5LXBA

Crystal structure of a mutant binding protein (5htbp-achbp) in complex with palonosetron
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYWERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Palonosetron-5-HT3 Receptor Interactions As Shown by a Binding Protein Cocrystal Structure.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine binding protein
total genus 49
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5lxbA00
3U8LA 5HEUA 4UXUA 3SH1A 4B5DA 2BYSA 3PMZA 3TLWA 4COFA 5LG3A 5KZUA 4ILBA 4X5TA 2XZ5A 3WTIA 2ZJVA 4QACA 3U8JA 4TNVA 3UU6A 3UU3A 4IL9A 2XQ4A 4ZK4A 2WNLA 3SQ6A 5BW2A 1UX2A 5L4EA 5LXBA 3WTHA 2W8GA 2BG9C 2PH9A 4D01A 2X00D 3UQ4A 3RQWA 5J0ZA 3ZKRA 4A98A 2XNVA 4QH5A 3UU4A 4EZ1A 2YMDA 2XYTA 1I9BA 2UZ6A 4BQTA 2Y57A 4TWDA 2BJ0A 5JMEA 3RI5A 2BG9B 3TLSA 4IL4A 2YMEA 4ZJSA 5CO5A 2XQAA 5IUXA 3UU5A 2XQ7A 4ALXA 3WTMA 5HEJA 2ZJUA 2Y54A 3RIAA 3RIFA 2WZYA 5HCJA 5BRXA 5L47A 5HCMA 4PIRA 4A97A 5AFLA 2WNCA 5J5IA 2QC1B 5FJVA 3EHZA 2WNJA 4AFGA 4ZJTA 2WN9A 3P4WA 3U8KA 4ZK1A 4HFCA 4ZRUA 5J5GA 4LMJA 3WTKA 4HFHA 3TLTA 3GUAA 2XNTA 4QABA 3RQUA 3JAFA 2W8FA 5HEGA 5SYOA 4UM1A 2BYNA 4LMLA 3EAMA 3TLVA 3T4MA 3TLUA 3WTJA 4XK9A 5HEHA 3C84A 3WIPA 5AFMB 2XQ9A 2XZ6A 4XHEA 3EI0A 4HQPA 5J5HA 3UUBA 2BG9E 3WTNA 3UU8A 3IGQA 4NPPA 3WTLA 3LSVA 4AFTA 5TVCA 4UM3P 4BFQA 3PEOA 4TNWA 3P50A 4DBMA 4ZZCA 4ILAA 4LMKA 5KE4A 5L4HA 2XQ5A 5BP0A 3C79A 4HFBA 5HEOA 4Z91A 5AFJA 2BR8A 4NZBA 4HFEA 2XYSA 4QH4A 4AFHA 2C9TA 4ZZBA 5AINA 3UQ7A 4QH1A 2BG9A 4F8HA 2YN6A 3SIOA 4HFDA 2XQ8A 4QAAA 3JADA 3SQ9A 2BYRA 4TWHA 4UY2A 2YOEA 2X00A 5AFHA 5J5FA 2Y58A 2YKSA 1UW6A 4UM3S 2BR7A 4ILCA 2Y7YA 4UM3A 2VL0A 2XNUA 4TWFA 2BYQA 2XQ3A 4IREA 3WTOA 4Z90A 4HFIA 2XQ6A 3U8MA 2PGZA 1UV6A 2Y56A 5AFKA 3JAEA 2BYPA 5CFBA 3ZDGA 4FRRA 3RHWA 5AFNA 4ZR6A 5AFMA 3ZDHA 4WV9A 3U8NA
chains in the Genus database with same CATH superfamily
