5LWYL

Revised crystal structure of the human adiponectin receptor 2 in complex with a c18 free fatty acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQQFWSTPYTFGGGTKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adiponectin receptor protein 2
publication title Structural insights into adiponectin receptors suggest ceramidase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lwyL00
1L0XA 1VADB 5JOFA 3HNVH 5EU6D 5MENA 1NEZA 3RVVC 5GSVA 1C08B 2EDTA 4LSSH 1EEYA 3HMWL 4MS8C 1Z3GH 3UZQA 3SE9L 1TTGA 3TT1L 2CLVA 3PWPA 1PW3A 4K9EC 3VXMA 1R5IB 1KEGL 3BE1L 2DLIA 4M4RA 1PVHA 3ISWA 3KDMA 1KCVH 1FFOA 5J13B 1FN4B 3F7VB 4QF1A 4K3DH 5MP6H 2WANA 2W0PA 2HJLB 1U3HC 3FQWA 1P7HL 1U3HB 2AK1H 2BJMH 3HZVB 4MJ4A 5AWNH 2AEWA 4NM8H 1JRHH 1LO5A 1CXLA 5E9DA 3G6JB 2DJ4A 3LIZH 5JA9A 3I02A 2F8XC 2BERA 4UV4L 2P8MA 4UINL 5GRXG 3ALXA 3L3DB 3W81A 3VXUB 2QSQA 4LLUA 4QXGH 1F3DJ 1W0VB 3OX8B 2RCSH 3CDYA 4NRZB 4LP4A 1MJUL 4NHUA 2YD5A 3MX0A 4HJJH 1FLRH 1WBYB 4APQD 4F57L 1I7RB 1F42A 1QSFB 1A4JA 2ZKHL 5ICZB 5DHVB 3BRDA 2ICEA 3QEUA 3R0NA 4FABH 3D5OF 1UZ6F 4BH8A 3DVGB 3ARFA 3TVMD 2FWOB 3HC0B 2MMXA 4PG9B 3MYZA 4CMMB 1QBMH 2CD0A 2O5ZL 4PJ8B 2XPGB 1TVHA 3CNKA 5IMOA 1KTDA 4KMTL 2SEBB 3VFSB 4UV7L 4NQXB 4Q9CA 2FEDD 4G6FD 4GS7C 2E9BA 1DBBL 4GS7B 5SWSD 4UNVA 5C0EA 5I66B 4UUJB 3VFGH 2HVKA 4G9FE 1JPFB 4MZ2A 4ZS6D 2QSTA 3VFMB 2AJ3B 4MNQE 1IM3A 1JWMB 4MMZC 1EUUA 3FFCE 4G43A 3RGVD 1FORL 4YDJB 1DSFH 5EU4A 4P99A 1QFWM 2VZSA 2P8LB 3BGMB 1OW0A 5IW6B 5KSAC 2GJ6A 1UB5A 5KSAB 4P23D 3QDGD 2EC9T 4RISL 1T5WA 3UPRA 2ADFH 3ZDXE 2VKXA 5J1AB 1JMXA 5I6XC 4KZEL 1WK0A 4LPTA 3S35L 5JOPD 1FAKT 2UY7A 1CCZA 1RZKH 2F74A 3BUYA 1SMOA 4UDTA 4UNUA 2F9BT 4PPTA 4R0LC 1RV6X 5GGUB 3DJ9A 3DPBA 1KPUB 4WY7L 4Q2ZB 1S9KC 3KYOB 3FN0L 3IJHA 3IB4A 5DSCB 4DEPB 2IPKB 1P53A 4KJQD 3GDBA 3IDYC 5M94B 1L7TH 4TSAH 3MQIA 5E7FA 1T0NA 4MA8H 2C3VA 5HHOA 5T1KD 1S7WB 4MGXA 4ZQKA 5EO9A 3VFPB 5HYJD 3HPJA 3UTTD 3TJHD 3AY4C 5ELIA 1XF3B 1VEPA 1I1FB 5ID1A 4OD1L 1U58A 1EFXD 1QSEA 1VGEH 1HNGA 3N06B 4YR6B 4CW1A 4XWGL 4JFXA 1DBML 3ORJA 4IRSC 3CVIL 3SJVB 2IANA 1ZTXL 2BMKB 3VE0B 1S9XB 4GG6E 2C3GA 5KOMC 4UU9A 2Q76B 2EYSA 5I15H 1BMGA 3K8KA 3QIWC 5TGBA 3QIWB 3MRQA 2X6MA 3AM8C 3WLWD 3PE9A 4HX1A 4LDOB 4YHZL 4LSUL 2BSTA 5GS0L 2AJZA 5F89B 3GO1L 5HHNB 4P2QB 1T4KB 5F9JA 4X6FB 2VIRA 3QXDB 1E6JH 3QFDB 1NAKH 2VLME 4WU5A 3QNZB 4TSCL 5KS9B 1RK0B 3U9UA 5KOVC 4F58L 1G9EA 3VGBA 2X41A 2P7TB 2CJUL 4ZAKB 3VI3F 4X6CA 3DSFL 4D0CA 3FAXA 1IFHL 3FRPA 3UDWC 3N1GC 4KRMB 4M7LH 4HW6A 2W91A 4H1LB 2X7LA 4M1GH 4XPFH 4XBPB 5EZIL 1HSAA 2FO4B 3WUZA 4GRLB 1N5AB 5DMYA 2YD7A 4PLOB 2YEZB 1BQSA 4RWYH 4AQOA 1B0RB 1Y18A 4FTVB 4MD0A 3TPKA 3VW3H 2H2SC 3JWOH 4KHTH 4E5XA 5I1HH 4HXAH 4OD3H 4PRIE 4D8PB 4TUOA 1ZXQA 4LPCA 1D7FA 4V2BA 3QWOB 3VDAA 4XAKE 1LP9F 4QHKI 4JY6A 4NYLA 5C9KA 4XPBL 4OZIE 2BVPA 2HN7B 4PJCB 4JPIB 4OKVA 3ULVH 1DANU 1H3GA 3T2NH 3EO9L 1AD0A 5I1JH 2F8OA 4PY7A 1QFOA 5ABDE 1CT8A 1LEGB 3UTOA 4R97C 1QO3B 5H37H 7FABL 5TDOB 4AEHH 1CGSH 4YE4H 4IMLB 1MIMH 1C5CH 1G7QB 5DQJB 4U6HA 4GUPA 5DRXB 3SGDH 1CXIA 4TTGA 5A2FA 1GPOL 2KZWA 4MDJB 3RY6A 1S9WB 1BGXH 5A16A 1HN1A 3OGOE 2Q8AH 3IGAA 3D2UB 1IZKA 4NZRL 4X4XA 5C0FB 1KIQB 4L8SA 3WJJA 3FT2B 4P9HL 1XGQA 3LPGA 1T0PB 3KPRB 3HR5B 3ARBA 1F6LL 1LNUA 4I3SL 4MX7A 4KMLB 1XIWC 2NQCA 2OI9B 2XQYG 1XIWB 3I6GA 2F54A 1MEXL 3LQMA 5CEZL 3TH2T 4K7FA 1XF5B 3B9KA 2R2HA 1J18A 4O4YH 1GVIA 1NC4A 4NQEB 3GKZA 2DWEA 5F7LB 4CADB 1M7IB 4PJIF 5GSRB 1KTLA 4MJIB 3KJ4B 3REVA 1IGIH 4KXZI 1MHEB 4PLNC 3BZ4B 4WI9A 3Q3GB 4MCZB 1CI5A 1OAUL 4X83A 1XGYH 3IVKA 4EOWH 4OI8A 3T09A 3ZKQD 3IFOB 4ORGB 4MD4B 5CBAB 2AP2A 4JGJA 1AJ7H 5CD5C 1DBAL 5HDQH 3LKOB 4DVRL 4NO2A 1U8NB 1TMCB 5L2JA 5L6YH 2A77H 2NY6B 4MYWB 4FFVD 3DO7B 1MFCL 4XVTH 1U2CA 4QGYA 4XCNB 5DJ6B 4U1IA 5IJKA 1CD1B 4DUWA 1HXMA 1D9KD 1S9YB 2F53B 1DQQA 4XNXH 2HT2D 4FQXC 4OFDA 4FQXB 4QRRA 1NDGA 4P5TC 4R96B 4U1JB 2R56H 4P5TB 2ADGA 4Z77A 2WBJC 4XHJD 1N2RA 1LK3L 2D03L 15C8L 2FR4A 4MJ2A 4HFWB 3V6OA 4DW2H 3C60B 1WTGT 4PJ9D 3MLRH 4UB0H 2XZQH 1BQHG 3WXVH 1SEBB 1D6VL 5CINL 1A0QH 1KENH 3IU3A 1J1PH 4NNYA 5IWLC 4R26H 3X17A 1Q38A 4ONHB 5DGRA 4P2RD 1U8KA 5DRZB 4RNRA 2HH0L 2XG4A 3TBWA 5CCKL 2OSLA 1C5BH 3MREB 4ZODA 4DVBB 2CKBB 2EDOA 2YXFA 1GOGA 1RU9H 1FC2D 1T20B 3I2CL 5IB1B 2VL5A 3IDXH 1S8DA 1T22A 1QQDB 5BZWB 4YHOL 3KPQB 4ZOAA 4XPTL 1KCRL 2OTWA 2W65A 5HGDA 4IS6A 4AEEA 2YZ1A 4YHIB 4QHUA 1FYTD 4PJ5A 4KTYA 4WWID 2IADA 2XA8L 3W2DL 3TO4A 3SDDA 4FQ1H 1NMBL 2X1QA 1MAML 3FB5B 4WNQB 2IJ0C 5IGXH 2XZAL 5ACZA 5D7LD 4ZUWA 3DRTA 3RP1A 5BV7C 5HVWA 1FO0H 2P5WE 3QXWA 4L5FH 5BV7B 5HD8C 5DURB 2J6EH 4U1NB 3DMMA 5F6HJ 3QEGL 3MXVH 4OZHE 1EEUA 4R4FL 5KJRL 5LGHL 3S8WA 1YMME 5GRUH 3RVUD 4XNYL 5F8RC 5J11C 3Q6GL 3P0VL 1FNLA 3QIBA 5LXGL 4QRUB 1EIBA 3L95A 3KPSD 1X4ZA 1MFBH 3MA9H 1FLTX 4HWZB 1JPSL 4AIOA 3QG7H 4DN3H 4H25A 4MA3B 4HZLA 2MHAA 3HZMA 1N64H 1S7TB 4HPOL 5C0JB 4N0CC 1PSKL 5FM5M 4NKIL 5GZOC 2BNRB 3DX8A 3MRCA 4LCWB 5D72L 2CMRL 1OVZA 2VL4A 4ZXBD 4P5MB 1NKOA 2NYYD 3S36X 3WE6A 4JHWH 4RMTA 3KGRA 2RIKA 3MJ8A 3T1FA 5JTWA 1KLFA 2MQ3A 1NL0H 4K2UH 4V1DA 1YEGH 