5LXQA

Structure of prl-1 in complex with the bateman domain of cnnm2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
MEELNIIQGALELRTKTVEDVMTPLRDCFMITGEAILDFNTMSEIMESGYTRIPVFEGERSNIVDLLFVKDLAFVDPDDCTPLKTITKFYNHPLHFVFNDTKLDAMLEEFKKGKSHLAIVQRVNNEGEGDPFYEVLGIVTLEDVIEEIIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Oncogenic Interaction of Phosphatase PRL-1 with the Magnesium Transporter CNNM2.
pubmed doi rcsb
molecule keywords Protein tyrosine phosphatase type IVA 1
molecule tags Metal transport
source organism Mus musculus
total genus 37
structure length 150
sequence length 150
chains with identical sequence H
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5lxqA00
3SL7A 5K23C 2QRDE 2D4ZA 2ZY9A 4L3VA 2EMQA 4IY2A 4GQYA 2QRCE 2OUXA 2OOXE 2UV4A 3TDHC 3LFZA 5KS7A 2YVXA 2O16A 3ORGA 4UUUA 3KPDA 3KPCA 4L27A 1PVMA 2UV6A 2YVYA 3KH5A 2QREE 4ESYA 2OOYE 1O50A 3FWSA 3LQNA 1XKFA 3FHMA 4IY0A 2QLVC 4FRYA 3HF7A 3PC4A 1PBJA 4P1GA 3T4NC 3OCOA 2UV5A 3TE5C 4IYSA 2RIHA 2QR1E 4O9KA 3KPBA 4P1OA 3L31A 3PC2A 2UV7A 4GQWA 5K22B 3K6EA 3FNAA 4NOCA 3GBYA 3L2BA 3LV9A 4IY3A 4IY4A 3DDJA 2PFIA 2YZIA 1Y5HA 5MMZA 3LHHA 3K2VA 1YAVA 5K24C 4FXSA 2NYEA 5K25C 5IIPA 4L0DA 5LXQA 2NYCA 2YZQA 3OCMA 3FWRA 4DQWA 2YVZA 3FV6A 4HG0A 4COOA 2QH1A 3PC3A 3OI8A 4L28A 2RC3A 4ESYB 3KXRA 4PCUA 2P9MA 4GQVA 2EF7A 2RIFA 3I8NA
chains in the Genus database with same CATH superfamily
3SL7A 5K23C 2QRDE 2D4ZA 2ZY9A 4L3VA 2EMQA 4IY2A 4GQYA 2QRCE 2OUXA 2OOXE 2UV4A 3TDHC 3LFZA 5KS7A 2YVXA 2O16A 3ORGA 4UUUA 3KPDA 3KPCA 4L27A 1PVMA 2UV6A 2YVYA 3KH5A 2QREE 4ESYA 2OOYE 1O50A 3FWSA 3LQNA 1XKFA 3FHMA 4IY0A 2QLVC 2J9LA 4FRYA 3HF7A 3PC4A 1PBJA 4P1GA 3T4NC 3OCOA 2UV5A 3TE5C 4IYSA 2RIHA 2QR1E 4O9KA 3KPBA 4P1OA 3L31A 3PC2A 2UV7A 4GQWA 5K22B 3K6EA 3FNAA 4NOCA 3GBYA 3L2BA 3LV9A 4IY3A 4IY4A 3DDJA 2PFIA 2YZIA 1Y5HA 5MMZA 3LHHA 3K2VA 1YAVA 5K24C 4FXSA 2NYEA 2JA3A 5K25C 5IIPA 4L0DA 5LXQA 2NYCA 2YZQA 3OCMA 3FWRA 4DQWA 2YVZA 3FV6A 4HG0A 4COOA 2QH1A 3PC3A 3OI8A 4L28A 2RC3A 4ESYB 3KXRA 4PCUA 2P9MA 4GQVA 2EF7A 2RIFA 3I8NA
chains in the Genus database with same CATH topology
3SL7A 5K23C 2QRDE 2D4ZA 2ZY9A 4L3VA 2EMQA 4IY2A 4GQYA 2QRCE 2OUXA 2OOXE 2UV4A 3TDHC 3LFZA 5KS7A 2YVXA 2O16A 3ORGA 4UUUA 3KPDA 3KPCA 4L27A 1PVMA 2UV6A 2YVYA 3KH5A 2QREE 4ESYA 2OOYE 1O50A 3FWSA 3LQNA 1XKFA 3FHMA 4IY0A 2QLVC 2J9LA 4FRYA 3HF7A 3PC4A 1PBJA 4P1GA 3T4NC 3OCOA 2UV5A 3TE5C 4IYSA 2RIHA 2QR1E 4O9KA 3KPBA 4P1OA 3L31A 3PC2A 2UV7A 4GQWA 5K22B 3K6EA 3FNAA 4NOCA 3GBYA 3L2BA 3LV9A 4IY3A 4IY4A 3DDJA 2PFIA 2YZIA 1Y5HA 5MMZA 3LHHA 3K2VA 1YAVA 5K24C 4FXSA 2NYEA 2JA3A 5K25C 5IIPA 4L0DA 5LXQA 2NYCA 2YZQA 3OCMA 3FWRA 4DQWA 2YVZA 3FV6A 4HG0A 4COOA 2QH1A 3PC3A 3OI8A 4L28A 2RC3A 4ESYB 3KXRA 4PCUA 2P9MA 4GQVA 2EF7A 2RIFA 3I8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SL7 A;  5K23 C;  2QRD E;  2D4Z A;  2ZY9 A;  4L3V A;  2EMQ A;  4IY2 A;  4GQY A;  2QRC E;  2OUX A;  2OOX E;  2UV4 A;  3TDH