5LXBA

Crystal structure of a mutant binding protein (5htbp-achbp) in complex with palonosetron
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
205
structure length
205
Chain Sequence
QANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYWERQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGVTCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Palonosetron-5-HT3 Receptor Interactions As Shown by a Binding Protein Cocrystal Structure.
pubmed doi rcsb
source organism Aplysia californica
molecule tags Acetylcholine binding protein
total genus 49
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2016-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5lxbA00
4NPPA 3PEOA 2W8GA 4TNVA 3JAEA 3EAMA 4XK9A 4A98A 2XQ7A 3UU5A 5HEUA 5KZUA 2BG9E 5J0ZA 1I9BA 3WTHA 5AFJA 4AFHA 3WTOA 2Y57A 2XNTA 5AINA 4LMKA 4UM3S 4DBMA 3U8KA 4BQTA 5J5IA 5J5GA 5BP0A 4Z91A 3RHWA 5BRXA 2XQ8A 5IUXA 3WTJA 1UX2A 3RIAA 2YMDA 3ZKRA 2XQ3A 5LG3A 5BW2A 2XQAA 4ZZBA 4IL4A 5HCJA 3T4MA 2X00D 4TWDA 3U8LA 4HFHA 3P4WA 5HCMA 3UU6A 5AFMA 5L47A 5HEJA 5JMEA 3TLSA 3WTIA 4AFTA 4QH4A 2XQ6A 2WN9A 4IREA 4ILCA 4QH5A 2BR8A 3JAFA 5KE4A 3WIPA 1UV6A 4NZBA 2Y54A 4UXUA 3U8NA 2XYSA 3RQUA 2BG9B 3P50A 4TNWA 4ZK1A 3SIOA 2WNLA 3U8JA 2C9TA 3WTKA 5L4HA 4ALXA 4UM3P 3TLWA 2UZ6A 2XQ5A 3C84A 3WTMA 4ILAA 3UQ4A 4ZR6A 2YKSA 3IGQA 3WTLA 3RIFA 4XHEA 4LMJA 3EHZA 3GUAA 4COFA 2BG9C 4B5DA 4IL9A 5AFNA 5J5HA 3UU4A 5TVCA 4HFCA 4PIRA 4QAAA 2BYNA 2YOEA 4HFEA 3TLUA 3RI5A 2WNJA 2W8FA 3U8MA 5L4EA 3UU3A 4FRRA 4BFQA 4EZ1A 2WNCA 5AFKA 3RQWA 5LXBA 4F8HA 3C79A 2Y58A 4UM3A 2XYTA 5CO5A 2Y7YA 2ZJUA 3UU8A 2YMEA 5AFMB 2VL0A 4HQPA 5CFBA 2XNVA 5FJVA 2BJ0A 5AFHA 5J5FA 2Y56A 5HEHA 2YN6A 4TWHA 3WTNA 3SQ6A 4A97A 2XZ6A 4X5TA 5HEOA 4D01A 2XQ9A 4Z90A 5HEGA 2BYRA 3ZDHA 2ZJVA 4TWFA 2BYPA 3TLTA 5AFLA 4ILBA 3LSVA 3JADA 3ZDGA 2XZ5A 4ZJTA 4WV9A 3SQ9A 3TLVA 2PGZA 4HFIA 4QH1A 2QC1B 3UQ7A 4QACA 4UM1A 3UUBA 2BR7A 2PH9A 2XQ4A 4ZK4A 2X00A 3PMZA 4QABA 4UY2A 2XNUA 4HFDA 4LMLA 2WZYA 3SH1A 4AFGA 4ZZCA 2BG9A 1UW6A 3EI0A 4ZRUA 5SYOA 2BYSA 4HFBA 2BYQA 4ZJSA
chains in the Genus database with same CATH superfamily
