5LXRA

Structure of the minimal rbm7 - zcchc8 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
b'EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 7
publication title Structure of the RBM7-ZCCHC8 core of the NEXT complex reveals connections to splicing factors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2016-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5lxrA00
2LKZA 1HL6A 2MQNA 2KU7A 1YIJS 2LCWA 2EK6A 4YB1P 3MOJB 4BS2A 4FXWA 1VQ4S 1JJHA 2MKCA 5LJ5Y 2FY1A 2CQIA 4CIOA 3B4DA 3UD3P 2I2YA 1D9AA 2CPXA 3CCUS 4PRFA 3THTA 3ULHA 2DH9A 2KXNB 3VALA 2N3LA 2JWNA 2L9WA 2MKJA 4OZ0A 2LYVA 2MJNA 1SJ3P 1FNXH 3NMRA 1S79A 2MYFA 3H2VE 2CPYA 1Q86T 4YOEA 5DDQC 2KVIA 4Y0FA 5BJRA 2QEXS 2N7CA 2OTLS 1OWXA 4ZKAA 4LJMA 1G2EA 1BY9A 2DHGA 3N9UC 3Q2TC 2CQGA 4A8XA 5D78A 3BO4A 2MSSA 3VAFA 1DRZA 2U2FA 1HD0A 2DGSA 2K8GA 1NJIT 1WF1A 1X5SA 3CTRA 1FT8A 2D3OR 2M8DB 3CCQS 2DNRA 2VONA 2DISA 2RVJA 2XB2D 2LXIA 1Q81T 2ADCA 5GAEU 1U2FA 4P6QA 1VBYA 2DGXA 3VF0B 5IQQA 1OO0B 3MURP 1WEYA 2DNLA 2MZTA 2E5JA 2MKHA 2CPZA 2G1DA 1YJ9S 2RRAA 3IRWP 2DGQA 2DNZA 3Q2SC 3R27A 3CF5Q 1X0FA 2NLWA 3CC2S 4Y00A 4TU7A 2XS5A 2KRBA 5DETA 1N54B 2Q79A 5GADU 1YHQS 3MI7X 3CD6S 5DDOC 3CMAS 2WBRA 2OJ3A 2M4MA 2E5GA 2KN4A 1WF0A 3ZZYA 5CYJA 2AD9A 4IUFA 2MSTA 1X4CA 3THPA 3MD1A 3PIPQ 2M8HA 2HGLA 1X4FA 2F9JA 3CCVS 1P27B 1URNA 2OSQA 2M52A 2O3DA 1H2VZ 1PO6A 3SXLA 4TU9A 3CPWR 2RRBA 1KQSR 4CH1A 2DIUA 3B4MA 2RQCA 2FC8A 3BO3A 1M5KC 3S7RA 2YH1A 5CXTA 2L08A 1WEZA 1UFWA 1X4EA 3TP2A 2VODA 2CQHA 5DM6Q 2AYEA 3SDEB 3UD4P 3CULA 1UAWA 4IO9Q 2MQOA 3FEYB 2OSRA 3R1HA 3G4SS 3U1MA 5IM0B 1KD1T 2X1FA 2DB1A 4F25A 1W2BR 2LMIA 1YWXA 2M2BA 2AYGA 2X1BA 1HA1A 2MQMA 4UQTA 2MJUA 3UCUP 2VOOA 3HHNB 2RS2A 2KFYA 1SJ4P 1WG1A 2EK1A 2HYIB 1WG4A 1VBXA 2MZSA 3CCMS 2MMYA 1B7FA 1YJWS 1M1KT 1X4GA 2V94A 2KRRA 3NS6A 3VAHA 2SXLA 1RK8A 2PEHA 1WG5A 2KG1A 3G8TA 1QVGR 3LPYA 4C4WA 5DDPC 3SDEA 1JJ2R 3G9CA 4UY8T 1F9FA 1U1QA 1FO1A 1NO8A 4WIIA 3OW2R 5IM0A 2MB0B 3MUMP 4CQ1A 5HL7Q 4M5DB 3RW6A 5LJ3Y 2G0CA 2DNKA 2CPJA 3U1LA 2CJKA 1U1LA 1VQ8S 2A3JA 2U1AA 2LA4A 5LSOA 1AUDA 2OIHA 2KM8B 1U6BA 2ADBA 1DZ5A 5EN1A 3MD3A 1VBZA 3IWNC 2I38A 2DNYA 4TLQA 2L41A 1YI2S 2CQ3A 4PR6A 4OZ1A 3S01A 1N88A 1D8ZA 5D77A 2MZQA 3VAIA 2YTCA 2NZ4A 4WKRA 5LSLA 3TYTA 3K0JA 5IFMA 3JB9k 1KC8T 4W92B 1VQ9S 2CQDA 3DLLQ 1YITS 1OPIA 2CQ2A 2RS8A 3CCES 4F26A 2BOPA 4WFBQ 1UW4A 3UCZP 5FJ4A 2DNNA 3TO8A 1VC6A 5HO4A 2K3KA 3VAGA 2CPIA 1R8HA 3HI9A 3P3DA 5H1SV 2FC9A 1U1RA 1WTBA 3I56S 2MY8A 2DO4A 2CPFA 5GVQA 2FHOB 5GMKa 2ZJPQ 5DDRC 4WFAQ 1WHXA 3EX7B 2DK2A 1CVJA 2DHAA 4EGLA 1K8AT 2KXFA 2G4BA 2DO0A 2D9PA 4QQBA 2RT3A 3L3CA 1YTYA 1WHWA 3CCSS 1U6FA 2LECA 1X5OA 2DH8A 2OTJS 1M5VC 1WELA 2J76E 4PKDB 4WFNQ 1KOOA 2MHNA 1WWHA 2HGMA 1YJNS 2XNQA 1PGZA 2MQLA 3MUVP 2GHPA 1U1MA 3CMES 5DM7Q 3I55S 4C7QA 1WHYA 3PIOQ 4ED5A 3P49B 2RU3A 1HD1A 1SXLA 4LIRA 2KI2A 2DNGA 3G8SA 2DHXA 2F3JA 4U67Q 1FXLA 3VAKA 2MPUA 2M7SA 5GAGU 4CH0S 2RNEA 2BZ2A 3G6ES 3RW7A 2MXYA 2DGVA 3D2WA 1VQMS 1WI6A 2YKAA 1M5OC 1U1OA 3CC4S 3CC7S 1ZZFA 2E44A 2JVRA 3LQVA 1A9NB 1WHVA 4IOCQ 3NNAA 2MQQA 1NU4A 2XSFA 1VQNS 2RQ4A 3S6EA 3V4MA 1DHMA 2M9KA 3BS9A 1A7GE 2KH9A 2J0SD 3G71S 2KXHA 2CPEA 2DNQA 3UWTA 1FJCA 1H2UX 1S72S 2ZJQQ 2CQ4A 1VQOS 1K73T 2E5HA 2GO9A 1JMTA 4QPTA 2MZ1A 2M70A 1X5PA 2ERRA 2XS7A 3CUNA 2DNMA 1H6KX 2LEAA 2VOPA 2LXUA 1WF2A 1X5TA 5JVHQ 1VC0A 2YH0A 2E5IA 2DGTA 4YUDA 1X4DA 2LA6A 4LMZA 1FJ7A 2DH7A 2DIVA 2D9OA 2JVOA 2RUGA 2DGUA 3J7YU 1X4AA 2B0GA 2CQ0A 4QU6A 1OIAA 2MY7A 3P6YC 3UE2A 4WF9Q 2KG0A 2JX2A 2DITA 4Z2XA 4C0OC 1SJQA 3BEGB 4WCEQ 3MUTP 2DGOA 2CQBA 4RU2A 2KHCA 3DXBA 1VC5A 4W90B 2UP1A 2ZJRQ 2DGWA 2M0GB 1WEXA 2CPDA 5JVGQ 2KT5A 1SJRA 3VAJA 1N8RT 1VQKS 