5LWYL

Revised crystal structure of the human adiponectin receptor 2 in complex with a c18 free fatty acid
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
107
structure length
107
Chain Sequence
DIQMTQSPASLSASVGETVTITCRASGNIHNFLAWYQQKQGKSPQVLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQQFWSTPYTFGGGTKLEIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adiponectin receptor protein 2
publication title Structural insights into adiponectin receptors suggest ceramidase activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 24
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2016-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5lwyL00
4F7CA 2QSCL 5C0FA 1W8OA 5ANMB 1NSNH 5KSBF 1KNOA 3LS5H 3STZA 3QEQD 2R1XB 3MLVH 1WFOA 4LCCC 3SDDB 4DQOH 1G9NH 1TITA 4PJIA 1D5BA 3EO1A 3LQAC 1NFKA 5C2BH 4HJGB 4X8JB 5DFVC 4HWBL 1SY6H 1CR9L 1Z9LA 4HIEB 3EYVB 4AEIL 4HCRL 4KGLA 4JFFE 4NWTL 5IJKA 2V17H 3D0LB 1ONQA 2VXTL 3GMMB 5FGCB 4ZXBD 1U8MB 4JAMA 3KPOB 2AXHA 5DRWB 4WTZG 1ZT4A 4YR6B 2WP3O 4N8VG 1JPGA 3SDCD 3LS4H 4MZ3A 1UQSB 3VFOB 1HQ4A 1C5CL 5AAMA 3M45A 2HMID 1X44A 4N5ED 1UVQA 1T0PB 1AXSA 3DURB 4MAYA 3MMEB 4HK0B 2R0LL 5L9DL 3BJLA 3CSYB 3QEQB 3U7YH 5I1GL 4OM1L 4JCLA 3KAAA 3BGFC 4MNQE 4I9WE 1JF6A 2WUBL 3OZ9H 1LILA 5C0RL 2O5YL 1MWAB 3QIUA 2EDDA 2LAAA 4LARH 3GBML 2MOVA 4WW1B 3J7HA 1EMTL 3MLSL 1MVUA 2CO6B 1KLUB 2MCPL 5DJ2A 2GAZB 4ZXBB 4AZ8A 4R7NA 3B43A 1S7TB 1JWSA 5GGSY 2NX5D 1YUHB 3I02A 4JZJA 4XVSH 3ULUC 5FYJD 2E6PA 4G6JH 4UQ2A 1T89C 4ZUWB 3SDCB 4NZDA 4ODUB 4W4NA 3UZEA 4MXQD 2OZ4L 2GITB 2W0FB 1MCWM 1XZ0B 4UT9H 1WV7T 1H8OA 4UIKH 2HT2C 4YDIL 4HS8L 5DVLA 1A3QA 2XKNB 3ARDA 3BKYL 2OS7A 4MGXA 4PJ7B 3U46B 5I71B 4Q97A 3FO1B 4PJHF 4JFXB 3R8QA 1BVLB 1AHWC 5D70L 1R6VA 4BSVB 1G7PB 1M71A 1A1OA 1B88A 3HRZA 2ZG1A 3P30H 3I6KA 1RJZA 2DYPA 1JGLH 1OAUL 2HJLA 5FUZL 4QRRA 4J3VA 3EOAB 2EYSA 1X5XA 5CCKL 2C7UB 3O6MH 1FRGL 4PJAA 3I6LD 5BV7C 2VIRB 1ZT1A 1CD0A 5TDOA 1EV2E 1HKLH 2CIKB 3RKDC 4LSUL 2XTLA 4ZPTA 4MAUL 4N9GB 2JB6A 1NAMA 4ODHH 5T1KA 2DQIH 2IALB 3LEVH 4TSCH 4WJ5B 4FNLL 1HILA 2NY1C 3NCYS 3WO3B 4LSSH 2I60H 1H15A 5EA0L 2ZKHL 2YR3A 4CN4A 3C5ZA 1P5VA 5D8JL 1IL1A 3KJ6H 2CRYA 1VSCA 2D7QA 2N4IA 3MRNA 5FYKU 1F3DJ 4TPRL 4HS3A 3WN5B 1TTGA 3WJLC 1SJHA 1EBAA 4G80B 4D9QD 1JRHL 3KJ4C 5TJWK 5BZDB 3RRQA 2NY5C 3EOYG 2VXUH 4L8CB 3PQYD 3HPLA 2EIBA 4N0FB 1UCBL 4NBXB 4OCLC 5CILH 4M7LT 1GHFH 4X6EA 4M7LH 5GGUB 4XT1C 4MVBC 2L0DA 4LPYA 4RMUA 1KPUA 3MNWA 1A64A 5AD0B 4POYA 2BXYA 3QCVH 1FCGA 1GOGA 2AK4A 3OB8A 2VDPH 3U2SA 4P0DA 4JO4H 1XF5B 1GH7A 3GMPB 5FUOL 4ORGB 5IJVB 3HI1A 4ETYA 5HYQB 1J8HA 2FWOB 43CAB 2GHWB 3BAEH 1I3UA 2R2EA 5TFSL 4GAGH 1RUKH 2X05A 3KYOA 4L3EE 5EO0B 1JPSL 4Z0BL 3D48R 1MIEH 5CP7B 3T4YB 4WU7B 1F11B 2AEQL 5KSBB 3K8KA 3RTQC 1FYTE 3WKNA 2N1KA 1EBPA 3T8XA 1DLHA 4JR9H 3FB8A 3BKCL 3BKMH 3V0WL 2YOCA 3D69A 5E70A 3QDGE 5DJYA 1P7KB 5LKNA 1KACB 3VXTA 3LV3B 3RVWC 4HQQH 2EXYC 3LN4B 1CICD 3PQYB 2R4SL 2D4FA 4RAVA 3U1SH 3QDME 4OFYD 3GBNL 4QWWC 1FFPA 2AJSH 3WLWD 5KTEL 3V52L 3ARPA 4KXZH 4DKAA 1IGTB 5HYSB 5D93B 4GRMB 4NQEA 1J1XL 4XMLH 3FT2B 4PP1C 3BE1H 3OJDB 1RFDH 4HEPG 3M8OL 4V2BA 4XC3L 5HPMA 4OGXL 5C92A 3L7EA 4FQQB 1NFDF 3QIBA 1GGCL 1T6WA 2PTVA 4NNXB 4UTAH 3TPKA 3GEWB 3BP6A 2M8XA 2HFEB 4M43H 1BWWA 5F7YC 3E8UL 5FYLE 3H42L 4HWBA 3FFDA 4LRIA 1LO2L 2QQKL 5DVNA 3QXWA 3WFBH 1NCBH 4LOUD 4HCRA 1BQUA 3DSFL 2MPAH 5EU6E 2FYYB 3SE4A 3NABH 4P2RE 4AL8H 5DMYA 3HNTL 1A9BB 4LF3A 3SO3B 1MCOH 2Z31C 1QFUH 5CKAA 4K23L 2GT9A 4TQEL 2HKHH 4HC1A 4G8IA 1NAMH 1A6AB 3I3DA 3OV6A 4G43A 2AJZA 3GMOA 5J13B 2HVJB 3FOMA 4PD4K 4WFGD 1IT9H 4I2XA 4L29A 5ELIA 2XYCA 4FZEH 1EHXA 4MLSA 5FHAH 3P0VH 3JV4A 2I07B 5F70A 1I1YA 1FL6A 3EJZD 4I18A 5D7KD 1PKQE 4EVNB 2BXZA 2JCCA 2A73B 5I8EA 1OVZA 3BI9X 3C8KB 4Q6IB 3VG9B 3VFMA 3LY6A 4PV9B 1Q0XL 2DQHH 2GUOA 5FO9A 5HI5D 2Z91B 1VADA 2KUTA 3D39E 5C70A 4PYHA 2Y06L 1RZ7L 2JLLA 1UJ3C 4PJHB 3FJTA 3L3GA 4R2GC 4EJ1C 1HEZA 4Z18A 2BY1A 4KZDH 2XWJB 5HVFB 2PO6C 4WV1C 5F1SA 1UCTA 2H26A 5TPWL 3STLA 5E08L 3B9EA 1QP1A 1GGTA 1WCBB 4EUPB 4KZEL 2YD1A 3VFRA 4OZFA 4EOWH 2GYSA 4UU9A 2E7HA 4L1HA 2ZCKH 2OZ4A 3PL6D 3VWJD 1YYMH 3BZFA 4JPWL 1FLTX 1U8PA 3ZSSA 3MJ7B 3FO2A 2Z92B 1OLLA 3ARGA 2GJZA 1W72A 5GZND 1EDQA 2Z0BA 2V9RA 1WAAE 5EOTA 5FXCH 4XAKD 3MRRA 3BVNA 5D6CB 3LKPB 4LSQH 4XAWL 4XP5H 2DBLH 3REVA 2WK2A 1LMKA 3SDXF 4JN1H 1T1YA 4PRNB 1JNHA 5TH2B 1SVCP 2X70B 4PV8B 5IBLC 2BVPA 4RFNC 3TCLB 4PGBB 4FFYL 5MEQB 3QIWC 5E8EA 2F74A 1G7IA 4XCYA 1YEGH 3Q5OA 3UC0H 1OY3B 1FL3A 3RIAK 3RY5A 3WJJC 3JTTB 1DQTA 2BNUB 5E9DA 3KGRA 1CR9H 5EBWA 2AJ3A 2ITCA 2OI9B 4A2MA 1A6TA 4P23D 4Y1AA 4HCRH 3KHQA 1KBGL 3RGHA 1KJ3L 4OD3L 5DRNA 3O6KL 4XPGL 2VXTH 4Y4FA 1VGEL 2MQ3A 3T65A 3K1DA 3PL6B 3VWJB 4CU7A 3IDMA 3RNKB 2F58L 4LQFL 2AAVA 2DQGH 1D5ZA 3FZUD 5GS2D 2FECL 4HC1H 5E2JA 4JN2A 3QUYA 1C5CH 4H1LB 4NBYB 2OJEB 4HHAA 1GAFL 4KC3B 2YUVA 5DD3L 4MJ6A 3L5XL 1X5KA 1G1CA 2JJTA 1G7LB 2R0LH 3ULSB 5L9DH 3MRJA 5FOBB 1JGUH 4CMMA 1T4KB 3ZE2F 3Q48A 1KIPB 1R3HA 5SWSE 3LAFA 3G5YA 1JF1A 2IFFH 3ESVF 1KELL 3O3BA 2OSLA 3QZWG 3TZVA 2RFXB 4PJEE 4POZC 4NQDD 4NNYA 3GHEH 5I1LB 2HT3C 