4NPPA 3PEOA 2W8GA 4TNVA 3JAEA 3EAMA 4XK9A 4A98A 2XQ7A 3UU5A 5HEUA 5KZUA 2BG9E 5J0ZA 1I9BA 3WTHA 5AFJA 4AFHA 3WTOA 2Y57A 2XNTA 5AINA 4LMKA 4UM3S 4DBMA 3U8KA 4BQTA 5J5IA 5J5GA 5BP0A 4Z91A 3RHWA 5BRXA 2XQ8A 5IUXA 3WTJA 1UX2A 3RIAA 2YMDA 3ZKRA 2XQ3A 5LG3A 5BW2A 2XQAA 4ZZBA 4IL4A 5HCJA 3T4MA 2X00D 4TWDA 3U8LA 4HFHA 3P4WA 5HCMA 3UU6A 5AFMA 5L47A 5HEJA 5JMEA 3TLSA 3WTIA 4AFTA 4QH4A 2XQ6A 2WN9A 4IREA 4ILCA 4QH5A 2BR8A 3JAFA 5KE4A 3WIPA 1UV6A 4NZBA 2Y54A 4UXUA 3U8NA 2XYSA 3RQUA 2BG9B 3P50A 4TNWA 4ZK1A 3SIOA 2WNLA 3U8JA 2C9TA 3WTKA 5L4HA 4ALXA 4UM3P 3TLWA 2UZ6A 2XQ5A 3C84A 3WTMA 4ILAA 3UQ4A 4ZR6A 2YKSA 3IGQA 3WTLA 3RIFA 4XHEA 4LMJA 3EHZA 3GUAA 4COFA 2BG9C 4B5DA 4IL9A 5AFNA 5J5HA 3UU4A 5TVCA 4HFCA 4PIRA 4QAAA 2BYNA 2YOEA 4HFEA 3TLUA 3RI5A 2WNJA 2W8FA 3U8MA 5L4EA 3UU3A 4FRRA 4BFQA 4EZ1A 2WNCA 5AFKA 3RQWA 5LXBA 4F8HA 3C79A 2Y58A 4UM3A 2XYTA 5CO5A 2Y7YA 2ZJUA 3UU8A 2YMEA 5AFMB 2VL0A 4HQPA 5CFBA 2XNVA 5FJVA 2BJ0A 5AFHA 5J5FA 2Y56A 5HEHA 2YN6A 4TWHA 3WTNA 3SQ6A 4A97A 2XZ6A 4X5TA 5HEOA 4D01A 2XQ9A 4Z90A 5HEGA 2BYRA 3ZDHA 2ZJVA 4TWFA 2BYPA 3TLTA 5AFLA 4ILBA 3LSVA 3JADA 3ZDGA 2XZ5A 4ZJTA 4WV9A 3SQ9A 3TLVA 2PGZA 4HFIA 4QH1A 2QC1B 3UQ7A 4QACA 4UM1A 3UUBA 2BR7A 2PH9A 2XQ4A 4ZK4A 2X00A 3PMZA 4QABA 4UY2A 2XNUA 4HFDA 4LMLA 2WZYA 3SH1A 4AFGA 4ZZCA 2BG9A 1UW6A 3EI0A 4ZRUA 5SYOA 2BYSA 4HFBA 2BYQA 4ZJSA
chains in the Genus database with same CATH topology
4NPPA 3PEOA 2W8GA 4TNVA 3JAEA 3EAMA 4XK9A 4A98A 2XQ7A 3UU5A 5HEUA 5KZUA 2BG9E 5J0ZA 1I9BA 3WTHA 5AFJA 4AFHA 3WTOA 2Y57A 2XNTA 5AINA 4LMKA 4UM3S 4DBMA 3U8KA 4BQTA 5J5IA 5J5GA 5BP0A 4Z91A 3RHWA 5BRXA 2XQ8A 5IUXA 3WTJA 1UX2A 3RIAA 2YMDA 3ZKRA 2XQ3A 5LG3A 5BW2A 2XQAA 4ZZBA 4IL4A 5HCJA 3T4MA 2X00D 4TWDA 3U8LA 4HFHA 3P4WA 5HCMA 3UU6A 5AFMA 5L47A 5HEJA 5JMEA 3TLSA 3WTIA 4AFTA 4QH4A 2XQ6A 2WN9A 4IREA 4ILCA 4QH5A 2BR8A 3JAFA 5KE4A 3WIPA 1UV6A 4NZBA 2Y54A 4UXUA 3U8NA 2XYSA 3RQUA 2BG9B 3P50A 4TNWA 4ZK1A 3SIOA 2WNLA 3U8JA 2C9TA 3WTKA 5L4HA 4ALXA 4UM3P 3TLWA 2UZ6A 2XQ5A 3C84A 3WTMA 4ILAA 3UQ4A 4ZR6A 2YKSA 3IGQA 3WTLA 3RIFA 4XHEA 4LMJA 3EHZA 3GUAA 4COFA 2BG9C 4B5DA 4IL9A 5AFNA 5J5HA 3UU4A 5TVCA 4HFCA 4PIRA 4QAAA 2BYNA 2YOEA 4HFEA 3TLUA 3RI5A 2WNJA 2W8FA 3U8MA 5L4EA 3UU3A 4FRRA 4BFQA 4EZ1A 2WNCA 5AFKA 3RQWA 5LXBA 4F8HA 3C79A 2Y58A 4UM3A 2XYTA 5CO5A 2Y7YA 2ZJUA 3UU8A 2YMEA 5AFMB 2VL0A 4HQPA 5CFBA 2XNVA 5FJVA 