5LXRA

Structure of the minimal rbm7 - zcchc8 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 7
publication title Structure of the RBM7-ZCCHC8 core of the NEXT complex reveals connections to splicing factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lxrA00
3UCUP 2MGZB 2RRBA 3U1MA 1WG4A 2XS7A 2CPXA 3Q2TC 2CPHA 3LQVA 3MUVP 3LPYA 3S8SA 1PGZA 1WTBA 1AUDA 2DB1A 1WHVA 5LXRA 3MURP 2MQNA 2NZ4A 2RS2A 4F25A 5DDOC 1KOHA 3CC2S 1QVGR 2KRBA 1M5VC 1N88A 1U1QA 1YTYA 2ADCA 1BY9A 3EX7B 2CPZA 2U2FA 1OIAA 2MKCA 4OZ0A 1X5SA 2RQCA 2RRAA 1ZH5A 2DNGA 1OO0B 1U1KA 3U1LA 1FJ7A 4RU2A 1YJWS 2CPIA 1K73T 2N82B 3CCSS 1PO6A 4WFNQ 1F9FA 1KQSR 2CQCA 2FC8A 2MQLA 4P6QA 2CPFA 2J76E 2JWNA 4LIRA 2WBRA 2CPJA 1U1LA 1FO1A 2KT5A 3CPWR 1VQPS 1VQKS 3CCMS 2X1GA 2YTCA 2J0QD 3CMAS 2HZCA 3DXBA 3I55S 4YUDA 3EGZA 5GVQA 4EGLA 3CC7S 2KRRA 2JVRA 3NNCA 1HD0A 2M70A 1OPIA 4Z2XA 4IOAQ 2E5GA 3BO4A 1M5PC 5IM0A 2LECA 1Q81T 2MSSA 2ADBA 2VODA 2AYBA 1VBYA 1U6BA 2KN4A 3P49B 3MD1A 3PIOQ 4CH1A 1X4HA 2I2YA 3BO2A 2EVZA 2DNLA 2AYMA 2D3OR 1L3KA 4CQ1A 1WEXA 1WG5A 2DIUA 4CIOA 3B4MA 2CPYA 2VOOA 3P6YC 2DGOA 1K9MT 3SDEA 2OTJS 2MZSA 2MQQA 2CQBA 1WG1A 1KOOA 1SXLA 3CCRS 3CCES 1U1PA 3MI7X 3CCQS 2K3KA 1U6FA 1FXLA 2LCWA 5D77A 2CQGA 1RKJA 4OZ1A 4U67Q 1JJ2R 2CQ0A 1ZZNA 3G96A 2DO0A 2HYIB 2DGSA 2DISA 2X1FA 3VAMA 2GO9A 1YITS 1VBXA 3VAGA 1H2TZ 1YJ9S 1U1MA 2QEXS 2MZ1A 5H1SV 1DZ5A 2YWKA 2U1AA 1VQLS 5JVHQ 1B7FA 3CCJS 4ZKAA 5GADU 4ED5A 1X4EA 3RW7A 3CCVS 2E5IA 2VONA 1H2UX 2CQ3A 2DHXA 1M5OC 2E44A 2X1AA 2LYVA 2CQDA 1A7GE 2KXFA 1N52B 1QM9A 1O0PA 2DNQA 1X4DA 3VAHA 2KM8C 1URNA 1HL6A 3HI9A 4PKDB 1FNXH 4IOCQ 2CPDA 2GHPA 1WI8A 2DNOA 2G1DA 2L9WA 5HO4A 2QFJA 3CD6S 2FY1A 1X4FA 3D2WA 2N3OA 1WI6A 2MQOA 2MKSA 2OJ3A 5DDPC 2MPUA 3NS6A 1VBZA 2DHAA 1YWXA 2MKJA 4TU9A 1HD1A 1Q7YT 4BS2A 5IM0B 2RQ4A 4LJMA 2DO4A 1U1RA 1K8AT 3Q2SC 3CUNA 2MYFA 4C4WA 1S79A 2DNMA 3MDFA 2DNRA 5GAGU 1VQOS 3H2UB 1DHMA 1WF1A 2ZJPQ 3CCUS 5BJRA 2O3DA 4C7QA 5GMKa 4WF9Q 2Q79A 4TU8A 1DRZA 3K0JA 1FJCA 1D8ZA 4WFBQ 3CCLS 4Y0FA 5CXTA 5D78A 3MXHP 2E5HA 3P5TL 3NNHA 3G71S 2L08A 3G8TA 2M0GB 2MKHA 5LSOA 1WWHA 2MMYA 1QVFR 1VQMS 4WKRA 2K8GA 2KM8B 2PEHA 2KHCA 1VC0A 1M1KT 1HA1A 2KG0A 3P3DA 3MUMP 5DDQC 1X5TA 1G2EA 5JVGQ 2G0CA 3VAKA 2AYEA 2LXUA 2AD9A 2V94A 4F26A 2MGZA 2CQ2A 2BOPA 2DNHA 2KXNB 2N3LA 1SJFA 1P1TA 5GAHU 2VOPA 1P27B 1X4BA 2KU7A 4QPTA 3VAJA 2XB2D 3CTRA 3US5A 3BS9A 3THTA 5EN1A 1UFWA 1R8HA 2I38A 3I56S 4ERDA 3CF5Q 3UD3P 1IQTA 2DNZA 3NS5A 2DH8A 4WIIA 4TU7A 3CC4S 2YKAA 1M90T 4C0OC 2J8AA 2MZRA 5FJ4A 2F9DA 3BO3A 1SJQA 2ZJQQ 2JX2A 1N54B 2M9KA 1X5PA 1KC8T 2DITA 2FHOB 2HGLA 2E5JA 2DGUA 3PIPQ 2JVOA 2D9OA 5DM7Q 4W92B 1M5KC 2RT3A 3VF0B 2RU3A 2DNNA 2M2BA 3VALA 5ITHA 1A9NB 4CH0S 3J7ZT 2CQIA 2LEAA 2YH1A 1FT8A 4YB1P 1U1NA 2LXIA 2XSFA 3G6ES 3CULA 1H2VZ 2DH7A 1ZZFA 5CA5A 2DHGA 1FJEB 3G9CA 2A3JA 3EGNA 3UD4P 1YHQS 1DBDA 1KD1T 4WCEQ 3H2VE 1NO8A 2MJNA 4Y00A 1X5OA 2RNEA 3S7RA 3SMZA 2LEBA 1H6KX 3S01A 1WF2A 2BZ2A 2MXYA 2M8HA 1WEYA 4FXWA 2RUGA 1JMTA 2N7CA 2FPHX 2ERRA 2QA4S 2NLWA 3HHNB 2CPEA 4WFAQ 2DGTA 3NNAA 1Q82T 2XNQA 2MQMA 1CVJA 3ZZYA 5DDRC 1SJRA 1N8RT 1WHXA 2YH0A 1UP1A 4QU6A 2DK2A 2F3JA 2UP1A 3DLLQ 2MY8A 1VQ8S 4LMZA 3TO8A 2KVIA 1SJ3P 1X4GA 5LSLA 2KI2A 3R27A 3UCGA 3ULHA 4FXVA 5GAEU 4IO9Q 2JRSA 3UCZP 3CMES 4YOEA 5CYJA 2MKKA 3B4DA 4M5DB 4PR6A 1WEZA 2HGNA 3BEGB 2G4BA 3UWTA 2MQPA 1SJ4P 2X1BA 3N9UC 2B0GA 2RVJA 1S72S 2MHNA 3V4MA 3IWNC 3SDEB 2DGXA 3THPA 3TYTA 5MLCV 2F9JA 3MD3A 2XS5A 2D9PA 1X4CA 4IUFA 2MJUA 3OW2R 2HVZA 5DM6Q 1NJIT 2LMIA 2J0SD 3JB9k 1VC5A 2MZJA 1XN9A 4UQTA 1W2BR 3CXCR 3IRWP 2KXHA 2DH9A 2LA6A 2DNKA 2CQ1A 2CQHA 3G4SS 1RK8A 1UAWA 4TLQA 2MY7A 1VQ9S 1WHYA 2OSQA 2M8DB 2M7SA 1U2FA 5LXYA 2M88A 2DHSA 1X0FA 1VQ6S 2LQ5A 2FC9A 4PRFA 2OIHA 3NMRA 2ZJRQ 2MSTA 2OSRA 5LJ5Y 1OWXA 1JJHA 1UW4A 2KH9A 1VQ7S 2MKIA 5IQQA 2M52A 4A8XA 2KFYA 2PE8A 2DIVA 3VAIA 2DGWA 1D9AA 4F02A 1VQ4S 1VQNS 3RW6A 2HGMA 1Q86T 2MZQA 2RS8A 1YJNS 3MUTP 1FHTA 2MB0B 3L3CA 4W90B 2CJKA 4V19X 3MOJB 3FEYB 3J7YU 3R1LA 3UE2A 2EK6A 2L41A 3TP2A 2CQ4A 2OTLS 1WHWA 2EK1A 2LA4A 4J5OA 3ZZZA 2DGQA 5LJ3Y 3S6EA 2LKZA 2DNYA 2XS2A 4QU7A 2MZTA 5IFMA 3R1HA 1VQ5S 1VC6A 1WELA 2KG1A 1U1OA 2CQPA 3SXLA 2KYXA 1X4AA 1R8PA 5DETA 3G8SA 2DNPA 2SXLA 1JJ4A 5HL7Q 3VAFA 1YIJS 1YI2S 2DGVA 2AYGA 1NU4A 2M4MA 4QQBA 3FEXB 2XNRA 1WF0A 4UY8T
chains in the Genus database with same CATH superfamily