3NCBB 3NBNA 1NFDB 2EIZA 4P23B 3T1WA 3QNXA 4OZFG 5DT1H 2J2ZA 1FGNL 5HBBA 2MCPH 3U79A 4NCC1 1H5BC 4HIHB 5EN2A 4BSJA 4OZFH 3SQOH 1KLGA 1DLFL 3VMPA 1S7VA 5DJZB 3HMXL 1T1WB 2OZ4H 1NDMA 3QUZA 5HVWA 5EU4A 3VRIA 3CDGB 4L8DA 1P6AB 5GHWH 2MNUA 1OM3H 2OQJB 3OGCA 2C9AA 1W72H 1BVKB 3SPVB 5KZCD 3T0EA 6CGTA 3EHBC 5GIRB 1AXTL 1J9CT 4WFHD 2I24N 3MRDA 5JW3L 5KG9A 4MJ4A 4JG1L 3NCJH 2IC2A 4U33A 4QRQA 4TUOA 4CADB 1OAUH 2O5ZL 3MNVA 5FUZH 3OGOE 1O7SA 2P49B 1FRGH 4NQDB 3NH7L 1I7TA 1AP2A 3A6CL 1GZQA 2A0LC 1Q94A 1ZT7B 5C0GA 5FK9B 4LSUH 1UXWB 2BSSA 4WGWB 1CLCA 1MF2H 3L1OL 3GKWH 1SM3L 3E6FB 3WEXA 4MQXC 4JY5L 4OCMC 5F7DB 3O9WA 5AZEL 5D8JH 5CUSL 3VXNA 5IT2H 3D25B 2WINA 3ULUE 5ESQA 3HTLX 3OKLB 3L6FA 4JM4H 2XTJC 1DQLH 1IMHC 3TH2T 1XGPA 1AGDA 4JFQA 5KSAA 4QRPA 4KUCF 5SWQA 4CN6A 3OKDB 2A83B 3O6FD 4FQLL 4UNUA 5KZCB 3PGCB 4DWHA 5IWLA 4IOSD 2A6JA 3VGAC 1I8MB 2UYLB 1XIWB 2EIDA 4KWUA 3IXTA 3ORJA 4X80H 5FUOH 4XCFL 2DKUA 2FD6H 4GRLA 2W65B 2ZP0T 1T21A 4H26B 5TFSH 3T0AA 1ZGLP 2PETA 2FEEI 1JPST 1OW0A 3HZVB 1UZ8B 4PTUA 1JPSH 2IBZX 4Z0BH 1S7XB 2D2OA 4NRZA 4Y2OA 3L3IA 4YE4H 1H9VA 3EOTH 2E6QA 4PTTA 5J3HD 2F54A 5JW4N 2BZDA 2FLRT 4TTDD 4LCUA 5JOPE 2BVOB 1X5GA 4NQVB 5EZLA 3DROB 3BKCH 4G6FB 1A4KA 3QJHA 1U8OA 5A16B 3BPNC 4NGHL 4Z7NE 5DHXB 1F42A 1PQZA 3GMLB 2PYEB 4MNHA 2XZZA 4LHUD 4HFUL 4NYLB 5H37G 3LEYL 3BP7B 1S9WB 3PNWB 3O6FB 4LLUB 3HE6C 2DLEA 4I3RL 4OBRA 4MNQA 3D5OF 4K3EL 4U0QB 4V1DE 4XC3H 5HGDA 3DRTA 1ZEAL 1GGCH 2HVKB 1UACH 4Z8FH 4PJIF 5DZNA 3TA3A 1ZLVH 2DIBA 3P4MA 4I0PD 3E8UH 3H42H 1KJVA 1LO2H 4R0LB 3ZTJH 2AKRA 3D85D 5GISL 3DSFH 3VI3F 4OV6F 4AIZA 3K2UL 4GKSB 5D7LA 1RZGA 3C2SA 1CXEA 1KXVC 4YXLH 4BELD 4WGVB 4TQEH 4K8RH 4A6YB 4JFEE 2Y7QA 5JIHA 1U8JB 3IDGA 5HDBE 1K8IB 3MROA 2QKIB 2Z8WC 1RHFA 2EKSB 5DI8A 4BZYA 4JEGB 5IMMA 4HG4J 3GSQB 4LHUB 4XPFL 1GCFA 1IC7H 1ZMYA 1EVUA 3GSUB 1ZWIA 5D1ZC 4LCYB 2ITDA 4QHUA 1CFSA 5IW6B 5GRJL 1XF2A 2UZXB 3RX8A 4ZDHA 2HJKB 2VZUA 2IH1B 3HNVL 2V5YA 4YK4C 3UTSE 1A6WL 1XGUA 3FFCD 1Q0XH 5D5MF 3P9MB 3VWKA 4H20L 1T20A 2A1WL 1ZHBB 4KUCD 5D7IF 4I0PB 3RIAF 3BXNA 1N6QH 1RZ7H 1QR1B 4YO0A 2APVA 1RZJL 3CAFA 5CHNA 1C16B 4F3FA 3D85B 3I6GB 4S2SB 2YPKB 5I76B 1VFBB 1F02I 4KTYA 1LO5A 3B9KD 3VRJB 1YEKL 1KB9K 5TPWH 3ALWA 1HCFX 5E08H 1RUQL 1U58A 1KCVH 3DETD 2ZPKL 4EBQL 2IAND 4OJFL 3N9GH 1AY1L 3PGDA 6FABL 2ID5A 3NIDE 4P2QE 4E41D 1FJ1A 4LMQE 2A2QT 3SGDH 1NQBA 4X6CE 5JXAL 2D7OA 2DQUH 4KK9C 3AB0C 5KN5A 2H9GA 4XPTH 3VFUB 4KKAC 5D7SL 1AGBA 1YMHA 4YC2C 1E4KA 2J8UE 3FT3B 4WI3A 3D0VA 1IAII 1MELA 1Y0LB 2VLRE 2AQ3A 3G5ZB 3CFEA 1T83C 1KENL 3FFCB 5IMOB 4KK8C 4L3EA 1HXMB 4OB5L 4QRUA 5IEHB 3NZHL 2JJSC 5C0AD 1GPOL 3FO9B 4KRPD 3HZMA 4ZFGL 1P69B 4FFYH 1BJ1J 5DLML 1M1SA 1M7DB 3U48A 2EDWA 1CGXA 1U36A 1S9YA 4DUXA 4KH2A 4G5ZL 5CINL 1I8LA 1LE9A 1EX0A 5TDPA 3KPMB 2ZSWB 1KIUA 4WI2A 3B9KB 2LFGA 4OZ4A 3X3FH 1BAFL 1KBGH 1OGAD 2IANB 1B0WA 2VN7A 4LSTL 2V7NB 3MGOA 4UBDD 3UBXA 4KRLB 4E41B 1NFIB 5AUMA 3JV6B 2F58H 5JA9A 1DDHB 4UT6L 4ELMA 5FM5O 5JHDD 4QTHA 4L3AA 1JNLL 3P4OA 3RGVA 1TCRB 1Z0MA 4CVXA 4GMSL 4R90L 2UWEF 3TIDA 1XF3A 4YHOH 1OP5H 4JPKH 3SKJL 3HC0A 3P77B 3HS0B 4FQ2H 1JI1A 4K94H 5C0AB 1W8NA 2J6EL 4G9FE 4JPVL 2BJML 1ZLVK 4KRPB 4S1RL 4HG4K 4F7PB 2ARJB 1R5VB 3S4SA 3QEUA 2Y5TA 5IIEA 2BK8A 2CMRL 3WUWA 4P2RA 4MAYD 3GM8A 1DQQA 4OGAC 1EO7A 4F7CB 3ZKND 5C0FB 1P1ZA 3SJVD 2DTMH 4BZ1L 3STZB 5JDSA 4AH2A 1CZ8H 3LIZL 4OLVH 2X7LA 3JSSA 3JVGA 1FGNH 1OGAB 3MJ9L 4PJIB 2VTFA 3VH8G 3EO1B 3J8F7 1KUMA 1I9RL 3QIUD 4QLRA 4NZTH 4BQCA 3A0OA 7CGTA 2HFTA 4IRJC 1PBYA 4Z7OE 4YBLB 5TQ2H 5KBNC 5JHDB 1PKQA 3IDYB 1KEGH 1LP9F 1U3HD 5T33L 2P46B 1TENA 1MFNA 4M48H 4JAMB 2F5BL 1VEPA 3D9AH 4U1LA 2EDNA 1ZT4B 5E2TL 4HH9A 3FQTA 5FECA 5IFJA 1JPGB 1VFOA 4O51A 2W9LA 1NUNB 4G6MH 1AXTH 1J1OH 5D2NC 1EUUA 1E6OL 1HQ4B 3L5IA 4U7SA 3MV7A 2ICWJ 5JW3H 3MV8A 1IC4H 2DL9A 4N90E 1KPVA 2R0KL 3P0YH 4QXUH 4KHTH 3ARDD 4HULB 2DMCA 1AXSB 5C6WH 4MAYB 1V3KA 2J5LB 1JYNA 1VKXB 1AQKH 3BIBX 5C0EA 3SJVB 1TVHB 2GTZB 1QYGH 1MAJA 2NY7L 3DUUA 5CZKA 4OZGE 2P45B 5EU7C 4ODXB 1CK0L 2JK5B 2EIEA 4NKOA 3UBXG 3L1OH 4NP4L 4BFEA 1SM3H 5D2LF 1REIA 2DYPD 3QIUB 4OT1L 5IBUG 4QRRD 5IHBA 4JY5H 1KYOJ 2R2BA 4KI5C 1IEBA 5AZEH 1NLDL 4LNRA 1WAAA 4ZFOB 5CUSH 1JGDA 3TYFA 5D9SA 1TPXB 5HD8C 1NMCB 1MVUB 4NN6B 3CXDH 5KVGL 4KXZI 5DVKA 5SWZE 5T1KD 3VW3L 4R7NB 1D5IH 1JWSB 3I02B 3NIGE 4NO0A 4FQLH 3C5ZD 1N8ZB 2JCCF 4NHCL 3PHQA 2X4QA 4QHKJ 4RGMB 3TT1H 3CLEH 3ARDB 5FYLH 4LCWA 4NOFA 1WBXA 4XP6L 4WI8A 1V8HA 1UYWL 2H2SC 4LPCA 4CVZA 2AK4D 5ESAA 5CAYB 4JFZL 1Q9LA 2OR9L 2Q3AA 2QHRH 3N1FC 3B6SA 4EDXA 3MRMA 1DE4A 2Q3ZA 3K1KC 5DO2C 3I6KB 1RJZB 3L5WA 1QHPA 4PJ8A 4UDUA 2CRZA 2DYPB 3MA7A 1AD0A 3BPLC 3MYZA 2HJLB 4QRRB 4XXDB 2EYSB 4K3DL 4LASL 4TOYL 4BSWB 2BRRH 4M93B 1EJOL 1ZT1B 5GJSH 5TDOB 1VPOL 4P5MB 1JBJA 1NCAH 1T2XA 4ZOBA 4ZPTB 1IE5A 2JB6B 1NAMB 4HWZB 5T1KB 1PSKL 1ZLSH 5A2JH 1HILB 1JCKA 4FFWC 3LEYH 3F65A 1YEFH 2XTJE 1FORH 3BUTA 1G9EA 5SWSA 1OP5K 3C5ZB 4BZ2L 1IL1B 4OFKA 3MRNB 4G8GD 4HS3B 1T04A 1TJGL 1SEBA 3CPLB 2IJ0C 1SJHB 2XZQH 4P59L 3S96B 1QHOA 4PJEA 1ZEAH 4KAQH 3T3PF 3ARED 4NKIL 2Y5EA 5BW7C 1IQDA 2VLKA 4NQXA 1OTUC 3SBWC 2AXGA 1PZ5A 5DRZA 