2BJ0A 5AFHA 5J5FA 2Y56A 5HEHA 2YN6A 4TWHA 3WTNA 3SQ6A 4A97A 2XZ6A 4X5TA 5HEOA 4D01A 2XQ9A 4Z90A 5HEGA 2BYRA 3ZDHA 2ZJVA 4TWFA 2BYPA 3TLTA 5AFLA 4ILBA 3LSVA 3JADA 3ZDGA 2XZ5A 4ZJTA 4WV9A 3SQ9A 3TLVA 2PGZA 4HFIA 4QH1A 2QC1B 3UQ7A 4QACA 4UM1A 3UUBA 2BR7A 2PH9A 2XQ4A 4ZK4A 2X00A 3PMZA 4QABA 4UY2A 2XNUA 4HFDA 4LMLA 2WZYA 3SH1A 4AFGA 4ZZCA 2BG9A 1UW6A 3EI0A 4ZRUA 5SYOA 2BYSA 4HFBA 2BYQA 4ZJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPP A;  3PEO A;  2W8G A;  4TNV A;  3JAE A;  3EAM A;  4XK9 A;  4A98 A;  2XQ7 A;  3UU5 A;  5HEU A;  5KZU A;  2BG9 E;  5J0Z A;  1I9B A;  3WTH A;  5AFJ A;  4AFH A;  3WTO A;  2Y57 A;  2XNT A;  5AIN A;  4LMK A;  4UM3 S;  4DBM A;  3U8K A;  4BQT A;  5J5I A;  5J5G A;  5BP0 A;  4Z91 A;  3RHW A;  5BRX A;  2XQ8 A;  5IUX A;  3WTJ A;  1UX2 A;  3RIA A;  2YMD A;  3ZKR A;  2XQ3 A;  5LG3 A;  5BW2 A;  2XQA A;  4ZZB A;  4IL4 A;  5HCJ A;  3T4M A;  2X00 D;  4TWD A;  3U8L A;  4HFH A;  3P4W A;  5HCM A;  3UU6 A;  5AFM A;  5L47 A;  5HEJ A;  5JME A;  3TLS A;  3WTI A;  4AFT A;  4QH4 A;  2XQ6 A;  2WN9 A;  4IRE A;  4ILC A;  4QH5 A;  2BR8 A;  3JAF A;  5KE4 A;  3WIP A;  1UV6 A;  4NZB A;  2Y54 A;  4UXU A;  3U8N A;  2XYS A;  3RQU A;  2BG9 B;  3P50 A;  4TNW A;  4ZK1 A;  3SIO A;  2WNL A;  3U8J A;  2C9T A;  3WTK A;  5L4H A;  4ALX A;  4UM3 P;  3TLW A;  2UZ6 A;  2XQ5 A;  3C84 A;  3WTM A;  4ILA A;  3UQ4 A;  4ZR6 A;  2YKS A;  3IGQ A;  3WTL A;  3RIF A;  4XHE A;  4LMJ A;  3EHZ A;  3GUA A;  4COF A;  2BG9 C;  4B5D A;  4IL9 A;  5AFN A;  5J5H A;  3UU4 A;  5TVC A;  4HFC A;  4PIR A;  4QAA A;  2BYN A;  2YOE A;  4HFE A;  3TLU A;  3RI5 A;  2WNJ A;  2W8F A;  3U8M A;  5L4E A;  3UU3 A;  4FRR A;  4BFQ A;  4EZ1 A;  2WNC A;  5AFK A;  3RQW A;  5LXB A;  4F8H A;  3C79 A;  2Y58 A;  4UM3 A;  2XYT A;  5CO5 A;  2Y7Y A;  2ZJU A;  3UU8 A;  2YME A;  5AFM B;  2VL0 A;  4HQP A;  5CFB A;  2XNV A;  5FJV A;  2BJ0 A;  5AFH A;  5J5F A;  2Y56 A;  5HEH A;  2YN6 A;  4TWH A;  3WTN A;  3SQ6 A;  4A97 A;  2XZ6 A;  4X5T A;  5HEO A;  4D01 A;  2XQ9 A;  4Z90 A;  5HEG A;  2BYR A;  3ZDH A;  2ZJV A;  4TWF A;  2BYP A;  3TLT A;  5AFL A;  4ILB A;  3LSV A;  3JAD A;  3ZDG A;  2XZ5 A;  4ZJT A;  4WV9 A;  3SQ9 A;  3TLV A;  2PGZ A;  4HFI A;  4QH1 A;  2QC1 B;  3UQ7 A;  4QAC A;  4UM1 A;  3UUB A;  2BR7 A;  2PH9 A;  2XQ4 A;  4ZK4 A;  2X00 A;  3PMZ A;  4QAB A;  4UY2 A;  2XNU A;  4HFD A;  4LML A;  2WZY A;  3SH1 A;  4AFG A;  4ZZC A;  2BG9 A;  1UW6 A;  3EI0 A;  4ZRU A;  5SYO A;  2BYS A;  4HFB A;  2BYQ A;  4ZJS A; 