3BGOP 2VG6A 3Q24A 5L9XA 1P8GA 3GSIA 3KOAA 3W5XA 4MYTA 5I3PA 3OJSA 2W9CB 2OEMA 1WTBA 4A8SA 4F3MA 4J9SA 4CO5A 1NDLA 1S9GB 1HWKA 1AA1B 2HHPA 1HBMA 1RHMB 4DV5J 1ZH5A 1MWQA 3MEGB 1N5SA 2IRUA 5C24A 4IRKA 1S1XA 4LIRA 2CPJA 3FRZA 4X4VA 2HHQA 4H4MA 1VQKS 5HAOA 3PRBA 3EPIA 1MN7A 3I0RA 1J2VA 1CJUB 1OPIA 1NBEB 1KP6A 2AYBA 5HANA 4C8NA 2FTRA 3BO2A 2XBPA 1JXLA 1RWXB 2XI3A 5AXKA 1NEEA 5F8JA 2IMOA 2G2ZA 3PYGA 3HSJA 1Q95G 4XO0A 2B9WA 3ZTQA 2FHMA 4B08A 4LF8J 2RH3A 2RRNA 3CCQS 4A8KA 4DSIA 4FXDA 1IKXA 1CS4B 5D4PA 2HLUA 2K3IA 3OFGA 5CYMB 4U67Q 2CJYB 1PYSB 1U47A 1Y0HA 2A2DA 2MLYA 2X1FA 3BQ2A 5ETSA 2PMHA 3SSQA 3FSIA 3LP2B 2HAFA 2PC6A 2WK4A 5B09A 1DTTB 2EI5A 5M2PA 4LFBJ 3RRKA 2YNFB 4I4BA 2V2QA 4LREA 2QFJA 1KQKA 1RWOB 2GIFA 3ISND 2FVPA 4MKAA 5C42A 2KB2A 1BC6A 2IYGA 4ED2A 1F5CA 4U8VA 3VGSA 2DHAA 1T9TA 5B0AA 3DRYA 2HW3A 1B3TA 3KJQB 4BWMA 3H2UB 3AD8C 2W4PA 2UVRA 1LWFA 3VQSA 3P5TL 1YRUA 2M0GB 4WU3A 1BQNA 4TNOA 4LR8A 3QIPA 2AYEA 2CZVC 1YSJA 2LQBA 1R89A 3FVYA 1NJXA 2VH7A 3BKUA 1OY8A 3UN3A 2XB2D 1FKPB 2H5IB 3ZTPA 1Q5VA 4ALZA 2W01A 3W63A 3W7BA 1VOMA 2DNZA 3R2CJ 2WSCC 1EP4B 2F9DA 1TL5A 2M9KA 4ES3A 2DITA 2FHOB 2VL1A 1KVIA 2FZKB 2VKZG 3VF0B 3TNVA 5ETOA 2ZITA 3QJJA 3IWLA 3V6HA 3GJRB 1R0BG 3C14B 4M95A 4DHVA 1CJUA 5KFQA 2B4PA 3G6ES 2MEWA 2RMLA 3HFKA 1WSVA 2FLOA 4WCEQ 4DSJA 2MJNA 3VZHA 2XMUA 1WDTA 1UVJA 1ROFA 5J2NB 3PJXA 4KC5A 3LGNA 5K14A 2ERRA 1S6QA 1OYEA 4DL4A 2IAJB 3RU0A 3AA8A 3AOAA 1R3NA 4UUWA 4X4SA 4K5RA 5E7OB 4P75A 1CS4A 4MIWA 2I8EA 2ZDPA 5CYMA 1LW2B 5GAEU 4DXLA 3R5AA 7FD1A 1NUEA 2E1AA 2GMJA 3LP2A 2JDJA 1R8AA 2JSXA 3D3CJ 3IA0A 2ZH7A 1DY3A 5KT4A 1DTTA 1RACB 5DM6Q 2YKPA 1VC5A 2YNFA 3M1VB 3GWCA 2QTWA 1TL1B 1X0FA 1S6PB 3KLGB 1OWXA 2ASDA 3PW5A 3EE3A 4Y34A 2M52A 1ZTTA 1NK0A 5HMWA 2HGMA 1U02A 3W1YC 1Q8BA 2GS8A 2WONB 3V6KA 2HK3A 3W5ZA 1HNZF 1TKZB 1DJ0A 4K2XA 4EEYA 2EK6A 2NSCA 4C8LA 3F0NA 3MPYA 3A1YG 1TU0B 4IQMA 2Y3YA 2CQPA 3T19A 1PC4A 5CCMA 2AEMA 4ZPTR 4DV6J 3G8SA 3V6JA 1JJ4A 2ZH1A 1TL7B 4ZPVR 3DM2B 2QRRA 1EP4A 2R2UA 4NCGB 3O3LA 4DUZF 1ZA2B 3PKMA 1NXIA 4RL1A 2FUG9 2D69A 4F25A 2HNZB 1YTYA 2ADCA 4I0WA 5HJXA 5C25B 3MPUB 2YKOA 2E7VA 4P2MA 1HWIA 2BW7A 3BH7B 4CLZA 2CQCA 2FC8A 5F0UA 1NPRA 2KT5A 4NLSA 5J2NA 3W65A 1UKUA 4LF2A 4X4OA 1NJWA 2R7UA 3GIIA 3TAMB 4EGLA 4J9UE 3K5MA 2IAJA 1NSQA 3OL9A 1JQGA 2VZ9A 1FKOB 3PIOQ 3AD7C 5ETKA 1LW2A 4E0DA 2FJAB 1VHIA 4CNYA 3OSPA 4Q44A 4Y28C 4KV8B 4KAIA 2UVUA 1H0HB 1FXLA 5D77A 1RKJA 3ILIA 3PHEA 3M1VA 2OPRB 3G8QA 2DO0A 2A6OA 1HMVB 1A6LA 1TL1A 2QEXS 1VQLS 1S6PA 5L1LA 3KLGA 4ZP6A 3RW7A 3PR4A 1E6YA 4LF9F 4X64F 1A7GE 4PG8A 3A3OB 3AB4B 1F5BA 2V34A 3HI9A 2WONA 4DR3F 3CD6S 3HXMA 1QJHA 1TKZA 4M5LA 2CVEA 2YPZA 4DLEA 1B0VA 5BR8F 4AL5A 5KFLA 1YVFA 5GMKa 1REGX 4C2MA 3MECB 2KM8B 2G2YA 4ED0A 1TL7A 3DM2A 3T3FA 1RHQB 4OYBA 4NCGA 5DDQC 1YRXA 3VAKA 4OHWA 2KJWA 2YVSA 4YS2A 4J9OA 3AJ1A 1HHQA 1P27B 2XYHB 2JLFA 2GGPB 5EN1A 3KK1B 3RBEA 1RAFB 4OYPA 4TY9A 3FKBA 2HNZA 3KDOA 4TKTA 1IR2A 2BEFA 2ZM6F 2F8HA 3P4UB 4TVAB 4M5MA 2FJXA 1WSRA 2RT3A 3CJ0A 5HQLA 4CWBA 3GFYA 2H4WB 4KHPJ 3TAMA 3J7ZT 1EKSA 1Y3KA 2VA2A 3I31A 4C9DA 1FKOA 3GYNA 3EGNA 4RNOA 1QAXA 4ZIWA 2WRMA 2ZNYA 2YWGA 2RNEA 3SMZA 2KKHA 1NHUA 1H6KX 3L4BC 1VGYA 1PAUB 1FRJA 3B82A 4A46A 2DK2A 4KV8A 1S9EA 4WKYA 2GV1A 2Q6BA 4WPAA 1TKTB 2OPRA 4K4SA 3PTWA 3HP6A 3DCAA 1ZAVA 1OQ3A 3LP0B 3BPSP 4N76A 4HI1A 4M5DB 4DPWA 3M8WA 3RJMB 2E5LF 2RVJA 4DX6A 2JC0A 2LP4A 2XS5A 4TYBA 3CDWA 4LF9J 1OMSA 3DLGB 1JLEB 1T02A 5DRKA 2DNKA 2UXDF 1WHYA 4F0HA 4E2FB 2FZCB 2M7SA 3JTPA 4ZVPB 1F5AA 4F4XA 1LXJA 5E0OA 2MSTA 3BBCA 2MLXA 1KQFB 4ECRA 4JYAF 4URSA 4ZVQB 4DR7F 3FBFA 1VQ4S 2QLJB 4LR9A 4KPYA 1FEHA 3MECA 4RKUC 2I9SA 2HBRB 4XPCA 4HYKA 2GCFA 3TWZA 1EAYC 3D0GE 4FZVA 2OTLS 3W64A 2EK1A 4J5OA 1WNEA 2PA3A 3T1HF 5KFJA 1JLCA 4BDPA 3PEHA 4Q8EA 1RYSA 3RBZA 1RTZA 3MM8A 2RDIA 1UTAA 3KHRA 4ZP8A 2EC0A 3ILOA 3HSDA 2GGPA 1WC6A 2V9WA 3KK1A 1X4AA 3HVRA 3U1NA 2BQ3A 2LFVA 1T03B 2HHWA 4LT6A 3AA9A 1RWKB 2ZM6J 2Y9HA 4RW4B 4WXOA 4J9MA 2NXCA 2CZ9A 3R2DJ 4WWSA 3W9JA 4DZ6A 3IBWA 2AV5A 1S7IA 2J9EA 4NX9A 1Q7LB 3H5XA 2Q43A 1X5SA 3OL7A 2W9BA 3MHYA 1PO6A 4UZBA 3D5MA 5KFBA 1NDKA 2Z57B 3HZGA 3EGZA 1VQSA 2EC2A 3EGWB 4OHZA 2JVRA 3RR7A 2ACMA 3A4TA 3BGLA 3H7HB 4BWJA 4DU7A 5KFXA 1VS3A 2HBZB 1TKTA 4F0MA 3A3PB 2PO4A 3IR6B 3MPWA 2XY5A 4KR0B 3LP0A 3JSMB 2KDOA 3BH6B 4PPDA 3W66A 3RTVA 2EBGA 1HIYA 1NSPA 1KOOA 2E5LJ 1VQYA 2HLTA 2K7KA 2R42A 3DLGA 3CJ4A 5E3AA 1JLEA 2OAUA 2LDYA 2DRAA 3UDCA 5EX3A 1RA6A 2EPIA 2NUHA 2P8IA 1N56A 1DZ5A 3R7NB 2H65B 3JQMA 1R7IA 2YWHA 2CQ3A 3GYGA 5J1EB 1SPBP 2V8DA 3LWMA 4RU9A 4JYAJ 4PPZA 3MM5B 2NSBA 4KB7A 1Y00A 3ZZUA 1FNMA 1LOUA 2BJDA 3LA0A 1WI6A 5A6WA 2GAGC 2F8MA 2ZBCA 2OJ3A 1D9FA 3B78A 2W2OP 1HD1A 4FDFA 2H9ZA 4PQAA 5KFFA 3FCHA 4AFFA 4KH0B 2R8KA 2DNMA 2EWHA 4Y2MA 5KG3A 4B3RF 2NXEA 1H74A 1TK5A 2MKHA 3RYLA 1QVFR 2KVQE 1T03A 1P1LA 4LRFA 3UVJB 3HMJG 3PO4A 2LEPA 3TUJC 2QA2A 2V94A 3I4PA 2ZDOA 2RJZA 5GAHU 2NXNA 1CC8A 2IDEA 1DTQB 3LGMA 2GJFA 5L1JA 4OYXA 3CC4S 1S5ZA 4DEZA 1HBUB 3PJ9A 1PBUA 4IH5A 4G1PA 3H4BA 1HLWA 1X31C 1QAIA 2X3GA 4OX8A 2CJXB 3N79A 2ZWPA 1RT1B 1FDAA 2LXIA 3N5FA 1A0OB 5HK4A 4RUCA 1N5YA 5D0GA 2DHGA 4NLVA 3G9CA 4DF4A 3TZXA 4WFZA 4JV0A 3CJ8A 4X4PA 4RNNA 4I6AA 3ZTOA 3JSMA 1YBTA 4YR3A 1GXUA 1U0SA 4GC6A 1IWGA 4MK8A 4DV7F 1SJRA 2HG4A 1RAGB 5EDWA 1FD2A 4LF6F 4NI2A 4R8UB 4YR0A 3Q0AA 5T41A 1NNDA 2HGNA 1ZPVA 3BDPA 1IBMF 4I6WA 5J1EA 4MK7A 3WC0A 2YNHB 3W60A 1TUGB 1CJKB 1CLFA 3MM5A 4DR1J 1S76D 2A2CA 3IRWP 1SL2A 2VPZB 2VC1A 4LF1A 1FE4A 1PCAA 4KY3A 2ZHBA 4DJBA 1Q8KA 2OSRA 2QA1A 3QRPA 4A8XA 2DGWA 2C1EB 2QFIA 4CM2A 4U8YA 1J5EF 1S12A 1IBKJ 3MOJB 2C22A 1PKUA 3M32B 5LMNF 3MOZA 3UVJA 3QRQA 2FLNA 3AB2B 5BXIA 3T1AA 2XS2A 4XK8C 3HZEA 4YFUA 5IFMA 1HW8A 5KG1A 1U1OA 5ETTA 5IT0A 1DTQA 3JSBA 4IR9A 3H8YA 1KBRA 3CVKA 4JI0F 3RGIA 