1KPUB 3MNWB 3EOBA 2ATPA 4NQED 1QBML 1KLFA 2AK4B 5DJ0A 3U2SB 5KVDH 2EC9U 1I4FB 3KYAA 1FPTL 1X4XA 3QIBD 3HI1B 2A77L 5GISH 1J8HB 4U31A 3CH1A 5IVXF 2PF6A 5ITFA 4Q74A 3K7UA 4Q7DA 4Z6AT 3K4AA 3UTOA 2Q8AH 4RGNC 5GS1C 3SDAD 4YDLC 1WK0A 1KCUH 1X7QA 3OSKA 5EUOA 3A6BL 4GBXD 3EJYC 1NCUA 5EO1B 5F7EL 1KCLA 1RUML 4XPFH 5DHVA 1RJLA 4CKVX 4IHOA 4WUKL 1OHQA 3TN0C 3T8XB 1DLHB 4KKLD 2B1AH 1J12A 3FB8B 4QGTA 4NZRL 5GRJH 3QXTA 4G8GB 3C09C 2BSTA 3O8XD 3D69B 1YDPA 1A6VH 2QQNL 1C08A 2J6EA 5DJYB 1IM3A 2LAGB 3VXTB 2VR9A 3X3GH 4YUEL 3HNVH 4RQQA 1A6WH 4BKLA 3DXAE 5CEZE 4RBPH 3QHTC 5E0QA 1FFPB 5DMJB 4H20H 3OTTA 4AY0A 5HGBA 4NQEB 4GLRI 3MLTA 4M00A 1INEL 4HFWA 3NA9L 4U1JB 5L8JB 4YNYA 1U92A 4LGPB 3WMSA 3L7FA 5C08A 5HPMB 3QIBB 4PJDF 3MJ9A 5F3HB 4NRYA 5LWYL 4PB0H 2W59A 4GG6E 2EEDA 1YEKH 2B39A 3BP6B 4HGMA 2VAJA 4CVUA 1RUQH 3RI5K 5J89A 4IRSC 4OZIE 4KJQC 1S78D 5DD0H 4EBQH 2C1OA 3FFDB 4X9BA 3SDAB 4ALAH 5IP4A 1AY1H 2FNBA 6FABH 1HIMH 5I15L 3VI4E 4GBXB 1Q1JH 1AQDA 1KXQE 4LVHB 4JQVA 2Q8BH 5C0IA 4KKCC 3OJMB 5D7SH 5D2LB 4G8IB 3HUJA 3OKEA 3DVIA 4RAHA 2AJZB 3GMOB 1AHWA 1QG3A 3G6AA 2NXZD 3FOMB 3ZKQD 4I2XB 4L29B 3TLRA 2VDNL 4KK5C 1KENH 1GZPB 1KEML 1HWHB 3FTGA 4OB5H 1A7NH 3ARGD 3PWPD 3HE7D 4N1HB 1GPOH 1P4IL 1L9NA 4JFYB 4KDWA 1I1YB 5FYKD 1FL6B 3H3KA 4XXCC 4I18B 4ZOAA 1PEZA 3FQNA 2WWMD 2YUXA 5HHOE 4CRPA 3LQAH 2JCCB 5I8EB 3ZKMC 1JZ5A 4Z9KB 5C86A 5IOPA 1W2KT 4LP5A 3VFMB 5IB3A 5CINH 3PGFH 4D9LH 4YX2H 1ZOXA 5DJCA 4M1CD 4J12A 3U9UA 1BAFH 4JQIL 5FEBA 2NW3A 1PKOA 2PYFA 1Z2KA 1ZVYA 5C09D 5LBSH 5CBEA 1XGYH 3RVUC 1HEZB 5GJTH 3QZWB 2PN5A 2VITA 1A0QH 3I75A 1AC6A 5E9DD 3WXVH 4UT6H 1B0RA 2H26B 3PWUA 3STLB 4Y1AD 2YPVL 4PREA 4DEPB 1S9VB 3VFRB 4IS6A 5A2FA 1RZIA 4OZFB 2BY3A 2R29L 3FRPG 4UU9B 3V5KA 1JNLH 4Y4FD 2H2PC 2XICA 5KANG 2NXZB 4H0IA 2DMBA 3BZFB 5FOJA 5LJYH 3M1BA 2E8YA 5IMKA 3RUGE 1FBIL 3FO2B 3ARGB 3PWPB 4X6DF 3HE7B 2DAVA 2Y6SC 3C5SB 4LNVA 1W72B 2J6EH 2EECA 4OZHA 3TO4A 4Z95L 5INDB 2BOCA 3B8YA 3CSPA 4S1RH 3QXVA 5BXFB 4L8SC 3MRRB 2KH2B 3REVB 2DQJL 2UV3A 1BPVA 1JNHB 1CYGA 2A9ML 2FEDC 2X42A 5MENE 3RTQA 4PRAA 3GFUA 4R4ND 3V7MA 5A40E 4JFEA 4OF3A 1OSPH 4XI5C 3WS3B 1DCLA 1ES0A 3LB6C 5L2KE 5E8EB 5C09B 3O3DA 4MSWB 1YQVL 1S7WA 4HDIB 3TZVD 1I9RH 1FL3B 2H8PA 3ULUH 1S9XB 5E9DB 2EDRA 4HPOL 1JRHI 1QUNA 1ZV5A 2ITCB 4M4PA 1FDLL 3U4EA 3VE0B 1P6FA 3ARXA 4Y1AB 3HI6L 1JWMB 1XH3B 3ULVL 1YEHL 5F1KC 1F4XL 5DRNB 5IVXB 3UTSA 1IEAB 4Y4FB 5D96B 2KKQA 5TE6L 4HKBB 5I74B 2F5BH 1EPFA 3IDMB 3RWHA 5BVJA 1RJYA 3TFKC 1GRWA 1D5ZB 5E2TH 5KS9A 1TCMA 2EDXA 3VGBA 2G9HA 3HHRB 1CU4H 4L4JA 5CIPA 4RBPK 5K9JH 1R3KB 1JZ8A 3QBTB 4KPHH 1NUDA 1MIMH 5IV2A 4MJ6B 4FXLA 3U7WL 1V7ML 4QEGA 1AGEA 2R2CA 5J11C 3SDYH 4H25A 3MRJB 5LAXA 3V0VA 2VXSL 3QQ3B 3G5YB 3WIIH 4DW2L 4X6CA 4XGZA 2YEZA 3U4BH 2ZZUT 3TZVB 2DMKA 3MLXL 4OT1H 3MXWL 4AIXA 3N1QC 5GGRB 1CL7L 4ZMAT 1Q0YH 4ZFZA 1NLDH 2ICCA 4PJXE 1FIGL 3KPRE 4DAGL 4H0GA 4PJDB 2EIZB 2YZ1A 3QNXB 4IOIA 1N0XH 1J0ZA 4Z7QE 4K8RD 4XPHL 4QHMA 3FO0L 2VLRA 3VW3H 1ZLUH 2NY5H 1TQCC 3W9DA 3RX5A 2VZVA 5JMRA 5D72H 1I8KA 5EN2B 1DSFL 3V2AR 3G5VA 4QXGL 3ARSA 4OCYL 4GKOA 1J05A 1RK0A 1KLGB 4HUXA 1V7NL 3LVEA 4OLUL 4EXKA 4PLJC 5EO9A 1NDMB 1MFCL 5EU4B 3VRIB 4I3SL 2GY5A 5DJ6A 4QRPD 1OAXL 3IU3A 3BWAB 1UJ3A 4L4VE 3OGCB 4WIQA 2ZCLH 1Y6KR 5A43C 3SN6N 2R8SH 2UVFA 4UV7L 4XP6H 3WDHA 5I0ZA 3ARUA 3FONA 5T1DL 2AS5M 4ACPA 1UYWH 1EAPB 4WV1A 3IS1X 5EBMB 1UA6L 5KG9B 1BOGB 4TULH 3E6HA 4N0CC 1AR2A 3E2HB 4YPGA 4UTBL 5FDWA 3BH8B 4HUMB 4KJPC 2YPLA 4GKNA 4JZOB 4G6KL 3C87A 4QRQB 4X6BB 2FX7H 1MJ7H 1BOYA 2IG2L 3MNVB 4P4KC 5EU7E 4XVTL 4K3DH 4B7IA 2WQ8A 4JFFD 3IGAB 1I7TB 1AP2B 2D9CA 2CLRA 4JGMA 5GGTH 1EJOH 1GZQB 4Y16D 2GEEA 5ALCL 1Q94B 4NT6A 1OTTD 3ZSTA 3VD5A 2BSSB 4KI5E 3W5NA 1AD9A 1A5FL 4OCXL 1PSKH 4WHYG 4OCWH 3U30B 2IAMA 3WFZA 5I66A 4LHQB 4OFVA 1EO8L 4WU5A 1K4CA 3OKKB 3VXNB 4L9LA 1JHKL 1TJGH 3TYGL 3L6FB 4UDTB 1XGPB 2QR0A 4D0DB 4P59H 3KXFA 4QRPB 3U36A 3MX0A 5SWQB 1MNUH 4NKIH 3FN3A 5CIPH 5M95B 3BGMA 4NKQB 1MHHA 3ROLB 5F1NB 1F2QA 4LGRB 4RMVA 3WJJA 4NDMA 4MNQD 1TNMA 4I9WD 1N0LA 2IMNA 1GIGL 5DMGC 2R0WL 1UXSA 1DJSA 3H7LA 3RI5F 2A77H 4GRLB 4F58L 3UTZA 3OG6B 1T21B 3DPBA 4KJWC 3TA3D 2XV6B 1WBYA 4JFFB 4RAUB 2Z35B 1FZKB 4M5ZH 3RWDA 4GG8B 3DBXA 3KPPB 4Y16B 4EIGB 3ARWA 5EC2B 4PTTB 1OT2A 3KYMA 3KS0H 4LCUB 1RUMH 3B5TA 4HWUA 5E00A 3CGTA 5JOFB 1EXUA 3RL2A 1QFHA 1SEQL 1F4YH 2FB4H 5EZLB 4RMRA 3C6LC 1XR8A 1A4KB 3S5LG 3HZKA 2MJWA 1QRKA 1U8OB 3V7AE 3IXAA 1BJ8A 4P4RB 1JP5A 3VFSA 2H3NA 3BZDA 3PP4L 2OLDA 4Q2ZA 4ZTOH 3O6LL 3VFTA 2KL6A 4E42A 1FFNA 2J8HA 4NC2B 1ADQL 1KN2L 2OTWA 1W0YT 4MNQB 3W11D 2HKFL 4LK4A 1KG0A 1BFOA 3TBSB 3GUTA 4WW2F 15C8H 5HHVL 1UWGH 5FM8A 5HGDB 2CLZB 3DRTB 1XCTA 1R5IB 3QNYA 4JQXC 4ZSOA 4C55A 2FX8L 2Y36L 3VWKD 5LWYH 2X2YA 4O5LL 1A7OL 1QLRA 5DK0A 1NGQL 3SE8H 3TA3B 2HJFA 4ONFH 3KLHD 4BH7A 1EFXD 4X5XB 5ERWA 5HDLA 1D5XA 1EHNA 3O0RL 1KJVB 2D7TL 3DYPA 1PEWA 5SWZA 2AKRB 2FECI 2DI9A 1MRCL 4NO2A 5GQBA 2FGZA 3MRPA 4GW4A 4N9OB 4HXBH 2Q7YB 2EDHA 1CLOL 4FP8L 1RZGB 3MV9E 3B4NA 1ZLUK 2BP3A 5AAWA 3NPSC 2AGJL 2CIIB 3WKMH 5HYJA 3S3JA 4HMDA 3TP4A 2Y7QB 3QRGH 3TNNA 3IDGB 3MROB 5DI8B 5J9PA 1QBLL 4YWGH 