA 3FMKA 2QOBA 3FBVA 4B6LA 5DWRA 3UOJA 5E4HA 5J8IA 3BX5A 1MRUA 3C4WA 3HA8A 5HIDA 3R7OA 3DDQA 4O86A 4IW0A 1PMUA 4IEBA 3LHJA 2PVNA 4NEUA 4ORKA 3U9CA 3RHXA 1JAMA 5M53A 2PZPA 3HMOA 3NYNA 2XM9A 4ZJIA 4C02A 4CMTA 5JFVA 2YLFA 4TKSA 2CJMA 3M11A 3C4XA 4D5HA 3NZ0A 2Y4IB 2ZOQA 4W4VA 2W1EA 4M3QA 4L3LA 2XIXA 2ZMCA 2HZIA 4LL5A 3EFJA 4NU1A 2R3MA 4WNMA 4ZZMA 5JRQA 3QQJA 3PYYA 2O2UA 4MTAA 2Y8OA 3P7CA 4DGMA 4BIDA 2W7XA 4CV8A 3SKCA 4MUQA 3WZEA 1ERKA 4XBRA 1X8BA 4R8QA 4YZ9A 3RNYA 5HZNA 3QL8A 2RIOA 1JWHA 2C1AA 2NRYA 3KXXA 1OIUA 4DCEA 4UMPA 2O5KA 4DDGA 2AC5A 4U97A 1YDTE 4RWIA 4C4HA 3GOKA 4AP7A 3TMOA 4ANOA 1ZOGA 3D7ZA 4ACHA 1PF8A 3POOA 3V5TA 4AW2A 4PP9A 1