#chains in the Genus database with same CATH topology
 4NPP A;  3PEO A;  2W8G A;  4TNV A;  3JAE A;  3EAM A;  4XK9 A;  4A98 A;  2XQ7 A;  3UU5 A;  5HEU A;  5KZU A;  2BG9 E;  5J0Z A;  1I9B A;  3WTH A;  5AFJ A;  4AFH A;  3WTO A;  2Y57 A;  2XNT A;  5AIN A;  4LMK A;  4UM3 S;  4DBM A;  3U8K A;  4BQT A;  5J5I A;  5J5G A;  5BP0 A;  4Z91 A;  3RHW A;  5BRX A;  2XQ8 A;  5IUX A;  3WTJ A;  1UX2 A;  3RIA A;  2YMD A;  3ZKR A;  2XQ3 A;  5LG3 A;  5BW2 A;  2XQA A;  4ZZB A;  4IL4 A;  5HCJ A;  3T4M A;  2X00 D;  4TWD A;  3U8L A;  4HFH A;  3P4W A;  5HCM A;  3UU6 A;  5AFM A;  5L47 A;  5HEJ A;  5JME A;  3TLS A;  3WTI A;  4AFT A;  4QH4 A;  2XQ6 A;  2WN9 A;  4IRE A;  4ILC A;  4QH5 A;  2BR8 A;  3JAF A;  5KE4 A;  3WIP A;  1UV6 A;  4NZB A;  2Y54 A;  4UXU A;  3U8N A;  2XYS A;  3RQU A;  2BG9 B;  3P50 A;  4TNW A;  4ZK1 A;  3SIO A;  2WNL A;  3U8J A;  2C9T A;  3WTK A;  5L4H A;  4ALX A;  4UM3 P;  3TLW A;  2UZ6 A;  2XQ5 A;  3C84 A;  3WTM A;  4ILA A;  3UQ4 A;  4ZR6 A;  2YKS A;  3IGQ A;  3WTL A;  3RIF A;  4XHE A;  4LMJ A;  3EHZ A;  3GUA A;  4COF A;  2BG9 C;  4B5D A;  4IL9 A;  5AFN A;  5J5H A;  3UU4 A;  5TVC A;  4HFC A;  4PIR A;  4QAA A;  2BYN A;  2YOE A;  4HFE A;  3TLU A;  3RI5 A;  2WNJ A;  2W8F A;  3U8M A;  5L4E A;  3UU3 A;  4FRR A;  4BFQ A;  4EZ1 A;  2WNC A;  5AFK A;  3RQW A;  5LXB A;  4F8H A;  3C79 A;  2Y58 A;  4UM3 A;  2XYT A;  5CO5 A;  2Y7Y A;  2ZJU A;  3UU8 A;  2YME A;  5AFM B;  2VL0 A;  4HQP A;  5CFB A;  2XNV A;  5FJV A;  2BJ0 A;  5AFH A;  5J5F A;  2Y56 A;  5HEH A;  2YN6 A;  4TWH A;  3WTN A;  3SQ6 A;  4A97 A;  2XZ6 A;  4X5T A;  5HEO A;  4D01 A;  2XQ9 A;  4Z90 A;  5HEG A;  2BYR A;  3ZDH A;  2ZJV A;  4TWF A;  2BYP A;  3TLT A;  5AFL A;  4ILB A;  3LSV A;  3JAD A;  3ZDG A;  2XZ5 A;  4ZJT A;  4WV9 A;  3SQ9 A;  3TLV A;  2PGZ A;  4HFI A;  4QH1 A;  2QC1 B;  3UQ7 A;  4QAC A;  4UM1 A;  3UUB A;  2BR7 A;  2PH9 A;  2XQ4 A;  4ZK4 A;  2X00 A;  3PMZ A;  4QAB A;  4UY2 A;  2XNU A;  4HFD A;  4LML A;  2WZY A;  3SH1 A;  4AFG A;  4ZZC A;  2BG9 A;  1UW6 A;  3EI0 A;  4ZRU A;  5SYO A;  2BYS A;  4HFB A;  2BYQ A;  4ZJS A; 