2QFJA 1WI8A 3MXHP 4J5OA 2DHSA 1QM9A 3MDFA 2MGZB 2X1AA 3CCRS 2M88A 3S8SA 3NNCA 3P5TL 1M90T 2QA4S 2KM8C 2AYMA 2MKSA 2CQCA 4FXVA 2F9DA 3UCGA 2J8AA 4ERDA 2J0QD 1FJEB 2MKKA 2FPHX 4IOAQ 2DNPA 5GAHU 1H2TZ 1ZZNA 1Q7YT 3FEXB 2JRSA 2N3OA 1VQLS 2MQPA 1VQPS 2HZCA 1VQ7S 5LXYA 2LEBA 2DNOA 1N52B 1K9MT 2X1GA 1O0PA 2KYXA 1JJ4A 2LQ5A 3CCJS 4V19X 1U1PA 2MKIA 2CPHA 1ZH5A 3EGZA 2AYBA 1VQ6S 2YWKA 2CQ1A 2PE8A 2MZJA 1UP1A 5ITHA 2HGNA 5LXRA 1Q82T 1SJFA 3J7ZT 3CCLS 2XNRA 2DNHA 1X4HA 1FHTA 4QU7A 2N82B 3ZZZA 1X4BA 1XN9A 2CQPA 3SMZA 4TU8A 3EGNA 3H2UB 5MLCV 1QVFR 1IQTA 2MZRA 3NNHA 1R8PA 3VAMA 3R1LA 1DBDA 1U1NA 2HVZA 2MGZA 3G96A 3US5A 3NS5A 5CA5A 1KOHA 1M5PC 2EVZA 2XS2A 3CXCR 1P1TA 1L3KA 4F02A 3BO2A 1RKJA 1U1KA 1VQ5S
chains in the Genus database with same CATH superfamily
9ATCB 3IWLA 3A3NB 2QA1A 4YB1P 4OYXA 2FHKA 1VQ4S 5LJ5Y 3B4DA 3QIPB 2ZBRA 5L1JA 4RPFA 3SEOA 2N3LA 2K1RA 2NYHA 1FNXH 3H2VE 1S0OA 1H72C 4UUXA 2LFVA 5LMNF 1HR0J 2ZHAA 4R8UB 2OTLS 4AUKA 3N9UC 1VDHA 1HNZJ 4B3SJ 2J6UA 3J80Y 2LQJA 3CTRA 4DHVA 2XSJA 2BVZA 2RVJA 2ADCA 2E29A 1IKWB 4WE1A 2HHUA 1N5VA 4DR3J 3CIZA 3P45B 1RBLA 2UUWA 4K5RA 2IA0A 3O1LA 5A8WA 2HHVA 3FBFA 3D1HA 2XMUA 3CD0A 4NCAA 4PCQA 2V68A 3JQKA 4PWUA 1RXOB 2YNIB 2KVQE 4FBTA 4WFYA 3SCKE 3MAAB 2VBZA 4BDPA 1RTIA 2XQCA 3CDEA 3EE3A 4ZVHA 4DV4J 2HAFA 3C15A 3P96A 2DR6A 4WK3A 1Y3KA 2O01C 2PC6A 2LMIA 4MJKA 2W4PA 4C3MA 2K2PA 5CCLA 5KT3A 3UCUP 1RTZA 3B78A 4ZVUB 1K0TA 2AGPA 5FD1A 4ECUA 3PM9A 3DLGA 4F0MA 2GJIA 3DHWC 3U1NA 1FF2A 1CJUB 2YKNB 3KWMA 3D66A 2Z0GA 3TOQA 2HRTA 4CM2A 3NGKA 4LF2A 2YNFA 3EVOA 1UFKA 3TQEA 3DOMA 4ZS6A 3IAS9 4ECVA 2WOMA 2QLJB 4TYBA 3LA0A 2K7KA 4B9MA 4FPRA 2I38A 4MH8A 4DU7A 2LXFA 2W4DA 2YTCA 2F5GA 2MQ8A 4W92B 4NLYA 3DLEB 4H4KA 5D0EA 3D67A 4IFYB 5L39A 4K7QA 3UR3C 3D9BA 1PG5B 2L9DA 4CYUB 4EGLA 2WHOA 2AJ4A 2X3GA 2W2PP 4U7CA 1HNVB 4AYBD 1VLOA 4ATNA 3HD2A 1JLGB 4QR2A 3SCIE 4ZVPB 4CNZA 4MMOA 3WX8A 4B3OB 4RUBA 4OMFG 3I55S 1FKPA 5GMDA 1RTDA 1EJ7L 2CJXB 2BX6A 2W7OA 1KHWA 4DFKA 2GMLA 5C25B 3MPVA 4USVA 4RNFA 1LOUA 3OL8A 3AT1B 1ZZFA 2CJYB 4TN2A 2BM0A 2FZCB 2VPWB 3IRXA 1XK8A 1AZSA 4OX7A 1RAOA 3T41A 2J0SD 4KBIA 2YX7A 1RCXB 4LFBJ 1JLCB 1DFDA 2UU9F 3FRZA 1DTQB 3Q89A 2RE1A 4WJBA 3CUNA 1FD8A 3G86A 1HPZB 3JSMB 2XTJP 2R7WA 2HNYB 3IWXA 2O1PA 3IAM9 4HT7A 4C9DA 2P9GA 1PBUA 1BQNB 2DGUA 1Q8KA 2ASYA 1J5OA 3NL0A 3TX0A 3BPSP 1OIAA 4DDFA 4X4SA 1TMMA 2ZNZA 1R8AA 4WCEQ 5HMZA 4RU2A 1NZ8A 2KHCA 3QLHA 5JVGQ 1P9YA 1N8RT 1P8GA 4NLRA 5CYQA 4FF4A 4DV7F 5I4MA 4O4RA 2YX4A 3LGHA 4C8LA 5IS2A 3MDFA 2X1AA 3CDAA 2QLXA 1XNRJ 1MWQA 3ISND 4CT8A 3BYRA 4KO0B 2RIJA 4K4VA 2DVIA 4F4AA 1ZZNA 1O51A 4O44B 4C8OA 2MQPA 4I69A 4G1QA 3AB2B 2ZH2A 4DR7F 3L7OA 2HFSA 1JXLA 1F2GA 4HT5A 3CIMA 2K1RB 1EQ0A 3AJ1A 2ACMA 5CHCB 1J27A 3ITHB 4KFBB 2VIHA 2R8JA 1I51B 1G3OA 5KT7A 3OR1A 1BQXA 2EFOA 1UEKA 2EBGA 2XSJB 5H9EJ 1JLBB 4C48A 2OPRB 1HWIA 5ETLA 1X0PA 2Y8YA 3EGWB 4WE1B 1YRXA 3RAQA 1HWLA 1WOSA 2FIUA 3H4DA 4DUZJ 3HVTB 2D74B 2L9WA 2VFUA 3CE8A 5D3GA 2BABA 5A76A 2R8GA 3OXFA 1YZ7A 1U0HA 4PG6A 2QGFB 2E5LJ 4QCLA 5K8MA 2W9CA 1FCAA 4A48A 4FBUA 4NLGA 2B5JA 4TQRA 1L5UA 4DR6F 3Q8YA 1RTIB 3IR6B 4ZA1A 3C15B 1WEYA 3QT7A 3OL7A 1NDPA 3V6DA 2KYZA 3H90A 2WVEA 3Q8VA 5DETA 5GADU 3TUIC 3CD6S 4DL2A 1PC5A 1TTHB 4A8KA 3ZZYA 2AD9A 3MD1A 1GXUA 4ZLNA 1DQAA 2ZDOA 1HQUA 3W9IA 1RADB 3SXLA 2KFZA 2NR0A 2WW4A 3OTCA 4DL5A 4PXBA 2FC8A 3THVA 2OO4A 1X9SA 5G0RA 1C0UB 1IWAA 2R7XA 3IBCB 2P2CB 5KFBA 1OY9A 3DOMB 4HR2A 4RO0A 3IM9A 2WOMB 1T9WA 2RDDA 4LBHA 4MIAA 3CJ8A 4R0EA 3HKWA 2EK1A 1EKSA 2H54B 3RBEA 1NKCA 4B3RF 3KJQB 3LGNA 2HQGA 1LK5A 2IM1A 1TL4A 3G8TA 4QIFA 4C4WA 1DY3A 1FE4A 3G9CA 2XBPA 5D8HB 4DPWA 4AQYF 4F0KA 4V1Ak 1RT7B 4CLZA 2OP5A 3KMQA 3D0HE 4ENOA 