3U8LA 5HEUA 4UXUA 3SH1A 4B5DA 2BYSA 3PMZA 3TLWA 4COFA 5LG3A 5KZUA 4ILBA 4X5TA 2XZ5A 3WTIA 2ZJVA 4QACA 3U8JA 4TNVA 3UU6A 3UU3A 4IL9A 2XQ4A 4ZK4A 2WNLA 3SQ6A 5BW2A 1UX2A 5L4EA 5LXBA 3WTHA 2W8GA 2BG9C 2PH9A 4D01A 2X00D 3UQ4A 3RQWA 5J0ZA 3ZKRA 4A98A 2XNVA 4QH5A 3UU4A 4EZ1A 2YMDA 2XYTA 1I9BA 2UZ6A 4BQTA 2Y57A 4TWDA 2BJ0A 5JMEA 3RI5A 2BG9B 3TLSA 4IL4A 2YMEA 4ZJSA 5CO5A 2XQAA 5IUXA 3UU5A 2XQ7A 4ALXA 3WTMA 5HEJA 2ZJUA 2Y54A 3RIAA 3RIFA 2WZYA 5HCJA 5BRXA 5L47A 5HCMA 4PIRA 4A97A 5AFLA 2WNCA 5J5IA 2QC1B 5FJVA 3EHZA 2WNJA 4AFGA 4ZJTA 2WN9A 3P4WA 3U8KA 4ZK1A 4HFCA 4ZRUA 5J5GA 4LMJA 3WTKA 4HFHA 3TLTA 3GUAA 2XNTA 4QABA 3RQUA 3JAFA 2W8FA 5HEGA 5SYOA 4UM1A 2BYNA 4LMLA 3EAMA 3TLVA 3T4MA 3TLUA 3WTJA 4XK9A 5HEHA 3C84A 3WIPA 5AFMB 2XQ9A 2XZ6A 4XHEA 3EI0A 4HQPA 5J5HA 3UUBA 2BG9E 3WTNA 3UU8A 3IGQA 4NPPA 3WTLA 3LSVA 4AFTA 5TVCA 4UM3P 4BFQA 3PEOA 4TNWA 3P50A 4DBMA 4ZZCA 4ILAA 4LMKA 5KE4A 5L4HA 2XQ5A 5BP0A 3C79A 4HFBA 5HEOA 4Z91A 5AFJA 2BR8A 4NZBA 4HFEA 2XYSA 4QH4A 4AFHA 2C9TA 4ZZBA 5AINA 3UQ7A 4QH1A 2BG9A 4F8HA 2YN6A 3SIOA 4HFDA 2XQ8A 4QAAA 3JADA 3SQ9A 2BYRA 4TWHA 4UY2A 2YOEA 2X00A 5AFHA 5J5FA 2Y58A 2YKSA 1UW6A 4UM3S 2BR7A 4ILCA 2Y7YA 4UM3A 2VL0A 2XNUA 4TWFA 2BYQA 2XQ3A 4IREA 3WTOA 4Z90A 4HFIA 2XQ6A 3U8MA 2PGZA 1UV6A 2Y56A 5AFKA 3JAEA 2BYPA 5CFBA 3ZDGA 4FRRA 3RHWA 5AFNA 4ZR6A 5AFMA 3ZDHA 4WV9A 3U8NA
chains in the Genus database with same CATH topology
3U8LA 5HEUA 4UXUA 3SH1A 4B5DA 2BYSA 3PMZA 3TLWA 4COFA 5LG3A 5KZUA 4ILBA 4X5TA 2XZ5A 3WTIA 2ZJVA 4QACA 3U8JA 4TNVA 3UU6A 3UU3A 4IL9A 2XQ4A 4ZK4A 2WNLA 3SQ6A 5BW2A 1UX2A 5L4EA 5LXBA 3WTHA 2W8GA 2BG9C 2PH9A 4D01A 2X00D 3UQ4A 3RQWA 5J0ZA 3ZKRA 4A98A 2XNVA 4QH5A 3UU4A 4EZ1A 2YMDA 2XYTA 1I9BA 2UZ6A 4BQTA 2Y57A 4TWDA 2BJ0A 5JMEA 3RI5A 2BG9B 3TLSA 4IL4A 2YMEA 4ZJSA 5CO5A 2XQAA 5IUXA 3UU5A 2XQ7A 4ALXA 3WTMA 5HEJA 2ZJUA 2Y54A 3RIAA 3RIFA 2WZYA 5HCJA 5BRXA 5L47A 5HCMA 4PIRA 4A97A 5AFLA 2WNCA 5J5IA 2QC1B 5FJVA 3EHZA 2WNJA 4AFGA 4ZJTA 2WN9A 3P4WA 3U8KA 4ZK1A 4HFCA 4ZRUA 5J5GA 4LMJA 3WTKA 4HFHA 3TLTA 3GUAA 2XNTA 4QABA 3RQUA 3JAFA 2W8FA 5HEGA 5SYOA 4UM1A 2BYNA 4LMLA 3EAMA 3TLVA 3T4MA 3TLUA 3WTJA 4XK9A 5HEHA 3C84A 3WIPA 5AFMB 2XQ9A 2XZ6A 4XHEA 3EI0A 4HQPA 5J5HA 3UUBA 2BG9E 3WTNA 3UU8A 3IGQA 4NPPA 3WTLA 3LSVA 4AFTA 5TVCA 4UM3P 4BFQA 3PEOA 4TNWA 3P50A 4DBMA 4ZZCA 4ILAA 4LMKA 5KE4A 5L4HA 2XQ5A 5BP0A 3C79A 4HFBA 5HEOA 4Z91A 5AFJA 2BR8A 4NZBA 4HFEA 2XYSA 4QH4A 4AFHA 2C9TA 4ZZBA 5AINA 3UQ7A 4QH1A 2BG9A 4F8HA 2YN6A 3SIOA 4HFDA 2XQ8A 4QAAA 3JADA 3SQ9A 