2KO1A 2XMJA 4QIVA 3R97A 1EB0A 2R2TA 5J1PA 1HBUA 2YY3A 3JS9A 1MMDA 2M4MA 4WYLA 1S9FA 1WF0A 3CCSS 2ZKTA 2IBKA 1YX2A 4ZMMA 3LPYA 3MFHA 1QUPA 3D1OA 4EI2A 4Q45A 2QSFA 2V8VA 1KOHA 3BM7A 4ECZA 3DMJB 2RF2B 3H0PA 4F3QA 4OZ0A 3RUBL 1OO0B 2XYGB 2CPIA 4DOZA 1KQSR 3MM7B 1VJWA 2Z2LA 4ES2A 4LVNP 2RU9A 2EFVA 3CDBA 3HK2A 4CLSA 4YDDB 1NHVA 2E5GA 3EJMA 4R8UA 5IM0A 1I1GA 4I68A 3ENAA 2DJWA 4CH1A 4NMLA 1UVIA 3IM8A 2CJBA 4ID5A 2DXEA 2V2KA 2Y0BB 1RJJA 3HKWA 2DIUA 3DI6B 4PWWA 2IVFB 2EKYA 2CPYA 2B56A 5A76A 2B51A 2CQBA 2DBBA 2NQPA 3MI7X 1RT3B 2YNHA 4P7TA 3N01A 1CJKA 4R0JA 2BMBA 3VZIA 3BQ0A 2GO9A 1S97A 1NM2A 3ILJA 2MZ1A 3I87A 3K8VA 1SQEA 4ZKAA 4IRDA 1X4EA 4GKJF 1IM6A 2ILZA 3B8HA 2J9DE 2C3MA 3R5DA 1IUJA 2ZFHA 3Q8SB 4QJVA 3CJ3A 1X4DA 2A10A 5L38A 4M1KA 4ANDA 4DR6F 1FNXH 2GHPA 2HWTA 1NLKL 3KK2B 1NSAA 3AJ2A 1MSWD 2W24A 3M32A 2MQOA 1I6JA 4A8QA 2OI2A 4ZLPA 4JI1F 2HFZA 2HBYB 2J9CA 8ATCB 5JMNA 2E1RA 1U1RA 5FLXY 2HVEA 2O67A 1BWVA 2BQUA 1UMJA 4OJ3A 4FNIA 4JI0J 3ZXWA 1M0SA 1WKJA 3DNCA 3L7UA 3PRDA 3QT8A 2CQ2A 3UD5A 4FPRA 3E51A 1RUSA 3V4IB 2VOPA 4NLGA 5EWGA 4U7CA 1RT2B 3DDNA 4L72B 2V2ZA 3EMTA 4NASA 4X4QA 3AFGA 5L1KA 3DMJA 4B9UA 2DH8A 2RF2A 4RPFA 4WIIA 1NRKA 2ZH5A 3DOLB 1M90T 1GTEA 3I5CA 3L95X 3FZBA 2FD2A 1KC8T 3IS9B 4WP3A 5HMXA 1QDUB 3ZNUA 3QGGA 4HDGA 3MM7A 4W92B 2RU3A 3VALA 5IV4A 4Q5VA 3MFIA 3L7OA 1W7WA 1TMJA 2KFZA 4DPYA 4CH0S 3GONA 4MK9A 1LNQA 1R27B 5E3CA 4AUKA 4JV1A 3KFWX 3WHIA 4KGZB 3C46A 3GILA 2ZH8A 4F04B 2IVYA 5L46A 3LP1B 4AQYF 1NO8A 4X62J 5F0WA 2QYCA 5C5JA 2M8HA 3DI6A 1LW0B 2RUGA 3GYXB 4B3OB 2QA4S 3W2VB 3VVUA 2GFFA 2XNQA 2MQMA 3ONQA 2DY1A 4NPOA 2AWZA 2V68A 1RT3A 3F44A 4O3SA 3QSYB 1VQ8S 2V69A 4Q8FA 1RA7A 5DQGA 5IQ6A 2HK2A 3TVYA 1Z4UA 3H4DA 2ZHAA 3DYAB 3MMJA 2ZE2B 2H48B 2FYXA 4F8RA 2FHKA 3RB6A 3MR3A 3IAM9 5DO2A 4JI4F 2CDRB 2GJIA 3D9BA 3JB9k 1SV5B 2RHQB 5IC6B 3KK2A 2D74B 3TUPA 1WKKA 3T1YF 1SQFA 1QSSA 4JI1J 4NLQA 2DIVA 4F4ZA 3RB4A 4DFMA 4KT0C 4R5PB 3OT9A 4W90B 4FVCA 2GZOA 5F8IA 1TL3B 2DRBA 5KAKA 2L41A 1FFSB 5DG9A 2DGQA 1WC0A 1D8YA 2ATLA 4DL6A 4URGA 1I5OB 1WDDA 4BCAA 3DU5A 2E1PA 3V4IA 4PXBA 1NKEA 5EGYA 3M6XA 4W4MA 2CYYA 1YBAA 1RT2A 2FDNA 3H5YA 1RDRA 5D3GB 2WBMA 4AXIA 1FDDA 2HHHJ 2B9EA 1IVZA 3DOLA 1Y7PA 2L9DA 4NLPA 4OI1A 2XNRA 2O01C 3CCMS 5E2QA 2CPXA 3Q2TC 3DLJA 2BXJA 1FNOA 4GVBB 2ILYA 3HKZD 2Y1IA 1RQ0A 2DB1A 1KONA 4OI6A 4DCOB 3OTEA 4O4GB 1D0EA 2GVZB 4A8FA 4DN0A 2GX8A 2I6WA 5JXSA 4UTGA 3LP1A 2N82B 1UVNA 2P2CB 4L3KA 5E3PA 1IM4A 4LQ9A 3H40A 2IYIA 1LW0A 3W2VA 3IXQA 3I55S 1TP7A 4OX6A 5CZVA 3EZOA 3GV8B 3M6VA 1S0VA 5DG7A 2VV5A 3CGIA 1VIOA 3TZZA 2ZNZA 3DYAA 4ECQA 4P10A 2ZE2A 1I3OB 4DZDA 3NAIA 2R8HA 4ZPWR 4NZ6A 4ER8A 2NREA 2JEJA 5CD4A 1SV5A 2UUBJ 1RT5B 1FTRA 2Y1JA 1U1MA 4OL8A 2J6SA 3AT1B 3CO0P 3CCVS 2AEJA 1PILA 3ENWA 5LL6d 5KFPA 3PNIA 5AE1A 3EWGA 3T1YJ 1NK7A 4NRTA 3I82A 4LR7A 3EM1A 4R5PA 1FRMA 5FDLB 2FY1A 3J7YI 3M9OB 4S0MA 2EXUA 2MKJA 2RQ4A 2G1HA 2AZ3A 2ZKUA 4QIFA 2ZUAA 2VPXB 3M2UB 5D3GA 2UXCJ 1VRUB 2ZOFA 1FFGB 3MCOA 4EK2A 3I32A 3KUGA 3UPFA 5HVHA 4QWEA 4DX8H 1ZA1B 1NJYA 2JFKA 1D9DA 2WVBA 1MMLA 4QPTA 3CTRA 5B0EA 4O4GA 1UFWA 2VJUA 4DV1F 2HQ3A 2GVZA 3NS5A 4ZLLA 1Q8LA 4TU7A 4DR2J 2CIMA 2G0IA 3PW2A 1BE4A 3T6BA 3J7Z5 5DM7Q 3FK4A 2M2BA 5ITHA 3EGVA 4P71A 2HS4A 3PY8A 2OEJA 3W5YA 1L3UA 1TZ0A 3MM9B 1KLMB 2UUCJ 4QR1A 4JV5F 4ED1A 1X60A 1CG2A 1V3RA 3KLIB 4RBTA 4DR4J 1JXEA 3SSSA 3MR2A 4ENOA 2CJQA 3WX8A 5IS2A 1Q82T 4AYBD 5DDRC 5B0DA 2MQ8A 4DU8A 3JSRA 4OYWA 4C11B 4WFYA 1T95A 2QLXA 2PI4A 5D8HB 2XY6A 2LQ8A 1SJ3P 1RT5A 2CFXA 4DL3A 3T5KA 5HLFB 2BE9B 3CMES 1U7LA 4EBEA 3QT6A 4WZQA 4F4YA 4OHYA 3FQLA 4DPOA 2DGXA 4X65F 1N36J 5HI7A 2F65A 4Q2LA 2MZJA 2VBYA 4RUBA 3MTJA 4ANEA 1SH2A 2BKPA 3CDEA 2CQHA 2ZWOA 1RK8A 5FDLA 3EDQB 1T05B 4JUZA 2FVRA 1HBOB 4HTIA 1B0TA 5E3RA 4J9RA 4B17A 1HWJA 2B8PA 2FJVA 3TX8A 2Y8WA 4CLYA 4OMFG 4F02A 4UZCA 1VQNS 3UO0A 1K0VA 4JI6F 3M2UA 1T0TV 4RZRA 1VRUA 4N77A 4RW6B 1I94F 2E9RX 5EWEA 1X9MA 1ZAXA 2LKZA 4FKYA 4B9LA 4QU7A 1S99A 2L9NA 3R1HA 2M5YA 3N28A 3MCMA 1QUVA 4OI4A 4DSFA 1BHNA 2F63A 3SBMA 3OSNA 2ZOGA 5ETMA 5KT7A 1CJTB 1TK0A 3NCRA 4JI8F 5KFSA 2D3ZA 4ZCKA 4ECTA 1WG4A 2ZH6A 2FJDB 4NL5A 3MM9A 3PACA 3CE8A 1KLMA 2RSQA 3HHKA 4GO5X 2YKNB 3TX0A 4X4NA 4ECUA 3B6BA 3HLUA 2J8SA 2RQCA 2RE1A 4JV5J 1G7CB 3H98A 3ISNC 3KLIA 4DS4A 2EG1A 3TA1A 1U1LA 4CO4A 1FWKA 1VQPS 1KHWA 1WC1A 4YUDA 4EO6A 4ECSA 4OV6A 4LQ3A 4C11A 4OV1A 4DFPA 1ZBTA 1JLGB 1R31A 1T7PA 1CPZA 4A8OA 4LBPA 4OYZA 3CJKA 2D3OR 3ELHA 3HVAA 4JI7F 2UVWA 2HIQA 4CIOA 4MYUA 2UV8G 4IH7A 1PSDA 3IMQJ 2R8GA 3D54A 4B3MF 3CCES 4X65J 4F50A 2WVEA 2EBEA 3TR5A 3D6FB 2HIYA 4YN3B 1HYSA 1T05A 2QLWA 3HVWA 4AE5A 1HBOA 3KUHA 1FX2A 3Q89A 4NCBA 5ETPA 1H73A 2J6TA 3VAHA 2KM8C 4YEAA 4MFBB 2DNOA 4ZPCA 2HNDB 3HD1A 2DTJA 2V4JB 3AAWB 1UCNA 3EZ5A 4KGVB 3ZZ0A 4QPXA 1U09A 3T9ZA 2IA6A 1BQMB 4BLGA 3GIRA 5F8NA 3CUNA 4FKXA 6FDRA 1MU2B 1LWCB 2OGUA 3MM6A 5D15A 2E5HA 2JJ4D 3BBFA 2MMYA 1VQMS 4LSNB 3NKYA 2KHCA 3CO9A 1SL0A 3MR6A 1CJTA 3TUIC 2KG0A 3A8IA 4DL7A 4JI8J 2N3LA 4DV2F 1SJFA 1L3VA 2ZC4A 1N5VA 4O3QA 1T11A 3OQ2A 4NEYA 4RNMA 5CABA 2YKNA 1IQTA 1T8EA 2C2EA 4Z37A 