4XNMA 2I5YL 1PGRB 4MHHG 5C0AD 4DTGL 3RWIA 3GSNB 3BT2H 4D3CH 3BKMH 1MF2L 4Y19D 3C8KA 2NPLX 1AGEB 4JFDA 3TV3H 2OLDA 4TRPH 4PJAF 2JF1A 4R4BB 1WZ1L 2P5ED 3QISA 4KQ4L 1A7RL 5INDA 3GSNL 1X5YA 3WKNA 1NKRA 1FZKB 4KK8D 4NHCL 4CDHA 3D18B 2ESVD 3VGDA 3T0BA 3WFHB 1J12A 4TUJB 3MUGB 2YWZA 3HE7A 1BF2A 5IBUB 4Z5RA 1IGCH 4ZUVB 1U8PB 5FGBA 4LSDA 4ZDHB 4PB0H 5HHXL 1ITCA 3S3SA 1M7XA 1WCBB 3F62A 1UA6H 2YPKB 4XNUH 4KKAD 4IJ3C 2I07A 4PJEE 4IJ3B 2HT4C 1GZQB 1KC5H 5CLWA 2V17L 3OJMB 2IBZY 3ARDC 4YX2L 5IV2A 4TUKH 5SX5H 3CDGB 3ARED 3FB6B 2YXMA 1A1MB 1KULA 4F2MB 2J8HA 2DF3A 5HYSG 2YUVA 5JW4R 2ZSWB 2CDFA 4XVJH 1L6ZA 1ADQA 1CXEA 4X6BB 2ZUXA 1IM9A 3HG1D 4M03A 3O11B 4CRPA 5ICYB 1D5BB 3CH1A 5C09B 2HKHL 4FFYL 4K3JL 4WV1C 4K3EH 3VXRE 1ZLSL 3LKNB 4GRWF 2VLRE 3UPAA 3THMH 1BJ1H 4LSQL 1UENA 4RFEB 1K5NB 1A3LL 1TTFA 3DXAD 4N90E 1YYLH 3BKCH 5I1IL 5EZOH 3HZYB 3K81A 3QI9D 4Z7UE 1WZLA 3GIVB 1A6WH 5IFHL 1PFCA 4YWGL 2EYRA 1R3HB 2B2XH 4XXCA 4J4PD 4WTZG 3QEQD 2IFFL 3T4AB 3VXSD 5DK2B 5F3HB 1W72L 1I9JL 3L7EA 1NC2A 2VXUL 3O8XC 5JUEH 4KJPD 3MRBB 1G7JB 3O8XB 4HKBA 5ITFA 2DIBA 5KN5A 1ZKAA 4D9LH 3BWUC 3IYLW 2R2EA 5D6CA 4HFUL 1CE1L 3LKPB 4ONFL 1LP9B 1HKLL 2DN7A 3RWGB 4HS3B 4HC1L 5DUPL 3GMQB 4I3GA 5EO1B 5EU6E 3TWCH 1JCKA 3K80A 3LKRA 4KRPD 4P49A 4G9FA 5DHYB 1PKQB 1KCUL 3L7FA 4WWKA 4X5WB 2EKSB 3U1SH 3Q1SH 3WIFA 1JZ3A 3RUGB 1J05B 1N6UA 3IDJA 2UZYB 3FFCA 3FMGH 3TNNA 3IDIA 3P9WB 2XQBL 5J89A 3MRMA 3HI6H 3B6SB 3TO2B 5IVXA 3GIZH 5JQHC 4BSWB 3SDXE 3PHOA 4IIQC 4F37F 4JO2L 1FG2A 4JFEB 5F9WC 1CYGA 3V5KA 5F9WB 4MJ5B 4DOHB 5DQDL 1P69B 1RULL 1JFQL 1OP9A 3QT2A 3CGTA 4Y16C 3NPSC 1NJ9B 5EIQA 2YMXL 3NPSB 1KELL 5HY9A 1J8HE 5F88B 5SX5K 2ADJB 3BAEH 3O2DL 3ZKND 2VLKB 4DCQB 4NT6B 2MCG1 1C12B 5I8CB 1CLOL 4L3ED 4X9FA 3PQYE 3UTPE 4I2XB 2VR5A 3ILPA 4QHNB 1IT9L 2AGJH 2ATPA 3KXFE 5HVHC 5HVHB 4QOKD 2A9ML 5FUOL 1UWEH 1A9EB 1ED3A 1AQDB 4GKSA 5I9QC 1HHHA 1OTUC 3DI3B 4FQLL 1OAZH 5I0ZA 1T7XA 1ZOXA 4RGNE 3PDOA 1DEDA 3GSXB 2BHUA 3U7WH 2ID5A 5FOBB 5IESH 5CKAA 4WEBL 2VOTA 1OAXH 4LLDB 4QNPF 1MCJA 2FLBT 3REWB 1LO0L 5FYJE 3QEHB 3DECA 3QHZH 1NANI 3D3VE 3MR9A 5D7JD 1H8NA 4KV5F 2IAMA 1JF5A 2AV7A 4JZJB 2OJZL 1QVOB 3G5ZA 5C0BE 3F8UB 2R0LL 5C3LD 3GB7A 4KK5C 3W9EB 4LFHG 4H5SA 4KK9D 4PG2C 1PLGL 1FNEB 1VFMA 3K2UL 5F3BA 3C6LD 4YAQA 4F3FA 1H3XA 1IEAB 2DIJA 3WHXB 1SVCP 5C07B 1X5IA 5ESQA 2Z31C 3VRLF 2XWJA 1R3IH 43C9A 4MXVF 4O2FA 4O51A 2YR3A 3MGTB 4S2SA 5FK9A 5FKAA 2BVTA 3M8OH 2QSCH 3F7PC 4GG8B 1T04B 3ARGD 2QR0A 4XPAH 3TCLB 3KVQA 4L4VE 2VXQL 4OGXL 5DLMH 3CFIC 3CFKB 2IFGA 5J1TC 2Q20A 3M45A 1ORQB 5DT1L 1IAOA 4LVHC 5JPNA 3P9LA 1YPZE 4PJHF 3I50L 1P4IL 3OXSA 1VFAB 2HFFB 1FZMB 1YYMH 4YQXL 1CBVL 5CKGA 3MRHA 1Q1JH 3BZEB 1CVSC 1JYXA 5F7DA 3UBXG 3JSSA 3SKUD 3UTTE 5D1XC 4U7SA 2WIIB 3CX5K 3IETA 4HKJA 2JJSA 4AMKH 1FCGA 5BZDB 2Y4SA 3F12B 3IS0X 4DGYL 1LD9A 1SJVA 2H26B 4Z76A 5IHBA 3AFLA 3CCHA 1P2CB 2E7CA 3LD8B 5TQ0L 4JM2F 3RVTC 3MRDB 2XN9D 1DVFB 3BP4B 4K23H 4L1DA 4NZTL 3S3PA 1IGML 3MBEB 4R4ND 1P5UA 2IMMA 2VDMH 3HCVB 2DQJL 1NCUA 1VADA 4KZDL 2H2PC 1RI8A 3TNMA 4YC2B 1N0XL 1LEIB 3B2VL 4WU7A 4GW5B 3IFPA 1A7OH 1C08A 3LH2H 3LQAC 2A9NH 2WP3T 1JNLH 3MYJB 3LSOA 2PXYC 9CGTA 3VXQB 1YEHH 3CLEL 2QADD 4GJTB 5DEZA 3VXOB 4GW1B 2BOBA 2Z4QA 4AYFA 5BOPA 2NY2B 3F7VA 1IEBB 5DD1H 4EUPG 4G5ZL 3IKKA 4WTXA 2IQ9H 1F02I 1ZHNB 1MAJA 4YLQT 4CMHC 3QQ3A 2DQTL 4P4RB 5DMIL 4G8GB 3SN6N 3FN9A 4F9LC 5TFSL 2GFBB 3L3DA 4RSVA 3D39D 3O9WD 1IGJA 4X9HA 5B38G 1W0VA 3S3JA 3ZTJH 4QY8B 4JFZL 4PD4J 5L7XH 1BBJB 4BFIB 1K3ZA 5AUMA 3RPIB 4AK1A 4X7SH 4RX4A 1QSFA 1IL1A 2K9UA 5L2KD 5F6IB 1YC7A 35C8L 1JGUL 1GOFA 4U31A 1OF2B 5DHVA 1PY9A 4UIKL 3VMPA 5C0RH 5IM7A 3MV9B 4PJAB 3PWJB 4JQXA 4M62H 2GW5A 1IKFH 3IXAB 4JRXE 4PG9A 4CMMA 4FHBD 4PJ8A 5DC0A 1T83C 3KLDA 1XGUB 4S1SH 1HILA 1I1AD 1RIUL 2ZUTA 4P2OC 1R3LA 3ULUF 2G5RA 2SEBA 1T89A 2D7MA 5GPRA 1FJ1A 4WHYG 4JN2B 1M6OB 5I66A 1MHCB 4UUJA 2EECA 1IC5L 3MODL 4BELD 5ILTH 4PTTA 3VFMA 1C8PA 4XGZB 4U2ZA 3AAZA 4WFFE 1JWMA 3LKQB 1D5MB 2B5IC 4YDJA 4GQ9H 4RRPG 2B5IB 2P8LA 3W5NA 3EHBC 5FCUH 3TN0B 4Q9BA 4U6XB 1C5DA 4X4MA 4CN4A 1CIUA 1A6AA 3PV7A 5IVOA 1K2DB 2VAAA 4TULL 4JZOB 4IOFD 3O6FA 3CFDA 1ZT1B 4Q6IA 3MRFB 3HR6A 3KYMA 4JFYB 3UTZB 1Q9OB 3JVGC 5I1LB 1QFPA 3TZVC 3D48R 2BC4A 3TZVB 1RJCA 5GGUA 4XAWL 1KPUA 4KXZH 2WUBL 3HS0B 3KYOA 4LCUB 1NCAL 5E94A 2AJUL 1K4DB 1H0DB 1V7NH 1ACYL 2APXA 2IPKA 3WJLC 2BVUA 1RUQH 1V7MH 4O2CB 4MAUL 2H9GB 1S7WA 4X6DB 5GJTL 2AEQL 2HMIC 4RFNB 5HDBF 3U0WL 3G5XA 3KYKL 2ZJSH 3BQUA 1NSNH 3WFBL 4XC1H 1OGAE 4PJIE 4DUVA 3QPQD 4ZS7H 4YR6A 3WSQH 1X6LA 3E8UH 2P5WA 5J9PB 2GT9A 2VZUA 4OZHA 4JPVL 4Q9RL 4PJ7F 1YMMA 2HVJB 4HBCL 4FQ2L 4NJ9H 5EDXA 2YZ8A 3C8HA 3N1PC 3S36H 4PRPE 3VFNB 3GMRB 1DFBL 2DD8L 1BECA 2V5SA 4FP8H 1M1SA 4H88H 4Q58C 2I9LA 5GJSL 4F9PA 4UT6H 4P2QA 1T4KA 4NPYB 4O2EB 1MRDH 2B4CC 1GL4B 1JE6A 3QXDA 3MLWH 4NRXB 3QFDA 5ADOL 4JG0H 5DJAB 4MNGE 1UKTA 5T3XH 1RK0A 2HJKA 4Z18A 3IAGC 3RVWC 4ZAKA 1QLFB 2ERJB 2CLRB 4X7TA 4XP4L 2HWZL 3EO1B 5GGVH 4KTEL 1IC4H 2X9WA 3VFWA 2KBGA 5BVPH 3U4BL 5EA0H 4PRNA 4FFWD 4Z7OE 1ZHBB 5DVLA 1F97A 4HK3N 4GRLA 3LQAH 4X0KB 2AQ3A 4M8QA 