5IMMB 4Y5YA 32C2B 4XVUC 2VDNH 4C58B 4GFTB 1IGCL 1KEMH 3IU4L 2PXYD 3ROOA 4JO2H 1ZWIB 1SJXA 1BFSA 1P4IH 4QHUB 1QKZH 1MCPL 1XF2B 5I30L 5E99L 5CJQH 4ZDHB 4ONHA 4ODTL 1XGUB 4YBHA 4L3ED 4FHBD 1C12B 1J18A 3VWKB 1VEOA 1CD1A 2BNQE 3MYJA 1T20B 5ABDE 4M03A 3NFNA 1QFWL 4PGCB 1AIFB 1EFXB 2DQTL 4WDIA 4JQIH 2MTPA 3BXNB 5JO5A 3X11A 4YO0B 3CVHL 1FYTD 1MRDL 1HSAA 3V6ZA 5JZ7C 5B8CA 5CHNB 4F3FB 3O45A 4ODVL 3C9NB 3DO3A 4I4WA 2ICWB 3GIZH 1T7WA 1CXHA 1JV5A 1RIHL 3QDGD 3QHFL 4OKDA 4W4OA 4Y4KC 3MXVH 5SV4A 2R29H 4DGIL 3FN0L 4KGJA 4KJYA 1X9QA 4G8EA 3QI9D 3OR6A 3QDMD 4XNXL 1FJ1B 4ZODA 3RPIA 3I85A 3O4LE 4M61A 3DX6A 1MJUL 4O9HH 5I6XC 5KN5B 1FBIH 2PXYB 3NAAL 1UH3A 1YMHB 1UT9A 3RGVD 4ZPVA 1KCSH 4PLOB 5D71H 3CC5B 5D6DA 5E8NB 4OCRL 2A9MH 1CGYA 4HIJA 4L3EB 5FYLD 4YGVA 3ZL4L 5E8DL 4LIQL 2VXQH 3SKMA 1UM6H 3G08A 1AO7A 3HZMB 3QDJA 4PS4L 4Y2DD 1NEZG 5EU6D 4P2RD 4C54A 1J1PH 3BMWA 1YQVH 2WUCH 4ZAKD 2AJUH 1BMGA 5I1IL 4N68A 5J12C 1LE9B 1WTLA 1U3ZA 4KQ3H 4AT6B 4OZ4B 3KYKL 3QDGB 3ULVH 3HE6A 3L3HA 4PY7A 4NQCE 4YZFE 4PGEA 3DXAA 2VOTA 3UBXB 4XH2A 1K9TA 3QI9B 4ZS7H 3QDMB 4OGZA 1L4IA 5AUMB 1AKJD 1I3RA 5CMAA 4X9IA 3FOLA 4QOKE 4ELMB 3IDNB 4PJEF 3TEUA 2EO1A 4F8TA 2VLJE 4FMKA 5J06A 3RGVB 2BHUA 4Z7WE 3NCFB 4CVXB 4QHLA 2YD6A 1ZHLA 3TIDB 2ZOKB 3LZFL 2ZUQC 1KOAA 4P46C 3D39D 3HC0B 3DMMC 4JKKA 4OZIA 2P5WE 5DJDA 1G0YR 3HPJA 4Y2DB 2Y5TB 1MRFL 3N50A 5EU6B 4JREB 2ARJQ 3WUWB 4P2RB 1FAIL 5F9JB 4ZAKB 3TBVA 3TCXA 3BW9A 3MXWH 1QRNA 5E24E 1WBZA 3RDTC 1CL7H 1U8IB 1FIGH 3OG4B 4AH2B 2K7PA 3H3BC 4Z5RA 3HR6A 12E8H 4Y5XA 3W39A 1JPTL 4XPHH 4LVNB 2HRLA 3SE3C 5JPNA 4UV4L 4JY4A 3DI2B 1B4JL 4ZD3L 3U9PL 1F6AA 1SBSH 5CEXA 1DSFH 4AM0A 2DDQH 1AKJB 4OCYH 5DRXB 4FFZL 3ILPA 3T2NL 4TVSa 2DWDA 1MFCH 2WM0A 1PKQB 3KPNA 1ADQA 5I1DA 5HGHB 3R0MA 3BMVA 3EO9H 4M62L 5BVPL 3GHBH 3F8UB 2DLFH 4NO0D 4U1LB 5HDQL 4ZFFA 5J0BA 4UV7H 5IFJB 3FQTB 3IJHA 3PF2A 3D39B 5FECB 3Q0HA 3ZYOA 3WIFA 3S3PA 3FKUS 1UA6H 1F4AA 4IOFD 3LN9A 1KPVB 4M6MH 1N64H 5ID1A 3ULUF 2Y25A 1ZGLM 1EK3A 4MB4A 2W0LA 2VWEE 4G6KH 5E1AA 2FIRT 5TF0A 1ZANL 1KC5H 3DGCR 2HLFD 5GS0C 3VGEA 4JJ5B 5C0EB 3C60D 1BBDL 4HKJA 4JFHE 2OP4L 3MOBL 1XMWA 1G9ML 3DUUB 1DANU 3BH9A 4RCAA 5ALCH 3I9GL 2D31B 4JGUA 4JZNB 5DC4B 1H3VA 1KJMB 4FTVA 4NKOB 2NXYD 2EICA 2VDKH 3L95A 3N1GC 4MLIA 4OCXH 1MWAL 1YN7A 4D0CA 2R2BB 2GQHA 3MBEC 1RMFL 1IEBB 4LNRB 4OIIH 3CH8A 3LN5A 5DEFA 3QJFA 3TYFB 5CEZH 1GYAA 2JJSA 5D9SB 2B4CC 3QWRA 3TYGH 2AVGA 2FATH 5J6HA 1NMBL 3F7PC 5EH1A 2VABA 4OM0L 1OTSC 5C0NC 2X5PA 1OP3H 3TVMC 4NO0B 4ESKA 4U0RB 3QFDB 3PUCA 2X4TA 5SWSD 3VXSA 1BREA 4RRPA 5L2KA 3PHQB 4PRIA 2X4QB 5BRZE 1GIGH 1P4BL 4HZAA 5I8CA 5GGVH 1MI5A 4TVPE 1G7QB 3F7YB 3CVHA 4PGDA 3RWFA 1FO0H 1H3XA 1TJHL 2G2RA 2D0FA 3AAZA 4YQXH 5H2BB 3QO0B 5E6IC 1DTUA 4KDTC 4CVZB 5DVOA 5ESAB 3PJSB 1MCSA 1Q9LB 1LDPL 3B6SB 4EDXB 1JK8A 2HFGH 1DE4B 1KTKE 1PG7X 2NXYB 4HT1L 4PJ8B 4PJBE 4UDUB 3MA7B 2O93L 4TUKL 2QQLL 1VENA 3KPSE 4YHKH 3WFEL 3QSKB 2FL5A 3LKSA 4U7KA 5DJXA 2FO4A 3N1PC 2VE6A 3LD8C 3M07A 2VQUA 3NCEB 4OQ1A 3VGDA 3QG6A 3VJ6A 2M2DA 2VL5B 5FYJL 5CGTA 4ZUTB 1NEUA 3G9VA 5SWSB 3TV3L 1LEKB 3QXUA 4WTWA 5TQ0L 4M1GL 1OPGL 1T04B 2HG5B 3AXLA 1QQDA 1D7FA 3RVVC 5HHVH 1XGQA 5LQBH 4PJEB 4NQSA 1V3LA 2FX8H 4FXKA 4NQXB 4C56E 4O5LH 1A7OH 4R97B 1NGQH 2AXGB 5DRZB 1QSVA 3EOBB 2ATPB 3ZLQC 4OTXL 4KY1L 5DJ0B 3BIKB 4IRJA 1MCDA 1MRCH 4ZOEA 3ARBA 2HFFA 3EUUA 1CLOH 3CH1B 4FP8H 4CN1A 3EYOA 4J8RA 5ITFB 5FUCC 3WXWH 3ULUD 4P48A 3LDBC 4L8BA 1QD0A 5L88L 2OYPA 1I9IH 3DVNA 1EHLL 3T04D 4X4YA 2R56L 5TGBA 3QPQC 4L4VA 3NTCL 3PWJA 1X7QB 1HHJA 4J6RL 1EERB 2EH8L 5EUKA 5LVEA 3IJYA 2HT2D 3B9DA 3VXQB 3IU4H 4IHOB 1X5JA 5IFAL 3H9SE 3SGJC 3DJ9A 4RRPG 1UM4L 1X5IA 1MCPH 2AEIT 1FH5L 4MDIA 2BSTB 3MRIA 5E99H 1YDPB 1C08B 4G6AC 1HHKA 1ULVA 4ODTH 3BGFB 1WWCA 4APQA 4BKLB 2HAZA 3NIDF 2VQ1A 1N5YL 4XZUB 2YD5A 4X6CF 4XTRC 5HGBB 1QOKA 2CJUL 5J1AB 4XB8A 4M5YL 5CSZB 3CVHH 2EDEA 5JOPD 5C0CE 4YNYB 1U92B 2J8UF 3RKDD 2VDML 4ODVH 4NRYB 1MCWW 4R8WH 2BCKB 3WD5L 4HJGA 1RIHH 3QHFH 5IHUH 5I18L 5ICXA 2C1OB 2KBGA 4DGIH 2EDBA 2Y07H 3EYVA 5A3ID 3IKCA 3O2DL 3BQUC 3V5DA 4AG4L 1IAKB 3ZHKA 3SDXE 5JHLH 2Z4QA 3D0LA 4PY8I 5D1XA 5E5UB 4DN4L 4NIKB 1MJUH 2F5AL 3PDDA 1U8MA 5C0IB 1OP3K 5DRWA 2CXGA 4MVBD 4V1DD 4YR6A 5DQJA 3HAEA 4OFDA 3OKEB 1UQSA 3FHQA 5FO7A 1AHWB 4K7PH 5IM7A 3G6AB 4K9EL 4LU5L 4ZUSB 2YXFA 3FTGB 3DURA 3MTRA 2W0PA 3WNKA 3TO4D 4HK0A 5LCVH 5E8DH 5B38G 1FGVH 4P2OC 3MRQA 3CSYA 3EYUH 4PS4H 3SCMC 4U1NA 5TE4L 3FB5A 2UY7A 3FQNB 2YKLL 1VA9A 2C3VA 3RTQD 4JM2A 4M6OL 4JFED 1KXTB 5DJCB 1MWAA 3U9UB 1BM3L 4GS7C 5EZIL 5EOCH 2PYFB 2BHZA 43C9B 2ADJA 4IJ3C 5FM5M 4JGJA 2E6JA 4WW1A 3HR5A 2FJGA 2VITB 3I75B 4S1SL 3GI9H 3RVWD 3O3AB 3KJ4B 2NY6D 2EXYD 4ZXBA 1B0RB 4PJFE 2X4PA 3PWUB 4P9HC 3P2TA 1DFBL 1YUHA 4QWWD 3BIAX 1C7TA 3EYSL 4PREB 3SBWA 3UYPA 3QRFM 4V1DB 1RZIB 4ZUWA 3SDCA 3UTSD 1U8QA 3V5KB 4Y89A 4HK3J 3Q1SL 4PP1D 1OSZA 1JF5A 1FZOA 4AQ1B 1E6JL 5F9AC 3M1BB 4C4KO 3NACH 4UILL 2EDQA 2XKNA 5EOCJ 4NUGH 3NCMA 4PJ7A 1JPFA 3TO4B 2RHEA 2BOCB 3OB0H 4Z7OF 2WWKT 5CGMA 4FQJH 3NOIA 1MJ8H 3DTXA 1HHIA 1UB6A 4GO6B 4H8WL 3MV9A 4I5BA 4WEMB 3RTQB 1K4DA 4PRAB 1ZVSA 3BZ4B 2OR8A 