2B5JB 3K17A 5IT4A 1FVQA 3KLVA 1L3TA 4HEA9 1TKXB 2A1BA 2ZZNA 3DLHA 1KLNA 4IO1A 3E2EA 4PG7A 1TVRB 2XYPB 4ZIVA 2GNKA 1FD8A 1GXLA 1ZM2A 1SC4B 4P2SA 1SH3A 3EVMA 4JB8B 1JLGA 5HQ8A 4WZMA 5I3UA 1AZSA 3PW7A 3QQCD 1DARA 2KZMA 3S01A 3HHNB 3VGVA 2CPEA 4JI7J 2B8QA 1EJ7L 3KWMA 1CVJA 1SKUB 2C2RA 4ICLA 2YH0A 1UP1A 2DCUB 4B3MJ 1K0TA 3DU6A 1C2PA 1RTJB 2DKOB 1DQ8A 2NPFA 3DFEA 1UJ5A 4PR6A 1NDPA 3IWNC 3N9UC 2PDAA 3BGUA 1NK4A 3L7PA 1YJUA 2Z56B 1PG5B 1ZPWX 4I67A 3ZC4A 1GXTA 3PX4A 2KXHA 2LA6A 4MFBA 2CWKA 2HBQB 3G4SS 2XMWA 2HNDA 2VICA 1N34F 2R7RA 2V4JA 4ZVRB 1UWBA 3VGTA 1BQMA 1RU2A 3IBFB 4PG5A 5JUMA 1Y5NB 1VQ7S 2MDAA 3P8BB 3HJFA 3WIVA 5GAGI 1BXNA 1MU2A 2RQKA 1Q86T 2WHOA 4HHHA 3I6PA 2GMLA 3EUNA 4EBDA 1XIQA 1YQHA 4V19X 1AROP 4X84A 4LSNA 4TLRA 2B6AB 2CQ4A 2FLPA 2UXBF 5HVFA 5KT5A 5L8RC 3M4XA 4OZ2A 4EYHB 1RCOB 1JKHB 2RKIB 3C6TB 1OSDA 3UQSA 1S77D 3RZAA 2OD6A 2B5JA 1B0PA 1XR5A 4CYUB 3AD9C 2AJ0A 2V50A 1AW0A 5KG0A 1TKXA 2IJNA 2EEYA 1RWVB 5DQHA 3R5GA 2WVFA 4ZS6A 5KG4A 2R3VA 4YP3A 1TVRA 1R6VA 2RS2A 2VDHA 4Q7AA 2W2PP 4NLXA 5B0CA 1UW9A 4KKOB 3D68A 2JOQA 2HFVA 1U1KA 3R7SB 2UUTA 1RXOB 3LGHA 1Y5LB 4K0KF 3E01B 4PXDA 2ASLA 1W2IA 3PG9A 5KFDA 3CPWR 1FDNA 2GQCA 4USKA 1S4EA 2CWXA 3OTCA 2CNKB 4ZVUB 3SFUA 1U6BA 1U2RA 4WBFA 2QO3A 2NR0A 1RTJA 5KFMA 3BF4A 2AYMA 4CZCA 3VV2B 3L9ZA 3AHPA 3QGPA 1K9MT 2OD4A 3OHBA 2IM1A 2VG6B 2CNOB 1QAJA 3IC1A 4FYXB 3DOMB 3VAGA 3WIUA 2HMIB 2OLWA 1B7FA 1XNQF 3CCJS 4DV5F 4ED5A 3IGVA 1YZ7A 3QMQA 2XCPA 1QSLA 1VBKA 2DPIA 5H9EK 1S1XB 4K2JA 4OIXA 5K8MA 1FRIA 3GJTB 4PKDB 2BE7D 5HO4A 2E66A 4YB7A 3I0RB 4LBIA 2NYHA 1U6ZA 2B6AA 5HP1B 3Q22A 1XC9A 3SFGA 2RAQA 2P5VA 3KLEB 2D1CA 4E98A 1RABB 2V67A 2FIUA 4L6V3 2FVCA 4QWAA 4Y0FA 5D78A 2IMWP 3MEDB 2RKIA 3G71S 2L08A 3C6TA 1NKCA 4LF8F 2XI2A 2PEHA 4C8MA 3QO9B 3D1QA 1T94A 1AFJA 4CYUA 2XY7A 4QWDA 3G2XA 5GAEI 4DUTA 2VFSA 1YJ7A 3PJWA 1YK9A 2J7KA 2GHWA 4K4YA 1YRTA 4LFBF 4FYWB 4FF3A 2XGQA 3E01A 4X66J 1XJWB 2DNNA 4TXSA 2DR5A 2LEAA 4IG3A 2Z2YB 4NRUA 4ANCA 2CA9A 1FJEB 2A3JA 2ZH2A 1R0AB 3TEHB 1Y3JA 1T9YA 2IPOB 5H9EJ 1X5OA 4ZN3A 2LEBA 1EIYB 1VIXA 4LRAA 5FLXU 1WEYA 2AX1A 3CD7A 4F4AA 2VKRA 4E8UA 2QL7B 2WW4A 1OQ6A 2DY9A 3QIPB 3U02A 4QR2A 1SQGA 2UP1A 1RWUA 3ZZTA 1TUVA 5ETRA 2BR0A 1RBLA 3DOMA 1UJ6A 2JRSA 4C0HA 2HMIA 1E6VB 5LMUJ 1KQGB 1NPKA 3P96A 3FCVA 3CMQA 2MHNA 3HJVA 4NLWA 3IM9A 4KGMA 1XNQJ 4GMKA 3SYZA 1X4CA 1G6BA 2MJUA 3ZZPA 2AJ4A 4B9NA 2LMIA 3QAEA 2VQFJ 4I2QA 5IT9Y 2QMWA 1XN9A 3QATA 1V3ZA 4TLQA 2MY7A 1U2FA 5LXYA 3JQKA 1HQUB 2VG7B 5HP1A 2HURA 1JJHA 3IGNA 3QJPA 3KLEA 1EZZB 2KFYA 1XK8A 1QE1B 1H7WA 3NOGA 3GV7B 3MEDA 1SKSA 5K14B 3QNWB 1JLQB 1UJ4A 1C0TA 1S6QB 1SVDA 3QO9A 2GQ2A 1WHWA 3D0IE 4DQRA 1Z2LA 2C2NA 4ZPAA 4R25A 4IYQA 1VQ5S 1VR6A 1WOSA 4WIQA 2XWXA 4U95A 5AE3A 4C8YA 2HFNA 3MPDA 1HNVB 2YQ0A 1DAXA 5ETLA 4P7VA 2O1PA 1LV5A 4NYOA 2DXDA 3FRYA 2NXUA 2WVCA 1H98A 4C3LA 1HW9A 3TA0A 2DXFA 4B02A 4HH1A 4J9QA 2KFNA 4ITSA 4ED3A 2AW0A 2MQNA 3QWPA 1LEOA 3M8QB 5C7PA 2AIRB 4UW2A 5CD4H 3OTOJ 5M2RA 1R0AA 3FC9A 2CADA 4P6QA 2JWNA 2ROPA 4OZ3A 4CLLA 1VRQC 5IWAJ 1NB7A 2X1GA 4USMA 3DXBA 2OMLA 2VQEJ 5GVQA 1NK6A 2KRRA 3SZ2A 2YQ3A 5F41A 5K9FA 3DRPB 1VHFA 4JI5J 1VBYA 4Q2MA 2XHWA 4ZCIA 2EVZA 4DV6F 4N7TA 2R8IA 8RUCA 3KLHB 2E7XA 1E6VA 5EX0A 1GEHA 1UVMA 4MAKA 1SXLA 2RIJA 1EKRA 1S6UA 2LCWA 2QN6B 1KEKA 3G96A 3W61A 1YITS 4OHVA 1HQUA 2BOAA 2VG7A 4QR0A 4NLOA 5AJ3J 2E5IA 2E44A 3BSOA 2PMZD 3BGFA 2ZH3A 4QW9A 1N52B 1QE1A 1QM9A 2BJ1A 3NCPA 4RW9B 2JFDA 2LDIA 5G0RB 1JLQA 2XLKA 5BYRA 3A8KA 3HDSA 3BQ1A 1RTIB 4BS2A 2NUUG 1G1XA 4DCPB 3Q2SC 4DI6A 3AXMA 1DHMA 4TU8A 2F1FA 3U27A 1HHTP 2AJQA 3SCJE 3AXKA 2JC1A 3DRSB 5KFGA 1T9VA 2POKA 4MKVA 4WKRA 1VC0A 3GB0A 4M5NA 1HNVA 3EVOA 1CQNA 2G0CA 2LXUA 3EZUA 5AXLA 3QLHB 2AD9A 4PABA 2BOPA 2B9XA 4EU0A 1P1TA 4WK1A 4YR2A 3NS7B 4J90A 4ZJLA 4DDFA 3G6YA 4PWDA 1DLOB 4RNHA 4LF4J 3M8QA 3RB3A 1O6XA 3CF5Q 1E6YB 3A8EA 2J8AA 2R7QA 3KHHA 3ILLA 2H4YB 1N54B 2B9YA 1IBCB 2HGLA 5A2QY 2XCAA 4ZITA 4J9PA 1TELA 1URRA 2FJWA 4B3SJ 1TAQA 1RHRB 1YDLA 3ADAC 3DKDA 3CULA 3DRPA 1JNZB 4TYAA 4D3HA 1RGVA 1UFLA 2GA7A 1FRHA 2ZH9A 4NZ0A 2XWYA 2HEKA 1N32J 3KLHA 5ADZA 2H3EB 1VJQA 1YKWA 4DV0J 4MMOA 2PEBA 3K2YA 4DUYJ 3M8ZA 2MY8A 1TK8A 4B3TJ 4LMZA 2HAIA 1KVKA 2KI2A 2FVSA 2FHJA 3WZ0A 5J2PB 2KJVA 1WD6A 3IAS9 3W2WB 5GADI 2G4BA 4IKAA 2XHCA 4DL0C 1DFDA 3RAQA 3SDEB 3TYTA 5MLCV 1HNWJ 1RHUB 1ZETA 1U49A 2VFTA 4RW9A 2V5HG 4KHPF 5G0RA 4MIAA 4LSZB 3LPEA 1FESA 3N5BA 4A8WA 5A8KA 1Q1KA 2OIHA 1RTIA 2VC0A 3C16B 1PJ7A 2Z4PA 3TEGA 3F56A 5IQQA 2HQIA 3FEZA 2PE8A 1PYOB 1D9AA 2HZVA 2XZDB 2DYAA 5BYQA 3DRSA 1FHTA 4CLUA 3L3CA 1T3NA 3ETOA 4UOHA 3J7YU 3SV3A 3O5TB 1OYDA 1FWLA 4ZCMA 4ID8A 2ZHOA 2BX6A 1RKIA 1S59A 2J7UA 3QLHA 1S9EB 4P72A 2PD1A 2MZTA 1Q79A 4ETZA 1OSCA 1TV6B 1RT6B 1DLOA 1SC3B 1GMVA 2FJBB 1WC4A 5HL7Q 1JNRB 2Z58B 4LRBA 2FVQA 3QZ7A 3C2PA 4K4WA 4NXMF 1RAOA 3H42A 4KGKA 3H20A 1IR1A 2PA8D 2CPHA 3CWJA 4A8YA 3TZWA 2W4CA 3MR7A 4HL9A 3O8WA 3KXDA 3MAQA 5LXRA 2DEJA 5E5NA 5D0EA 2CVIA 5B0GA 9ATCB 2IA0A 2QYGA 1QLNA 3U1LA 2GO8A 3WQPA 4KH1B 4DQSA 4DR5J 1MROB 4L3NA 2PT0A 8AT1B 2CPFA 2HRUA 2A6MA 1IBLJ 2UZAA 