1D5ZA 3HAEG 4JPKH 4LHUD 4FTVA 2HTLD 5IF0B 2BRRL 4P3DA 5BJTB 2GSGB 4G6AC 4OJFH 2Y6SD 3I9GL 1E27B 2NNAB 4K3GA 1MHHB 4NQCB 5IBTL 3QP3A 4NSKB 1YEEL 3FO0L 2PN5A 3MLPA 4AM0B 5HSFA 1R5VB 4XVUC 4Y5XC 4Y5XB 3ZE0F 2HN7A 4P59H 3NH7L 4NN5B 5D7LE 3CFBB 3TFKC 1BWWA 5DHXB 3WEXB 4PJDF 3QCTH 4BH7B 4JN1H 3BXNB 5JHDD 4LF3A 4R2GD 5F6HI 1LEGA 2O5XH 5TQ2L 4YXKL 3O6MH 4PJXF 3STBA 5J6HB 2O93L 1QO3A 3U0TA 1AHWA 2OZ4L 4WO4B 1IAKA 4GOSA 3JV4B 3KPSE 1JI1A 2CLZA 4X8JB 5TDOA 4YHLH 2EYTB 4OZ4B 3QUZD 1MVFA 4U6TA 4IMLA 1G7QA 1KSRA 3QH3B 5DRXA 4MXWH 5FV1L 1OTSD 3BDYL 1ZLWH 1JNNL 1U8LB 4M5ZL 1QNZL 5I74C 5ECJE 1S9WA 5I74B 1HHKB 1A7QL 1TJGL 1UCBH 5J7CC 4E41E 1NH6A 4F7TB 4OCRL 1HHGA 3VXRA 5JZ7C 3FT2A 4OCMC 3LN9A 1UWXH 2VLRA 1A8JH 2H6PB 1CLZL 5CHNB 4DGIH 2VXSH 2EDQA 3P73B 1B4JH 1KCLA 5AEAA 4KTDH 1QHPA 4O5LH 2LVCA 4NKMB 1U8QA 4Y19E 1KIPB 4P57B 1HK6A 1LE9A 5JR1H 1I3UA 3C5JA 5FYLE 4BFGA 5T1MA 4X9BA 4JO3L 5JMOC 2AK4E 2P5EE 4OZGE 5F21B 1H3VA 2YC1B 4Y89A 5GSRA 3HA0A 1CGUA 3JZ7A 4OGAC 3LHPH 5FKPB 4E9LA 5E6ID 3GRWL 1VKXB 1A6UH 5D7IE 4QXTA 3QIUC 3C09C 3C09B 3RZCB 4XMKH 2OTUA 4MD4A 2L4OA 1I8LA 5H8DA 1E4XH 4S0SD 4PJHB 1U8NA 3LY6A 1J0KA 3D85D 2VQTA 5T5FH 5EUOF 3DO7A 4UBDC 3U2SB 5DJ6A 4XCNA 4QRQB 4KI1A 4WI6A 5FUZH 3MA7A 2FX7L 3WFEL 5HVGB 2JJVA 1FIEA 4OIBA 3VCLB 2F53A 4Y2OA 4EUPB 3OR7B 1J0HA 4Y4FB 1X3DA 4R96A 4U1JA 2VYRE 2GYSA 1GAFH 1YECL 2HFGL 1G7IB 3DV4A 4NQVA 4BFEA 4ZUTB 3QUXA 3FONB 2N7BA 1P9MC 2EC9U 1WGOA 4HFWA 3C60A 1QKZL 3KLAB 4GT7A 3RL1A 4JM2B 4M6ML 4N68A 3H9SD 3I3EA 3OTTA 2EE2A 3QPXL 1F8TL 4Y1AE 1PG7H 5C1MB 3CVHL 3P4OB 3SDXA 3SDCA 5DZNA 3UJIL 3RTQD 3ZDYF 2WBWB 3CSYB 1ZHLB 1F4HA 3F7RA 4M48L 4JFOB 3LEYH 2AXFB 4M43L 4JHAL 3BN9C 3MRGA 1ZAGA 5J12C 1KIRA 5DYOB 1XAUA 4Y4KC 3H0TB 4Y4KB 1U3ZA 4DVBA 4NC1E 4YPGA 2J1KA 1T20A 5IB1A 2GUOB 1ZLWK 3KPQA 1MRCH 1H3PL 2N4IA 1I9IH 4GRWE 5DVMA 4YFLI 3HMXL 3KXFA 5CJQH 2QQKL 3ARVA 5IG7B 1XR9B 2HLFC 4K8RC 1X9QA 2ATKA 3BH8B 1UWXK 3MOAH 3UTSD 4JY4B 3FB5A 2BY2A 1KJMB 4IRJC 5D9SB 4WNQA 5E8NB 5GGQL 4IRJB 4OUUA 3K8LA 3VFVB 1P7KA 4NWUL 4R8WL 4YJZL 1FL6A 1IJ9A 3MV7B 3QUMH 2ED8A 4PRBB 1KXQE 1MCLA 2GTZB 5FO8B 3DARA 4IMKA 3OKDB 5ESAB 4Z0BH 3D3VA 3ZE1F 4QRUA 3V6FB 3PV6B 4GBXD 3OHXB 4WW2C 2C1OA 1T0MB 1RUPL 1DL7L 3HMWH 5C0BA 4G8IB 1OY3B 2WLZA 4W4NA 4OTXH 3MV8D 4MA3A 4WUKL 4R7NB 3NA9H 2CDGB 4Y88A 5EOTA 4HIEA 4YNYB 4YGVA 6FABL 3B9AA 4M6AA 3UP1A 1KEGH 3SPVB 4KDTA 2PYEB 4CVZA 4F7EA 5C0JA 2NX5D 3LEXA 4AIZA 4XBGA 3WD5H 5JIPA 3I75A 1T2XA 1FYHB 4D0BB 25C8L 3H8NA 4ODHL 1CG9B 5JW5B 3ULUL 4BZ1L 3NPZB 2PW1A 3PABB 1JHLH 3D25B 3FQUB 2H45A 3ULVD 4QT5A 3LPWA 4KUCD 4UINH 5GGSY 3V4VL 1F3DH 1QA9A 4L3EE 3GSNA 4AY0A 2UVFA 2ZOLB 2Y9RT 1MLBA 4LKCB 2C26A 3FB8B 3WNMA 1AGEA 3SO3B 4F57H 2MCPL 3BGFC 1HYSC 4QOKE 3BGFB 2JELL 3BVNB 4J7RA 4R4BA 5EBLB 4TTDD 2ZKHH 3DTXA 2ZCKH 5ESVB 4ODSH 2FBJH 5F7MC 4OLZL 5I71C 1N4XH 1JF6A 1FZKA 4FNLL 5B39G 1BD2B 5DR5L 5D5ME 3QFJD 4PRHB 3D18A 4DZ8A 4TUJA 3MUGA 1NANH 3K3QA 2R1YB 1AO7B 4XH2B 1U8PA 2O5ZH 3IT8D 5DHVH 1INEH 4QRSB 4XCCH 3G5VA 5T33L 5E8OB 1LEKB 1WCBA 2YPKA 3CUPB 3ROOB 5LVEA 1B3JA 2IPUG 4JKPH 3BSZL 1UKQA 3RWEA 1OD9A 1QD0A 5J3HC 5JXED 1NGYB 2C3XA 4NBZB 3VRJA 1I8IA 5IQ7L 2Y7QA 1Z5LB 4RISH 1FPTH 4PJ7B 2ZSWA 4KV5E 4RA0C 1R0AL 3CLFH 4LVNC 4LVNB 2BNQD 5ICYA 2OR7A 1D5BA 5C09A 4WEMB 4KZEH 5LBSL 3VFUB 3S35H 1I3RB 3SCMA 4LNRA 5BRZB 4Z78B 1U8JB 4XZUB 4WY7H 2Z8SA 3FN0H 2W9EL 5GRJH 4FXGB 4FQQA 4Z95L 2IBZX 3FQNA 4EDXB 3VRLE 1P7QA 2H32B 4NC2B 1BZ7B 3IJYA 1MCPL 1W72A 2ICES 5LWYH 1XZ0A 3PUCA 1OLLA 4NKOB 3RAJL 3B5GA 2O5YL 3N9GL 2BK8A 1S7VB 3PGCA 3MJ9H 1CDGA 3CFCH 4OD1H 1QEWB 4IEFB 3U7YH 4ZNCD 3G9AB 4GRMB 2G5BB 3ZKMD 1DBMH 2A6KB 4J6RL 3CVIH 4FQIL 4Q0XL 2PETA 1ZTXH 3LS4H 4HC1A 4L4JA 5JW3L 4RA3A 5FF6A 2AXGB 1W0WA 2JB6B 4HIIB 4IRSD 3KJ6L 4WUUE 3LKPA 1CQKA 1LP9A 1Y6MR 3SE3A 4YHZH 3BEWB 2AJSL 4HS3A 1A14L 1FNGB 2J4WL 3GMQA 3GO1H 1P4LA 5F1OB 1HHJB 4ALAL 4PJDB 1M71B 5DHYA 3GSOB 2EEAA 3BN3B 3K4DA 4X5WA 3VRIA 2EKSA 4YIQB 4P9MH 1NFKA 3GSUA 5D7SL 5C0IA 5IKCA 4UT7H 3GM0A 1AGDB 1IGYA 3ARPA 1S3KL 3QAZC 3LV3A 3TH4T 5C2UB 4MNHA 3B6SA 3DX7B 1NAMH 1RQ5A 5HPMB 4BSWA 2J5LC 1BFOA 2J5LB 3O2DA 4JFEA 2W9DL 1CFTA 1IFHH 4MJ5A 2IBBA 4OFYA 4TNWF 1QYGL 4RQQB 3WIHL 1LK2A 4TVSa 4LASL 2P46B 2EH7L 3LZFL 4S1QL 4APQB 5D2LB 1NJ9A 3WLBB 1I1YB 5F88A 1OP5H 3O81A 2ADJA 4H0IA 4X9IA 2JJWA 5CIPB 1RZGA 5DVNA 5LG1A 4NT6A 1XFPA 1GGTA 3G6DH 1C12A 5I8CA 4I0PD 2B20A 4UNTA 4L9LC 3TVMB 3D39E 1FVCB 4I2XA 2JCCF 2WAHA 5INCB 3PL6A 3B83A 4QHNA 3P77B 3TC9A 1IC7L 5JPMA 3FO1B 3NFNB 2DQGL 5T1LD 4JLRA 2FEDC 4PGZA 2NY4D 3U9PH 1G7MB 3LS5H 5SWSB 1BQHA 1CZ8L 3NAAH 4QTHA 5MEND 2VLLB 1CFVL 2VE6B 4XMLL 1XEDA 2YD8A 3RGVC 5FOBA 3RGVB 4PJIA 4ISVA 1UJ3B 2LTQC 3QQ9D 3O3AB 1QR1B 4P23C 3REWA 4P23B 4PGBB 3QDGB 4JRYB 3VXMD 1KB5B 1L4IA 3F7YB 5CBEB 1QBBA 4JZJA 1QVOA 2ZCHL 4Q97A 4PRPA 3T0EE 2GTWB 4RWHA 2N1KA 5EUOB 1UZ8B 3P0GB 3W9EA 4QHLB 2C5DC 1UACL 1UXSB 1KB5L 4OM0L 1VFOA 1BZ9A 4C56E 1KBGL 1TPXC 1S5HB 1TPXB 1Y6NR 2G75A 3LAFA 2OQJA 5DC4B 2WV3A 4NZRH 1IEAA 5E9DD 2D31B 3R06A 5ADPL 4P9HH 1D5IL 5C07A 5HTSA 1CD9B 1OQXA 2M2DA 1YPZB 3MROA 