4B9LA 2OPQB 2U1AA 1NSAA 4ZN3A 3KK1B 3JYTA 1B64A 1A0OB 3EWGA 4IFVA 4OZ1A 1NNDA 2OD6A 2F7VA 3AOCA 1TKZA 1RTDB 2M3DA 1FDDA 2COLA 4NXNF 1ACMB 3TO8A 3NP5A 5HO4A 1NEEA 4K0KF 5CZVA 2B8QA 3WDOA 2CPFA 1N5SA 3MR7A 2BW2A 3PW7A 3BR8A 2IFXA 1YRTA 4OIXA 1CQNA 4WZQA 3IRXB 1URRA 4KPYA 1B99A 3HDSA 2W24A 4JI0F 2WVFA 1WELA 1AXQA 4LRBA 3BZQA 3CJKB 4AL6A 1FA0A 4J90A 1JXEA 1PYOB 2C3UA 2Z57B 1TL3A 3D7SB 3GTYX 3ZZOA 3K17A 1T05A 2DHXA 5B0CA 1NHKL 3OV7A 2PI4A 3DLJA 2FJBB 4PUOA 3PJWA 2AW0A 1TKTA 2ZH5A 1J5OB 4DR2J 4IKAA 3RW7A 4ELTA 4KR0B 1YKWA 2JVRA 2V2ZA 3J80U 2C2ZB 2XSFA 3QLHB 3EGVA 1S72S 3SFGA 2GNKA 2GO9A 1IBCB 1VISA 2MZ1A 1KVIA 4KYZA 2RHQB 2V6AA 2VOPA 1SBRA 3V6KA 2PN6A 3KMSA 4XDCA 1RWKB 3TZXA 2E1MC 2A1BA 4G1QB 4ELVA 1C4AA 1SJQA 1NK0A 3OTEA 3K5LA 3DXBA 2UP1A 4KGXB 2FD2A 2WSFC 3DI6A 2G9OA 2CJBA 3RB3A 2QFJA 4GVLA 4ZP9A 2C2EA 2V34A 1HQ2A 5HQ8A 5HSPA 3MTKA 1UWAA 4RBUA 5THWA 5L1IA 5J2NA 5KFHA 4OHWA 1DTTA 2Y3YA 3EXCX 4OV6A 1S48A 4I2QA 1IBMF 1K9MT 4MTPA 1HBOA 4GKKJ 4K2XA 1RWPB 4OL8A 3W62A 4YY3J 2I5JB 5ITHA 1SC4B 3KHHA 3E01A 3AD8C 1EKRA 1SJFA 5FLXY 5A8RA 4UOCA 1KVKA 5D3GB 3A12A 1CJVB 2UUTA 2UUCF 4JV1A 4JB8B 4U7UD 4ED4A 1RKJA 3PEJA 3D0GE 4Z37A 5T7LA 2BUNA 2LCWA 4KGMA 4QJVA 3JQMA 2HK2A 4ZPAA 4DV6F 4I6AA 1S76D 1Y4ZB 2A2DA 2I2YA 1IR2A 4PXCA 2BXJA 3TAQA 1OQ3A 5AJ3J 3T5KA 2JWNA 5F8MA 3W5ZA 2Y1IA 1GQEA 4PQUA 2JSXA 4RNHA 1ZOTA 2KVIA 2HBZB 5BJRA 2QEXS 4JBCA 3J81Y 5HMWA 3BKFA 3MEDA 4RZRA 3I0SB 2CQGA 1XQIA 2DRBA 5D78A 1FJGJ 1ZAVA 2U2FA 4OI3A 1BXNA 4EEYA 4FXDA 1FT8A 1W26A 5L46A 3ISNC 4Y2AA 2AP6A 2XB2D 2LXIA 2VG5B 5GAEU 1LXNA 1VHFA 1VBYA 5G0RB 4RUAA 2V9KA 2YNGB 2IVYA 2Y1JA 2DNLA 3HT0A 4CWBA 2GVZA 2XYHB 2IJFA 1HBNA 2D3UA 3L9ZA 1RT3A 1SKWA 2E5GA 3SSSA 5A6WA 3QJLA 3B6BA 4IUFA 4MKVA 4DV5F 3PEHA 4JI2F 3KLHA 2OSQA 4C8MA 4ZVTB 3HT3A 5CXTA 1YBAA 2X7IA 2CQHA 1SL0A 1VR6A 4IO9Q 3FEYB 2BJ1A 5B0FA 3R1HA 1KD1T 1VI7A 4IR1A 4DMZA 1VQYA 2EFVA 2LLZA 4IRKA 2QIFA 3R6LB 4KKOA 9RUBA 3JYTB 3GP9A 1MW7A 3I4PA 3NKYA 1WG4A 4WK1A 1RAFB 2YNHB 4IFVB 4TLRA 4URGA 1HW8A 4ZCKA 4DR1F 4URQU 1TVRB 3QRPA 4LR8A 2F4VF 3HJFA 4NXMF 3AAWB 4IH6A 3GJSB 1IJFB 1P9QC 5HP1B 4JV2A 1HNWF 4YR2A 2ZH9A 2Z8QA 1VBZA 4Q0BB 4LSNA 2AHOB 1OPZA 1EZZB 2IVFB 3D6HB 1N88A 2MLYA 4DZ6A 2CJAA 3DFEA 1TL3B 5IFMA 1K1SA 2PD1A 4CLWA 2BOPA 4PUOB 2QJ3A 1RWNB 4DR4F 4N8OA 4K4YA 1WTBA 3PX6A 3Q0AA 1N0UA 2KXFA 2G4BA 3EICA 4QQBA 3L3CA 1U6FA 3RR8A 2OTJS 4HL9A 4I2PB 3MWBA 1VJQA 2LQ9A 3Q83A 4EBEA 1QY7A 3JAMY 2GGPA 3TZZA 4JI5J 1WTFA 4OZJA 3OFEA 1FX2A 3BGOP 4LIRA 1Y3JA 2F3JA 2H5EA 2H5IB 2FVSA 2PSZA 4QYZJ 3K5MA 3BSOA 4NWBA 1HYSB 4CLYA 2DGVA 3D2WA 4OI2A 2E44A 2BMBA 3MCSA 4IOCQ 1EIYB 2MQQA 1VQNS 4X66J 2KXHA 3A8JA 5HI7A 2ERRA 2XS7A 1JX4A 2R7RA 1C1CA 4QWAA 2VG6A 5J2NB 1LXJA 1V5IB 4DV2J 4PPZA 5I3QA 2AQ4A 1DTTB 3PVXA 3UFCX 3W5YA 4LVOP 3OHAA 2HVIA 3UN5A 2DIVA 2RUGA 4EFAC 4QU6A 2FVPA 2JX2A 1YQHA 1TMJA 3MCNA 2W2QP 2HS4A 3G2XA 2J8SA 4DX5A 2A6MA 3E01B 5A8RB 4JYAJ 3C19A 1C4CA 2R42A 4DL0C 5BR8F 4EYHB 4ILMA 2BE2A 3M2VB 1RHUB 2FYXA 2QLFB 2HHSA 3H5UA 3NWGA 2WB4A 2CA9A 4HI1A 4PG8A 1T9XA 2BJ8A 2GAGC 4NLOA 2CPHA 4EUVA 1JB0C 1VQ6S 1RT4B 4U8VA 2CQ1A 3MM5A 2XI2A 2ZNYA 1XN9A 4LBIA 1WSVA 4ANEA 2ZH8A 5J1EB 4ZIVA 3V6HA 1FWKA 2MGZA 4RL1A 3MEDB 5U47A 3BN7A 4EBDA 2BJ7A 1FFGB 3OQ2A 8ATCB 1CULA 3M4XA 4OHVA 2EFPA 3DLBA 4FF2A 3S1TA 4WWSA 2Y1RI 2FJEB 1JJHA 3DDNA 1JNRB 3THTA 4ZPTR 1EX8A 1LV5A 1K0VA 3NS7B 1Q8BA 4L3NA 3TAPA 4I0WA 1FTCA 1HBNB 4DQPA 1S9GA 2CXEA 4RW7A 2L48A 1OWXA 2EKNA 1PYTA 3KLHB 2CIMA 2E1PA 2ZH1A 1ZETA 1R89A 3VAFA 1N4LA 1YJRA 3PX0A 3Q86A 3PDNA 3V6JA 3T1AA 2NPIA 4N56A 4DEZA 1QE1A 1YK9A 5EWGA 1Y0HA 3MPDA 5F8IA 1M1HA 2V8VA 5C42A 3AXMA 2MZTA 2FB0A 3AHPA 3OPKA 1JKHB 2KZMA 3HSDA 1IQZA 