4JFEB 4X4XA 3TN0A 3EOAA 3GRWL 2IPTL 2C7UA 2Z31D 4JFPA 4P2QD 5FA4A 1Z5LA 4NJ9L 2WBKA 3O3DB 2AQ1A 4UV4H 1TETL 1N59A 1B4JH 2H8PB 2DLTA 1DANT 4N9GA 3WIHA 3GSWB 2NY6B 1QEWB 3U4EB 2R2HA 1WITA 2NX5A 4U1GC 3OKYA 3BJ91 4LPVA 2EDLA 3KDMA 2P47B 2VLRD 1I9JL 1RZKC 3UTSB 4OZGF 2R4RL 3RWHB 5GSVA 3B83A 5BVPH 1RJYB 5HDQH 2XZCL 4G80A 1HINL 5BZDA 1AC0A 2CDEA 2G9HB 3CXHJ 1YN6B 3HAEH 4N0FA 5LGHH 2JJVA 4TVPL 5CIPB 4HKZA 2DD8H 3VXPA 4CDHA 3JBG7 3WSQL 5AD0A 5DF0A 5B21A 2E7BA 1BVZA 5MEPA 1CGSL 2XI9A 4R2GD 1XF5A 1AGEB 3GMPA 1ZANH 2BVEA 4H25B 2VDLL 1YEEL 2FWOA 3EAKA 3NIGF 5L8KB 1OP9A 43CAA 3V7AG 3V0VB 3O4OB 5I71C 1DBBH 1X4ZA 4P2QB 2Z31B 3SKUD 2ENYA 2NY4C 5EO0A 3QDAA 3VXME 1PG7L 4X6CB 4XGZB 3T4YA 2DS4A 2YEZB 1MQKL 4FQCL 4K2UL 4YXKL 1MWAH 3K2MC 3IAGC 3UJJL 4ZFZB 3QQ4B 2J8UB 3ARYA 3V6BR 3VFVB 1OGTA 2C5DC 1NMBH 4XXCA 4YDVA 2VLRB 3U0TB 5I1JL 1B6DA 1MAKA 1LO0L 3W9DB 1IGIL 1CXFA 2IAMD 1I8KB 3ZYIA 4G9FD 5IESL 3S34L 5DJ8A 5E1HB 1J05B 1RK0B 2EEAA 5GGQL 2P7TB 4HW6A 4XNUL 4XMPL 2VZ1A 3S5LB 5EO9B 2IADA 1X6LA 2V2WA 5ILTL 1IGTA 4NOBA 1KJ2H 5IBLD 3FT2A 3IU3B 2AEPL 3QIWD 1UJ3B 3OJDA 4R2GB 1TJHH 1NGZA 5IKCB 3DIFB 4FQQA 4PRDB 3FONB 3IF1A 1S5IL 4NNXA 2J4WL 1PDKA 1KN4L 2F15A 2E9BA 4WV1B 4AK1A 4WO4C 2YRZA 4NQCA 4JDTL 3T2OA 1CIUA 1IFHL 4S1DD 4U6TA 3E6HB 1UWXH 4YPGB 2OTPA 1U3YA 3F7RA 4GKNB 1D6VL 3FMGL 1CGTA 1WLHA 4DGYL 3O2DA 3AS3A 1BBJB 4ZQKA 2VZTA 4TUKH 2VLJA 5GRUL 4XNMB 4K71C 5HHQA 1NMAL 5DFWH 1BEYH 1DUYA 2OX5A 3ALPA 4NT6B 4YLQT 3DHMA 4HZLA 3WIHH 1AD9B 3QWQB 1A6AA 3LH2H 2IAMB 3LHPH 4K3HA 4XP4L 2ESVE 3QWOB 4WU5B 2ZUWA 4CUCA 2UVEA 2G75A 1K4CB 1CICA 4L9LB 3QEGL 4N90D 4OFYA 2XZAL 3CVIH 1OPGH 3O3EA 2I07A 4LSRH 4MMXC 1WZ1H 2AJVL 4OV5B 2EE2A 2QR0B 2WANA 3U36B 4UUJA 3OB0K 3O81A 4UT7L 3QIWB 1L7TL 2NY3C 3U6RA 4O58L 3IETB 4POUB 1HCVA 3BGMB 5CZVL 1MHHB 4ODWA 3UMTA 4NDMB 1S8DB 4POZD 5LG1A 5FGBC 1A7QL 1HOCA 3EDDA 2Z91A 2VAAA 5C9KA 2AK1H 3TH3T 3CXHK 2MHAA 1AE6H 2K7QA 3UTZB 4FQXC 4LLVA 1WBYB 4YDKH 2HWZH 1KT2B 3RWDB 3DBXB 5H94A 5HI3C 5SWZD 1RUAL 2UZYB 5E6ZA 1F58L 5DZOA 2EH8H 1BQHA 1MCRA 2NTFA 5HHNB 2ADFL 2DN7A 5JW5B 1EVTC 4LLWA 2ZUUA 3IFNL 4MA3A 3ZTNH 1XR8B 4GXVH 1UM4H 5F7LB 5D7IE 3HZKB 4H88H 3EHBD 4GG6F 2ARWA 1FH5H 3CU7A 4KVCL 4OZIF 2Q6WA 1ZKAA 1DR9A 4DKFH 2H3NB 5F21B 1KF9B 3OHXA 4Q2ZB 4R7DA 4URTB 3LKPA 1N5YH 4Q9QH 3VI4F 5J13C 4E42B 1GC1C 1FFNB 3UZQA 4OZGB 1ACZA 2CJUH 2OTWB 1I3GL 4FG6C 1KG0B 3JWNC 1BFOB 3GUTB 4BQ8A 1YECH 3GRWA 3ISWA 4PGBA 3TCLA 3L3JB 1GL4B 1XCTB 3QNYB 5B39A 2VDMH 4XC1L 1H5BB 4Y5VC 1QLRB 2EXWC 1RUPL 2HJFB 4XHQA 4BH7B 3WD5H 4YHZH 3OKNA 4MQXD 2XG4A 3JTTA 4DUWA 1WJ3A 1D5XB 3R06A 5E56A 4AIOA 5SWZB 5C0JA 2BVYA 2PR4L 2WQRA 5FUCE 3O2DH 4NO2B 4OF6A 3ES6A 2E7LC 2XTJD 3MRPB 5EORL 4GW4B 3MOQA 5I1HH 3D3VE 3GSVB 1YEIH 2ORBL 5HHPB 2F5AH 2Y72A 3JV0A 3VWJA 1N6UA 3P0GB 3RNKA 1A1MB 4X98A 1M05B 5BRZA 4A6YL 2X89A 1TJIH 3TNNB 5H35A 2XWTA 4Q9RH 4WY7L 4H1LA 5DC9B 4LFHG 3JWDC 4DJMA 3QUXC 5J9PB 4WUUE 4YEEA 3ROOB 3WFCH 1G7LA 3PXHA 5F9OH 3ULSA 4P4KA 4KQ4L 4U2ZA 1KTDB 5FOBA 2FRGP 4JDZA 1CDCA 1G7HB 4MA1C 5TE4H 4WEUD 1KIPA 1CL7I 1NBYB 4PJBA 4ONHB 2YKLH 1AFVL 4TSAL 1UWXK 1CD8A 3OAUL 1CD1B 3I2CH 3KPSA 3RUGF 4WDIB 4KHXH 2HA1A 1NSNL 5JO5B 2WLZA 3LS5L 1CGVA 1IVLA 4XBEH 1HSAB 5DWUH 5B8CB 4P23A 2CD0A 3O45B 2G5BB 2XTJB 3ILQD 5HJ3A 5IUSA 3QUMH 3VGFA 3UTTE 5T3ZE 1HSBA 4MHHI 4I4WB 3L3KA 5JW4R 4P2YA 1FZJB 1DFBH 5C2BL 1PYWB 3EYSH 3R8BB 3HE6D 1MH5A 3HG1E 1QVOA 3DXAD 1X3DA 2DM3A 1S5HB 5CEZD 3Q1SH 3OR6B 3HC3L 5DDHA 2QBWA 4FQIL 3RPIB 2ZJSL 1R3JA 3DX6B 1XFPA 1U6AH 3ET9F 3AY4C 4FQHB 2AV7A 3SPVA 4U3HA 1D5MB 3T3ME 5GSRA 1NGYA 5CD5C 3LS4L 4QYOA 4ZPVB 4ERSH 1YJDC 2RR3A 4PJCE 1JGVH 4H8WH 2DIJA 4BK5A 4U3CA 4HIJB 3QG7H 4XMKL 4I3GA 3QNZA 4X7FC 4YGVB 1ZA6B 4CADA 1ZHNA 1A7BA 4KU1A 3SKMB 3G08B 2P8PA 3GRWH 1KTRL 2IPTH 2ZOLB 5CFHA 1LP9E 4NJ9H 5CWSB 3BPNB 1TETH 3SKNA 3F12B 1ZT7A 5FK9A 4TNWK 1OWWA 1JTTA 4P5TC 4FA8A 1YY8A 1JWUA 4CU6A 3E6FA 4X7CC 3B5HA 3HE6B 4Y0GA 3INUL 4DVRH 1NKOA 4CJ0A 4LARL 4GMTH 3DXAB 5E2VH 4XH2B 3WNLA 3OKLA 1K6QH 2ZUYA 4QHNA 3DNKA 1WUNT 1MCEA 1I3RB 5CMAB 3BWUC 4JQXA 3FOLB 4X7TA 3BHBB 4TVPH 1XF4A 4XVSL 5IHLB 2A83A 2AJXH 4G6JL 5HHOD 2CR3A 5C0CA 2YUZA 3RWJA 4PJXF 5D7JC 3FZUC 3RKPA 4QHLB 4DK6A 3K4ZA 4H0HB 5C2UB 1ZHLB 1CGSH 2OBGA 4Z7QF 4UT9L 4GQPH 4UIKL 4GG6B 5F6IC 3TNMA 1AH1A 4OZIB 1FO0B 5DJDB 2C26A 4LLDA 5IB4B 3HPJB 3SDXA 1PG7H 1B4RA 1HWGB 4HLZH 1MQKH 3V8OA 4K2UH 4YXKH 1RIVH 3TBVB 1MCQA 1RIUL 4X9HA 3N0PB 1WBZB 2NPLX 1IRAY 3UJJH 2HYMA 1JGLL 5FDYA 3T0BA 4MQTB 1OT1A 2GW5A 1XT5A 3MV01 4NQVA 4KKAD 2AI0H 4Y5XB 1I85C 2VKXA 5ALBL 5I1JH 4Q9CA 5A16A 4JY4B 1HKLL 1LO0H 3PABB 5JA8B 2OL3L 4RNRB 1F6AB 1UFUA 5CEXB 4UI2A 4YK4B 3S34H 4AM0B 1NAKH 4ODHL 3GSXA 3ARFA 4TSCL 5FKPA 4KK8D 1U9KA 4XNUH 3ILPB 4LSSL 2CRMA 1N2RA 5ILTH 5HHOB 4J4PC 3KPNB 4ZNCD 1ZHKA 4YHNB 3KJ6L 5MEND 2AEPH 4KI5F 4HUUA 4ZFFB 2KZWA 2QSTA 1MCJA 5L2KD 1GHFL 3WIFB 3WE6B 5AYUL 4O02L 3AFLA 4Y4KA 2VDPL 1D6VH 2BC4A 5I2IA 1T7XA 4R0LA 4PJFA 3GB7A 5E1AB 1XIWC 5C0DB 4XBGA 5B3NA 3F6IA 4HKJB 4GKSA 1MREL 3TH4T 1D9KC 2EKJA 1RHHA 3AB0B 4GAGL 4O4YL 4OLZL 4P49A 1NMAH 3BH9B 2CUMA 4A6YA 5JXEC 5IHZA 3L95B 3RUGB 