4R6UA 1D6EA 3MGTA 1KJ3H 4I3SH 4ZD3H 1J0IA 2FEEL 5T1KB 4RMSA 1T04A 2GK2A 3TJHC 5HYJB 1HIML 3V95A 3WKML 2DYPB 4HUWB 3TCLA 4LL9A 5FYKE 1QRND 3MNZB 1EFXB 3CFKA 1FIGH 4RIRB 1S9VB 2IALA 5E99L 2X10A 1OB1B 5A40E 3LRSB 4HK3J 1ZLVH 5IIEB 1FL5A 1EMTL 2VDRL 4G8EB 1U2HA 3GMMB 4M3JA 1UM5H 1CLCA 3D9AL 1CFBA 1YEFL 4KAQL 3EO0B 3WLWC 1JZ4A 3L3HA 1OP5K 1MFCH 4JQVC 1KYOJ 3MACL 4MB5A 4XTRD 5I8KL 2H26A 2UUDH 3I6LE 4H20L 1INDH 1P2CA 1RUAL 2GJ6D 3MRDA 1DVFA 1DBKH 4HF5H 3SY0B 2D03H 3U4AA 1I4FA 3MBEA 3ZMRA 4M61A 1J87A 5CZVL 4YXHL 5GISL 3TPUA 3BUTA 4RZCA 2AJYL 3G08B 2WBJD 3H9ZA 5E8DH 4RCAA 4Z7VF 4U6VL 2FL5B 4LLQB 1LEIA 1MFEL 3PJSB 1SVZA 4GW5A 4JAMA 1EGJL 3NMEA 3T08A 4U1LA 1JV5B 2FCBA 4LLYA 1ZHKB 2Y06H 2X42A 3MYJA 2AW2A 4LBEB 5BXFB 5CCKH 1V3MA 4XP5H 3F5WB 3R1GH 5DK0B 4E41A 2ARJA 3CDFA 3VXOA 1A6PA 1A6ZB 2W0FB 4DKEL 2MJWA 4GXUM 4LSRH 4K94L 1FBIH 5HHPB 4GXVL 5CD3A 2EIEA 4IDJL 5HHOD 4ERSL 4YHOH 2DQDH 1KCRH 4ELMF 1ZHNA 1X5HA 4C54A 4OF3A 3WS6C 1YQ2A 2VDNL 4P4RA 4ZNEE 2X9XA 3OKNB 1QSED 4G8GA 5I1KL 3U6RB 5JDSA 2B39A 2CO6B 2P24A 5IK3B 3NCCB 4WRLA 4OCLC 4QY8A 3C5SB 2IAND 1NMBH 1MAMH 5HI5D 4BFIA 3HC3L 4D0DB 2DM4A 5K9JL 3EKCA 3ZYIA 1B2WL 2HTKC 2XZAH 2A73B 5FV2A 3CXDL 4KROD 4OGZA 5HYSA 1RJZA 2X4NB 3SQOH 1OSZB 4OLVL 5LGHH 4WGWB 3MV9A 4PJAA 1G9NC 1KN2L 3Q6GH 3P0VH 2GITB 5LXGH 1TJHL 3MMEB 3OMZA 5HD8D 3IXAA 2NY5L 5I1GH 1WF5A 1JBJA 4X4YB 1E28B 4HJGA 5DD6A 2ICCA 5AD0A 4JM4L 1JPTH 2BY0A 4PGCB 1G0XA 4JN2A 5FYJH 4HPYH 3P9MB 4LCIL 5GGRY 4HHAB 1MHCA 3QO1A 1DQMH 5E8PA 4M5YL 1AGBB 1PSKH 4GAJH 1IQWL 4PJXE 2VKWA 1D5MA 5D72H 3RL2B 2UUDK 3GMLB 4Y1AA 3IFNL 3TN0A 3OKKA 5TF1L 4WTZA 5GZOD 5DJZA 1RVFH 1IGTA 3ALWA 4IRZL 3NIFF 4A6YH 3VH8G 3UC0L 1CTNA 3LN5B 1ZT1A 1XGPA 2AKRB 3V5HB 2DLHA 1X44A 3EOBB 1A4KB 3MRFA 2YSSB 4JFYA 2W60B 2APFA 3ETBF 4LARH 1AGFB 1HH6B 1WZ1H 3UBXI 4ZPTB 2IG2L 3HS0A 4FFVC 5F97E 1SEQL 1DP0A 1K4DA 3D0LB 3SKMB 1XH3B 2YRPA 4NZDA 1J1OL 1MCRA 5D93B 1CDUA 3RWCB 1D9KC 4NHCH 4P2YA 1A7NL 4EJ1C 2HT2C 2LU4A 4LLVB 1YY8A 1J0JA 5CILL 2Y36L 3GHBL 4L9DA 4XHJC 5HHXH 1CVRA 1A9BB 2E27H 3DUSB 3BP6B 4PJ9C 4PJ9B 3I6KA 1U8HA 3PDGA 1I7TB 1NLBL 5KAQF 3BDBA 4MA1C 3J7HA 4MA1B 4FOMA 3DRQB 4ETQB 1HI6B 2OL3B 5J9PA 4TNVK 3W5MA 3A67L 3C08L 2F58H 4IHOB 4MAYA 2HVJA 4LLMB 4OGYL 4CVXA 4P2RB 1X6NA 1OAYL 1FVDA 4HK0B 3GMRA 2AV1A 3ARDD 1FFQA 3L3OA 5IEKA 3ARBD 2YPLB 3RX5A 4O2EA 2HKHH 2KPNA 4K3JH 2BDNL 2F54D 3ET9F 5DJAA 2CR6A 1ZLSH 3S5LG 3B9KD 3IJSA 5E03A 3S37X 3JTSB 1EAPA 1NGPL 1NC4D 5EBWB 1A3LH 5L8JB 4GSDL 4MDIA 1FYTB 2FH6A 3KNBB 5I8OL 3OAZH 5I1IH 2DBJA 1ZE3C 3WNPA 5JDJA 4NO0A 5D2NC 4WCYH 5D2NB 4CNIA 5IFHH 2X4UB 4RMRA 5KAQG 5IQ9B 4YWGH 1VFBA 2Z35B 5BOZG 1EHLH 1QLRB 2NXYC 4B0MM 2R8SH 3DX6A 4KQ3H 5F9DC 4X0KA 4Z8FH 1FSKC 2IFFH 1LO4L 3GJEB 3P2TA 5CSZB 5IF0A 1W72H 2DTML 1I9JH 3KPMB 3RWHA 5BJTA 5EWIH 4LMQE 1QBLL 1DANT 2VXUH 3P4MB 3UTSE 4ONOA 2JLLA 2VN7A 2NNAA 3S9DB 4NQCA 2YUWA 4U1GC 2NW2B 4G3YL 4U1GB 4AENA 2OZ4A 1CLYH 2YHGA 3CFBA 4HFUH 2XZCL 5IHUL 1P1ZA 1ND0B 4ZOCA 4ZFOB 1HKLH 3V0AC 3NACH 4HC1H 5DUPH 5HYQB 1AP2B 3BKYH 3JWNC 2V7HA 5KVMC 5FA4B 2Z92A 2B7DT 3BEVB 4OQ1A 3BESR 5J6HA 4ZXBC 2DWDA 4WO4A 4ZXBB 3N1MC 5FGSA 3D69A 1F58H 4ZFOL 2A6JB 4OZ4A 2XQBH 3MV8E 2VDOL 2AJXH 3DX9B 2VERN 3WIIL 1F2XK 5C0AB 4ONGH 3ZE2F 3BD5A 1UM4L 2DJSA 4I9WD 3VGAC 1A5FL 3VGAB 2I26N 2R23A 5DQDH 5DD5L 1RULH 1JFQH 4CJ0A 2X1XR 3OV6A 5E6ZA 4PTUB 1TZHA 3INUH 3IS1X 5ERWA 1JZ7A 4XPGL 3UBXA 4F7TA 5FHAH 4PJ5D 3VXNA 3TBTB 4ZSOB 5H2BA 5ANME 3MGOA 3TO4D 4Y16D 3EJZD 4PYHA 3X11B 2H6PA 5SWZB 1CLOH 3SDDD 3ULVE 2FX8H 5CHNA 1MI5D 2BVYA 2ESVB 3CZJA 5HPOA 3GRWA 4OLYL 2W0KA 2CGRL 3F58H 1KIPA 5FUOH 1Y0LA 3VFOB 4KJWC 3IU4L 3DMMD 2GSIB 3CZFB 2DLEA 4KKAC 5EOCH 1FL3B 1G9ML 3QIBD 1VKXA 4KI5E 1RJLB 5J4MA 2LU7A 2X9YA 3OAZK 4LSTL 1EHNA 4WI3A 3IDMB 3AS2A 4DKFL 3VG0L 5F7WC 1KT2B 3RZCA 1CFQB 3AREC 2HKFL 3AREB 3G6AB 4ZFFA 3SGJC 4LSVH 1RUKL 3QQ4B 5IR1B 1NMAL 5JORB 2DICA 3VA2C 4IOIB 3MUJA 2CK0H 3U2SA 4QRQA 3HG1B 3PWUA 4FQJL 1NCWL 5FHBL 3CC5A 4XCYB 2AABL 4WUUA 5TE7L 4EUPA 1KJVB 3OR7A 3MLZH 2EEBA 4Y4FA 5B8CA 1PLGH 1PY4A 3O3BB 4DJMA 3CVHA 4HD9A 5DRWB 2JJUA 2D7QA 2F5BL 3KPNA 4LP5A 5EN2B 5IT2L 5I19L 5IJVA 4V1DD 2P43B 1EEZB 2NW3B 1FE8L 1E4WL 1DBJH 4JM2A 3DXAB 4NC1C 3WS3B 3LQZA 3OAUL 1YJDC 2NY1D 5B38A 1BJ1J 3QI9C 3WDHA 1PEZA 3G04A 3QI9B 1ZA3B 4U1SA 1HSBB 4N5ED 3P4OA 4MQ7B 4JFDD 1RK1B 3BIKB 3CSYA 3DYPA 1ZHLA 4TOYL 5A3IC 2Z31D 2Q3AA 2AXFA 4J4PC 3O6KL 4PP2B 3SDYL 1S7XA 5F9OH 3GKWL 3QEQB 5DYOA 4OGXH 3PP3H 3VXSB 4NDMB 5T1DL 4G6JL 2NTFB 2JB5L 3HMXA 2QLVB 2XQYK 4KJPC 4LCYB 2X5PA 2QHLA 5DT1H 3HE7D 3BPCA 4OM1L 2J8UF 1G84A 1UWGL 1BAFH 4RMQA 1CBVH 4YQXH 5EZJB 1K8IB 3ECBB 5FGCE 2MSPA 2KQNA 1F11A 5ALCL 5DJ2B 2VDPH 2QV2A 4GKZB 1WTLA 1XR9A 3FHAA 3BH8A 1QLEH 3STLB 5GGTL 2B1AH 5F1NB 1RHHB 2Z93B 1KPRB 3PWLA 4RMWA 4JY4A 3BWAA 2E6PA 4RRPA 1U8IB 5CGYC 4Y5VA 5D9SA 4OQTL 1MPAL 4KRPB 5E8NA 1YEIH 8FABA 3F65A 4LU5H 2F19L 3CK0L 5TQ0H 4PJFE 5J6GA 3VFVA 4NZTH 3RWFB 3JUYA 5T3XD 2XFXA 4PREB 1A7PL 4DAGH 3MV7A 1MCWW 2D7TL 1IM9D 3MRLB 3Q5OA 4CU8A 5A2JH 3VH8B 5FO8A 3RVTD 4M3KB 3OKDA 4YFDB 2DQJH 4KZDH 4POYA 