2XS5A 4UOGA 4TU7A 2QG9B 2VUGA 3MI7X 4KKOB 1HR0F 1IM4A 5DDOC 4RLEA 4CLUA 3NCRA 2V4QA 2KN4A 4QIVA 4ZJOA 3TVZA 3B8HA 3GFXA 2MSTA 5DGBA 3BSNA 1QTMA 1HNZF 3F44A 2P5VA 5IWAF 1XR5A 1H2VZ 1RAEB 1ZTTA 2GV1A 3LOUA 3R9LA 3B4MA 5IT4A 3S7RA 4MYUA 4MIBA 4USMA 1KDNA 2BEFA 2MLZA 4D3HA 4DUYJ 2MQOA 1UVLA 1A6LA 4PQAA 4N41A 1YWXA 2KTQA 4OI6A 5KT5A 2GC8A 3OTOF 5CAAA 4N7TA 4K4UA 3EZUA 1NRKA 1RISA 3ZTRA 4HTIA 1WJ9A 1EHWA 2XI3A 5H9FJ 1D9DA 3OFHA 1H7WA 4DPUA 3G8QA 4DV4F 1UJ6A 1WG5A 3BJYA 3QJJA 4QR0A 3LANA 4ED6A 3MEKA 1U1QA 4GKJJ 3H5YA 5KFIA 5DG7A 2LA4A 4C11B 5DJBA 1CEZA 4PWWA 1H3DA 2A10A 1U6BA 2OPPB 5D15A 4OZ3A 2EXUA 3PY8A 1QAYA 4WKRA 5LSLA 5J2PA 4DFPA 5T41A 4TY8B 1JLFA 5FLXU 3C16A 1QAJA 2B8PA 1RJJA 1UZHA 3R7NB 3QAEA 1S1VA 5IV4A 1HQEA 4F2SA 2I0XA 4M5DA 4ZHRB 1I94F 3CCSS 4Y65A 3EPGA 4WFNQ 1FRIA 3GPAA 1NB7A 1PGZA 2MQLA 1VGYA 4L75A 3GQCA 3J81j 4NX9A 3AQPA 2HNDA 5KOWA 3DLHA 2V8PA 1LFPA 3J81U 2HLTA 1ZM3A 1U26A 3T3FA 1RTJA 5ETVA 2IBKA 1JJCB 1A9NB 4OFZA 1RBOB 2BBEA 3QO9B 3G71S 1BWEA 4IG3B 2DNQA 4NPOA 1FJCA 1P1LA 1IWGA 2M70A 1K44A 2QSFA 1H6KX 2N7YA 5M2UA 4LF5F 5JVHQ 5KFKA 1W25A 1MU2A 4HHJA 1UWBA 4PAAA 1JLQB 4FS2A 3J7YU 2ASDA 1OYDA 3M2UA 4XPEA 3UE2A 2KG0A 2DITA 4Z2XA 3N01A 1IXKA 3H4BA 3TZYA 2DGOA 3MM5B 1RWVB 1E6YA 1WEXA 1T9YA 4ETXA 2HQFA 4P7VA 1B0VA 2JZ5A 4JV0A 2WAQD 2OGUA 3BKUA 1QM9A 2MGZB 3Q23A 3C6UA 1MN9A 4RX6A 4L76A 3JSBA 5K9FA 2KFNA 1CULB 4HHHA 2CQCA 2IM2A 4ES3A 4A8FA 2AJ2A 2HHPA 2DNPA 3NGUA 2HZCA 1TZ0A 2DNOA 3BH7B 1O0PA 2LQ5A 2DT9A 3H7HB 1CJTB 1RBAA 3CJ0A 4R5PA 4OLPA 1S9GB 2XWXA 2XCAA 4DSFA 1R0AB 2H4WB 2AEMA 3NNHA 1R8PA 3PJXA 3G96A 2CYYA 3US5A 4ICLA 4OQJA 4HTJA 1XNRF 1KOHA 3F41A 2DCUB 1XJWB 1S97A 5B08A 4X4UA 1IKYA 2P6TA 3NBPB 4Y2MA 2B9XA 3FEZA 2DXFA 1BD6A 1VMBA 2GIQA 4YB6A 2BW7A 4DX7A 5ETPA 3DRXA 3MMAA 2EI5A 1NJXA 4KQZA 2B7BB 3TJ8A 4F04B 3VALA 4FYWB 3ZTOA 3LGMA 3M1VB 5F0UA 4YDDB 1WOPA 1M0SA 1T9VA 4WKYA 2D41A 1M1GA 2GQQA 4OX9J 5EHHA 2V2VA 4MKAA 2J0WA 4OJ3A 1N32J 2CZVC 2JLGA 4EYIB 1T8EA 1HHSA 3OSNA 2O67A 4DN9A 2G13A 4XPCA 1OO0B 2F8MA 4OJGA 3NLCA 2X51A 4DUZF 3KHLA 4Y00A 5KG0A 1S6OA 4KGVB 2MTLA 2QO3A 2XWYA 5HATA 4P9SA 2ZM6F 5DG9A 1PAUB 2UVUA 3B82A 1UVNA 2DIUA 2V2QA 2Q1LA 1EP4A 4M63A 2XM3A 1VYAA 4L6V3 3ZC4A 3DOKA 4GMKA 2VODA 3RUBL 1PAEX 2XO7A 3BM7A 4K4TA 5ETKA 2QN6B 5ETNA 3DGPA 2X1FA 1XNQJ 5KT4A 4F4WA 4PWDA 2ABYA 2MQMA 4G6VB 2EC0A 3MR2A 4ZPVR 3AD9C 3VV2B 2IDEA 1M1KT 2W9AA 3JSYA 1FEEA 3OL6A 1GK8A 4KHMA 1JLFB 4NCBA 2H5JB 3C16B 4USJC 1ITPA 2VQEF 5F0WA 4RNNA 1OMSA 3TEGA 3K58A 1F2HA 2YKPA 2XLIA 2YKMA 4M5DB 4XDDA 1U47A 3J7Z5 3QFWA 3CVKA 2VDIA 3BGUA 2GS8A 3V81B 4WPAA 3T1HJ 2ZZMA 4CT9A 1HBMA 2HNDB 2EC2A 3G87A 1OSCA 1U09A 2YY3A 3MMBA 4RW6B 1VOMA 3HI9A 5KFUA 3ENQA 2FQQB 1L3TA 3LPEA 1T0TV 5I3PA 5EUHA 5GMKa 4C97A 4WFAQ 1RTJB 4HHUA 4DCPB 4D3GA 4X65F 2CNKB 4DOZA 1WHWA 2H51B 2V4RA 2HNZB 5K8NA 2QLWA 2UXBJ 4QWDA 2BJDA 4DCOB 1FVQA 3GMGA 1QAXA 4ED5A 2VASA 4U67Q 4HDGA 4OYOA 4LF7J 5K8OA 2QYGA 4O3SA 3M2UB 3CD7A 4DV3J 1IN0A 1UEUA 2R8KA 1U1OA 3QFHA 3HFKA 2C1EB 3BSCA 3MMCA 3HM9A 1T9TA 3R3TA 1TAUA 1NK5A 2KH9A 5KG6A 3NGSA 2CWKA 1H2UX 4AD6A 1FDAA 2OMOA 2QT7A 3VR1A 2FHJA 2AZ1A 3T9NA 4ETZA 2DNMA 4WP9A 4EK2A 3NEKA 1NDKA 2HQIA 1T03B 3ILJA 1FJ7A 2DH7A 2XYPB 3FFIA 3WBZA 1NSPA 3TWZA 4LQ3A 1UVIA 1VRQC 2ZJRQ 4DL3A 3VAJA 2F4FA 4FNHA 2B9EA 3FCHA 2RQKA 5ETRA 2AX0A 1S77D 1F6TA 2PA8D 4ICLB 3M9NB 1Z2LA 2XMKA 1Q8LA 3X3UA 2H4YB 1U4BA 1LW0A 3HF5A 4OLOA 2MKKA 2PO4A 1KSPA 2UVVA 3VCDA 4NMLA 2JRSA 3RBDA 1FVSA 5C5JA 5I3UA 2LEBA 3PYEA 1UVKA 4V19J 3GLJA 1G4CA 1RA6A 2PEBA 1VBKA 2R8IA 1UKUA 5AXMA 1FEHA 3Q8RB 3TUJC 3H2UB 3R5DA 5EDWA 4IDKB 3R1LA 3PFOA 3A13A 3M32A 4H4MA 4RWWA 2GAHC 2HG4A 1KP6A 3LP2A 1U6ZA 3GG1A 1TQLA 