2ZH4A 4ECXA 2UU9F 3NMAA 3T6JA 2HHXA 2E1MC 1XBWA 4L73A 2M70A 2NCKL 2VFVA 1JLCB 3BO4A 4KGXB 3G87A 3MD1A 3MM8B 1KNZA 2KTQA 1UPMB 5J2PA 4M5IA 2YX1A 4YB6A 1OPZA 1S0MA 3W2WA 1RI7A 4DMZA 3EXCX 3SDEA 3DLKB 2VG5A 4HLBA 1RAEB 2W2QP 3D6HB 3RBXA 3HHLD 5DS7A 3KUEA 4TY8B 3KTQA 1ITPA 2C2MB 2HYIB 2HRYA 1VBXA 1QTMA 2ASYA 5KOWA 1SL1A 1RSCA 1F0XA 3C16A 1Y5IB 2UVVA 2W9BB 1F6TA 2LYVA 4AT1B 5B7WA 2CQDA 4ATNA 1R8BA 2CG4A 1EQ0A 4FYVB 3RAMA 4WXWA 1F9HA 5ETNA 5DDPC 2MPUA 3SCLE 4OHXA 3T9NA 4LJMA 1MG7A 1QAYA 4I6YA 3W9HA 2ZJPQ 1FF2A 4UOGA 4NOHA 1DRZA 1RT6A 1D8ZA 1TV6A 2YX7A 1LKZA 1V9OA 1WWHA 2QLBB 1X5TA 4USIA 1G2EA 3TAPA 4PQUB 3TJAA 4LUBA 1PAEX 1CJVB 1ACMB 2BJ9A 4F26A 4NXMJ 3FDSA 1JLFA 2KU7A 3VAJA 2XGPA 3IBCB 5T14A 3QWUA 2R4FA 3WC2A 3TVZA 3NRBA 2C3YA 3O1LA 5B0FA 2ZJQQ 1FX4A 4K4VA 1MROA 4NZ7A 5A0YA 4KTQA 1TKDA 3Q8PB 3DOKB 5HBMB 3PKYA 4DV4J 2UU9J 2XSFA 5DQIA 4X2BA 1JLBB 3SIPB 4A4JA 2IY5B 2VA3A 3JSYA 1VK3A 3S7RA 2LLZA 1FE0A 2OO4A 3CJ5A 3Q86A 2C3PA 3NNAA 3DLKA 1R43A 1K47A 3J81Y 2YQ1A 1JX4A 3LO3A 2VJVA 2OH2A 4ZP7A 1UWAA 3M8YA 1FA0A 1MN9A 4TY8A 5LSLA 3GE9A 3ULHA 1O51A 2AZ1A 2J0XA 1PJ5A 4IO9Q 2Y0SD 2X1BA 4XDDA 1WC5A 2IC3A 3M2VB 1MW7A 3OUYB 2UV8A 4NMXA 2YWEA 2QX0A 3NAHA 1RE1B 2DH9A 1VQ9S 2OSQA 2XMKA 3KJNB 3UN5A 1FXRA 2QZ8A 3O6QA 2QIFA 1N5YB 4P73A 1RYRA 1U4BA 1Q53A 4LF7J 1HFEL 4DF8A 2CKWA 2O5DA 3EYZA 4YY3J 5KFZA 4K50A 3SQOP 3SI8A 4DX7A 5IV3A 3R1LA 3PYDA 4DWIA 3JXOA 4NI2B 4NEZA 4PQUA 1H72C 2XEXA 2XO6A 1CJVA 3M8RA 1Q5YA 4X4UA 3FSYA 1UA1A 3N6NA 4YQWA 2KG1A 3G82B 2HS3A 3V81B 2KYXA 1REVB 4O23A 5KFWA 2B7BB 2Z8QA 3R8YA 1C4CA 3M7VA 4CLFA 5E41A 5CZXA 3FFIB 3UR3C 4DR1F 3FEXB 5AXMA 1FK9A 2C2OB 1GQEA 3ZZOA 3J7A1 4HHJA 4CO0A 1RTDB 1GFWB 2DT9A 3D66A 3C66A 1K44A 3DOKA 2EKNA 5HBMA 3K57A 4USWA 4MKYA 2RB7A 2OFGX 1ZOTA 2RRAA 4ES1A 2MKYA 1JLBA 1IBKF 1S1UB 3D67A 2IJRA 4LVOP 2MQLA 1HI1A 1PJ6A 3JAMY 2J76E 2AGOA 4PG4A 3HHLB 1GTHA 2IDLA 3ZFVA 1ZS6A 4F4WA 4HHUA 6FD1A 2BA9A 2QA4G 2AU0A 4Z2XA 2XQCA 2LECA 4K4TA 3VR1A 2KN4A 2V9KA 5I42B 1R8CA 5K8PA 2X7IA 4P52A 1VI7A 2C2KB 3HFVA 3X3UA 3CB4A 1XWLA 1SIWB 2UUAJ 2V8GA 3DLBA 4CO2A 3M2VA 3OUYA 1X0PA 1U6FA 2WCXA 2DGSA 1S7HA 4L76A 3NGDA 2FB0A 1J5OB 1BGXT 1IKYB 2P9GA 3GV5B 2JLGA 2OPPB 1XEZA 2H5JB 1URNA 3NG8A 1YGYA 1J27A 1S57A 2W1BA 4U9RA 3UNGC 3NS6A 2G2OA 4WTYA 5IM0B 2YKMB 4USTA 1S4FA 2BJEA 1IR0A 3OFFA 2Q3PA 1HNIA 5GMDA 5GAGU 1VQOS 2EW9A 3J80Y 1KTQA 2BE2B 3T5HA 4WF9Q 3G82A 4ID5B 3V81A 1AUSL 1FJCA 4ZHRB 4WFBQ 5CXTA 1REVA 3KJFB 3MXHP 4EBCA 3NNHA 1TMMA 2ASJA 3P3DA 5K8NA 1F1BB 3FFIA 1RWWB 3MMAA 1M5SA 2K7JA 4PEOA 4XDCA 3LW5C 1JK9B 2HKEA 1U2CA 2HSEB 3T5JA 4X4RA 1RTDA 2YXLA 4OX9F 5JJBA 2FY8A 2JZ5A 1XNRF 5FIIA 3BYPA 1N4LA 4DQIA 4ZP9A 3W8GA 3Q23A 3DC2A 1EQMA 2YNGB 2MZRA 1ZM4A 3JTNA 1H3DA 3T41A 1JWWA 1SJQA 1S1UA 1C1CA 3PIPQ 2AEFA 3HHLA 2OHDA 4RBUA 7FDRA 4O3OA 2IM3A 3Q8VA 2CQIA 4IDKB 4EO8A 1LFPA 2YH1A 4YB1P 2XMAA 2IVMA 2ZEJA 3QT5A 4J9NA 3QZ8A 5I42A 3H2VE 4KPCA 4KQZA 4CCHA 2GIRA 1F2GA 2N7CA 3F41A 4V1Ak 2DGTA 2ZBIA 1MWYA 3QGHA 2OEKA 3QFWA 2Z0GA 2BVZA 5F8GA 3SCIE 4I7FB 4M5JA 3R5JB 4NLDA 5AT1B 2L3MA 1S49A 3I9V9 3AODA 3HSZA 5KG6A 1R0CB 1RU1A 2XULA 2I1RA 2HQDA 1J5OA 5ETVA 1WC3A 1IKYA 3TQ1A 3MD3A 2APOA 2OPPA 2XSJB 3TZYA 4EZ6A 4WE1B 2KT2A 2W9CA 4QBUA 4BBYA 3C6UB 4C0BA 2YX4A 1S9GA 2D3UA 4Y2KA 2YKMA 3D1HA 5LJ5Y 2KH9A 4LFCF 4X62F 3MEGA 2BE2A 4F7VA 2H51B 1WORA 5IXUA 4GC7A 4ZHRA 4QCLA 3TRGA 5EUHA 2RQMA 4FF4A 4OYIA 4ILLA 9RUBA 2CRLA 5SUHA 2R2SA 4B9VA 2GIQA 2DNYA 2V63A 4V19J 1RHJB 3NGRA 1JLAB 4PUOB 3NGKA 1B7YB 3A12A 2HFUA 5KFKA 4M5HA 4FS2A 4OX9J 1XNRJ 4FS1A 1KVJA 2B7CB 2YNGA 4MIBA 2AYGA 1RZMA 4C48A 3P45B 2ZD1B 1SKWA 3HVTB 1UA0A 1SB6A 2W9AA 4UUXA 1G3OA 4J9VA 2XG8A 3OL8A 4C8KA 3H90A 2R2RA 5B0BA 2CAJA 4OJGA 3MURP 4K4ZA 5IT9U 4IDKA 3K58A 4RR5A 2O66A 4UQGA 1U1QA 1NHKL 3NOCA 3GIJA 1ZM3A 2OFHX 2MTLA 3M2RB 5KOXA 1FVSA 4DPXA 1L5UA 1K73T 3FCWA 5CCLA 4RUHA 4Y2IA 1QTNB 2Y8YA 2I0XA 1GMWA 2JH3A 1SCJB 2E1CA 4USHA 1NZAA 1P6TA 2N4DA 2PIIA 3D7SB 2BM1A 5K5MA 4JI2F 2JNJA 3PW4A 3BN4A 1U24A 4UOCA 5F9LA 4I7FA 2ABYA 2DNLA 3OXGA 3CDAA 2AF6A 5KFYA 3W8PA 4F36A 5KG7A 4BHQA 1L3KA 7AT1B 2HHHF 2B43A 4O44B 4UF4A 2XSJA 4H4KA 5IOLA 4WE1A 5IC4B 1VMBA 3QIDA 2Z2MA 1FKPA 3C6UA 2YWKA 2CJ9A 3MMBB 1LK5A 2V2VA 2VB6A 2BKNA 2VONA 4CM0A 1KR4A 4FPIA 4LFCJ 1U0HB 1ULRA 4CO3A 4LBHA 3GIKA 2XTJP 3V2UC 1HR0F 3C14A 1TFYA 1VBZA 3K5LA 4KYZA 4TU9A 2H54B 2W2NP 1VCTA 1DQ9A 3PX6A 2RD5C 2QV6A 3GJSB 1QY7A 2DO4A 4ILMA 1KKHA 1K8AT 1JLAA 4U96A 4PUOA 2BJ3A 3K0JA 3IFEA 2C2ZB 1V5VA 4H4OB 3PHTA 4DN9A 5EWFA 1S1TB 2V6AA 3G8TA 3GZ7A 4KRWA 2VFUA 2C3UA 1NSKL 2ZD1A 3HVTA 2UUBF 1N6QB 3LANA 1YJTA 4M8LA 3ET6B 1V3SA 3JQJA 2VHGA 1X4BA 1RBAA 3PO5A 5A8WB 3BS9A 2LXFA 3HPOA 1R8HA 2I38A 5F3ZA 4ECYA 4HT7A 3M2RA 3K8WA 4WTOB 3KLFB 1S10A 4UT4A 2A0FB 2HFSA 3T5LA 1JJCB 1N5TA 4MTPA 3LF0A 3ZTRA 1U8SA 4P2FA 3ZTSA 2IBOA 3LWLA 3ENVA 4NCAA 5HATA 2VBXA 4WYWA 1MNEA 1UPPA 4JI2J 2UXCF 5KT6A 2HWHA 4CH7A 5HQMA 4N56A 1YJRA 3P5BP 4O44A 4Z7YA 4RX6A 3NBPB 3AJDA 1Z1ZA 3CD0A 3SCKE 3PW0A 4U7UD 3DHWC 1HNZJ 3MWBA 1WOPA 2F3JA 3IWXA 4H54A 3H5SA 1NCLA 5RUBA 1X4GA 1FI4A 