2A6DB 2ZNXA 4OZFB 4RBPK 5KVGL 4NZJA 3V6FA 4XP1L 3B2VH 5I73B 1AR2A 1T0MA 3TH3T 4LQFL 4FQHB 4Y2DA 4O9HH 3VMNA 2GQHA 1FVEB 3OAYK 4R7NA 2CDGA 1FDLL 4OB5L 2J12B 3TJEL 2PCPB 4C56A 3SPVA 2PYEA 3QHFL 1XF4A 3CX5J 3S4SB 4HCRH 4WW1B 4PJBF 1F90L 4PGDB 4AL8H 4Q6YA 3L5HA 4MVBD 3P11L 3PWVB 4D0BA 4PYGA 2VSDA 4RAVB 3VFTA 5JW5A 1C1EH 2ZOKB 3VFRA 2D9QB 3D25A 3FQUA 4W6WB 4NNXB 3PP4L 3QDJE 5B22A 4Z7WE 1NC2D 1WC7A 1OD7A 1RUML 3BD4A 2QKIB 4PGEB 4JFZH 4NO5A 3KWWB 3FB8A 1AFVL 5HHVH 1MHPL 5HGAB 5EBLA 4H8WH 1G1CA 1DLFL 35C8H 3LVEA 5D7JC 1Z9SA 5FYLH 5D7JB 2D0GA 5JXAH 5E2JA 1P84J 1DQLL 1TQBB 2JCCE 2ARWA 2R1YA 1E4KA 4G9FD 4XH2A 3S5LB 1OTTD 4G7VL 2VZVA 4G8FB 1RIUH 3C6LB 3FFCD 3ARWA 3PWPE 1LEKA 4F7CB 1B90A 3VXME 3KR3L 1X5XA 3L5IA 3ROOA 4HIXL 1IC5H 1I7ZB 5DA0B 5IW1B 3QO0B 1Q0YH 2AJVH 4X5XB 1OP3K 3ZKXB 3QSKB 3ARGC 4R90L 2X70B 3ARGB 4UAOC 1ZA6B 4UAOB 4TSBL 4PR5B 5KZCB 4PJ7A 3HAEA 1I85A 1ZT4A 2BZDA 4ODWB 4HEME 3MBXH 4BQ6A 3I3BA 1UYWH 4YHPA 1WT5A 3MRRB 1EHAA 3QJFB 5IHZA 2YK1L 4JY5H 1NGZB 4ZOBA 1NFDF 1OGTB 4Z78A 1U8JA 4XZUA 4XAWH 4BZ2H 2WUBH 4X7FC 2FEEI 3CFJA 4LIQL 2IH1A 5E2WL 3AU1A 1NCAH 5J1SC 2AJUH 4FXGA 5IVZB 5GGSA 2H32A 2H1PL 5A2IH 1VGKB 4HAFA 1MQKH 1FZOB 4FFZL 5HHME 4PB9L 3GBLA 5IMLB 5GJTH 1KCKA 2XN9B 3EDJA 4NKDB 3AC0A 2AEQH 1S7VA 3L6FB 4GRWH 1JPGB 3ZDZE 3U0WH 3LEVL 3KYKH 4QLRA 4WI8A 4UTAL 1EXUB 2BP3A 5HJ3B 4R4NC 2IAMD 3WFBH 3AGVA 3IAQA 4OSUL 5T3ZE 1QEWA 4I18A 1HDMA 2Y5TB 2A6KA 5KSBF 4PD4K 4JPVH 4Q9RH 2DS4A 4HBCH 4RMVA 4FQ2H 1CF8L 1F4YH 2AXGA 4LMQI 4HIIA 4O02H 3BO8B 4N8CL 2Y1VA 4JFFB 2VLMD 3M1BA 1ZGLA 4LEXL 3X3GL 5C0DB 2QADC 2QADB 3BEWA 3V6BR 4XC3L 5GJSH 1FNGA 3OKEB 4F7PA 4S1RL 4QTIH 5BVJA 2DLFL 1HHJA 3NCJH 4PJDA 4YEEA 3T65A 1EZVY 2EXWD 4EVNB 1V3JA 5DK3A 4ODBD 2Y5EA 5ADOH 3GUTA 3HB3C 1D5XA 3WIHA 5FO7A 4PJXA 3MRKB 5K9KB 1AGDA 3DX7A 2QQLL 3D39B 3HRZA 2P8PB 3O9WB 5EULV 2HWZH 4EBQL 2O26U 3GNMH 4RGOL 4Z7VE 4YK4C 3SGKA 4NM4H 5K33A 1OPGH 5HHOE 4KTEH 4QEGA 5SV3A 4APQA 3UYRL 3NA4A 2UYLB 3OZ9L 3OSKA 1SJXA 3WLBA 4PRID 3U4BH 4QHKJ 5ALBL 3ZLQC 2VDLL 5L2KB 2F15A 4HQQH 3RY5A 4XAKD 3G9VA 4ZUSB 5E5MB 3HNTL 3PXHA 4G80A 1LO3H 1KGCD 4OCWL 4NQDE 3C87A 1NMCC 3FO2B 4U05A 3TVMA 5INCA 3I9GH 4NO3B 1GC1L 5IW3A 4XBEL 5EU7E 1I1AB 2VNCA 3FO1A 3DWTA 5B3NA 4HUVA 3RPKA 4ELME 3MRIA 4KPHL 3JV0A 3N0PB 4AJ0A 1S7SB 3T0EC 4XVUD 2VLLA 2VE6A 3SBWA 4JKMA 2G2RB 1G7LB 2R29H 2UZXB 3OKOB 1UJ3A 2OZ4H 3EOYG 2FECI 3DUUB 1PZUB 3O4LE 1QR1A 4Y5YA 2DAVA 3V5DB 2PR4L 1KLGB 4PGBA 3QDGA 2BSSB 4JRYA 4R3SB 4L4TE 4W4OA 1KB5A 4GLRH 5ETUB 3L1OL 3U0PB 1T3FB 3SGDI 4X6CE 4IOFC 3R4DA 3SKJL 4FQPA 1HWGB 4JZNA 2DLGA 5EUOA 1UZ8A 2CRIA 3IDNB 1QNZH 3HPLB 1L0QA 4LRNL 1TETL 1UXSA 3PXJA 5DF0A 2OK0L 3MC0A 3O45A 4K7PY 2KDGA 1S5HA 3MCKB 3O3EA 1RIVH 3E3QE 2D31A 4P46A 1AIFB 4WHTA 3OB0H 1YMHA 3RKPA 4OCSH 5C0NC 2PF6A 2JK5B 4HWBA 1I8MB 2ZCLL 1E4JA 4RX4D 1A2YB 5GZNC 1CE6B 4QCIB 2FJGB 3MUY1 2DYPA 4WFEE 4JO3H 1A22B 1JTTA 4M7KH 1TIUA 3MNZA 3EOAB 3QPQC 5EU3A 1EFXA 4NCDA 1S7UB 1S9VA 3KS0H 1BQLL 4X98A 1RJYB 1OB1A 3WFDL 3FZUC 1FCCA 3WBDA 3EGSA 4YXLL 5K93A 4G8EA 3GMMA 5TE6L 4E0RB 4OFKA 4ODVL 5CSBA 4U33A 3QNXB 3MOBL 5JOEA 3MLXH 3QQNA 2GCYB 1ULVA 2IBGA 1MCOL 3SKOA 4N0UB 4PGJA 2FX7H 3WFEH 5JW4N 3GSWB 4P2CG 2VABB 1YUHB 2MTPA 3OR6B 4XMPL 1YECH 1TCMA 2HFGH 1T80A 4LPWA 5I1AB 1EGJA 1NBVL 4X5LA 3FQRB 1QKZH 1TJIH 3O6FD 2CIIB 4WDIB 4JFPB 2XTJE 3OL2A 1F8TH 2FL5A 2X4TB 1JL8A 3CVHH 4KVNL 3U36B 3NCBB 4AIXA 1TNNA 1ORSB 3TEUA 5CLTA 3BW9B 4FFWC 3UO1L 4B7LA 1ZHKA 4HKZB 4LBEA 2ORBH 5CEXB 1FNSL 1EFQA 4JHAH 4P5KA 5C86A 1Y6KR 3DROB 4QRTA 3WDJA 1CQYA 5DK0A 4ODUA 5JHLH 2Y6SC 2DQFB 4XWOD 3RNQB 3H3KA 1DUYB 5FOJA 1TCRB 1WVZA 5ANMA 4L8BB 3FRUB 1TNMA 2I24N 3D6GA 4MD5A 4FRWA 1UVQB 4BQCA 3TLRA 2PO6A 1S7QA 3FKUS 4OT1L 3BQUD 1KCSL 4PJBB 4XVSH 3EYUL 1KUMA 4BUGA 1I75A 2QQKH 2XOTA 3OKNA 1MWAL 3K74B 1EK3A 5JHDB 4R2GC 2P5WD 4R2GB 2NY7L 1LILA 3OB0K 4JDZB 4HH8A 1MRFL 4PBVC 5ICXB 5C2BH 1YMMD 4LSSL 4QXUH 4PJGF 1CFNB 1N8ZA 5GGQH 2HJFB 4QRRE 4WHYH 5C7XH 1Z3GL 2GAZA 2YWYA 3N85H 4YBLC 4YBLB 5KS9F 2FH8A 3HZKB 2CXGA 4YPJA 2H3NB 3C6SA 1MJ8H 2D4DA 4NWUH 3QUZB 2WINB 4U6YB 3V4UL 1OTSC 4P2QD 4ETYA 2GITA 3H7BB 4Z7NF 4K3DL 5BCAA 3MMEA 4JGUA 5IFJB 5B21A 4KRLB 4LPXA 4X4YA 2AK1L 2BJML 1E28A 1RUPH 4NC0B 8CGTA 5AWNL 5CJXA 4I5BB 4NM8L 3LIZL 3VWJA 4LOUD 4NP4L 3ZKSD 3D0VB 4KJYB 4QXGL 2D2OA 2RCSL 1AGBA 4W68A 1FLRL 1KB9K 4I9WE 3RL2A 4MCYB 4PV8A 3QJHB 3GZKA 4URTB 4JDTL 25C8H 1TLKA 4GRLD 4ODHH 3ULUH 1XR8A 3T4YB 4BZ1H 1MCQA 4FTVD 4QYOB 5E6IC 5E6IB 1II4E 3V4VH 3MCLL 5B4MD 1IILE 2B1HL 3Q5YA 2BFVL 1VPOL 4YGAB 6CGTA 3A6BH 5DJ8B 3S88L 1LHZA 4JG1H 4ODTH 1WV7T 5E4IA 4U7MA 1FHGA 3EIFA 1AGFA 1KF9B 1HH6A 3RHWK 2O61B 2DRUA 4HMCA 3D85B 4HDIA 1N5YL 3VFGL 1NFDB 1XH3A 3D1MC 4H1LG 5FYKH 3SKMA 5KW9L 5DR5H 4RAHA 5DJDA 2HG5B 4LLVA 4PRAB 5JA8B 2BY1A 1UGNA 1FRGH 1FZJB 1JGEB 3B5HA 4XT1C 5T33H 3BP7B 1HWHB 3P30L 4NQSB 4X99B 1CICA 3FB7B 1I7TA 1VCAA 5E00B 3JTTA 1PAMA 2V5YA 5TDPA 1TZGL 4E42A 3H9SB 3DRQA 2J88L 5BS0E 2R4SH 1MCFA 3KPPB 3S7GA 3C5ZC 5IB3B 1RZKL 2WMPA 1K4CB 2FB4H 3BSZH 1I9RH 1KFAL 3RTQC 4NFBA 1W8OA 3KPTA 3CXHJ 1MUJB 