3VGUA 4XK8C 5J1PA 4GKKF 3MAQA 1FX4A 4U8YA 2CNLB 4XIUA 2DXDA 1F3FA 1AFIA 4JI8J 3ZZUA 3SI8A 2CAJA 1F9HA 4DQQA 2UUAF 2HKEA 2VBXA 4DF8A 4ZKAA 4EWTA 4KRWA 3BO4A 3W8GA 2BJ9A 3EMTA 3CCQS 5DGAA 1EP4B 2UV8A 3T9ZA 3VF0B 1S4FA 5EWEA 4JV5F 1FRKA 2E5JA 2DNZA 3SBMA 3TW0A 3RGIA 2J7WA 4PWDB 4BHQA 3BBBA 2WBRA 1GFWB 3PKMA 2M8HA 3CCVS 2O3DA 3CJQA 4U7UK 5A0YA 4OZ2A 3FC9A 1YJTA 2OD4A 3CPWR 2RRBA 4ECRA 5RUBA 3IO1A 3O8WA 3L7PA 2HZVA 1N5TA 2ASLA 2QYCA 3LO3A 4HDHA 2BANA 5D4NA 2QC3A 4F25A 4FNIA 1AT1B 3BBFA 3CJ3A 2DHHA 5CD4A 4C8YA 3HZGA 4A8YA 4ZP7A 2V0NA 4I6WA 1GH8A 1WACA 1VHIA 3M30B 1RUSA 1UETA 1KLMA 4X4VA 1T95A 2W2NP 1TL5A 4EO6A 4KT0C 1HBMB 4J9PA 2LEPA 3BV8A 4NL5A 2EFNA 1R7IA 2PEHA 4TKTA 1QVGR 3AOAA 3KDNA 1UPPA 1RHMB 1FO1A 2A6OA 5IQ6A 3A3OB 1Z1ZA 2RDJA 2CWXA 1BMQB 4X4QA 2B4PA 3PZPA 1QSYA 2IAJA 2DPJA 5DLGA 3AY0A 1Z4UA 4AL7A 4URSA 3WIVA 2XMTA 5A2QU 4UUWA 3OVSA 5FJ4A 2HFOA 1TKXB 2K3KA 2ZBQA 3J7AN 4G65A 5IC6B 2XMAA 3GWCA 2G0JA 5E2QA 3TX8A 4J9SA 4DPOA 3MMCB 1RGVA 2V63A 5GADI 3FUYA 4NLUA 1S1TA 4GRSA 4LF6J 3POTA 5EX0A 2B7CB 5L1LA 3TA0A 3DXSX 2YWFA 2ZVSA 3VTIA 2UV8G 2HEKA 5IT0A 3BBCA 3ONQA 3NXZA 5KFJA 2PMZD 3GJQB 1H38A 3DLKA 5AE1A 4N8NA 1D3WA 4WYWA 3IR7B 5BYQA 1DHMA 2M9KA 1A7GE 4I4BA 4OI1A 4CNYA 2E5HA 3NY0A 1KWMA 4QPTA 4M5HA 3HSZA 3KLFA 2E9TA 3PV8A 1XMOJ 1LWFB 4FP9A 1LW0B 4YUDA 1KNZA 2VPXB 2P8IA 3TUZC 3PRVA 4PXEA 3P6YC 5I3UB 4GC6A 4A8WA 2HRYA 2DRAA 4ER8A 5LMUJ 3AD7C 3HHLB 5B0DA 3W1YC 3DNCA 1FNMA 4C0BA 3K5NA 5ETQA 4LR9A 4H4OA 1N36J 1TKDA 1Y10A 4XTTA 4RNOA 4QPXA 4Y2CA 2FLNA 4I56A 3LP0A 4M95A 8AT1B 1RT1B 2Z2ZA 5BYRA 2AYMA 2MKSA 3K2YA 1CLFA 4ZCLA 3N79A 3LP2B 2C22A 4I7FB 4IOAQ 1CJKA 2CJQA 1PSDA 3K8VA 2DEJA 3DM2B 1T02A 1E6VA 1B0PA 2XHCA 3EGZA 1VCTA 3R8YA 3WX4A 3IXQA 2CDQA 2IM3A 3ZZRA 5IZHA 3OFFA 4Q7AA 1NMEB 1YZ6A 3LW5C 4Q8EA 1U1NA 4K8RA 5CA5A 4YB5A 4FF1A 3PR4A 4OZLA 1PCAA 2GJFA 2LKZA 5ETMA 2QZ8A 1FE0A 3UNGC 3VWSA 2C2MB 2OKQA 3G82B 4U95A 3TJ9A 2DH9A 2KXNB 2BM1A 5HAOA 4X4PA 5C24B 2RUSA 3VGVA 3DRSB 5EWFA 3QGHA 4ZCIA 2FJXA 2D1CA 2ZHOA 1VQSA 3AOBA 3OR2A 2BDPA 2D3OR 3RB6A 2W9BA 4K50A 5DQHA 2AEJA 4USHA 2HURA 1XC9A 3VZIA 3H25A 5E3CA 1CS4B 1MN7A 1BUXA 1JNZB 3MHYA 4DPYA 5IQQA 1Q1KA 3AB4B 3BDPA 2O5DA 2CPZA 1TELA 1YJ9S 2RRAA 1IM6A 3N5FA 4HACB 4DV1J 2KRBA 2ZDPA 3AH6A 4NI2B 2MLXA 4OYZA 1W2IA 5E0OA 1WD6A 3PIPQ 4ZVEA 1X4FA 2MKYA 1URNA 1KLMB 1MLAA 4ZVFA 3TVKA 1MG7A 2R2RA 3RG6A 3OD2A 2XZTB 4Y2KA 1YJVA 4ZPWR 1RACB 1RT2A 3M6XA 4B9SA 4JOUA 5F3TA 5LMNJ 1S0VA 4BCAA 3M9OB 5DM6Q 3X1LB 1REGX 1RT6B 3KJFB 3FGVA 2HVEA 1H0HB 3KDOA 3EDRB 2JHEA 5L9NA 4KH0B 4ID8A 3G6YA 3O6QA 1UL3A 3AFGA 2IAJB 4CO5A 4WU3A 4U6PA 1B7FA 1YJWS 4ZN1A 1S0NA 4M1KA 2FLPA 1YGYA 4ILLA 3LAKA 2HAIA 2G2YA 2KG1A 4ZVRB 1KN6A 4OZ5A 2FVRA 4KHRA 3QZ7A 4ZOSA 3I9ZA 3U1LA 3I4HX 1S1TB 3ET6B 1RU2A 3GZ7A 2QX0A 1RT5A 2VFTA 2ZKTA 2QE5A 1D8ZA 5LSRA 2NZ4A 1KC8T 4A8MP 2E1CA 3GSIA 1SH0A 5GAEI 1YBTA 1IVZA 4F3OA 5IC4B 3P3DA 3PW0A 4FYDA 3K5OA 2XCPA 2NYIA 4LQ9A 3DLKB 2Y1LB 3V4IA 2Z2YB 1X60A 4GKJF 1FESA 4Q2LA 1WC0A 5A8KA 3N0VA 2LECA 2DH8A 1R8BA 7FD1A 3I87A 2J9DA 1IKXB 1XR6A 3M8SA 2KO1A 4WU2A 1GEHA 3MEGA 4C7QA 3R5BA 2ILYA 3CJ5A 2DNGA 4FPIA 1JLAB 1RAIB 1N33F 5GAGU 2ZHBA 2YWGA 3QZ8A 3KHRA 4MK7A 3KG1A 1FRJA 4X64F 2E9ZA 1HKAA 3CDWA 4RW4B 1YJUA 1WHVA 1AUSL 3NNAA 1IR1A 2BACA 1UA0A 1HFEL 1L3UA 4H4OB 4RUCA 3R7BB 1WC3A 2GQCA 3DCAA 2HZAA 1FFWB 4O0NA 1REVB 1WNEA 3QSIA 4DN0A 1SIWB 3K7RA 3NGTA 2ZZNA 3PXGa 1N6QB 4ED2A 3I0RA 2D9OA 1CJKB 2CQ0A 3FK4A 1HNIA 3D6TB 4EZ6A 4YHHJ 1DURA 3OJSA 3GFYA 1RU1A 3VGSA 1PKUA 5CH7B 1TK8A 2KT5A 1VQKS 5B0BA 3TI0A 3GIJA 5D0HA 3A1YG 4J5OA 1WC6A 4CLSA 1SV5A 3TA2A 2PGCA 1KTVA 5F8NA 1BQMA 2OFGX 3FZ2A 3HSJA 5KFQA 2ZH6A 2AEFA 3DOLA 2YWKA 3FVYA 1UP1A 