2BYRA 4TWHA 4UY2A 2YOEA 2X00A 5AFHA 5J5FA 2Y58A 2YKSA 1UW6A 4UM3S 2BR7A 4ILCA 2Y7YA 4UM3A 2VL0A 2XNUA 4TWFA 2BYQA 2XQ3A 4IREA 3WTOA 4Z90A 4HFIA 2XQ6A 3U8MA 2PGZA 1UV6A 2Y56A 5AFKA 3JAEA 2BYPA 5CFBA 3ZDGA 4FRRA 3RHWA 5AFNA 4ZR6A 5AFMA 3ZDHA 4WV9A 3U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8L A;  5HEU A;  4UXU A;  3SH1 A;  4B5D A;  2BYS A;  3PMZ A;  3TLW A;  4COF A;  5LG3 A;  5KZU A;  4ILB A;  4X5T A;  2XZ5 A;  3WTI A;  2ZJV A;  4QAC A;  3U8J A;  4TNV A;  3UU6 A;  3UU3 A;  4IL9 A;  2XQ4 A;  4ZK4 A;  2WNL A;  3SQ6 A;  5BW2 A;  1UX2 A;  5L4E A;  5LXB A;  3WTH A;  2W8G A;  2BG9 C;  2PH9 A;  4D01 A;  2X00 D;  3UQ4 A;  3RQW A;  5J0Z A;  3ZKR A;  4A98 A;  2XNV A;  4QH5 A;  3UU4 A;  4EZ1 A;  2YMD A;  2XYT A;  1I9B A;  2UZ6 A;  4BQT A;  2Y57 A;  4TWD A;  2BJ0 A;  5JME A;  3RI5 A;  2BG9 B;  3TLS A;  4IL4 A;  2YME A;  4ZJS A;  5CO5 A;  2XQA A;  5IUX A;  3UU5 A;  2XQ7 A;  4ALX A;  3WTM A;  5HEJ A;  2ZJU A;  2Y54 A;  3RIA A;  3RIF A;  2WZY A;  5HCJ A;  5BRX A;  5L47 A;  5HCM A;  4PIR A;  4A97 A;  5AFL A;  2WNC A;  5J5I A;  2QC1 B;  5FJV A;  3EHZ A;  2WNJ A;  4AFG A;  4ZJT A;  2WN9 A;  3P4W A;  3U8K A;  4ZK1 A;  4HFC A;  4ZRU A;  5J5G A;  4LMJ A;  3WTK A;  4HFH A;  3TLT A;  3GUA A;  2XNT A;  4QAB A;  3RQU A;  3JAF A;  2W8F A;  5HEG A;  5SYO A;  4UM1 A;  2BYN A;  4LML A;  3EAM A;  3TLV A;  3T4M A;  3TLU A;  3WTJ A;  4XK9 A;  5HEH A;  3C84 A;  3WIP A;  5AFM B;  2XQ9 A;  2XZ6 A;  4XHE A;  3EI0 A;  4HQP A;  5J5H A;  3UUB A;  2BG9 E;  3WTN A;  3UU8 A;  3IGQ A;  4NPP A;  3WTL A;  3LSV A;  4AFT A;  5TVC A;  4UM3 P;  4BFQ A;  3PEO A;  4TNW A;  3P50 A;  4DBM A;  4ZZC A;  4ILA A;  4LMK A;  5KE4 A;  5L4H A;  2XQ5 A;  5BP0 A;  3C79 A;  4HFB A;  5HEO A;  4Z91 A;  5AFJ A;  2BR8 A;  4NZB A;  4HFE A;  2XYS A;  4QH4 A;  4AFH A;  2C9T A;  4ZZB A;  5AIN A;  3UQ7 A;  4QH1 A;  2BG9 A;  4F8H A;  2YN6 A;  3SIO A;  4HFD A;  2XQ8 A;  4QAA A;  3JAD A;  3SQ9 A;  2BYR A;  4TWH A;  4UY2 A;  2YOE A;  2X00 A;  5AFH A;  5J5F A;  2Y58 A;  2YKS A;  1UW6 A;  4UM3 S;  2BR7 A;  4ILC A;  2Y7Y A;  4UM3 A;  2VL0 A;  2XNU A;  4TWF A;  2BYQ A;  2XQ3 A;  4IRE A;  3WTO A;  4Z90 A;  4HFI A;  2XQ6 A;  3U8M A;  2PGZ A;  1UV6 A;  2Y56 A;  5AFK A;  3JAE A;  2BYP A;  5CFB A;  3ZDG A;  4FRR A;  3RHW A;  5AFN A;  4ZR6 A;  5AFM A;  3ZDH A;  4WV9 A;  3U8N A; 