5IQ7H 2XY2A 4NGHL 5CEZD 3VXRD 4HK0A 1XT5A 5KSBB 1A3RL 3MLUL 5E08H 4Y7MA 3MCG1 2VLRD 2C1PB 5GGRA 1R0AH 2QEJA 4HKXA 5J3HD 2JJTA 3PG2A 4R7DA 3SE4C 5DQ9B 1L7TL 4TSAL 2YPLA 2I60H 4B41A 3L5WB 3NIGE 4N90D 5LBSH 2BCKB 3L3IA 4X6EA 1Q9LB 4KKBD 5JNYB 3PIQA 4OAWB 4JFDE 3HAEH 1F00I 2XNAB 3BMVA 1P5VA 5EBWA 5CJ5A 5IROA 1VGEL 2YOCA 2W9EH 4G7YH 4Z95H 3VU2A 3KNBA 3X14A 2ADIB 2MKLC 3WO4C 3MRNA 3WO4B 2VQ1B 4HGWA 4GAYB 1ZANL 1NUNB 3BMWA 1G0DA 2LE9A 4MSWA 1MCPH 1CGXA 4RDQF 3RAJH 1U93A 1J7VR 3VA6A 4PLKD 1I8KB 2O5YH 3N9GH 5IQ9A 2WZPD 5HYFA 3QYCA 1QP1A 4M6OL 3QXUA 5I15L 3H3BC 3ULSA 1QLRA 3QCVH 3QZWB 5FECA 5FYJU 2X4PB 1JUFA 2H32H 2NY6D 2XACC 5E4EC 3LN4A 5E4EB 5CSZA 1T1ZB 3QDHA 3KPMA 2YRLA 3RDTA 4HUUB 5E8EB 4U1MB 4ZO6A 2MKWA 2J8UE 4GBXC 4D9QE 3DI2B 4ZYKB 1NAKL 5ISZE 4NUGL 4Z7QE 3NCMA 2VLJE 3QUXD 3RA7H 2JCCA 4UT9H 1OT2A 3C60D 4M00A 4C57C 3KJ6H 5T3XE 4MWFB 4NCC1 4ZFOA 3X12B 4M4PA 4EDWH 1A14H 2NX5B 2J4WH 5HYQA 3JWOC 1AP2A 5FA4A 3QULB 5ACMA 3SDCD 4M1GL 4V2CB 1ZWIA 2Q7YB 3VI4F 3UMTA 4XNQA 4LVEA 3ROLB 1MNUH 4RWYL 3QRGH 4RDQG 3ULVC 3TBSB 5JO5B 1X4XA 3HLAB 4K9EL 5I1HL 2EDBA 4HXAL 1J8HD 4OD3L 5C0AA 3TA3A 3AS3A 3W0WB 1JHTA 1DUZA 3WIHH 3PF2A 3PDDA 1MJ7H 4YDIH 2OCFD 2EH7H 3LZFH 3PQYD 4PTUA 3UTPD 1OM3L 1H15A 2Q8BH 1RZJC 5F1IB 4TTDC 1BOYA 4DZBB 3KXFD 5CUSH 2RHEA 3GSQB 5CP7B 3OJ2C 4ZSOA 3QG6B 4KI5C 2X4OB 3SKNA 3OB8A 1IAII 5SWZA 3QFJB 1R6VA 2PW2B 2J7LA 2LAGB 2UWEF 4RGND 1B0GA 2WW8A 2EXYD 3VFOA 1WFTA 4OFVA 2DQGH 1IC1A 5C08A 4AEHL 5K59F 5CJ8A 1CGSL 4XRCA 1VACB 4YE4L 2IWGA 1C5CL 5FYJD 1BJ8A 3D3VD 1RJLA 4XMLH 3V7MA 3IF1B 1INQB 1IQDA 1BGXL 2FD6H 1KT2A 1OCWH 3CMGA 5JXEC 5EBMB 5C0BD 2Q8AL 1MY7A 1H5BC 1A02N 3G6AA 4M7LT 3BFOA 5KG9B 3CJJA 5EPMB 3N1FC 2RFXB 1T6WA 3ZT5A 1ZVSB 5IR1A 5JORA 1PZ5B 1UC6A 3KPLB 4IOIA 1MFDL 2Y07L 1DN2A 5IVXE 2A0LD 3PWNB 2IQAB 2BNQB 3E6HB 2WM0A 3X13B 4XCYA 3G5YB 4XXDB 5C6TL 1CTOA 1KJVA 4DUXA 3V7AG 1KBGH 4O4YL 5I6XB 4G9DA 5C6PB 1YEKL 1AE6L 5DS8A 5ADPH 3SEPA 3DXAA 3NCEB 4R0LB 3E0GA 3MNWB 3FQTB 4L4VD 5C0CB 2X40A 1ZA3A 1XGYL 3QNYA 4MQ7A 1KV3A 5FGCB 1RK1A 5CGTA 2EDHA 4EN3A 4NFDA 1AJ7L 3CMOH 3GMOA 4Z7VA 5J8OA 3IDYB 5BQ7B 5L6YL 4PP2A 2A77L 2AQ1A 2P42B 1A6VL 1BIIB 2ARJQ 3QEQA 4Y4HA 4NDMA 2EIZB 5C9JB 1Q9WB 3ZKMC 4HWBH 5E99H 4LCYA 4N9GA 2YA2A 2A83B 1CICC 5MEOA 1MY5A 1V8HA 5MEPB 5GGTA 1U6AH 1ZS8B 5EZJA 1EMTH 1K8IA 4NQDA 4U3XA 2UVEA 1ZT7B 5T5NF 4OQTA 3I85A 5DJ2A 4IRSB 4KAQH 3MLRL 4UB0L 5FO9A 2KUTA 3V6ZB 1U8OB 3M17B 3QHTC 3WXVL 1IKNC 3ZSSA 2P47B 3STLA 3MACH 4ELMA 1KENL 5F1NA 1RHHA 2Z93A 1J1PL 5FUCE 3BJLA 3NABL 5I8KH 3QXAB 4EEEA 3FO9A 3L3GB 4H20H 1NCCL 4PRDB 43CAB 2G9HB 1SM3L 4L1HA 1IAMA 1JF1A 1J5OH 3RWFA 1MFAH 2ED9A 1Z0MA 4PREA 3C2SA 4PJGB 3QA3B 5IBUG 3MRLA 3O4LA 5GISH 3VH8A 1RU9L 5I2IB 5CGMA 1U95B 2AJYH 3HI1B 4L4TA 5C09D 4J23A 2ZPKL 3VD4A 3IDXL 4TN9A 3RJQB 4XI5D 1MFEH 5DJYB 4UI2A 2HFEB 4QGTA 5F7HA 3SCMD 1WIOA 1EGJH 3W39B 5GRVK 4FZEL 4FQHA 1HXYB 1B9ZA 1FVEA 2BVOA 2M26A 4LRIC 3FQXB 2PCPA 3NBNA 1E0OB 1FO0B 5F93C 1P7QD 4I0PC 1GGUA 4CN6A 4AEIH 5F7NC 4DKEH 3X3FH 5T5NG 4K94H 1K9TA 4JJ5B 4WW1A 3STZA 2NLJB 4IDJH 2EDXA 1JGDB 1U36A 4HIJB 5IGXL 2V2XB 1BEYL 3KPOB 2Y25A 3PWVA 1C7TA 5T1LB 1FO0L 2VXTH 3EFFA 4L5FL 2J6EL 3ALPA 3HUJF 2ZOKA 2NY4C 1I9EA 5DC9B 1P4BL 4LQ1A 4Z76B 4NNXA 4YDKL 5I1KH 2FGWL 5TE4L 5E1AB 5JOFB 1JMZA 3ARSA 1KGCE 1HH9A 5MENB 1KLUB 5EFIA 5GSVB 4ZUUA 3KWWA 5EOQL 3QQ9C 3HC3H 5K9JH 1MFBL 3GSRA 2DKMA 3MA9L 4FMKA 4M7ZC 4YHNB 1JNHB 5HGAA 5HHQB 2EDEA 3RUGF 4JRXD 4DWHA 3C2AH 4R97B 3NFPA 5I1DB 1RZJH 5GIRA 1CL7I 4UQ3A 4OD2A 1ITBB 2HTKD 1KN2H 2N7AA 3Q6FA 2MNUA 1TJHH 3TT3H 2ITDB 4FG6D 2NY5H 3S5LA 2ENYA 3H3PH 3FQWB 3DNKA 1KJ2H 1WWAX 3E6FA 4JM4H 1MCHA 4WFFD 5M7QA 3C6LA 5IFAL 3DBXA 2X4QA 1YEGL 5E9DB 2P8MB 2I9TB 3P4NA 3SDAA 1XF2B 3BT2L 1I7ZA 4OFYD 2RBLA 1KYOK 4M5YH 1JZ6A 4NHUB 3BKML 3QO0A 3TV3L 3U46A 1FAIH 4TRPL 3ZYZA 1IVLA 3MRPA 1JZ2A 1ZA6A 3QEUB 4PR5A 5TF1H 4BH8B 1QRNB 4M1DH 1SJEA 1NGXB 2EE6A 3ARFC 4HWUA 4ODWA 3G6JE 2R2BA 2X05A 3UC0H 3VXUE 3MRRA 4JR9H 3PL6D 5EC2A 3EFDL 5BW7A 2VB5A 1CXFA 1TVHB 1VEOA 3B9EA 1OAKL 1NGZA 5IMOB 1KTDB 1QSFE 4OLXH 5LCVH 3T3MF 1UA6L 1FV1A 2C4FU 4XNUL 4J3VA 5C0EB 4NUJA 5EIIA 2HVKB 5IVZA 5J57B 4BYHA 1J1OH 3NZHH 5GS1A 1IM3B 3RNKA 4XTRC 1OGAD 4G43B 1VGKA 4BKLB 1OW0C 4TUKL 3QUYA 1NGQH 4MXQC 5IMLA 2GJ6B 1UB5B 5L9DL 2XN9A 4NKDA 1RHFA 1JPGA 1T5WB 3DURA 1Q9KA 4RGMC 5DWUH 1S5IL 3UPRB 4RGMB 2I27N 4C83A 3TIEA 1GGCL 1NLBH 3P40A 5DD3L 1T1XA 1BZQK 2GEEA 1URLA 2WBJB 3HE6A 4PRPD 3A67H 4K3EL 2DKUA 3V8CA 1G6RH 2F74B 3THML 3EJYD 4OGYH 1OOAA 1OAYH 1NPUA 3PGDA 2FYYB 3IJHB 4JFFA 4X4ME 5C07D 3D87B 3BKCL 4DGVH 5EZOL 4KK6D 5I30H 1M7DB 4OFIA 1T7WA 3BZFA 4FZ8H 1A6WL 3OWEA 2BDNH 4ZQKB 2HT3C 4EVNA 3O0RH 3OBAA 2B2XL 3E2HC 2D7OA 3MRKA 5K9KA 1VENA 3WCYA 4GSDH 1DEEB 1QSEB 4CW1B 5I8OH 3O9WA 1CS6A 4JFXB 2IANB 2CKBL 5HI5C 2X4SA 5EU7C 4D9LL 4UU9B 4KROC 4DFHA 2H8PB 5TGBB 5F96H 3MRQB 1ONQA 1DLHA 3T77B 1UH3A 4HX1B 2BSTB 2AJZB 3VD5A 3FO2A 5F9JB 1QBLH 3BHBA 2VIRB 2BRQA 2NXYD 3TWCL 4P0DA 3SJVE 2YBRB 3U7AA 4OV5B 1QG3A 4WU5B 1NBZA 4CBPA 4BJLA 1DVFD 3Q1SL 3U9UB 4JO4H 1I1AA 2VDKL 5J11B 