1U8JA 2VERN 1C5BL 1YN7B 1K8IA 3HKFA 4D0CB 1IM9A 1W0VA 2EKSA 3CU1A 4HEME 4NO5A 3GSQA 4LHUA 4ZFOL 5KOMC 5T5FL 3GSUA 5DEFB 3QJFB 2AJVH 5J6HB 1O0VA 5I8OH 3IT8D 3CSGA 2VABB 1WQVT 4WWKC 5MENB 1QFWI 3VD9A 4J1UB 1JHTA 1L7TH 1NGPH 5D1QA 1JZ4A 4HQQL 1MLCB 4F15C 2X4TB 1NH6A 2N56A 3PWNA 3U1SL 4J23A 5L2KB 1A7QH 2VSCA 1F90H 3OR7B 2JB5H 4KRNA 3O6FC 1U8NB 1HH6A 4I0PA 2YA2A 5I8CB 5JOEA 1QR1A 1B6UA 1RFDL 3CVHB 4LKXA 2W9EH 2FBJL 2G2RB 3KPRD 1MEXL 3OAYH 5EIVA 3D85A 3AAZB 4UTAL 3OX8A 4S2SA 1YY9C 1HYSC 5C3TA 4JHAL 4IRJD 3Q5YA 1JK8B 3GGWA 1F58H 1ED3A 3FQXB 4DOHE 3GM0A 4KKBC 1RU9H 2ADFH 1NCBL 1DVFC 1UEMA 4R4FL 3IFNH 2MPAL 2ZUTA 4P46A 4AL8L 1FSKC 3TBTB 5JIKA 1MCOL 3VFUA 2FL5B 1QFUL 3LKSB 4KVCH 4L4VD 4X4ME 3NGBC 2HKHL 2FO4B 2IFGA 4CAGA 3FT3A 5I75B 1MHPL 1OARL 3VJ6B 2DJ4A 1Y0LA 4PG2C 2XACC 2JKXA 1IT9L 4PRBA 4FZEL 3G5ZA 1J0KA 1P4LB 4WTZA 1MSPA 4CL7A 3RDTA 4N8VA 1I3GH 3P0VL 1KIRA 3VXMA 2NW2A 2NNAA 2P8MB 1QQDB 1X6NA 3GNMH 5DUML 5F6HI 5GGSA 2CUIA 3ZKXC 1HZHH 4NQSB 3TBYB 4FXKB 4XC1H 3U7AA 4HXAL 2X41A 4PJXB 3KPRB 1RUPH 3EO0A 5DUBB 5BMFH 1EZVX 5F7UA 2DQHL 4KI5D 4MS8C 3B9KA 2BY0A 5F71A 4IRJB 4KTDL 2DOCA 2DM7A 1UWEL 4U1MA 3GSRA 4LSPL 4N8PA 5HD8D 5IROC 1CCZA 3OF6A 3RAJH 5K9QI 4PBXA 2HFFB 3MREA 4J8RB 4LKCA 4KZDL 3DUSA 4WHTA 4L8BB 4U6VH 1INQA 1DDHA 3ZKSD 3I84A 5TGBB 3T0WA 3FQWA 2VZ3A 3I50L 3AM8C 4WY7H 3BD3A 4L4VB 5ACZA 3PWJB 1D3CA 1A7PL 3LPFA 4EOWL 5D1XD 1TCRA 1CDYA 5I9QC 1YYML 3JTSA 1E4XH 4NRXA 2VKWA 4KQ4H 4PGZA 3P77A 3MRIB 2NYYC 4LEOA 5IB5A 3B3IA 4PJ5E 4ZYKB 2ARJA 1A3LH 4F37K 4TSAH 1T1XB 4XP5L 1PVHA 3JUZA 5AWNH 3ECBB 4TNWF 4NKDB 3G5XB 1CDHA 1ZS8A 4MQ7A 2VLME 1UKSA 8CGTA 2QV2A 1OGAA 1CLZL 4JM2D 2ESVA 4LRNH 1YEGL 3UC0L 2OL3A 4FFWD 2AXJA 4UAOC 4X6DE 3QH3A 1AGCB 1HH9A 5ICXB 2F8XC 3HZYA 3IKCB 3V5DB 1RJCA 3HC3H 5JHDA 5FKAA 4FQIH 3DETC 1T1ZA 2Z4QB 2ZJSH 3WDJA 5D1XB 4DFIA 5T3XE 2IPUK 1OTUD 1OCWL 2DQGL 1IGFL 4HC1L 2FJFA 4FFVC 5DQJB 3HAEB 1FLRH 4OQTL 5FO7B 5IM7B 2BNRE 1BFVH 3T4AB 1U93A 4LAJH 4YZFF 2VO5A 4D9RE 5IB1B 1JUFB 4XMKH 1T0MA 2H1PH 1VKXA 3V5HB 3BPLB 4HGKC 4JKMA 3OAYK 3MRQB 1JGUL 3SJVA 1TVHA 4U1NB 3MRLA 2GTZA 3FB5B 4LSVH 3U83A 2X4RA 4HMEA 1BGXL 4A2LA 3MV9D 3MJ8A 3RVTD 5EC1A 1ITCA 2C3VB 2IFFL 4ODXA 5D5MA 2JK5A 5DD6B 4KRPC 4Z7WF 3EJYD 2QJDA 4JM2B 5AYQA 5D7IA 3W9EB 2WV3A 2OJZL 5F7WC 3TN0D 5DGQA 1FC2D 4ZOCA 3INUH 2ADJB 4ZFOA 3GHEL 5CP3H 1AI1H 3HR5B 2FJGB 5DT1L 4XCEA 2CPCA 4HAFA 3ELAT 1U3HA 3B9VA 4UIMA 2X4PB 1C7SA 1HDMA 3RFZC 1HYRC 2CQVA 1N8ZA 3SQOL 2YK1H 1U8QB 2LU7A 5CJOH 1J0YA 1OSZB 4JRYE 4FZ8H 1FZOB 2BNQD 2K9UA 2HN7A 3PWVB 1KJ2B 3KLAA 4NWUL 5GHWL 2W38A 1OM3L 1MCCA 1W72L 1RVFH 3DV4A 1JPFB 5FYKL 1QPXA 1R3LA 4IRSD 1NBQA 4KJQD 1DL7H 3AU1A 5GS1B 9CGTA 2R0ZL 4YDLB 3D3VA 3DTXB 1HHIB 1UB6B 3MV9B 3NIFE 2RCSL 4I5BB 2LTQC 3ZE0E 1RIUH 3NCJL 1F3DH 4Z77A 1K4DB 5HGGS 1ZVSB 4X4XB 3FT4A 2AERT 4XXDA 3TN0B 4JFPB 4KKCD 1CDIA 4BSWA 3ZKNC 5FA4B 1IKNC 2QHLA 1Z5LB 3O4LD 2R23A 1WIOA 5ALBH 1FP5A 4WUUA 1N59B 3C09B 4P5MA 2BSED 2OL3H 2J8OA 1EH9A 1MF2L 1IAOA 2P5EE 3GKWL 4HWZA 4KK5D 2V9TA 2YC1B 1IQWH 2R2HB 2NX5B 4XHJC 4YFLI 2X4NB 3KDMB 5IT2L 4BJLA 3VD4A 2FIKB 2X10A 3CPLA 4JM4L 5GSVB 1DQLL 2BNQB 3ZKMD 1NMCC 3S96A 2CDEB 1A9EA 4OLYH 4NN6C 2WW8A 3T2QA 1AGFB 2DRUA 4HKZB 5F97E 3VXPB 1PX3A 4JZJC 3PHOB 4XWOC 5AYUH 4IRSB 2UWEA 4O02H 5MEPB 3UTTA 4XNQB 1IZKA 3BQUA 1I4FA 4X80L 3ZZ1A 2FD6L 1VCAA 2Z8SA 2FGWH 4Y4HA 4NQCD 1MREH 2GK2A 2IWGA 5GRXG 4O4YH 4OLZH 1TZHB 4GKZA 4OGYH 5IW1A 4YE4L 3EOTL 2H2PD 1J5OL 1C5BH 2OTUB 4QOKD 3MLPA 3CMOL 2F8VA 5EO1A 2VLJD 4TN9A 1I1FB 2JE8A 4AMKH 5T5FH 3NZ8A 3SGEH 1VERA 2Y6SD 1OGTB 2CLVA 1XR9A 5IMLA 4YDVB 2X1WL 2OMNA 4G8GA 5HVHB 5M94B 4HJJH 3RY6A 4LHJB 1AR1C 2P5WD 1H3PH 3VD7A 4OI9A 3FN9A 4S0TD 4OCSH 2G60H 5DJ8B 4PJBF 2FEDD 3AREA 4KFZC 3JWOL 2XA8H 3LKQA 2JF1A 2FX9H 2IADB 5IFHH 1LP9A 2V2WB 1MFDH 2ZG3A 4XI5D 3G9AB 4LFHD 2Z8RA 2GSGA 4X0KA 3LB6D 3OKOA 3VXOB 4U1JA 5BO1L 1NGZB 4LVOB 2FBJH 4LDLB 1MEXH 2BVUA 1CG9A 3IF1B 4PYGA 1UACL 4Z8FL 5F3HA 4Z7UE 4NQCB 3DHJA 4JHAH 4HIIA 4BK4A 1IBGL 3F7VA 2UY6A 3SDAA 4AEHH 2AJYL 1LK2B 3OWEA 1QPPA 1N3NA 3REWA 4QOKB 4R4FH 2D9QB 4ZQKB 1WCQA 3TFKD 4GBXA 3O11B 1U41A 2VLJB 3MPCA 3DVGA 2ATKA 4YXLL 4Z7WB 5HHQB 1T5WA 1DUYB 3GK8H 4HZLB 3WUZA 4K8RL 2DF3A 5HI4C 5D2LA 1FG9C 4L8SB 4OQTA 3O8XA 1MHPH 1OARH 2P5WB 2VYRE 3B2VH 4N0UE 3EBAA 2WIIA 2G75B 3RWGA 1CICB 1GZPA 4F37F 1IC7L 3ZDXE 3N1MC 1RK1A 3O3EB 1FNGA 3T08A 4JFYA 5DUMH 1JJUA 4LDEB 2PYEE 4NZJA 2ZUVA 4DCQA 4I0CC 4UUJB 3MQIA 1RAMA 4B0MM 1CE1L 4JFHD 3U6RB 3MZTA 4HXAH 3HA0A 2HTLC 2FHBA 4FABH 4ODWB 2GSIB 4JRXE 1HOCB 5T3ZH 2B1HH 2VAAB 4KTDH 1HHGA 2LU4A 1UWEH 2PTTA 4QTIH 4J3SA 3TPUB 1HXYB 1Z9SA 2MHAB 4LSPH 1N6QL 2UZIH 3KWWA 2YUWA 1NBZA 3GI8L 4YHYC 3QZWA 4PLKC 4LLAA 2O5XL 4LLVB 4HSQA 5T5NG 3CFCH 3M17B 3QUMB 4PRHE 3QIBC 3V6FA 4I77L 3EYQD 4ZO7A 5I16B 2EEBA 5H94B 1H3TA 3I50H 4PLJD 1KCVL 2AV1A 1S9VA 5FIEA 5DJAA 1A7PH 3LRSB 1CQKA 3IDJB 4NC1C 1BQHB 2NTFB 3O3UN 3N9GL 4ONGL 4LRIC 4LLWB 3U82B 1J11A 4MA3B 2QQQA 5BRZD 5F6HJ 5J11B 4GT7A 2DQUL 2X89D 3D1MC 4G8FB 2DQFA 3PWPA 1X5HA 4TVPD 3HE7A 1LHZA 4XPTL 4C57C 3C5SA 4J3XA 5INDA 4MA8L 4HX1A 2Q6WB 3UEZA 3W0WE 1ORQA 