#chains in the Genus database with same CATH homology
 4NPP A;  3PEO A;  2W8G A;  4TNV A;  3JAE A;  3EAM A;  4XK9 A;  4A98 A;  2XQ7 A;  3UU5 A;  5HEU A;  5KZU A;  2BG9 E;  5J0Z A;  1I9B A;  3WTH A;  5AFJ A;  4AFH A;  3WTO A;  2Y57 A;  2XNT A;  5AIN A;  4LMK A;  4UM3 S;  4DBM A;  3U8K A;  4BQT A;  5J5I A;  5J5G A;  5BP0 A;  4Z91 A;  3RHW A;  5BRX A;  2XQ8 A;  5IUX A;  3WTJ A;  1UX2 A;  3RIA A;  2YMD A;  3ZKR A;  2XQ3 A;  5LG3 A;  5BW2 A;  2XQA A;  4ZZB A;  4IL4 A;  5HCJ A;  3T4M A;  2X00 D;  4TWD A;  3U8L A;  4HFH A;  3P4W A;  5HCM A;  3UU6 A;  5AFM A;  5L47 A;  5HEJ A;  5JME A;  3TLS A;  3WTI A;  4AFT A;  4QH4 A;  2XQ6 A;  2WN9 A;  4IRE A;  4ILC A;  4QH5 A;  2BR8 A;  3JAF A;  5KE4 A;  3WIP A;  1UV6 A;  4NZB A;  2Y54 A;  4UXU A;  3U8N A;  2XYS A;  3RQU A;  2BG9 B;  3P50 A;  4TNW A;  4ZK1 A;  3SIO A;  2WNL A;  3U8J A;  2C9T A;  3WTK A;  5L4H A;  4ALX A;  4UM3 P;  3TLW A;  2UZ6 A;  2XQ5 A;  3C84 A;  3WTM A;  4ILA A;  3UQ4 A;  4ZR6 A;  2YKS A;  3IGQ A;  3WTL A;  3RIF A;  4XHE A;  4LMJ A;  3EHZ A;  3GUA A;  4COF A;  2BG9 C;  4B5D A;  4IL9 A;  5AFN A;  5J5H A;  3UU4 A;  5TVC A;  4HFC A;  4PIR A;  4QAA A;  2BYN A;  2YOE A;  4HFE A;  3TLU A;  3RI5 A;  2WNJ A;  2W8F A;  3U8M A;  5L4E A;  3UU3 A;  4FRR A;  4BFQ A;  4EZ1 A;  2WNC A;  5AFK A;  3RQW A;  5LXB A;  4F8H A;  3C79 A;  2Y58 A;  4UM3 A;  2XYT A;  5CO5 A;  2Y7Y A;  2ZJU A;  3UU8 A;  2YME A;  5AFM B;  2VL0 A;  4HQP A;  5CFB A;  2XNV A;  5FJV A;  2BJ0 A;  5AFH A;  5J5F A;  2Y56 A;  5HEH A;  2YN6 A;  4TWH A;  3WTN A;  3SQ6 A;  4A97 A;  2XZ6 A;  4X5T A;  5HEO A;  4D01 A;  2XQ9 A;  4Z90 A;  5HEG A;  2BYR A;  3ZDH A;  2ZJV A;  4TWF A;  2BYP A;  3TLT A;  5AFL A;  4ILB A;  3LSV A;  3JAD A;  3ZDG A;  2XZ5 A;  4ZJT A;  4WV9 A;  3SQ9 A;  3TLV A;  2PGZ A;  4HFI A;  4QH1 A;  2QC1 B;  3UQ7 A;  4QAC A;  4UM1 A;  3UUB A;  2BR7 A;  2PH9 A;  2XQ4 A;  4ZK4 A;  2X00 A;  3PMZ A;  4QAB A;  4UY2 A;  2XNU A;  4HFD A;  4LML A;  2WZY A;  3SH1 A;  4AFG A;  4ZZC A;  2BG9 A;  1UW6 A;  3EI0 A;  4ZRU A;  5SYO A;  2BYS A;  4HFB A;  2BYQ A;  4ZJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...