3HC4L 3FMGL 1GH7A 5GQBA 3HI6L 2XZCH 5IHUH 4ENED 3GIZL 2UWEB 5BV7L 1S7SA 5FEBA 2ICWI 4KY1L 3M07A 4OCYH 3TYFA 4P2QE 4Z0XA 3GJFA 5HVFB 2G2RA 3UYOD 3GBNH 4J8RB 4X80H 3DUUA 4JDVA 3RWDB 1HSAB 5BS0A 1L9NA 4YEFA 3TP4A 1I3GL 3U0PA 1T3FA 1Y18B 2VDOH 4YDVB 4MD0B 4E41D 1SMAA 4E5XB 3FOLA 1UXWB 2NY2D 4U1KB 5KTEH 1Q72L 5TF0A 1A5FH 3MLSL 1SBBA 1RURL 2FATH 1JYWA 3MV01 1UWEL 4ELKA 3T2OA 2BVPB 1VEMA 2VZTA 4XPGH 2AEIT 3QDMB 2FIRT 3HRPA 4G8GD 1OAZL 3GMNB 4OLWL 4PY7B 3LRGA 1CT8B 5FYLD 4FTVE 5SWQB 3U7WL 1UEYA 1EERB 2AK4D 5IESL 1JK8A 1SYVA 2JK5A 1OAXL 5IB5A 1I8MA 4MJ6B 2GHWB 4NBYB 5K9QI 4OLYH 3DSNA 2HA1A 4GFTB 5D6DA 3IU4H 1AY1H 1YEDA 3PGFH 3C9NB 4PJCE 3K4AA 3RVXD 2R0KL 3EOAA 1MCDA 3ZDXF 5E5RB 3T0DA 5CEYA 2XICA 3UJJH 1S7UA 1G9MH 4L8DB 4K7PX 4KJWD 3LMJL 5F72S 3RY6C 1R3JA 3BIAX 3EYSH 1QFWL 5A16B 3VG0H 1VSCA 3DO3A 3TCXA 1E4XI 3NTCL 4BSVB 5FAAA 1WITA 5IOPB 3IGAB 3H9HB 3RWJA 4L8SC 4X4XB 4E0RA 2J8UA 3WJJC 5ISZA 1KG0B 4H26A 3BPOC 1XGQB 2VH5L 3ZO0A 3BPOB 2VLJA 5C8JB 2CO7B 2HRPH 3ARDB 2QHRH 4QO1A 3ARBC 4FQJH 4N0UA 5T3ZH 5A43C 1KN4L 1LNUB 4MX7B 5FHBH 1LE5A 4N0YL 3M8OL 3UAJD 3I6GB 3ILQD 2F54B 3MLVH 3B9KC 4K7FB 3B9KB 4Y1AD 2R2HB 3TN0D 2F5BH 5HGBA 1I7UA 1NC4B 5I19H 3FQRA 3RIFK 1NGWA 5CEZE 2E5EA 4G6KL 4WV1B 1BQUA 1FE8H 3CPLB 3REVB 2CIIA 3KPRE 3JWDC 2WQ8A 2X4TA 3IVKB 1YYML 4GG6F 2YN5A 1LQSR 3SGEH 2CIKA 1MIEH 5H35A 5EG6C 1AQKH 4X6DF 1BREA 1PD6A 5CEXA 5I1EH 2R9HD 3O6KH 1WBZB 4NQEE 4NNPH 4AMKL 4C59B 5IJKC 4U1IB 5T1DH 1DN0A 2A6IB 4G6JH 4MJIE 5A3ID 1DUYA 1MWAA 3ARUA 5H94B 4OM1H 4JO1H 5IVNA 4KGJA 2LV4A 3HTLX 4L8BA 4LCCA 5CJOH 2FRGP 3DYOA 4U0QB 4Z77B 4K23L 3EYFA 1UVQA 1BFVL 2FR4B 5DA4A 3V6OC 2Z91A 4NCC2 4PJBA 5ALCH 5HGHA 3KYAA 1GGIL 2HRLA 3FL7A 2VDML 2ICWA 5HI4D 1O7SA 2CRYA 2XYCA 2ZUUA 2CDEB 1SJHB 4GMSL 2VISA 3HUJB 3IRPX 3KG5A 4NNYB 4MAYD 1U3JA 4BSJA 2F53E 1A7OL 3LH2L 2COQA 1CFNA 4OQTH 2VWEC 5F7YC 2E7LA 1U8KB 4RNRB 3CK0H 3OJVC 4N1CA 5E6YA 2FSEB 5SX4I 1TENA 2H3NA 2OSLB 4XNZC 4XNZB 1A7PH 2CRMA 3QUZA 5CGYD 4HWEL 3WUWG 2WINA 4U6YA 3MLTB 2HLAA 3NZ8B 3VWKA 3OKMB 1JWUA 1YNTA 5KVGH 1S8DB 5IFJA 1MVUA 1PG7W 1ZVHA 4XP1H 4DKDC 3L3KB 4GW4B 4IBLT 1OAQL 1S78D 2W65B 3A6OA 5KVFL 2OJEB 3GHEL 4OZIF 4IIQB 2FLRT 2IQ9L 4LQFH 5HGDB 4OLUL 1Z9LA 4D94A 4I5BA 1EDQA 5CMAB 3WFCL 4PJ5B 3PNWA 4OB5H 2IADB 1WCQA 3V4PL 1VB9A 3TJEH 3TO4C 3EJZC 4Y16B 3D0VA 3SDDC 4KJYA 3SDDB 1F13A 4NO0D 1MI5B 1U91B 1BP3B 3K46A 2V7NA 3VG9C 1CXHA 4P4KA 3VG9B 5ACZB 1PG7X 4ZUWB 3DRTB 3VI4E 3LB6D 3DV6A 1IAIH 3DMMC 3DMMB 3JUZA 1P6AB 5B3JF 4B50A 1NEUA 3GSVA 3PP4H 3QIBC 3QIBB 4QRPB 5MEQA 5LAXA 2FJHA 5EIVA 4LFHD 5I9QB 3HI5H 4S1SL 3MTRA 5DJ8A 5LGJA 5EOCJ 1NBQA 1LGVA 1AFVH 1MHPH 2PUQT 4M02A 4JFQB 4H25B 2V6HA 4HZLB 1CN4A 3D85A 3RIAK 3NCYS 2MHAB 1NFDA 1TTUA 1H3WM 3V7AE 4GMTL 1IZJA 3VGFA 1DQLH 4GQ9L 1UZ6E 2X1WL 4EI5A 1YZZA 2VXVH 4G7VH 3WE6B 5DI8B 4UTBH 1JGEA 3MJ8B 3T1FB 5K59E 5D71H 3BP7A 4V1DB 5LQBL 1N26A 4X99A 3K1DA 3FB7A 5DJCB 4FS0A 2NY1C 4LAQL 4HIXH 3RWIB 4OCXH 1WWCA 3H9SA 3TF7C 1NDMB 4TVPL 3B8YA 1R24B 3H42H 3VXPB 4N5EC 5IB3A 1CXKA 2W59A 4LCWE 4PIRF 3DETD 2WNGA 2AVGA 2Z31B 3O3DA 2EH8L 2Q3ZA 2E9IA 5KSBA 2P48B 1V7NL 4CN1A 3CAFA 1BM3L 1T2JA 5DQ9A 1RUQL 2J8OA 3HE7C 3L5WA 3HE7B 4Z5RB 5FGBC 1GJIA 4HUXA 1Q9LA 2CK2A 3T0VA 4L8CA 4PY8I 3IDGB 2XNAA 1NSNL 3L3JA 2VDQL 4LVHB 1SQ2N 4M6NL 1G1YA 1NFIA 3ZL4L 2I07B 1BOGB 1JGVL 3WSQL 2ZUQC 5D1ZA 2DDQH 3WL9A 5E2TH 3HFML 4GAYA 1BBDL 3GI9H 5D1XB 3RZCD 4FFZH 3V52L 5IV2B 3JWDH 4OKDA 5D1QA 4JKKA 5DRNA 2BVQA 3S36L 3LEVH 4K71C 4Q7DA 4UTAH 4TQEL 2CDFB 5A1AA 3OXRA 1XGTB 3ARRA 4FP8L 4H88L 2EKJA 3WN5A 1YDPA 4UT6L 3CH1B 4WUUD 3U82B 4HUUA 3UJTL 4U1MA 4LLWA 4ZYKA 4JG0L 1T1WA 5IEHA 5EC1B 5HYIA 1T1YB 2R69L 4MQSB 1MH5B 4N8CH 1ZSDB 3TGXA 4MWFA 4JM2D 3X3GH 2V9TA 4W70A 1KXVC 3X12A 3OG6B 1E6OH 3KAAA 3UX9B 3O2VL 5GGVL 4S1RH 1J1XL 2CH8A 1UH2A 2PXYB 1R5IA 3QULA 1P84K 5C09E 3T0AA 3H6JA 1IC4L 4MVBC 4CAGA 2EYRB 4WFHE 2Q7YA 5EA0L 3MOQA 4XXCC 5EO0B 1HCFX 3LQAL 1AC0A 1H8OA 1FN4A 3ROLA 3O2WL 2PTUA 1YEJL 5FYKU 1C16B 3EYQD 2HJLA 4NOBA 3TBSA 3HLAA 5JO5A 3L7EB 1U3HA 4OJFL 1LO2L 3HB3D 1U41A 3HZVA 3W0WA 1WEJL 4CMHB 5ITFB 2YPVH 4KKNA 3G6JA 3VI3E 5KN5B 3UYRH 3VXUA 5D6CB 2R2EB 4P59L 3OX8A 3S35X 4NRZA 1HQ4B 5CP7A 1WQVT 4CDGC 1WBYA 4JN1L 1ROWA 2X4OA 1I7RA 5FB8B 1HHIB 4OCWH 3U30C 3CU7A 5ICZA 4WIQA 3O6ML 4I0KA 3LKRB 1GC1H 3DVGA 4WWKC 4G9FB 3L7FB 1OTTC 1QHOA 4WW2F 4EKXA 4NQUA 3SHSA 4MNQB 1CL7H 2FWOA 3FFCB 3TNNB 3HC0A 1KXTB 1T2QL 5F70A 2DLTA 2XPGA 1LP9E 2D7PA 4P2OB 3K7UA 3VFSA 4JFHE 4NQXA 1INQA 5D8JL 5D96C 3MUHL 5EBMA 4Y2DD 1JPFA 1PKQE 4HUMB 3T0ED 5HY9B 2BOCB 2AJ3A 5EPMA 2RFXA 3RUGE 1ZVSA 3IKCB 5JW4M 1FNHA 2YN3A 3KPLA 4GAGH 1HZHL 4C56D 3V0VB 5HXMA 3ULUD 2PYED 3GJFH 4XP6L 3BGMA 5IW6A 4DGIL 5KSAA 2BNQA 2VXSL 2XWTB 4JFEE 3E6HA 1G0YR 4KGLA 3ILPB 4XXDA 4HUKB 2ZUYA 4PBXA 2VRAA 2ILLA 4IOSD 4YZFF 4OIIH 1K6QH 5JR1L 5J1AA 1ED3B 1ZK9A 4GKSB 4TPRL 2VZ3A 3EYVB 4PJEF 2DQCL 4U1HB 3GI8L 4M93C 4M93B 3IRZA 4R0LA 3MNWA 5FYKD 5C0CA 4QWWD 4Q2ZA 4I2XE 4EXKA 5GHWL 4XMKL 5CZKA 5DSCA 1F45A 1WFOA 5C0ND 3MR9B 2IAMC 4GG6B 5T5FL 2IAMB 2AV7B 1BIIA 4HIHB 3WUWB 3FT3B 