#chains in the Genus database with same CATH topology
 3U8L A;  5HEU A;  4UXU A;  3SH1 A;  4B5D A;  2BYS A;  3PMZ A;  3TLW A;  4COF A;  5LG3 A;  5KZU A;  4ILB A;  4X5T A;  2XZ5 A;  3WTI A;  2ZJV A;  4QAC A;  3U8J A;  4TNV A;  3UU6 A;  3UU3 A;  4IL9 A;  2XQ4 A;  4ZK4 A;  2WNL A;  3SQ6 A;  5BW2 A;  1UX2 A;  5L4E A;  5LXB A;  3WTH A;  2W8G A;  2BG9 C;  2PH9 A;  4D01 A;  2X00 D;  3UQ4 A;  3RQW A;  5J0Z A;  3ZKR A;  4A98 A;  2XNV A;  4QH5 A;  3UU4 A;  4EZ1 A;  2YMD A;  2XYT A;  1I9B A;  2UZ6 A;  4BQT A;  2Y57 A;  4TWD A;  2BJ0 A;  5JME A;  3RI5 A;  2BG9 B;  3TLS A;  4IL4 A;  2YME A;  4ZJS A;  5CO5 A;  2XQA A;  5IUX A;  3UU5 A;  2XQ7 A;  4ALX A;  3WTM A;  5HEJ A;  2ZJU A;  2Y54 A;  3RIA A;  3RIF A;  2WZY A;  5HCJ A;  5BRX A;  5L47 A;  5HCM A;  4PIR A;  4A97 A;  5AFL A;  2WNC A;  5J5I A;  2QC1 B;  5FJV A;  3EHZ A;  2WNJ A;  4AFG A;  4ZJT A;  2WN9 A;  3P4W A;  3U8K A;  4ZK1 A;  4HFC A;  4ZRU A;  5J5G A;  4LMJ A;  3WTK A;  4HFH A;  3TLT A;  3GUA A;  2XNT A;  4QAB A;  3RQU A;  3JAF A;  2W8F A;  5HEG A;  5SYO A;  4UM1 A;  2BYN A;  4LML A;  3EAM A;  3TLV A;  3T4M A;  3TLU A;  3WTJ A;  4XK9 A;  5HEH A;  3C84 A;  3WIP A;  5AFM B;  2XQ9 A;  2XZ6 A;  4XHE A;  3EI0 A;  4HQP A;  5J5H A;  3UUB A;  2BG9 E;  3WTN A;  3UU8 A;  3IGQ A;  4NPP A;  3WTL A;  3LSV A;  4AFT A;  5TVC A;  4UM3 P;  4BFQ A;  3PEO A;  4TNW A;  3P50 A;  4DBM A;  4ZZC A;  4ILA A;  4LMK A;  5KE4 A;  5L4H A;  2XQ5 A;  5BP0 A;  3C79 A;  4HFB A;  5HEO A;  4Z91 A;  5AFJ A;  2BR8 A;  4NZB A;  4HFE A;  2XYS A;  4QH4 A;  4AFH A;  2C9T A;  4ZZB A;  5AIN A;  3UQ7 A;  4QH1 A;  2BG9 A;  4F8H A;  2YN6 A;  3SIO A;  4HFD A;  2XQ8 A;  4QAA A;  3JAD A;  3SQ9 A;  2BYR A;  4TWH A;  4UY2 A;  2YOE A;  2X00 A;  5AFH A;  5J5F A;  2Y58 A;  2YKS A;  1UW6 A;  4UM3 S;  2BR7 A;  4ILC A;  2Y7Y A;  4UM3 A;  2VL0 A;  2XNU A;  4TWF A;  2BYQ A;  2XQ3 A;  4IRE A;  3WTO A;  4Z90 A;  4HFI A;  2XQ6 A;  3U8M A;  2PGZ A;  1UV6 A;  2Y56 A;  5AFK A;  3JAE A;  2BYP A;  5CFB A;  3ZDG A;  4FRR A;  3RHW A;  5AFN A;  4ZR6 A;  5AFM A;  3ZDH A;  4WV9 A;  3U8N A; 