4FXVA 4AXJA 2JLEA 3GCWP 2RDJA 1PYTA 3CD5A 5I4MA 1T9UA 3MMBA 3LH2S 4DR2F 4WJBA 2MQPA 3THPA 2GHVC 3NWRA 1T9XA 2HVZA 3NCQA 2HHSA 1FTCA 1U0HA 5MAOA 3UNYA 4DUZJ 4UQTA 1TAUA 4HTJA 3DXSX 4ZLNA 2UUCF 4C98A 3IG1B 2NS1B 5A2QU 5B08A 2ZZMA 2DR8A 2FC9A 1HR0J 3NMRA 5E3QA 4DQQA 2AHOB 3GJQB 4ZN1A 5C25A 4DR4F 4B9MA 4AD6A 1RP5A 1GT8A 3VAIA 4L74A 1MLAA 4DL5A 1HI8A 1UZHA 4H4OA 4LFAF 1S1TA 2BM0A 3FEYB 4C3MA 4MT1A 3FZ2A 4AL7A 2W25A 4N47A 1GNKA 5F8HA 4CNZA 1N6QA 3OL6A 3ET6A 5A8RB 1NPPA 5A8WA 1XR6A 5HN0A 1N36F 2WB1D 4IQXA 3V6DB 3WBZA 1Q16B 2AGQA 1LFWA 3KLFA 5F3TA 2ZBQA 1UZDA 1BD6A 1HMVA 2DCLA 4NYPA 1WTFA 5IZHA 3GCXP 5T7LB 1QVGR 2KRBA 3DDIA 3FGVA 2E9ZA 3TW0A 1BY9A 2MHEA 2CPZA 2DNGA 1RAJA 3CSKA 5CQGA 3EDRB 1Q0NA 2R7SA 5LSRA 4X64J 4WFXA 2WBRA 3VQTA 4DLGA 5LOQA 2BACA 3NBPA 4DFKA 4DR3J 3N6LA 4OZ5A 3BKFA 3ITHB 4IOAQ 3BZQA 2VD3A 3PX0A 1Z2ZA 3OXFA 4CO1A 1D1UA 1XMBA 2J9DA 2KL8A 2E29A 2GC8A 5BR8J 2CXEA 3RRGA 4G3IA 3FUYA 4DS5A 2DGOA 3TARA 3CCRS 2X51A 2P9CA 2ZZTA 4OYOA 2HQCA 1UL3A 3PFOA 1LK7A 1ZZNA 1HWLA 2DISA 3MAAB 3IG1A 4ZK7M 3RR8A 4M94A 5GADU 4URQU 3OLBA 2HPUA 4B9SA 2R9LA 1HL6A 2OPSB 2X3DA 2G1DA 1V6HA 2QE5A 2BANB 3QAUA 4O0NA 4LFAJ 2GAHC 4OX7A 3BB5A 2MKSA 2XMVA 2K06A 3DRRB 1YWXA 1FRLA 3CCWA 4ZPDA 2W7OA 3TOQA 4C4WA 2MYFA 1S79A 3MDFA 2Y1RI 3CCUS 4C7QA 5A8RA 3CJKB 3OLAA 4TQRA 3CCLS 4ZPBA 3QSIA 3HHEA 3NGUA 2C28A 1UVKA 3V6DA 2K8GA 3CJRA 3MUMP 1NH7A 5JVGQ 4FBUA 3M8PB 3K5PA 3ISZA 1FEEA 1FRKA 2BW2A 3QFHA 1HYSB 3H5UA 3I9ZA 4JV2A 1SH0A 4M5DA 5T7LA 5KFIA 3UD3P 3PXGa 2YKAA 1X7VA 1X5PA 3VCDA 3KMQA 1VDHA 3R9LA 2BUNA 3H25A 1GX5A 1GMUA 4RJVA 1NJZA 4DSKA 2HNYB 2UXDJ 3ITHA 1UETA 3U7JA 4BC7A 2V0NA 5BYSA 5DJBA 5CA5A 1Q8IA 2IJFA 2UUWA 2LQ9A 2VIHA 3UD4P 2QMXA 2JL9A 2IM2A 4Y00A 2LU2A 3MM6B 4DR7J 3MGJA 1JB0C 1APSA 4DPTA 2BYCA 3SSRA 1NMEB 1JMTA 5A6PA 3FSXA 1N8RT 4R0EA 4ZLJA 3FNNA 1FXDA 1G4CA 2ATCB 4PAAA 3GG1A 4CLPA 3T1HJ 1P9YA 3EICA 3OV7A 3OHAA 3MAAA 1KFSA 3UCZP 2P6TA 5D6GA 5CYJA 2D9PA 3OW2R 1KTVA 1NJIT 1Q4RA 3A13A 1S0NA 4RW4A 4OZNA 2OPSA 3CXCR 2EG2A 5HMYA 2CQ1A 2OPQB 1UAWA 2FZGB 2BANA 4BC9A 3PZPA 3DRRA 4O3NA 4EYIB 2MKIA 4L75A 3IR7B 4DQPA 5I3UB 1AZSB 4ZA1A 1NAQA 1YBUA 2MB0B 4ZVSB 3HT3A 2PSZA 4G1IA 1S1WB 4IFVB 1XQIA 3W62A 3I5BA 4ICLB 2LA4A 4Y6IA 3S6EA 3M8PA 3UW1A 3FQKA 3J81U 5K8OA 5CYQB 4FVMA 3VVTA 3KG4A 2WW8A 3SXLA 4ZVFA 1M1HA 4P2XA 2W7AA 3HX9A 5J1NA 3UI3A 3AY0A 2AGPA 1NU4A 1EETB 2QG9B 2HQGA 2BJ7A 3O44A 1CQMA 1VISA 1HWUA 1PGZA 3D3BJ 2HNYA 1WHVA 2DPJA 4P9SA 2K1RB 1YLXA 1UWBB 3LALA 2NZ4A 3HD2A 3V5RA 4I56A 4XPEA 5DDOC 3IR5B 3CC2S 1N88A 3NEKA 3EX7B 2U2FA 3N6MA 3N0VA 3OBIA 5DLGA 2BDPA 2HVHA 1FJ7A 3Q8QB 3GSDA 2AJFE 5KFVA 1S48A 4F67A 1RWNB 4QWBA 4KHMA 3TANA 2VDIA 3NNCA 1RB0A 1HD0A 2JEGA 4F0KA 2KZZA 3C3LA 2KYZA 1NDCA 2YWWA 1Q81T 1FFWB 2MSSA 5HSPA 3R5BA 5D0RA 3G6XA 3OJUA 1F3VA 3Q83A 3MF5A 1L3SA 4CQ1A 4KIAA 1WG5A 4B3RJ 3QGIA 3GR0A 2XZTB 2XC9A 3UDVA 4F2RA 1CEZA 3R6GB 2B4UA 4P74A 2OPQA 3CT9A 3HHDA 4DFJA 4W98A 2RHSB 1TQLA 3Q8UA 5C2GA 2R7WA 5AE2A 5H1SV 2U1AA 4J9KA 5I3QA 3D6TB 4OLPA 1D3WA 2DR9A 4FYYB 1HKAA 3UDEA 4ZJOA 3JTOA 1JXVA 2NYIA 3WDOA 4IOCQ 4QOTA 2CPDA 4HI2A 1WI8A 2EFPA 2L9WA 3AH6A 1S1WA 4IFVA 5F8MA 2R7OA 3JAMU 1RT1A 2YNIB 4LF5F 4DPUA 2YBVA 2DEIA 2V8HA 2ZUGA 5HVGA 3MEKA 5AXNA 3I0SB 3DLEB 5CYQA 2W4DA 2O3DA 1NK8A 1NK9A 1UEVA 1RADB 3H59A 3MZIA 3TA2A 2LQJA 3Q8RB 2W8KA 1EETA 3BDEA 4DV7J 2FLLA 4PYAA 4J37A 2J6UA 1RAHB 4LF6J 2VUGA 4F4KA 4JOUA 4PYDA 1N48A 2L48A 4DSEA 4TQSA 2QL5B 3GP9A 4O4RA 2K1RA 3SEOA 2PFFB 1HI0P 1ELOA 2WAQD 4ED4A 4ERDA 1RCXB 2EFQA 5KT2A 4KFBB 5DZ6A 1SI9A 5FJ4A 4GKKF 3D6MB 4GO7X 3PVXA 1IBMJ 3OFEA 2E5JA 2HHTA 1IJEB 1PIEA 2YPYA 1CBKA 1IWAA 1XERA 4RWWA 4M63A 4ED6A 1FT8A 4FN5A 1RT4B 1ZZFA 1MWZA 2ZVSA 2HVIA 2HFOA 4OJHA 3D0HE 4J91A 1DBDA 5KFOA 1KD1T 4LIWA 1ZYQA 3PV8A 2BZ2A 4RLEA 2IIHA 3J80U 1J5EJ 1I51B 3TAQA 3QYYA 5HROB 2IM0A 4GRSA 2VBWA 5M2UA 1VFJA 5LMNJ 1UEUA 3NLCA 3QT7A 2KVIA 3KNGA 2HS0A 1S6OA 4RW8B 2MKKA 4ED8A 2HHUA 2IHR1 4IRCA 1PBAA 4X66F 2IRYA 4N8NA 1IXKA 3BSAA 3CJTA 1W2BR 3M8SA 3I96A 2AX0A 2W7PA 1D09B 1U48A 2W2MP 4IG3B 1X8DA 3K7RA 3PEJA 2YNIA 1VK8A 1HQ2A 2QGFB 2JHEA 4LF5J 4WK3A 3CCZA 1UW4A 3M6WA 3OVAA 3I0SA 3GFXA 3PRVA 3R7BB 3ZO7A 3DLEA 3RBDA 3RAXA 4M5KA 2BRKA 1IJFB 4NXNF 2CJKA 2OELA 4CLKA 3PR5B 1AXQA 3ZZZA 3IO1A 2ZC3A 4XIUA 2XO7A 1WELA 4ECWA 2KT3A 2V8PA 4QIWD 4ZVHA 5LMUF 1M5HA 4RW7B 1H7XA 2B3TB 2DNPA 5F9NA 2NXJA 3CJQA 2AJ2A 2D41A 4KFBA 2DGVA 1RLDA 3QJLA 3HHLC 2VQFF 4QZVB 4IR1A 4UY8T 3UCUP 4GKKJ 2MGZB 1C0UB 2RRBA 4I2QB 3U1MA 2DD8S 3D4JA 4CP5A 3HT0A 1BUXA 4K5SA 1SBRA 1U25A 2BABA 4EWTA 1RT4A 4ELTA 2MKCA 1OIAA 1GK8A 4GKJJ 1T9WA 1F9FA 2J5AA 2E9TA 2FHJD 3I5AA 2PFDA 3K59A 1MMNA 2R7VA 1Q78A 1F9EB 3GG0A 3QRRA 4DR6J 4JP8A 1C0TB 2XMTA 2J0QD 3CMAS 5HROA 3PYFA 4Q43A 3TUZC 1M5PC 1Y9OA 1SIZA 2EFGA 3N4WA 2VODA 3FMWA 3KKFA 3BR9A 1X4HA 4C97A 4KE5A 3J81j 4GVLA 1BWEA 4JBCA 4I2PB 3NGTA 2DHHA 4RW8A 5D4OA 3M05A 3B4MA 2VOOA 3P6YC 3IRXB 2OTJS 1X9SA 2CDQA 2MZSA 1WG1A 3LUYA 2DRDA 5KFCA 1JIHA 1PC5A 1Y4ZB 4ZVGA 4OI0A 2CQGA 4OZ1A 3VAMA 3BREA 3OTOF 5JVHQ 1FDBA 1P9QC 5KG2A 2PGCA 3IN5A 