5E2UH 1CDBA 5ACLA 3G5ZB 2EIZA 4ZFGL 5C9JA 1Q9WA 5GZND 3VFPA 3P0YH 1BQLH 3GB7B 1XF3A 1I1FA 3AY4A 2A83A 4XHQA 3DUHA 4J3UA 1ZS8A 1GAFL 4LPYA 4XP9L 2OM5A 5DD0H 1RMFH 1ZT7A 4YAQB 4F3FB 3I6LD 3MJGX 3SJVA 3VE0A 2BMKA 4W6XB 3FZUD 1S9XA 4MA7L 3M17A 5ESQB 4EIGB 5DZOA 4TVPE 2Q76A 2XWBB 4I1NB 1IRAY 4O51B 4Z7UF 1OWWA 4S2SB 5FK9B 5FKAB 2L7JA 3DYMA 3QIWA 2EXWC 3AM8A 3L3GA 4LGSB 4PRDA 2G9HA 5F89A 5HHNA 3QDAA 2QR0B 2YKLH 4X6FA 1NBVH 4PJGA 3QA3A 5I17B 1DR9A 3QNZA 1OSPH 2AEPH 5C07E 5KS9A 1U95A 1ADQH 1DQJB 3HI1A 3VJ6B 4CGTA 5JPNB 3P9LB 3OXSB 2P7TA 1MRCL 5DJYA 2HFEA 4KVNH 1I9IL 4DK6A 1JI2A 2JIXD 4WJ5B 2B4CL 4C55A 2CQVA 1HXYA 2R0WH 4PRIB 5BO1L 5F7DB 3B43A 1MREL 5CJQL 3UDWA 1H3UA 3IETB 4KUZL 2BXYA 2CRZA 2JJSC 4HKJB 4H1LA 3FQXA 1FO0A 4OZIB 1JNJA 4NJAH 2UZIH 2J6EA 3MOAL 4XBPA 2FO4A 3QUMB 1RZ8B 2WK2A 1LD9B 1YQVH 4JJ5A 1N5AA 4K7PH 4N0RA 1JGDA 5I18H 2YEZA 5I76B 1B0RA 3KPOA 1YNKH 3QXVA 4N8PA 3DHJA 1KCSH 4D8PA 3QUML 4CVUA 3QWOA 1MWAH 3ARZA 3GK8H 1AD9B 2F8VA 4Z0BL 12E8H 5E1AA 3MNVB 5DO2D 3TNMB 1KLUA 4EXPX 4PJCA 2NY7H 4JPIA 2OYPA 1MRFH 4WU7B 3TIDB 3IFPB 4YHMH 2N56A 2OS7A 1JNHA 3K1KC 4YHNA 5F1SA 2XTLA 4OTXL 3LSOB 5HHQA 5J06A 3NA9L 4HG4K 4TNVF 2XKSA 5I1DA 1SY6L 3V4UH 5J13C 2BOBB 2Z4QB 3WD5L 2EO1A 2ITDA 4CU7A 3ABZA 2DQHH 4JVUA 1CR9H 5DQJA 2WWKO 4U3HA 5D2LF 4Q9QH 4HS8L 4WHDA 5DJXB 2GY5A 2YD2A 2WUCL 1JHLL 3K8MA 4MDJA 3QQ3B 1N7MH 2I9TA 4NP4H 1IGJB 1XF2A 3RKDD 1FGNH 5GS2H 2CXKA 1ZV5A 3D2UA 3SE8H 5C0FA 1KIQA 1DQDL 2LABA 2CUIA 5AUMB 4DFIA 1IL1B 3KPRA 3HR5A 1MJJB 2ZCKL 4JDTH 4F8QA 4ODSL 2FBJL 2Q1EA 4JB9L 1QRNA 1OL0A 1XIWA 1NGXA 5IM7B 1N4XL 4G8GE 4JQXC 4Y0GA 4W6YB 1XF5A 1JYVA 2AAVA 5F7UA 5I1CH 4HGKC 3MCLH 3T2PA 2B1HH 2BFVH 3FHQA 1VPOH 2L7UA 4NQEA 4PJ8C 4CADA 1M7IA 4ZMAT 4F33B 1INEL 5AZ2H 1HILB 4MJIA 3S88H 32C2B 2A1WL 1R3LB 4XCCL 1T89C 1BPVA 1MHEA 3KS0J 3UZVB 3BZ4A 1FJ1B 2E7BA 3Q3GA 4MCZA 3QIUB 3ZHDA 1N5YH 4GAFB 4AG4L 3IFOA 2R0ZH 4ORGA 5CBAA 2EE3A 4PTTB 3MV9E 2VN4A 4JKPL 4PJAE 2D9CA 5KW9H 3AAZB 3LKOA 1WAAF 1T03H 4BKLA 2XKNB 3WV0A 5IHLB 1CD1A 5E2VH 1IGFH 3IXTB 4KDVA 1KB9J 1FPTL 4JRYD 1C5DB 1S9YA 1A6AB 1QFWI 1YNLL 5DVOA 4FQXA 2VAAB 4LPVA 3CLFL 3P30H 3JV5A 3O6FC 4NZUL 4P5TA 3O6FB 1GGBL 1TZGH 2WBJA 3CFDB 3V2AR 1F4XL 2J88H 4Q6IC 1YPZF 4Q6IB 4OF6A 1PQZB 4OF8A 4PS4H 3KYMB 1KFAH 2X1PA 4J3SA 2BC4B 1SEBA 4ZPVB 5JQ6H 1CIDA 4M9OA 4NGHH 2FYYA 3R0MA 1A3RH 1WISA 5E94B 5AYQA 1T66C 3C5ZD 5GRJL 5IWLA 3MLUH 4P46D 4DEPC 4ONHA 3F6IA 5DRZA 4XWOC 1MCBA 1M7DA 5LWYL 5J12B 2YD3A 3MREA 2CKBA 1QPPA 1UM6L 3MJ9L 3BQUC 3G5XB 2DYPD 3BQUB 3AS0A 4AH2B 1RIHL 3CFCL 2QBWA 5BZWA 1QQDA 1DEEA 3U7YL 3RQ3A 1J88A 4ZO8A 3UCRA 3EUUA 2P5WB 2GT9B 3L5XL 4YHIA 1AKJB 5GS0C 4UDUB 1ZANH 4OZHB 4AEFA 2QQQA 3LS4L 4CUCA 3QCUL 3FAWA 1YMMB 1G7HB 4M1CC 4X6DE 1T5XB 4M6OH 1JHKH 1YN7B 2QTEA 2X89A 2H8PA 5CFHA 2XIDA 3T77A 1F4WH 5EU5B 4F9PC 2I9LB 3N50A 3OJDB 3QWQB 4BQ9A 1NAMB 4K8RL 4KKCD 4YFLF 2R1WB 2WWMD 5SX4H 4U1NA 5I16B 5F8QC 2YBRA 4OV5A 4NUGH 4P9ML 3FCTB 4UZGA 2HJKB 4UT7L 3NVQA 4ZAKC 3CSGA 4YDLC 1NAML 3BX7C 3DVNB 4LOUC 4YDLB 2UWEA 4WW2B 4X7TB 4JKLA 1Q8MA 3MUZ1 4HWZA 3SE9H 2NZ9D 3TT1H 1NCNA 2W0LA 1T6VN 4J8RA 4O00A 3VFWB 3BE1H 1S7TA 3I3DA 3RWDA 4PRNB 2PTTB 4GRLC 2BNRA 2ZG2A 4LCWA 4M8QB 1D5ZB 4KHXL 4YDVA 4P5MA 3G6DL 4P3DB 4K9EH 5B4MC 1U8MB 4EQ2A 1UXWA 4U1KA 3TBVB 3CFEB 2V9QA 1YN6B 4UV4H 4NFCA 1NBYB 5DEGB 2PO6D 1A47A 4C4KO 1OM3H 2I25N 1FH5L 5AG8A 1DZBA 3QDMA 3CXHK 2VC2L 3U9PL 5KSUB 1MJUH 3LS5L 3GMNA 2DKSA 3NAAL 4LF3B 5SWQA 2P49B 5DEFB 3MXWL 2PTVA 1AHWC 4PJEB 4XCEB 3U0TB 1AHWB 1X5JA 4MJ6A 5C70A 1IAKB 4NQCE 5I71B 4KI5D 1OARL 2CLZB 3MGAA 3WFHA 2YD9A 3C9NA 5D7KD 2RB8A 4N1HB 3IFLL 5B3JE 4HV8B 4ZTPL 4ZUVA 4ZDHA 4JHBA 4L8DA 4P9HC 1T21B 2V5TA 4KMTH 4UV7H 1DBBH 5AAMA 4BSVA 5IOPA 1GZQA 1X4YA 3BIBX 3H9HA 1HHGB 1SHMA 5FIEA 3VXRB 3KLHD 1KG0A 3VWJD 3LPFA 1FORH 2VLRB 4JHZA 5LKNA 1OQOA 1MFDH 1MCNA 5C8JA 2Y07H 4QNPE 3ARDA 1ZMYA 3CDGA 3FB6A 2R1XB 1A1MA 1KJ3L 4HXBL 4F2MA 2OI9C 4ZD3L 3EJJX 5C6TH 3RI5K 1Z9MA 4KKBC 4X6BA 4CJ1A 1U8QB 3O11A 1LE9B 1J0ZA 3C5JB 4Z7UB 5T1MB 5CP3A 1DJSA 1YEKH 1AE6H 4WV1A 4AQ1B 3KJ4C 1ZVYA 3LKNA 1FIGL 3CPLA 4GO6B 1MLCB 1CGTA 5DVKA 4QXTB 3ME0A 3C8DA 4RFEA 1K5NA 5L88L 4PLKC 1I8LC 2OTUB 1Q94B 3PHSA 1UM5L 1BVKB 4ZTOL 1CDCA 3HZYA 4MXVE 2NY6C 2OTPA 3GIVA 1EO8L 2PYFB 3GMPB 1A6VH 1WBZA 3KYNB 3MA7B 1R3HA 2A6IA 4L3AA 1AH1A 3RY4A 5H94A 1SYSB 1INDL 4RMUA 3T4AA 4P48A 5DK2A 5F3HA 1DBKL 3DV4B 4NQVB 1HE7A 3QUXC 4HF5L 5EU6B 3QUXB 4XWGH 4U49A 1CFSB 3A6CL 3C60C 3MRBA 3O8XA 1G7JA 1R3KB 4XX1G 4PJHE 4OBRA 2EDRA 1CICD 3RL1B 2PNDA 5DZLA 1BF8A 5E8DL 2CDEA 1SJHA 3HUJA 4YUEL 3R8QA 2E9JA 3NABH 3SDCC 3SDXB 3SDCB 2NTSP 3A0OA 1NCCH 4LSUH 5C3TA 3RWGA 5GS0H 4Z7OF 2Y06L 1SM3H 4XCFL 2FSEA 4YHYC 1LMKA 4YHYB 1L7IL 3H2WA 5EO1A 4XP5L 3MRGB 4ODXB 2NY0D 1KIRB 3R1GL 4G6ML 1PKQA 4GKOA 4YH6A 3MLTA 4TSCH 4LSRL 1J8HB 4YPGB 1FBIL 2YPLD 3RUGA 1J05A 3NZ8A 3OKMA 4F58H 3BGAA 2BNUB 2ZPKH 5DUML 2IH3B 3QAZB 3KLSA 2CJUH 3TO2A 3L3KA 2DQDL 5F1KC 4GW4A 3PQYB 2OJEA 4IIQA 5BMFL 4MHHI 3DSFH 4FZEH 3TYGL 5ENWB 1UQSB 3KXFB 5CMAA 1TXKA 1G6VK 2ATKB 4FQCL 4Y16A 5EZIH 4JCMA 1MI5A