C;  3LFZ A;  5KS7 A;  2YVX A;  2O16 A;  3ORG A;  4UUU A;  3KPD A;  3KPC A;  4L27 A;  1PVM A;  2UV6 A;  2YVY A;  3KH5 A;  2QRE E;  4ESY A;  2OOY E;  1O50 A;  3FWS A;  3LQN A;  1XKF A;  3FHM A;  4IY0 A;  2QLV C;  4FRY A;  3HF7 A;  3PC4 A;  1PBJ A;  4P1G A;  3T4N C;  3OCO A;  2UV5 A;  3TE5 C;  4IYS A;  2RIH A;  2QR1 E;  4O9K A;  3KPB A;  4P1O A;  3L31 A;  3PC2 A;  2UV7 A;  4GQW A;  5K22 B;  3K6E A;  3FNA A;  4NOC A;  3GBY A;  3L2B A;  3LV9 A;  4IY3 A;  4IY4 A;  3DDJ A;  2PFI A;  2YZI A;  1Y5H A;  5MMZ A;  3LHH A;  3K2V A;  1YAV A;  5K24 C;  4FXS A;  2NYE A;  5K25 C;  5IIP A;  4L0D A;  5LXQ A;  2NYC A;  2YZQ A;  3OCM A;  3FWR A;  4DQW A;  2YVZ A;  3FV6 A;  4HG0 A;  4COO A;  2QH1 A;  3PC3 A;  3OI8 A;  4L28 A;  2RC3 A;  4ESY B;  3KXR A;  4PCU A;  2P9M A;  4GQV A;  2EF7 A;  2RIF A;  3I8N A; 
#chains in the Genus database with same CATH topology
 3SL7 A;  5K23 C;  2QRD E;  2D4Z A;  2ZY9 A;  4L3V A;  2EMQ A;  4IY2 A;  4GQY A;  2QRC E;  2OUX A;  2OOX E;  2UV4 A;  3TDH C;  3LFZ A;  5KS7 A;  2YVX A;  2O16 A;  3ORG A;  4UUU A;  3KPD A;  3KPC A;  4L27 A;  1PVM A;  2UV6 A;  2YVY A;  3KH5 A;  2QRE E;  4ESY A;  2OOY E;  1O50 A;  3FWS A;  3LQN A;  1XKF A;  3FHM A;  4IY0 A;  2QLV C;  2J9L A;  4FRY A;  3HF7 A;  3PC4 A;  1PBJ A;  4P1G A;  3T4N C;  3OCO A;  2UV5 A;  3TE5 C;  4IYS A;  2RIH A;  2QR1 E;  4O9K A;  3KPB A;  4P1O A;  3L31 A;  3PC2 A;  2UV7 A;  4GQW A;  5K22 B;  3K6E A;  3FNA A;  4NOC A;  3GBY A;  3L2B A;  3LV9 A;  4IY3 A;  4IY4 A;  3DDJ A;  2PFI A;  2YZI A;  1Y5H A;  5MMZ A;  3LHH A;  3K2V A;  1YAV A;  5K24 C;  4FXS A;  2NYE A;  2JA3 A;  5K25 C;  5IIP A;  4L0D A;  5LXQ A;  2NYC A;  2YZQ A;  3OCM A;  3FWR A;  4DQW A;  2YVZ A;  3FV6 A;  4HG0 A;  4COO A;  2QH1 A;  3PC3 A;  3OI8 A;  4L28 A;  2RC3 A;  4ESY B;  3KXR A;  4PCU A;  2P9M A;  4GQV A;  2EF7 A;  2RIF A;  3I8N A; 
#chains in the Genus database with same CATH homology
 3SL7 A;  5K23 C;  2QRD E;  2D4Z A;  2ZY9 A;  4L3V A;  2EMQ A;  4IY2 A;  4GQY A;  2QRC E;  2OUX A;  2OOX E;  2UV4 A;  3TDH C;  3LFZ A;  5KS7 A;  2YVX A;  2O16 A;  3ORG A;  4UUU A;  3KPD A;  3KPC A;  4L27 A;  1PVM A;  2UV6 A;  2YVY A;  3KH5 A;  2QRE E;  4ESY A;  2OOY E;  1O50 A;  3FWS A;  3LQN A;  1XKF A;  3FHM A;  4IY0 A;  2QLV C;  2J9L A;  4FRY A;  3HF7 A;  3PC4 A;  1PBJ A;  4P1G A;  3T4N C;  3OCO A;  2UV5 A;  3TE5 C;  4IYS A;  2RIH A;  2QR1 E;  4O9K A;  3KPB A;  4P1O A;  3L31 A;  3PC2 A;  2UV7 A;  4GQW A;  5K22 B;  3K6E A;  3FNA A;  4NOC A;  3GBY A;  3L2B A;  3LV9 A;  4IY3 A;  4IY4 A;  3DDJ A;  2PFI A;  2YZI A;  1Y5H A;  5MMZ A;  3LHH A;  3K2V A;  1YAV A;  5K24 C;  4FXS A;  2NYE A;  2JA3 A;  5K25 C;  5IIP A;  4L0D A;  5LXQ A;  2NYC A;  2YZQ A;  3OCM A;  3FWR A;  4DQW A;  2YVZ A;  3FV6 A;  4HG0 A;  4COO A;  2QH1 A;  3PC3 A;  3OI8 A;  4L28 A;  2RC3 A;  4ESY B;  3KXR A;  4PCU A;  2P9M A;  4GQV A;  2EF7 A;  2RIF A;  3I8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...