2CZ4A 4WP8A 1TR0A 5DGBA 5L39A 2YKQA 2X1AA 1WUUA 4G6VB 2KXFA 2AMCB 3IS9A 5IWAF 4DBQA 1NB2A 5J2QB 3KK3B 2VQEF 1SJ1A 4NXNJ 1CSJA 5KFHA 4EMDA 3CIZA 4JI5F 3LTOA 1FERA 1Q7YT 2ZBPA 3MCSA 1SC1B 1KWMA 1S1VB 1WF1A 4IOBA 2LU1A 3MAHA 3OVSA 1B4SA 4RW7A 1UFKA 4AQYJ 2WOMB 3FJ2A 4B3OA 2B4OA 4MKBA 2COLA 1HPZB 2XMMA 2MGZA 1C0UA 2DNHA 2WVDA 2WTFA 1SUQB 2N7YA 3ZNJ1 1WOOA 3TJ8A 2DR6A 4DSLA 3US5A 5AJ3F 4A47A 3OD2A 3BPDA 4ZDNA 4USUA 2WB4A 2WSFC 4CI0B 4FF1A 2AP6A 3PM9A 4ECVA 3IP0A 1KRPA 2VBZA 4C0OC 1B99A 2F40A 4JI4J 2XM3A 2JVOA 2I5JB 1OJ4A 4QIEA 1LXNA 1N0UA 2AKWB 3TQEA 2XLJA 1HARA 2PMWA 2DH7A 1EHWA 3L09A 2MLZA 3Q8YA 4OI3A 2GW8A 1YHQS 4Z7CA 1ZAWA 4I2PA 2QC3A 4EFAC 1W25A 2BJ8A 2MXYA 2FPHX 3A3NB 2NLWA 3IRXA 4H4KC 1TL3A 1R6YA 1WHXA 2H1YA 1BMQB 4DG1B 4CDIA 4LF4F 5KFNA 4PWDB 3TI0A 1WEZA 3C19A 1SJ4P 2CJAA 2F9JA 2RILA 5DGAA 2K2PA 4KSEB 3R3TA 1RT7B 3KDNA 3UFCX 5J2QA 3KK3A 4B3SF 2BBEA 4K59A 2F4VF 2BV3A 3GTYX 3AQPA 3BGRB 3G86A 4GVBA 3EPGA 1AYEA 2M88A 2LQ5A 5L1IA 3GLJA 2C42A 3M9NB 4O3RA 5DG8A 3VHQA 3CCTA 1U45A 4K4UA 1S1VA 4C8OA 1N32F 2VU5A 5HMZA 3CJ2A 1SKRA 4KHRA 4IH6A 4DV0F 4ZCLA 2RS8A 1YJNS 1KSPA 2WOMA 1RBOB 4DUYF 2AQ4A 3HM9A 4ZVEA 3QPIA 4NLUA 3UE2A 1K1QA 4NLYA 4B3TF 1HPZA 3BR8A 1SUQA 1VC6A 2P6SA 3BSNA 3JYTB 4Y2AA 2V4QA 1SC6A 1R8PA 2R7TA 1C1BB 5DETA 1HNWF 1XTZA 4PCQA 1GX6A 1UVLA 5HJYA 2GMHA 3HF5A 5EHHA 2QL9B 2XS7A 4YB5A 3CNQP 2I5JA 3MUVP 3S8SA 3GR1A 1AUDA 2DVIA 2VASA 1KN6A 5A8KB 3KHGA 1M5VC 4ED7A 4CT8A 4F2SA 3KG1A 2HWIA 3BJYA 1ICEB 4RU2A 2QMUB 1YJWS 3ZZRA 5CHCB 1FO1A 2F8EX 3CEDA 1FCAA 1OS5A 3HCXA 3M9MB 3CC7S 3HO1A 3M30B 3OPKA 2J0WA 2OKQA 2ADBA 1F2HA 2D7SA 3P49B 3BV8A 1HQEB 1N33F 2I2YA 1OY9A 4DG1A 4USVA 5CAAA 1WACA 2YWFA 3MMCB 1WEXA 3B54A 3AQOA 3FBCA 4IG0B 1TUWA 3A8JA 1RAAB 1FJGF 2MQQA 3OVBA 1U1PA 3FBBA 1LQ9A 1RT7A 1CULB 2Q6CA 2DR7A 4DCJB 3BGRA 1AB8A 2EFOA 2CQ0A 3OXLA 3KHLA 2F4VJ 4XAKA 4QYZK 1H2UX 4DV1J 4DR5F 2DHXA 2CG8A 3MEEB 1M5OC 3GPAA 4G1QB 2C3OA 1IBLF 1HBNB 1VLYA 2G9OA 1B64A 4Q0BB 3MCNA 3AOBA 1DURA 1UEKA 4JI3F 4EZ9A 1YJVA 4J7CA 1X4FA 3D2WA 2N3OA 2F7VA 2KHDA 2VPWB 2HHVA 4I64A 4ZVTB 6AT1B 4G65A 1T3OA 2DNRA 2GVDB 3POTB 2Q79A 4XTTA 1AT1B 3JYTA 4HH0A 2F4FA 1C1BA 2RDDA 3DGPB 5G4DA 2H5EA 2NZCA 4ELUA 4FF2A 2VG5B 2QLFB 4DL2A 4ELVA 1XR7A 3HSGA 2FJEB 2OUGA 4MH8A 4HACB 1FWPA 3MTKA 2HZAA 5HLFA 4I1TA 3THTA 3X1LB 4TN2A 5KFAA 5FD1A 1QSYA 2CUYA 2NPIA 5DZ7A 3OFHA 5GMEA 1F60B 3BO3A 1O8BA 5K20B 3QBCA 1IQZA 2DGUA 3D28A 3NY0A 1M5KC 2JEIA 3KYLA 2BQRA 4OYMA 3M30A 5KTQA 2XZWA 5SZTA 1H2VZ 1VRTB 4QYZJ 3NGSA 1HQEA 4AL6A 4CTAB 1N33J 2ZVIA 3MMCA 4D3GA 2HVDA 4JI6J 3DGVA 4RW6A 4IG0A 1TFWA 5LM7E 4HVZA 3OR2B 4OZLA 1I94J 4PWUA 2W8LA 1FJGJ 2QJ3A 1CULA 4ZOSA 3RRHA 4J9LA 1RLCL 3R27A 1JLFB 4M5GA 2CNNB 3TJ9A 4OJ1A 4NA3A 3PYEA 4C6AA 3RB0A 4C8ZA 2VFRA 3B4DA 3UWTA 3KNAA 1BQXA 2B0GA 3V4MA 4USJC 4KBIA 2F5GA 1QD1A 3MEEA 3UR0A 4QWCA 5D4LA 4IUFA 4G1QA 1HBNA 4Q0BA 4NA1A 4NLRA 1RWMB 2P9EA 4KO0B 5A0YB 5KFTA 4DV4F 2M8DB 4JI3J 4FNHA 4N41A 1VQ6S 3WX4A 3GIMA 4K8RA 3CW2C 4PRFA 2FQQB 3M6UA 4FBTA 3R6LB 2ROEA 4LRDA 2GVDA 3POTA 4RBVA 3NL0A 3RW6A 3CJSA 3KMSA 3MUTP 3DGPA 2VF3A 3MPVA 3I4HX 4PXCA 4CLWA 3VWSA 3TP2A 3HFZB 1NZ8A 5LJ3Y 3ICLA 3E8OA 4OYAA 4HACA 3OR1B 1F3FA 5KFRA 3FBEA 1HNXF 1CC7A 3C15B 5GAHI 1EARA 3PCOB 1AFIA 4Y3CA 1IN0A 3GU0A 5KFUA 2ZOMA 4OZJA 2SXLA 3LAKA 2RUSA 3VAFA 1GAOA 4WU2A 5E33A 1YIJS 3DRXA 3DN9A 1YI2S 2V4RA 3CIMA 2IC3B 3OTBA 1IKWB 4QQBA 4HT5A 1ZTWA 1VLOA 3W9IA 3LQVA 1KS2A 1TTHB 1FKAF 2CNLB 2LVWA 5THWA 1RISA 1S0OA 4LF7F 2PN6A 4I69A 4DV3F 1VRTA 4QIGA 2C2DA 1LWXA 4UOFA 3UN2A 4YY3F 3ETMA 4CTAA 4WFNQ 2G13A 1KFDA 4IFYB 5ETQA 2YTCA 2HZCA 5D4NA 3OR2A 1FRXA 4KJIA 4N8OA 1KDNA 5LT5A 3J7AN 2J7WA 1XMOF 4ILRA 1RTHB 4ETXA 2ACYA 5F8LA 1DQAA 3SQGB 1LWCA 3H2LA 2N4CA 2R8JA 1YZ6A 3RG6A 1WJ9A 4HDHA 2IRXA 2AT1B 3GQCA 1IKVB 1FK9B 1O5JA 2OP5A 3R5CA 2K3KA 3TVKA 4KO0A 4CRJA 1YG0A 1JJ2R 4OFZA 1EX8A 4YHHF 1H2TZ 2IFXA 4PXEA 4DV2J 1YJ9S 3HULA 3UDLA 1C4AA 2ROGA 4HKQA 4YDXA 2WSEC 2R7XA 1X9WA 4LSLB 3OTDA 4NLTA 3MR5A 2XLIA 1O0PA 2DNQA 3THVA 5H9FK 1GH8A 4FYDA 2WZ1A 3KJVB 1W26A 4RO0A 5U47A 1TL4A 2BRLA 4RUAA 3OR1A 3EXYA 4PG6A 3C15A 5BJRA 1KHVA 1HHSA 1HNXJ 2UUAF 4C3KA 5LSOA 2HRTA 1ZM9A 1M1KT 2ALYB 1HA1A 3DDKA 5CH7B 4OQJA 1XMQF 1IKWA 2E7WA 1LWEB 1U26A 3BBBA 5KG5A 4FP9A 2KXNB 5J2MB 1VYAA 2PI5A 4QW8A 2Z2ZA 4N5SA 3K89A 1GMWD 4X4TA 3G6VA 3EVWA 3I56S 3DHXA 2A18A 4NWBA 1NKBA 3AOCA 4Y2CA 2HQFA 4OLOA 4CT9A 4DV3J 4WP9A 3O2IA 2JX2A 4U7UK 4U6PA 4DX5A 4YMEA 2D9OA 5D0HA 5KFEA 2VPYB 4NYZA 5C2CA 3KG0A 3LAMA 4IFYA 1A9NB 4OI2A 2QT7A 1U8WA 3BKTA 1U1NA 1N34J 4EUVA 1HBMB 1HNIB 1RTHA 4K7QA 3K5OA 4NE9C 3BSCA 1K1SA 1XMOJ 2D3O1 5C24B 3SQGA 2QSWA 1NK5A 1B70B 1H38A 5H9FJ 3S1TA 1WF2A 4H4MB 4RWXA 3GFZA 4FXWA 4A8MP 4WFAQ 2Q1LA 3ZZYA 4HR2A 3MMAB 1IKVA 2Q66A 4QU6A 3DLLQ 3LOUA 4CLTA 3NXZA 1RHKB 1WKLA 3TO8A 3NP5A 2EFNA 3E3XA 5KT3A 1Y10A 3UCGA 2UXBJ 1RWPB 1RAIB 2ALZA 3W3SA 3VTIA 4YOEA 1Y11A 2Y1LB 4YHHJ 3K5NA 1N5QA 1JKHA 4PZVA 2M3DA 3BEGB 1S72S 4LSLA 3PFEA 3C8YA 1C1CB 4B9TA 2J0SD 1IKXB 4A48A 3NWGA 2Z30B 3GFHA 4O3PA 4ZJQA 2FGCA 2GQQA 3GMGA 4Y65A 3KJVA 2FGOA 4F3OA 4ZVOB 2DHSA 5L9NA 1BLUA 1M1GA 2ZJRQ 4KKOA 1OY6A 2GJ2A 3BYRA 4RNFA 2MZQA 1N0VC 4K4XA 4K0KJ 2JEFA 4QYRA 5C42B 2BKOA 3CDUA 3F73A 3VGUA 2ZBRA 1LWEA 1XMQJ 1NH8A 1V5IB 5J2MA 4NA2A 2G0JA 4O0IA 3ENQA 1LWFB 5DLFA 2OMOA 2B4VA 2AJ1A 4UY85 3SV4A 1BQNB 3FMBA 3BN7A 4LRCA 3PDNA 4MJKA