1S4EA 2CQPA 1QVFR 1MWZA 2HK3A 2EVZA 4F02A 4WXOA 3BGRA 3OSPA 3OR2B 2V4JA 2XMWA 2QL9B 5KFZA 1SB6A 4DV7J 2IA6A 3MMJA 2NXNA 1D9AA 1VLYA 5KFRA 3GB0A 3RR7A 2E1RA 2LDYA 3DRRA 4X62J 1HARA 2MKJA 3MPYA 2PT0A 1S79A 2MYFA 4I1TA 2CPYA 3HP6A 1HMVA 3DKDA 4B9UA 2VA3A 3FSIA 3Q2TC 2MSSA 4DR7J 3W61A 1LWCB 1D9FA 3KFWX 5DS7A 1DAXA 1Q81T 1RT2B 3E2EA 3EUNA 4ID5B 4P6QA 4QIWD 2GFFA 4G1PA 1WDDA 5A6PA 1TP7A 3KXDA 4DWIA 4X4RA 2MKHA 3MM8A 3BQ2A 2B56A 5E3PA 1HI1A 2NLWA 3DDKA 2JJ4D 4MFBA 4NZ6A 1UMJA 5CQGA 4OX9F 1X4CA 3HVAA 2QRRA 3PW2A 2W7AA 3QYYA 3EDQB 4LBPA 4FN5A 1N32F 2YQ0A 2BOAA 4F4XA 1X4EA 1TR0A 1NK6A 3N6NA 3N5BA 3KLEA 1HWKA 2K7JA 2VG7B 2DB1A 3A8KA 3HMJG 1KKHA 4YEAA 2X1BA 2JFKA 1N34J 5KG4A 3U27A 1SKRA 1VBXA 1SUQA 2E9RX 4C3LA 2HHQA 5H9EK 2NXEA 3D6MB 2D3ZA 3GG0A 3EPIA 2YXLA 2HS3A 3V4IB 1JJ2R 2IM0A 4WIIA 1XNQF 3MUMP 3FZBA 3GIKA 1WDTA 3M7VA 1MROA 3BKTA 1FFSB 2BRKA 4DV0F 3QPIA 4BBYA 2N4DA 2Z58B 2OIHA 4J91A 3KLIA 5EN1A 1YJ7A 2DNYA 3SQGA 4DSKA 3MGJA 4Y34A 5D77A 3VAIA 3GONA 2VU5A 3RBZA 4FF3A 2WONA 1U1RA 3UDCA 2MY8A 2DO4A 4ZVSB 1H74A 3K57A 3A8IA 2RILA 4A8SA 3E51A 4ECYA 4E2FB 2GZOA 2NXCA 3ILOA 1IKVA 1T94A 1M5VC 1U24A 3H98A 2MHNA 2VFRA 4FYXB 2GO8A 3M8QA 4Q45A 3T1HF 2F8HA 4BWJA 4RBTA 2DCLA 3GU0A 3TEHB 2WSCC 2Q3PA 2UUBJ 4MK9A 3UNYA 1WI6A 2YKAA 1SH3A 2LU1A 2UXCF 1JIHA 5LT5A 2JFDA 3SFUA 2XEXA 1D1UA 3HVRA 4P75A 4NXNJ 3PRBA 2B4OA 2UXBF 4IQMA 4ES2A 4KHPF 2A0FB 1X5PA 2WBMA 1SV5B 2LXUA 1AW0A 5L1KA 5HLFA 3ZTPA 1V3RA 2DGTA 5A8WB 1X4AA 1BQMB 4ZCMA 4RJVA 4DSJA 4WF9Q 1T9UA 1YG0A 5G4DA 3DOLB 2FY8A 2H65B 1TL1A 5M2RA 3I6PA 1UCNA 1XR7A 2ZBIA 3GYNA 2KM8C 3MFIA 6AT1B 3SSRA 3DYAA 3MZIA 2N3OA 4QW8A 3PACA 3MOZA 4DR5F 3DLGB 2EBEA 3IBFB 1UJ4A 1FKOA 4O3PA 4XO0A 3LUYA 4F4KA 2J6SA 1HMVB 1Y5LB 3O5TB 2AZ3A 5DRKA 2YNFB 4IH7A 1T7PA 2XZDB 3IG1A 3UQSA 1RCOB 4J9RA 3BO2A 2YBVA 3ZZTA 4ED1A 4F0HA 2YVSA 4LFAJ 2DKOB 2KU7A 4BWMA 3UR0A 4BS2A 1JK9B 1RWWB 1Y11A 3EM1A 4N76A 1HWJA 1DLOA 3MM8B 2HQ3A 1K1QA 1S6PA 5DZ7A 2QV6A 2LYVA 1SJ3P 1TUVA 3OTBA 4MFBB 2J7UA 3QAUA 2R2SA 4DBQA 1Y00A 2IY5B 1G2EA 1NAQA 1ZS6A 2J7KA 4A8XA 3TAMA 1VIOA 4YS2A 1EQMA 1MMDA 4M8LA 5KFAA 4RR5A 2MEWA 1OY8A 3C8YA 4P2MA 2R4FA 3MFHA 3J7YI 2DISA 4MT1A 5KG3A 1I1GA 1RWOB 1S6QA 1CSJA 1SQFA 2IRYA 3KLEB 1FKPB 2F8EX 3CF5Q 3E3XA 1N54B 4FS1A 4IO1A 4RU9A 2C2DA 1NCLA 1WF0A 4F4YA 3FMBA 2W2OP 5EGYA 2AJ0A 2UXDF 3QWPA 1C1BA 2VFVA 4ALZA 1AZSB 2DY1A 4JI7J 4CH1A 1UFLA 2IYGA 2YH1A 1AB8A 3HFVA 4NYZA 4CO1A 2JOQA 2RQMA 3N28A 1ZYQA 2AJ1A 2HSEB 4Y3CA 4EI2A 2J5AA 3KNGA 2LP4A 1CQMA 2F1FA 2HQCA 3M9MB 1ELOA 3SQGB 3UDLA 4H54A 1Q53A 2MZSA 1Y5IB 4EU0A 3A3PB 2G0IA 2KRRA 2JH3A 5CYQB 4LUBA 4CZCA 3A8EA 2G2OA 3LPYA 1PC4A 1XMQF 3GR1A 1WC4A 2B4UA 1R8CA 3I96A 1LNQA 2DBBA 4USWA 5ETTA 2LQ8A 1SCJB 2CKWA 3RB0A 5LSOA 3HVWA 5AE3A 1S1XA 3JSRA 3MD3A 1PYSB 1NZAA 4QIEA 3AA8A 3QIPA 4C98A 3FMWA 3VZHA 5F41A 3JB9k 3B54A 3DLLQ 4OYIA 2CVIA 4WFBQ 2ZC3A 2R7SA 2Z4PA 1RAAB 2GQ2A 5H1SV 2HS0A 4DQRA 4CLTA 4B17A 2B3TB 4R8UA 3OR1B 1HW9A 2DHAA 3J7A1 1NPKA 4X4TA 2DR5A 2DO0A 4OYAA 1NK9A 4LF1A 4DR1J 1WWHA 3I5BA 4LRDA 3QQCD 4NXMJ 5HN0A 2UVWA 4PXDA 4IRCA 4QWEA 3RTVA 1SXLA 2OLWA 2PFFB 1HNWJ 1HHQA 2IBOA 1U0HB 3D28A 2CZ4A 4B3TJ 1TAQA 1JWWA 2W9CB 1WKJA 3GV7B 2I1RA 2RF2A 2B5JB 3KTQA 1MWYA 1TL1B 5KTQA 4DQSA 1UJ5A 3JQJA 4B08A 2CQ4A 3K59A 1S9FA 4Q8FA 4M5KA 2CG8A 3V6DB 2CZ9A 1SKUB 3DYAB 2E5IA 3DRYA 4M94A 4PG4A 3M6UA 2WZ1A 2YPYA 1HQUB 2CQBA 1FKOB 1VC5A 3BGFA 1LFWA 3N6MA 2NREA 2HHHF 5BYSA 2BJ3A 2CUYA 3R5CA 3P5TL 5KFCA 1R3NA 4CLPA 3CDUA 5GAHU 3C6TA 1S1UA 4A46A 4DLGA 2RD5C 2AWZA 1N52B 1JJ4A 2K06A 2KYXA 3DDIA 1RYSA 3NWRA 4QIGA 2HIYA 3DLEA 1TK5A 4IFYA 4QU7A 4PZVA 4L3KA 4WFZA 3ZZZA 2VHGA 1N36F 3SMZA 1BE4A 3QBCA 5C2GA 4UQGA 4CYUA 