4UOW0 4N0CD 5BXFA 8FABA 3OHXB 4KJPD 4R7DB 4DGVL 2NLJA 4RGOH 4P4KD 3DX8B 2CK2A 1U2HA 4LL9A 4KK6C 1I1AC 4M3KB 2ED9A 4KI1A 5F96L 2EE9A 4OIBA 3WS3A 4X5WB 3F7QA 5B39B 4NHUB 3GSNA 1WIPA 4I18C 1CLZH 3RPKA 5C09A 4PRPE 4MSWA 1TQCB 3K74B 3UJIL 3KPSD 3VXRE 4HDIA 4P9HH 1S9XA 3OKNB 4GXUN 3BO8A 4MXWL 1B0GB 3R06B 5EIIA 2XQYG 5C0JB 5DMKA 3VE0A 3X3FL 1YNKH 3ES6B 1JWMA 1XH3A 4QNPE 5F1OB 5EZOH 5IVXA 1IEAA 2VQTA 3BP5B 5GZOC 1DZBA 2JELH 3HN3A 3BDYH 4HKBA 1BIIA 1DQJB 1OCWH 4UOW1 4X98B 1IGFH 5BRZB 2ZCHL 3MODL 1QZ1A 1K2DA 1JVKA 4OQTH 5H35B 2XWTB 4WO4A 3UYRH 3BYYA 1R3KA 1A8JH 2J3SA 4C56D 5C1MB 2VH5H 4TUJB 5DMGD 3U0WH 3L3DA 1BECA 1TLKA 2VB5A 2ENSA 1JZ6A 4YHOL 4JPKL 4XX1E 4X4ZA 3HRPA 4P4KB 3MCLL 2X1OA 4PJFF 3MRGA 4JDZB 4FQ2L 4K94L 5FA3A 4Z0XA 3ARVA 1WGOA 3IDIA 4PJBB 4MB5A 1BGXH 5ENWA 1L7IL 1N4XL 3QQ3A 2AABH 5EU5A 3VFGH 2OJZH 3KPSB 4GAFB 2X1XR 1OF2B 2VSDA 3HI5H 5GGRA 5L7XH 2Q7NA 4X4MA 2D4DA 2DTML 1RZKH 1CFTA 3QT2A 2K3TA 1CZ8L 4PJDA 3PIQA 4OLVL 3H9SD 5HJ3B 4NM8H 3D2UA 3MACH 1HSBB 3L3KB 5I73C 5AG8A 3OPZL 5BS0E 1CFNA 1HNGA 4HWEL 4NZTL 1UJTA 1MH5B 5ADOH 1QVOB 4XBPA 2F53E 3WO4B 1NGXB 5FGBA 5TQ2L 1QACA 4C56B 5DDHB 1KEGL 1R3JB 1CGUA 4NWUH 1YEJH 3BWAA 5SX4H 4M48L 2C1PB 3G6DH 1T2JA 2AV7B 3D9AL 3H3PH 5D96C 4FQXA 3SOBL 5FYKH 1WVZA 3GMNA 5C0CD 5GSRB 1NGYB 4G6ML 1I7UA 3RHWK 1J1OL 4QYOB 1EAPA 3CSBA 2HT4C 4YHIA 4F2MA 3QUYC 2R0ZH 5EBMA 1BOGA 1IC4L 2RCSH 4MJ5A 2HTKD 3P0YL 4QXUL 4KHTL 3BH8A 3QNZB 4LPUA 4JZOA 4X6BA 4NCC2 1AQKL 3SEPA 1ZHNB 3F58L 1PLGL 2JJTC 2P8PB 3VA6A 3SO5A 3IGAA 3GSNH 1QYGL 1E4JA 3SKNB 4MDJA 3EKCA 3H9SB 1CFVL 4HAGA 2X40A 4XVUD 1YY8B 1JWUB 2YD9A 4EI6A 2KQNA 4PJ5A 4U2YA 3OKKA 3PHSA 4UDTA 4QHNB 5EOQH 4D0DA 1V05A 4F7MA 2B5IB 3CXDL 3TT3H 1O5DT 1D5IL 3ARFD 4X7TB 1MHCA 1XF4B 4Y5VA 3OKMA 3ROLA 1SBBA 5ICYB 5C0CB 5F1NA 3RWJB 2BVQA 2KDGA 4BUHA 2JTDA 2DLIA 2VZOA 1YEDA 3TT1L 3QUZC 5HHXL 3CLEL 3TNMB 4X6DA 2E7LA 5FYLL 4LLDB 1QSFE 2OXGA 1F6FB 3T0EC 4QT5A 3MCG1 3SDXB 4JFFA 1SMAA 2Z35A 4RAUA 4Y4KD 1FZKA 4GG8A 2IH3A 2QHRL 3TO2A 3KPPA 4M6NL 4Y16A 4GXUM 5EC2A 1J5OH 1I1CA 1U91B 3T77A 5E7FA 3QUXA 4ZS6C 3CMOH 2NY2C 3K3QA 4NUJA 5JOFA 3ZT6A 2BNRA 2EDOA 2XQYK 4JRWA 2BRRL 1U3JA 5DC0A 4YPJA 5GJSL 3CLFH 1NCAL 2XN9E 5I19H 1IM9D 3VXUE 4P4RA 3DV6A 4K3JH 5HYSG 2C3GA 3GSXB 3ARFB 5FKPB 1ZLSL 4DTGL 1DBML 3JWOH 5F9WC 3TESA 1YEFL 1FORL 3GJEB 1N2RB 3WS6C 1RI8A 3MO1B 1E27A 1ZHKB 3O9WC 2FR4A 5E8OA 4YXHH 3K4DA 1D6EA 5C07E 3TBSA 5DA4A 3DOSA 5D1QD 5H37H 5BO1H 2R1YA 4HUUB 2XZQL 2CLZA 4DK3A 1R5IA 4KAQL 5KSAC 4M7KH 4M8QB 1EGJH 2R69H 4OSUH 3IDXH 3QUKB 3K80A 2FDBP 4BFIB 4X5XA 1IBGH 4IEFB 5IWLC 4Y4KB 5KVDL 2AJYH 2BC4B 5I2IB 4PJFB 3GB7B 4GH7B 4XBGB 4X8XA 1J88A 1V3MA 2Q7YA 4O2FB 4GRLC 1RHHB 2CIIA 4JRYA 1JIBA 4MXVE 5IBTL 2Q8AL 5KJRH 1VACB 1B90A 4JVWA 5IHZB 1DBAL 3GO1H 2YRLA 2B20A 4UMGA 3V4PL 3C08L 1IM9B 1FE8L 1FZMA 1KCUL 1MVFA 1W0VB 3UPAA 5ITBL 5GS3A 1GC1H 4NO5B 4PJAE 32C2A 4P46D 1SJVA 3DMMD 2CGRL 2P42B 4BYHA 1HKFA 4YEFA 2B1AL 4HMCA 2CO7B 4TSBH 2VL4A 3SKOA 2AEWA 1I7RB 1CE1H 3MGTA 1A6VL 1JHTB 5D1QB 4U3XA 3X3GL 1DQMH 1LDSA 7FABH 3PWNB 1FYHB 4TNVF 3RDTD 1C12A 4JDVA 4P5TA 5EBLA 3VXMD 3R0NA 1T5XB 4PGCA 1AIFA 1EFXA 2V5MA 1HH6B 3EDKA 4MWFB 3TC9A 3OMZA 2P5EA 4LKXB 4KTEH 4HWNA 3GI8H 2O5XH 3W2DL 4EUPG 3DYOA 3OX8B 1KV3A 3C9NA 2GK0B 4PB0L 4I77H 2ICWA 1R5WB 3GGWB 1ZXQA 5T3XH 3JWDH 1ED3B 1I9EA 5DD0L 3OF6D 4G3YL 1J8HE 4ALAL 3VH8A 5D7JA 3QA3A 4ONGH 2NY0C 2PTUA 1HIML 4YHLL 3C8DA 2V5RA 2P48B 4J3WA 1Q1JL 1RZ8B 1BZ7A 1BJ1H 4P46B 4ZTPH 3DMMB 1BZ9A 2Q8BL 3S35H 2PXYA 3P3YA 1DEDA 4LVEA 5DUPH 5I0DA 4MA8H 1M7XA 5HHME 5I1CL 4DGVH 5AEAA 5E2UH 3CC5A 4PRBB 5E8NA 3IFPB 1MCKA 5GS0D 3RDTB 4N8VB 5JUEH 1A7NL 5KSUB 1KIRB 3EYFB 3VXMB 2NW2B 2NNAB 3X14B 2YD7A 5GGSB 3QDHA 5F96H 2VRAA 3ARRA 1CI5A 3HC4H 2B7DT 1I75A 1FYTA 4MJID 3RZCA 3LQAL 3UJIH 2NZ9C 3EO0B 1YC8A 5DHYA 3PGFL 5KVEH 3NVQA 4D9LL 3MBED 4MXWH 4YX2L 3EFDH 3S37H 1RSFA 5JW4M 3MRHB 4AT6A 4U1MB 3QDGA 3GSRB 4YIQB 2ESVD 5LBSL 3MRFA 1XGYL 5C0BE 2IBGA 1OTSD 5GJTL 3MREB 1UZ6E 3HFMH 3QI9A 4LKCB 3QDMA 5C0ND 3TVMD 1A0QL 3DUSB 4WHTB 4DFHA 5LGKA 3BPCB 5EB9A 1INQB 4NC1E 2ZCHH 3MODH 3WXVL 2GCYA 5I17A 3FQWB 3IDNA 1K85A 4X7SL 2Z8VC 5ACZB 4DZBA 3BESR 1XAUA 5DURD 3RHWF 4Z7UA 3GIVA 4N8CH 2ZOKA 3JTSB 1FVDB 1P84J 4EI5A 4NRXB 3MCLH 4RA3A 4HBCH 5E6ID 5T1MA 4LEOB 5ADPL 4M1DH 5IB5B 4OI8A 3B3IB 5L0QC 1L7IH 4Y2DA 1N4XH 5CGYC 5EU6A 1TQBC 2RB8A 4TYUA 5JXEA 3RWEA 2ADIA 5F9JA 3THMH 4ZAKA 1FQ9C 3MBEB 4WW2A 2KZ1B 3MRBB 5BZWB 1ZS8B 1OSPL 1U8IA 4MQ7B 5T5NF 3T3MF 4X5LA 4XPBH 4N0UA 3P11H 2ESVB 4PJCF 1R3IH 2APBA 3D18A 1UADC 2YMXL 1F8TL 2OL3B 3MC0A 3OPZH 3ULUL 4RZCA 1Q9WB 4M02A 3QH3B 4HWEH 2XRAL 1X5LA 3F5WA 1AKJA 1HH9B 3QCUL 1EO5A 4P3CH 5DRXA 2NQCA 3HZYB 4QCIB 3IAPA 25C8L 3Q6GH 2WNGA 5FKAB 3RVVD 1T1ZB 3ZHDA 3BT2L 5DURB 5HGHA 2CKBA 2GJJA 3SOBH 2E8ZA 3O2VH 3D39A 1RD6A 2FJFB 5C6PB 5KVMC 3IFLH 4KUZL 1CU4L 2GFBA 5E6IB 5K9JL 1RZFH 1U93B 4KPHL 4FS0A 3FCTB 4PRHA 1MIML 3RGVC 1LWRA 5IQ7L 3MCKA 3VRLE 1T0MB 4KDVA 1DVFA 1MCIA 3F58H 4L1DA 1PLGH 3SDYL 4JJ5A 3FB6B 3MRLB 5BV7L 2X4RB 4IMLA 4M7ZC 3D3VD 4G7YH 1KCRH 3MJ8B 3QPQD 2D31A 4JZNA 5EC1B 5D5MB 1CFVH 2D0HA 