chains in the Genus database with same CATH topology
3O44A 1CQMA 2VG6A 4KGKA 3H20A 5E2QA 5L9XA 1P8GA 2CPXA 2PA8D 2CPHA 3Q24A 3Q2TC 3CWJA 3KOAA 4A8YA 3DLJA 4MYTA 2BXJA 5I3PA 3OJSA 2W9CB 1HWUA 1FNOA 2W4CA 2ILYA 3HKZD 1PGZA 4HL9A 1WTBA 4A8SA 3O8WA 2HNYA 4F3MA 1RQ0A 2Y1IA 2DB1A 4J9SA 1WHVA 5LXRA 3MAQA 4CO5A 1KONA 2DPJA 4OI6A 3OTEA 1S9GB 4O4GB 2K1RB 1UWBB 3LALA 5E5NA 1D0EA 2NZ4A 3V5RA 1HWKA 4I56A 4XPEA 5DDOC 2CVIA 3IR5B 3CC2S 1N88A 5B0GA 2HHPA 3EX7B 1HBMA 2U2FA 4A8FA 2IA0A 3N6MA 3N0VA 3OBIA 4DN0A 1ZH5A 1QLNA 2GX8A 5DLGA 2BDPA 3U1LA 2HVHA 3MEGB 5JXSA 1FJ7A 3Q8QB 2GO8A 1N5SA 2IRUA 3LP1A 2N82B 4DQSA 3GSDA 5C24A 2AJFE 5KFVA 1MROB 1S48A 4IRKA 1UVNA 4F67A 4L3NA 1S1XA 2PT0A 2CPFA 4LIRA 5E3PA 2CPJA 2HRUA 3FRZA 4X4VA 2HHQA 1IM4A 4LQ9A 4H4MA 1VQKS 3H40A 2IYIA 1LW0A 2UZAA 2ZH4A 4QWBA 3PRBA 3W2VA 3IXQA 3I55S 4KHMA 1TP7A 4OX6A 3EPIA 4ECXA 2UU9F 3I0RA 5CZVA 3NMAA 3TANA 3T6JA 2HHXA 1J2VA 3NNCA 2E1MC 1XBWA 1HD0A 2JEGA 2KZZA 2M70A 1OPIA 2KYZA 2VFVA 3GV8B 3C3LA 1JLCB 3M6VA 3BO4A 1S0VA 1Q81T 2MSSA 5DG7A 2AYBA 2VV5A 3CGIA 3MD1A 3MM8B 1VIOA 1KNZA 4C8NA 2FTRA 2KTQA 3R5BA 3G6XA 2XBPA 3BO2A 2ZNZA 1JXLA 3DYAA 3OJUA 4ECQA 3MF5A 5J2PA 1L3SA 2XI3A 4CQ1A 5AXKA 2YX1A 4YB6A 1NEEA 4KIAA 2ZE2A 5F8JA 1OPZA 1WG5A 3NAIA 2IMOA 3QGIA 1S0MA 3GR0A 3W2WA 1RI7A 4DMZA 3EXCX 2R8HA 4XO0A 3SDEA 3DLKB 2XC9A 2B9WA 4ZPWR 2FHMA 2VG5A 4B08A 4NZ6A 2RH3A 4HLBA 4F2RA 4EZ6A 2RRNA 3CCQS 4A8KA 2JEJA 2NREA 4DSIA 1CEZA 2B4UA 4FXDA 1IKXA 5D4PA 2HLUA 1SV5A 2K3IA 3OFGA 5CYMB 1RT5B 3HHLD 4TY8B 5DS7A 4U67Q 3KTQA 1U47A 1Y0HA 2A2DA 2OPQA 1FTRA 3CT9A 2HYIB 3HHDA 4DFJA 2X1FA 3BQ2A 2HRYA 1VBXA 1QTMA 2Y1JA 2ASYA 1TQLA 2R7WA 2PMHA 1U1MA 5AE2A 5H1SV 5KOWA 2U1AA 4J9KA 5I3QA 3SSQA 3FSIA 4OL8A 1SL1A 2J6SA 3LP2B 4OLPA 1F0XA 1D3WA 1Y5IB 2DR9A 2PC6A 3CCVS 1PILA 2WK4A 3ENWA 5LL6d 5B09A 2UVVA 2W9BB 5KFPA 3PNIA 5AE1A 1DTTB 2LYVA 5B7WA 2CQDA 2EI5A 5M2PA 1NK7A 3JTOA 2NYIA 1R8BA 4ATNA 4NRTA 3WDOA 3I82A 4IOCQ 3RRKA 4QOTA 2YNFB 2CPDA 4I4BA 4HI2A 4R5PA 1WI8A 2CG4A 1FRMA 2EFPA 2L9WA 2QFJA 1KQKA 5FDLB 3ISND 2FVPA 4MKAA 3RAMA 2FY1A 4WXWA 3AH6A 3J7YI 3M9OB 1S1WA 5C42A 2KB2A 4IFVA 5F8MA 2R7OA 2IYGA 4ED2A 1BC6A 1F5CA 2MPUA 5DDPC 1RT1A 2YNIB 2DHAA 4LF5F 2MKJA 3SCLE 5B0AA 4OHXA 2V8HA 2ZUGA 3DRYA 2RQ4A 3T9NA 4LJMA 3MEKA 5AXNA 2HW3A 3I0SB 1QAYA 2ZKUA 4I6YA 3DLEB 4QIFA 5CYQA 4BWMA 3H2UB 2ZJPQ 1FF2A 2W4DA 2O3DA 2W4PA 1NK8A 1NK9A 4NOHA 1DRZA 2UVRA 2VPXB 1RT6A 1D8ZA 1TV6A 3M2UB 1UEVA 1LWFA 5D3GA 3VQSA 2YX7A 1LKZA 3P5TL 1YRUA 1V9OA 3H59A 1VRUB 3MZIA 2M0GB 3TA2A 2ZOFA 2LQJA 1WWHA 4WU3A 3Q8RB 2W8KA 1BQNA 4TNOA 1EETA 3BDEA 1X5TA 4USIA 3QIPA 1G2EA 3I32A 2AYEA 2CZVC 3UPFA 3TAPA 1YSJA 4PQUB 2FLLA 4LUBA 4QWEA 4F26A 4DX8H 2LQBA 4J37A 1NJYA 2J6UA 2VUGA 4F4KA 3FDSA 2JFKA 4JOUA 1R89A 1D9DA 1N48A 2L48A 1JLFA 3FVYA 4DSEA 1NJXA 2VH7A 4TQSA 1MMLA 2KU7A 4QPTA 3VAJA 2XB2D 3CTRA 1FKPB 5B0EA 2XGPA 4O4GA 4O4RA 2K1RA 1UFWA 3SEOA 2PFFB 5T14A 1HI0P 1ELOA 3QWUA 4ALZA 2R4FA 2WAQD 4DV1F 4ERDA 3W7BA 2HQ3A 1VOMA 2EFQA 2DNZA 3NS5A 5KT2A 4KFBB 3WC2A 2WSCC 1SI9A 1Q8LA 4TU7A 2CIMA 1EP4B 5FJ4A 2F9DA 3NRBA 3TVZA 3PW2A 4GKKF 2C3YA 3O1LA 5B0FA 2ZJQQ 1TL5A 4GO7X 3PVXA 2M9KA 4ES3A 4K4VA 3T6BA 2DITA 2FHOB 3OFEA 1MROA 2E5JA 2HHTA 2VL1A 1KVIA 3J7Z5 1IJEB 5DM7Q 2VKZG 4NZ7A 3VF0B 2M2BA 5A0YA 3TNVA 5ITHA 1XERA 2ZITA 4KTQA 2HS4A 3IWLA 4RWWA 3PY8A 3QJJA 3V6HA 4M63A 1TKDA 3Q8PB 1L3UA 1TZ0A 3MM9B 3DOKB 4ED6A 1KLMB 5HBMB 4M95A 3PKYA 4DHVA 1FT8A 5KFQA 4FN5A 2XSFA 2B4PA 3G6ES 4QR1A 5DQIA 4JV5F 4ED1A 1RT4B 1ZZFA 1MWZA 2ZVSA 2HVIA 4X2BA 1CG2A 2HFOA 4OJHA 2RMLA 1JLBB 3D0HE 4A4JA 1DBDA 3HFKA 5KFOA 1KD1T 1V3RA 2FLOA 3KLIB 4LIWA 4RBTA 4WCEQ 1ZYQA 1JXEA 3JSYA 2VA3A 4DSJA 3SSSA 3MR2A 2MJNA 3VZHA 2XMUA 1VK3A 3S7RA 1UVJA 2LLZA 3PV8A 2CJQA 1FE0A 2OO4A 3CJ5A 2BZ2A 1ROFA 2C3PA 4RLEA 3PJXA 5J2NB 4KC5A 3LGNA 5K14A 2ERRA 1S6QA 5IS2A 3NNAA 3TAQA 3DLKA 1R43A 3QYYA 4AYBD 5HROB 1Q82T 2IM0A 2IAJB 3J81Y 5DDRC 2VBWA 5M2UA 5B0DA 4DL4A 3RU0A 3AA8A 1JX4A 1VFJA 3JSRA 3LO3A 2OH2A 1R3NA 4UUWA 4X4SA 4K5RA 4C11B 4WFYA 4ZP7A 5E7OB 1T95A 2QLXA 2PI4A 5D8HB 1UEUA 1FA0A 3NLCA 4MIWA 2XY6A 2I8EA 2ZDPA 2KVIA 5CYMA 3KNGA 1SJ3P 1RT5A 2HS0A 4TY8A 5LSLA 2CFXA 3GE9A 3ULHA 1LW2B 4DL3A 1O51A 5GAEU 1S6OA 3T5KA 5HLFB 2J0XA 4IO9Q 3R5AA 3CMES 7FD1A 4RW8B 2E1AA 1U7LA 4EBEA 2MKKA 4ED8A 4WZQA 2Y0SD 4F4YA 4OHYA 2GMJA 3LP2A 3FQLA 2X1BA 2JDJA 2HHUA 4DPOA 1R8AA 2JSXA 4XDDA 2DGXA 3IA0A 2IHR1 4X65F 2ZH7A 4IRCA 5KT4A 1DTTA 2IC3A 3M2VB 5DM6Q 1MW7A 5HI7A 2IRYA 4X66F 3OUYB 2YKPA 2UV8A 4N8NA 2YWEA 4Q2LA 1IXKA 3BSAA 1VC5A 2MZJA 3NAHA 2VBYA 3MTJA 1W2BR 1SH2A 2DH9A 2YNFA 3M1VB 3M8SA 3GWCA 3I96A 3CDEA 2CQHA 1RK8A 5FDLA 2AX0A 1T05B 1VQ9S 2OSQA 2XMKA 2W7PA 4JUZA 1U48A 2FVRA 4IG3B 1HBOB 1TL1B 1X8DA 4HTIA 3K7RA 1X0FA 3PEJA 1S6PB 1B0TA 1FXRA 2YNIA 5E3RA <