2B6AA 4C8ZA 3PTWA 3TAMB 5D4OA 4Y2IA 2MQNA 4QYZK 3OL9A 3ZTSA 1S6QB 2V8DA 4CIOA 4NE9C 5BR8J 4ZVGA 2XMJA 1TKZB 2HHWA 3IS9A 2E7VA 4NRTA 4WZMA 2XYGB 2ZOGA 5DDQC 5C25A 2VPYB 2VBWA 5HK4A 1T11A 1C1BB 3KUHA 4ZDNA 2DGSA 4P74A 1Y5NB 4J9UE 2W1BA 1ZM9A 2JC0A 3ILIA 3IN5A 1KFSA 2FTRA 4KSEB 2R7QA 1HPZA 2PMHA 3JSMA 2DGQA 2HNYA 4DCJB 3CC2S 1T05B 4PG7A 1YHQS 3EVMA 2DXEA 1NUEA 1F0XA 4AE5A 1NDLA 1TKTB 4K4SA 2M4MA 2DJWA 3HPOA 1NDCA 2VBYA 4J9QA 4NLXA 2D7SA 3R6GB 1DARA 2IJNA 1QSLA 1NH7A 4YR3A 4NLVA 2HMIA 2FJVA 2W8KA 4CH7A 3ILLA 1CBKA 3T1YF 5AXLA 2OSRA 3U1MA 3R2DJ 3T6JA 4JI3J 2M2BA 4KO0A 1WC5A 4CO2A 1TUWA 1S1XB 4O44A 3AODA 4KGZB 1K47A 1SKSA 3OJUA 4OZNA 4B9TA 2VB6A 1EETA 4KC5A 1X4GA 3DI6B 1V9OA 1NM2A 3AQOA 3ITHA 4KFBA 5B7WA 2OELA 4BLGA 3SV4A 4OI4A 2ALZA 4UOHA 3W66A 4UY8T 1F9FA 4F2RA 1NO8A 3ZNUA 5HL7Q 5IWAJ 2DNKA 2WTFA 2CJKA 3SZ2A 1JLBA 1U1LA 3GV5B 4FKYA 4I2QB 2OPRA 2CNNB 2AX1A 2W8LA 4FZVA 1HBOB 1XEZA 4PR6A 3QRQA 4K2JA 3BB5A 3NMAA 1IJEB 1AFJA 3HVTA 3MEEA 1UW4A 1N5QA 2BA9A 2ZJPQ 3CMQA 2ASJA 4TXSA 4HI2A 3PKYA 3OTOJ 3SCLE 2C2NA 2RF2B 2M5YA 2O66A 2E7WA 4OYMA 4NMXA 5T7LB 5D6GA 2J76E 1IR0A 2HGMA 2CVEA 3CDBA 2R2TA 5DM7Q 4JI4F 3DMJA 2RU3A 1FXLA 3VAKA 1KRPA 4PQUB 4ANCA 3G6ES 4B3MJ 3R7SB 2IC3A 3W8PA 2XY5A 1R31A 4YB7A 3LQVA 3OBIA 3D3CJ 4EBCA 1VK3A 4E98A 1YVFA 4PYAA 3S6EA 4KB7A 2CFXA 4I67A 3CWJA 4NZ7A 1HI8A 2YX1A 2ZJQQ 1Q5YA 2D69A 1C0UA 5KFVA 3GSDA 1S49A 1S10A 4NEZA 4NA1A 4KH1B 2HW3A 2GVZB 1WF2A 1MNEA 4LMZA 1RT3B 4KE5A 5H9FK 3C6TB 3TARA 1S1UB 5HBMA 1I94J 5JXSA 3SIPB 4OYPA 4Q2MA 3FKBA 3NOGA 1H98A 3O3LA 4R0JA 1NK8A 4J7CA 4LRFA 1F60B 4LRCA 4M5JA 2R9LA 3V2UC 4LFCJ 1WI8A 2DR9A 5KFPA 4IQXA 3D3BJ 4QOTA 1ZM2A 2M88A 2B6AB 3NG8A 4M5NA 4Q5VA 1RT7A 1RAHB 2OPQA 3ETOA 3JXOA 1NJYA 3KK1A 1VQ7S 4YHHF 4CO3A 4B3SF 2PE8A 3CJ2A 2J9EA 1GT8A 3IS9B 3RJMB 4LF5J 3J7ZT 1G6BA 4Y28C 2WK4A 4DR3F 4JUZA 2YWWA 4EO8A 2KL8A 3MAHA 3ENAA 4BC7A 2YKOA 3CXCR 3PW4A 1P1TA 4DX8H 1Q5VA 1F1BB 2AJFE 1U1KA 3PRDA 2HVDA 2VFSA 2ZOFA 2UVRA 3VQSA 3CJKA 4KAIA 2FY1A 4LSNB 3RZAA 4P7TA 4J9MA 4USTA 4TQSA 3KNAA 2XY7A 1QTNB 1UW9A 1Q86T 4YOEA 1F5AA 4WXWA 2N7CA 1U25A 4M5IA 4NYPA 1U8WA 1CC8A 3I5CA 4X4NA 3GIIA 1Y9OA 4ZP8A 1KTQA 1WF1A 2E66A 1RHQB 2M8DB 2HMIB 3CO0P 1X9WA 3MCMA 1X9MA 2AKWB 2GGPB 5AT1B 5KFMA 1YX2A 4X62F 4YR0A 2PA3A 5T14A 3EYZA 4A47A 5KOXA 4UF4A 4K4WA 3L09A 2HGLA 2QLBB 3K8WA 1QLNA 1PO6A 5KFDA 1EETB 3ZZPA 3CJRA 1KBRA 4HH0A 2JC1A 4ECTA 1HNXJ 3DC2A 2L08A 1WEZA 4WTOB 3TP2A 2RHSB 4RW8A 1C1CB 2VG6B 3ZFVA 1HA1A 3EXYA 1OYEA 4OHYA 4FVMA 5FDLA 4NASA 3HHNB 5C7PA 2XLKA 4DJBA 3M8ZA 3UO0A 1L3SA 1Q79A 2I5JA 3R5GA 4IG0A 3MEEB 5KT6A 4DL6A 1RHJB 1RTHA 1XMBA 1P6TA 3VVTA 1CJVA 2BKPA 1BGXT 1SI9A 3W2VA 2BE2B 1NKBA 2NZCA 1FRXA 4CTAA 3ZO7A 2ZM6J 2IMWP 3ENVA 1N34F 3ZXWA 4DQIA 2YWHA 4P52A 1FRLA 2KM8B 1B3TA 4J9VA 4TLQA 2H48B 3KG0A 3HLUA 3CD5A 3DMJB 1GMVA 1VQ9S 3KYLA 5CABA 4EMDA 1PIEA 4LFBF 4CLFA 1R8HA 3I56S 2IC3B 2FHOB 3QT5A 3EX7B 4KPCA 1RHRB 3I0SA 4K4ZA 2GIFA 4C2MA 2RSQA 4IRDA 1X5OA 2I8EA 3M6WA 1CG2A 1WOOA 2VG5A 3PYDA 1Q16B 1R0BG 2HIQA 2R2UA 1YJNS 2VQEJ 2YNGA 1OQ6A 4UY85 3LP1A 3BREA 4DG1A 4NLWA 3HCXA 3UD5A 1HD1A 2KI2A 5J2QA 2ZVIA 5HBMB 2BE7D 1SH2A 3OFGA 4RW7B 1Q4RA 3M2RA 3D54A 3NRBA 4DI6A 3ZTQA 3SV3A 2ZBPA 1NU4A 2HQDA 8RUCA 4DSIA 5KFEA 4DL4A 3IR5B 2BE9B 2N4CA 4OI0A 4MIWA 3SCJE 3W3SA 3BQ0A 1QE1B 4RUHA 1VQOS 1K73T 5JMNA 2H9ZA 5C42B 4O4GA 1SVDA 4DS5A 3F56A 2CG4A 1QD1A 1VC0A 5KFFA 1X4DA 4X65J 2HWHA 2UUBF 3M05A 3HKZD 4LF4J 2KB2A 3CJTA 4I68A 2YNHA 1SL1A 4WYLA 4FDFA 5HMYA 2JEFA 2DGWA 4DFJA 2ALYB 1OSDA 4JI6J 4U96A 3F73A 2YWEA 1NJZA 3FBCA 1TVRA 1NLKL 5D4LA 5D0GA 3JAMU 2NPFA 3R5AA 5HP1A 1VIXA 1RP5A 4ZPDA 3GV8B 2FPHX 3DRPA 3IFEA 1D09B 1VQLS 1FRMA 1VQPS 