1KJMA 1JTOA 3WIIL 2V2XB 3ARZA 3U4BL 4S0SD 5D7IB 3LD8B 4JREC 2MQ0A 1ETZA 2H41A 4PG2A 3CFJA 2WP3T 1Q0YL 2EH7H 3DX7B 3W0WA 1URLA 2EYRA 2EDFA 4WUUD 4X83A 1J10A 1N0XL 1TVDA 1G6VK 2MFNA 4G6AD 4NFBA 4XCEB 2WBJA 3JVGC 1U3HB 4UIMB 2NY5L 4Z76B 5SV3A 5D72L 3QXDA 4HKXA 1HDMB 1X4YA 1Y6MR 3QFDA 3CFKA 4XTRD 35C8H 2X4OA 2VDQH 5KW9L 3CFDA 4U1SA 3Q5TA 4PRPA 3V8CA 2HN7B 2P8LA 5C6TL 1LK3L 1EAJA 5HHXH 5L2JB 3KLAB 3EFFA 1G7QA 5IF0A 3F7YA 2ZCLL 3DV4B 2B2XL 2R8SL 4EQ2A 2F19H 4XCNA 2UUDH 3SGKA 1R3LB 5H2BA 3QO0A 3C60A 3VCLA 2VR5A 2ZWLT 3PJSA 3AU1B 3UTTD 5T3ZD 3D3VB 1NBVL 4M6NH 1P84K 2DM2A 4TULL 3BQUD 1CIDA 3AM8A 4JLRB 2RJMA 1RURL 4Z77B 4MQSB 4Y4HD 3HG1D 4F7TA 2FX7L 3STBA 3FT4B 1MJ7L 3CD4A 4QY8A 3QYCA 4XP9L 3UJTL 3UAJD 2LV4A 1MUJA 1XEDA 4YHML 1T3FA 1WWAX 2R23B 5GGTL 2J88H 4WUUB 4YDJA 3CZFB 2HP4A 1IAOB 1NCDH 4HLJA 4DTGH 4OCWL 1DBMH 2VL5A 1QNZL 4NC0B 4ZUTA 2CKNA 1LEKA 2EE6A 2CKBH 2HG5A 4KKNA 2Y1VA 5CS7A 4LCCA 5IVNA 1A9EB 1MNUL 1H3UA 1G0DA 3PV7A 4PIRF 1MJJA 1GOHA 2PCPA 3ZYJA 3L9RA 2UWEB 4WVRA 4I13B 1CS6A 3UTTB 3BIKA 1TTUA 3BQUB 4KRMB 4BUGA 3T0EE 4QKXB 5DEGA 5E03A 3PV6B 4L4TE 2DQDH 1Q9OA 4LBEA 4Y4HB 3HG1B 5FF6B 4GKZB 1RZJC 4QF1A 5MI0C 4JHZA 4M9OA 5IBTH 5IW1B 4M5ZL 2R1WB 3WL9A 2Q87A 1DBAH 5EULV 5C71A 3V4PH 1MFBH 1MY7A 3C08H 1FE8H 3TJEL 4Y8AA 3MNZB 5ITBH 1CFQA 3DX9A 1MQ8A 4X7DC 4EIZC 3NZ8B 1F5WA 2CGRH 3DYMA 3VXQA 4Y7MA 4PJ8C 2FO1A 1F4YL 3UTPE 2FB4L 4U4BA 4PJCB 2CLVB 1XR9B 5IMLB 1YNTA 3LEXA 5DTFA 1BQLH 3FRPA 4JANA 4FXGA 4E0RA 1INDH 1KYOK 2HRPL 1Q38A 3AREB 4ZTOL 1TTFA 3LKQB 1NGWA 2BDNH 1LO3H 4XZUA 1LP9B 4OD1L 2YXMA 2ADGA 5J1AA 2NMSA 4GS7B 2GSGB 4X0KB 5F9DC 3OKOB 1LEGB 3TBWB 4IJ3B 5CSZA 3NA4A 3OBAA 3HLAB 15C8L 3DWTA 1Z6JT 1UWGL 2YN5A 1N7MH 5CKGA 1CG9B 1L9MA 3B2UC 4H5SB 4NFDA 3W2DH 2FJHA 2BCKA 3SE8L 1JMZA 1VFMA 4ONFL 4HGWB 4HIIB 3LQZB 4R97C 2EDYA 1T89A 3F7VB 4G3YH 4BFBD 1A21A 1N3NB 3REWB 4YHLH 1IAKA 4XX1G 4MZ2A 4HXBL 3VDBA 2HLAA 3DVGB 2ATKB 1MCHA 3CFBA 1T5WB 1T2QL 2OXHA 5TF1H 3WKML 1CF8H 2F54E 4ZUUA 4I0KA 2DI7A 1G6RL 5I1CH 3QRGL 2W9DH 3UP1A 3O8XB 3V4UL 4YWGL 1OAKL 1QSFA 4WI7A 5L6YL 2WIIB 3E1F1 3RWGB 3P40A 4O2EA 4ZUSA 4JO2L 1RK1B 4U6YB 1FNGB 3MBXL 1QKZL 1PX4A 4DCQB 2UUDK 2NY4D 4K7FA 5CJQL 1IKNA 4AENB 2H32A 1IAIH 4HS6A 4NN7B 4ZO9A 3QP3A 3S97C 2GTWB 1QR4A 5K59E 4P2CG 4JE4B 3MFFB 1GSMA 1TZGH 5JPMA 1HHGB 3DVFA 1HK6A 4U1GB 2XN9A 2PTTB 2YD2A 43C9A 3VXUA 4P9MH 4EKXA 3CUPA 3LPWA 1FHGA 3KWWB 1NBZB 3UO1H 4MMZC 3WJLA 5MP6H 3V6FB 1Y18A 3O3AA 2YA0A 3GIZL 4X7SH 5C07A 5SX4I 2AV1B 1VFUA 4GAJH 2W1NA 4V1DA 3MXVL 3MUJA 5DJAB 2VZSA 1LEIB 5IR1A 1FNLA 3BKJL 4HV8A 4GQ9L 1DUZB 5D7LE 4WEBH 3JZ7A 4P5KA 4O9HL 1DBJH 2DQFB 4JQVC 1UH2A 4WO4D 5ADPH 3DECA 4HX1B 1EIBA 5CEYA 1M4KA 1ORQB 3ZYZA 2NY4B 1G7MA 8FABB 1KCSL 2XWBA 5D71L 2I9TA 5F8RC 4AJ0A 2NLJB 1VFAA 2BHYA 5TE7H 5MEOB 3UX9B 1TZIB 5BJTA 4LQ1A 3BZ4A 4JKPH 4QGYA 4CMHC 5GPRA 2VXQL 1UM6L 3VU2A 3UZVB 4RDQG 3GSNB 4PD4J 5GGTA 1J1PL 2EYTA 2WUCL 4RMSA 2YMXH 1F8TH 2E3VA 3L3OB 2AJUL 3MRKB 1L0XA 1UC6A 1F2XK 1NLBL 3BO8B 2XRAH 3GSWA 3QCUH 4KQ3L 5EIIB 1QEWA 5E2WL 5DMKB 3DRQB 25C8H 4EN3C 4MX7A 3D2UD 3RNQB 3BT2H 4RX4A 4ZS7L 2NY3D 5A3IC 1J87A 1BIIB 3PWLA 3MLWH 3NFSL 1K2DB 1YN6A 1BFTA 1RV6X 2P4AB 4KUZH 5JORB 3F62A 2AXFA 4WO4B 1QO3B 4OF5A 5DQDH 3L3DB 4K7PX 2VLLA 3GJFA 1E0OB 4PG9A 5IQ7H 1PW3A 1OAQL 4FQXD 4U6XA 5DQ9B 1FNEB 1ZGLA 5CLWA 4OD2A 1MCFA 3MRGB 1SJEA 3B8SA 5BV7H 5FA3B 4Z0XB 4DOHB 3IDIB 2H32H 4K71B 1CFBA 5HI3D 2Q76A 5ENWB 3TO4C 4P2QA 2Z31A 1QSEE 5EU5B 1A3RH 3NCCB 2MKLC 2DQCL 2HH0H 3E3QC 3H0TA 3BDBA 4KROC 3QQ4A 1KFAL 3ME0A 1CFTB 2J8UA 5ISZE 2PW2B 1DEEA 3PIQB 1CE6B 3VFVA 12E8L 5D4QA 5HYIA 1T66D 3D2UB 1DQDH 2FHFA 2E7MA 4GW1A 3U0TA 5F3BA 3NIFF 1H3WM 3ZE0F 2NY3B 1SBSL 1CFNB 2DDQL 3DARA 4PJ5D 4XBPB 2P7TA 4K07A 4JJHA 5KW9H 3S5LA 2NY6C 4FG6D 4YHPA 5C6TH 1LK3H 1SYSB 1AJ7H 1TFHA 2IGFL 5D2NE 5L8LB 3EO9L 5E4EC 3MA9H 4MD4B 4OF8A 4ELME 1A1NB 3GHBL 2DLFL 4OBSA 4FQXB 2B2XH 2VLMD 2EXWD 5IKCA 2VC2L 3DIFA 3GMNB 4PRDA 1I7UB 2W60B 2PO6A 1JN6A 4LAQL 1CXLA 4F2MB 1UM5H 4YHIB 3IVKA 5C0BA 1NBVH 4MJ5B 4M6ML 1N64L 1NKRA 4W70A 1RURH 5HPOA 2IBBA 4FQ1L 2DI8A 2DLHA 1BBJA 1KC5L 3H9HA 2EC9T 4XP9H 3UJTH 5T1LD 4YHMH 4XNMA 3O4OC 4MDJB 5T3XD 3QUXD 4OKVA 3UPCA 4U6HB 1G6RA 2I5YH 2VDKL 1OB1A 4EI6B 4DN3H 1OAZL 2BNRD 1QNZH 4G9FA 1QBAA 4PJ5B 3QWOA 4D9RD 4OIIL 3KNBA 1X5ZA 2ZSVA 5CEZL 1I1AA 3FB7A 4OV5A 3C5JA 2FATL 4WHYH 4IIQC 4F7MB 2EDJA 1FFQA 2W92A 2FCBA 3QIWA 4WCYH 1MHCB 3IETA 4Y5VB 1OQXA 3OKMB 1A6ZA 2BVQB 2H6PA 1S8DA 3HNSH 3GJFH 3LKNB 4GRWE 5F1IB 1YEDB 2OM5A 2PUQT 3LOWA 5GGVL 2CK0H 4X6DB 1H8NA 2APTA 4TTGA 1FO0L 1EA9C 5E4IA 3MV7E 5J6GA 5E5MA 3W82A 3MV8E 4YQXL 5JR1H 4QT5B 5T1LB 3WBDA 4F9LC 5F44A 4S11A 1KT2A 3FQUA 3SGDI 2IH3B 3TO2B 3R1GH 4PFEA 3WNOA 4BM7A 2ICEA 2HFGL 1JGEA 3T77B 3QUXB 4JPIB 3TJEH 1Q72H 5HHNA 4NUJB 5JW5A 3RL1A 1R24A 2EE3A 4N1EA 2BNRB 4KMTL 4JRYD 4ISVA 4Z7UF 4F33A 1PGRB 5CD5D 1U8KB 5FM4A 4YHKL 3ZE1E 4MA1B 3BN9C 3LMJH 4ZO6A 3C6SA 3DV6B 4NFCA 2HRPH 4NQTA 1G7JA 3MUGB 1QSZA 4ZO8A 3CDCA 2FLBT 2D7PA 2IAMC 4OD1H 1N6VA 1E27B 4OZGA 5JMOC 2FR4B 5E8OB 1JHLH 2VDOH 2WBWB 4R6UA 1D6EB 2LVEA 4L9LC 2QSCH 4X9FA 3O2WL 5JTWA