#chains in the Genus database with same CATH homology
 3U8L A;  5HEU A;  4UXU A;  3SH1 A;  4B5D A;  2BYS A;  3PMZ A;  3TLW A;  4COF A;  5LG3 A;  5KZU A;  4ILB A;  4X5T A;  2XZ5 A;  3WTI A;  2ZJV A;  4QAC A;  3U8J A;  4TNV A;  3UU6 A;  3UU3 A;  4IL9 A;  2XQ4 A;  4ZK4 A;  2WNL A;  3SQ6 A;  5BW2 A;  1UX2 A;  5L4E A;  5LXB A;  3WTH A;  2W8G A;  2BG9 C;  2PH9 A;  4D01 A;  2X00 D;  3UQ4 A;  3RQW A;  5J0Z A;  3ZKR A;  4A98 A;  2XNV A;  4QH5 A;  3UU4 A;  4EZ1 A;  2YMD A;  2XYT A;  1I9B A;  2UZ6 A;  4BQT A;  2Y57 A;  4TWD A;  2BJ0 A;  5JME A;  3RI5 A;  2BG9 B;  3TLS A;  4IL4 A;  2YME A;  4ZJS A;  5CO5 A;  2XQA A;  5IUX A;  3UU5 A;  2XQ7 A;  4ALX A;  3WTM A;  5HEJ A;  2ZJU A;  2Y54 A;  3RIA A;  3RIF A;  2WZY A;  5HCJ A;  5BRX A;  5L47 A;  5HCM A;  4PIR A;  4A97 A;  5AFL A;  2WNC A;  5J5I A;  2QC1 B;  5FJV A;  3EHZ A;  2WNJ A;  4AFG A;  4ZJT A;  2WN9 A;  3P4W A;  3U8K A;  4ZK1 A;  4HFC A;  4ZRU A;  5J5G A;  4LMJ A;  3WTK A;  4HFH A;  3TLT A;  3GUA A;  2XNT A;  4QAB A;  3RQU A;  3JAF A;  2W8F A;  5HEG A;  5SYO A;  4UM1 A;  2BYN A;  4LML A;  3EAM A;  3TLV A;  3T4M A;  3TLU A;  3WTJ A;  4XK9 A;  5HEH A;  3C84 A;  3WIP A;  5AFM B;  2XQ9 A;  2XZ6 A;  4XHE A;  3EI0 A;  4HQP A;  5J5H A;  3UUB A;  2BG9 E;  3WTN A;  3UU8 A;  3IGQ A;  4NPP A;  3WTL A;  3LSV A;  4AFT A;  5TVC A;  4UM3 P;  4BFQ A;  3PEO A;  4TNW A;  3P50 A;  4DBM A;  4ZZC A;  4ILA A;  4LMK A;  5KE4 A;  5L4H A;  2XQ5 A;  5BP0 A;  3C79 A;  4HFB A;  5HEO A;  4Z91 A;  5AFJ A;  2BR8 A;  4NZB A;  4HFE A;  2XYS A;  4QH4 A;  4AFH A;  2C9T A;  4ZZB A;  5AIN A;  3UQ7 A;  4QH1 A;  2BG9 A;  4F8H A;  2YN6 A;  3SIO A;  4HFD A;  2XQ8 A;  4QAA A;  3JAD A;  3SQ9 A;  2BYR A;  4TWH A;  4UY2 A;  2YOE A;  2X00 A;  5AFH A;  5J5F A;  2Y58 A;  2YKS A;  1UW6 A;  4UM3 S;  2BR7 A;  4ILC A;  2Y7Y A;  4UM3 A;  2VL0 A;  2XNU A;  4TWF A;  2BYQ A;  2XQ3 A;  4IRE A;  3WTO A;  4Z90 A;  4HFI A;  2XQ6 A;  3U8M A;  2PGZ A;  1UV6 A;  2Y56 A;  5AFK A;  3JAE A;  2BYP A;  5CFB A;  3ZDG A;  4FRR A;  3RHW A;  5AFN A;  4ZR6 A;  5AFM A;  3ZDH A;  4WV9 A;  3U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...