3JS9A 4DZDA 5K20B 2VJUA 4Q0BA 2E5LF 2J9CA 1ZH5A 4ZVQB 3BH6B 4E0DA 2FHMA 2DYAA 4LVNP 2XNRA 4OJ1A 1X4BA 1U48A 4NZ0A 1IQTA 4DUTA 4LIWA 1BHNA 1M5PC 1YBUA 1RLCL 1IBLJ 2GCFA 2XMMA 1HL6A 5GAGI 1YIJS 2EK6A 4I2PA 1U7LA 3H20A 3MOJB 4FXWA 3UD3P 3SYZA 3HHEA 3QGGA 1T3OA 1UPMB 2FHJD 4B9NA 5J2PB 4NLTA 5F9NA 4UOFA 1T3NA 1U45A 4J9NA 3OVBA 2MJNA 3NMRA 1NKEA 2W7PA 2OFHX 2PMWA 1S1VB 1HYSA 4P2FA 1C0TA 2GMJA 2J0XA 1HQEB 1DJ0A 2OMLA 2NUHA 2I9SA 2BQRA 3DN9A 1F5CA 2PIIA 4TVAB 4LFAF 3MECA 2RB7A 2DNRA 2VONA 4ZLJA 4LREA 3CT9A 4RW8B 4JI1J 2ACYA 3RAMA 3CGIA 1TV6A 1LEOA 2AMCB 4DS4A 3R5JB 3EVWA 2FLLA 3PFEA 5FDLB 2C2KB 5CYJA 2P9CA 3THPA 3CJ4A 5HVFA 4MAKA 1QJHA 4IG0B 4ECSA 1RTHB 3FCWA 4AT1B 2G2ZA 2RQCA 2OPSA 2ROGA 3EJMA 3HHLD 2B43A 2AGQA 2OEKA 1UFWA 4AXIA 4W4MA 3MR3A 1MSWD 2UUAJ 3W2VB 3TA1A 2XC9A 2WVBA 4C8KA 4L74A 4LF9J 4UZCA 3QRRA 3PO4A 3M2VA 4WIQA 4PPDA 4CTAB 1MU2B 2GHWA 1SC1B 1UWBB 2RDIA 1XBWA 2MJUA 1ULRA 2ZWPA 5E41A 4YP3A 3ADAC 4GO7X 3QMQA 2RS2A 2BRLA 3NGRA 4JV5J 3CCMS 2MMYA 4W98A 3W9HA 1RT4A 1E6YB 2C3MA 4JI7F 2BV3A 3D1OA 1GMWD 5ADZA 2C2OB 3D6FB 1RK8A 5J1EA 3C6UB 2DR8A 1TFYA 4ZVOB 1FXDA 3DGVA 2ZH4A 3RW6A 5IT9Y 2CPJA 3H40A 1SC3B 2A3JA 4DR2F 3PYGA 1N5YA 3FCVA 4O3NA 2ADBA 4MK8A 2AGOA 3IWNC 2CDRB 3PG9A 5K5MA 2L41A 1YI2S 5C2CA 3LP1B 4DG1B 4ED7A 4NYOA 3TYTA 4R5PB 4ES1A 5J2QB 1FDNA 4X4OA 2VDHA 3GIMA 3T19A 2CPIA 1ZAXA 2WW8A 2FC9A 3KUGA 5KFNA 3M2RB 1K8AT 1IKYB 2QA2A 3DHXA 4NA3A 4HVZA 5KG2A 1NPRA 5E5NA 1AYEA 2XZWA 3M8RA 3MMAB 3JTOA 1SC6A 2JEGA 4O4GB 3AXKA 4PYDA 4U9RA 4L73A 1KHVA 3TR5A 3PNIA 1JKHA 3FBBA 5IXUA 2FVQA 1KQGB 2PDAA 5HANA 2BZ2A 2XY6A 2Z56B 2P9EA 1I3OB 3I31A 2MXYA 1GXLA 2X3DA 5HQLA 3AA9A 5KFYA 2FJAB 2RMLA 3L4BC 3BS9A 2CPEA 5KAKA 4RNMA 4LSLA 2VV5A 2EFGA 2NCKL 3KJVA 4YY3F 2LEAA 2HPUA 3TRGA 3GR0A 1V5VA 3DRPB 1YRUA 2KKHA 4LF8J 1LKZA 1GTEA 4P2SA 5K14A 1HBUA 1J5EJ 4ECZA 2MY7A 4B3TF 2RRNA 4CI0B 1XIQA 1N56A 3UDEA 4NRUA 4MKBA 2CPDA 2HWIA 2BQ3A 3DOKB 3MXHP 1GX5A 1SQGA 2LQBA 2HRUA 3S8SA 1TU0B 5CCMA 1M90T 3LH2S 3DGPB 5AJ3F 1EB0A 3RBXA 4ERDA 1U2RA 1IUJA 3GE9A 4C11A 1WSRA 2C28A 1CC7A 2OPPA 1FJGF 4WP3A 4QWBA 2MZJA 5KFLA 2NSCA 4TY8A 5LXRA 2ZC4A 5I42A 2AT1B 3CCLS 3RRGA 1FHTA 1RKIA 4MYTA 3M8PA 1DBDA 4Z7YA 1C0TB 3KLGA 2R7TA 2YKMB 1Q8IA 1R6YA 4AXJA 4ILRA 4ZHRA 3MECB 4YMEA 2KT3A 3NCQA 3AJ2A 1IBKJ 2WVDA 2CQIA 3P4UB 2Z30B 5F8HA 3FBEA 1G7CB 1RDRA 3ISZA 5L8RC 3ULHA 3MM9A 1TV6B 4A8QA 4DU8A 3QT8A 3MMBB 3QWUA 4IOBA 1TK0A 2KDOA 1NBEB 3H42A 5DZ6A 5F8JA 2DPIA 6FD1A 4LJMA 1S1WA 2V8HA 1LWEA 1HD0A 2ROEA 4WFXA 2OPSB 3QO9A 2FLOA 4YDXA 1U2FA 1NB2A 2P6SA 4IG3A 3BSAA 2NXUA 1FRHA 3KK2A 1UA1A 2G1HA 2G1DA 4R25A 3IBWA 4ECWA 4I64A 2F65A 3RU0A 4NEYA 3T5LA 1GX6A 2Q79A 1AROP 1OY6A 2R7UA 1JLQA 1AA1B 4PG5A 4I6YA 4BC9A 2DY9A 2VKZG 5HVGA 2C42A 2RAQA 1B4SA 3BN4A 3BO3A 1H73A 4PEOA 3MR5A 3I82A 3CULA 1UAWA 2FZKB 2GIRA 3CJSA 2AYGA 3C66A 3ZNJ1 3FFIB 4NOHA 1N5YB 1BLUA 2VKRA 1NSQA 2KFYA 2FVCA 2HYIB 1CJTA 1R0CB 4OX8A 1S6UA 3MTJA 3NS6A 1RHKB 3Q8PB 3WHIA 1R0AA 1I5OB 4JI5F 5DDPC 3CCZA 1LW2A 1ZPWX 4NCGA 2CRLA 5KFGA 5SZTA 4JI3F 1GMUA 3NBPA 3WQPA 2G0CA 3W64A 4WP8A 2LVWA 2ZWOA 3OXGA 1N48A 1UTAA 2IVMA 1L3VA 2BJEA 2QSWA 4FYVB 4LSZB 5M2PA 4E8UA 3GILA 1ZPVA 4J9KA 4ZJLA 1WC1A 4YQWA 2IPOB 4X66F 3M1VA 3OXLA 3ELHA 2RKIA 2HHTA 3UCZP 2DNNA 1VC6A 2OEJA 4IR9A 3L7UA 3HHLC 1U49A 2KHDA 3M32B 5DDRC 1CVJA 1O8BA 4ED0A 4H4MB 4DV2F 2DR7A 3GFHA 3C2PA 1KEKA 3BDEA 1C2PA 3VHQA 2IJRA 2Q66A 4LSLB 1KOOA 2JL9A 4AFFA 2XNQA 3KJVB 2V5HG 2GHVC 3MUVP 3PIOQ 4F4ZA 4P10A 1D8YA 4JYAF 5B0GA 1B0TA 3UDVA 2MPUA 5K14B 1HBUB 3KOAA 3MCOA 4USUA 3CC7S 5CZXA 2EEYA 3BYPA 2PFDA 1RA7A 3U7JA 4FYYB 2EFQA 4WBFA 3UWTA 2RJZA 1RSCA 4HLBA 1XERA 4KV8A 1ZBTA 5DQGA 2VQFJ 2UZAA 1JMTA 3QGIA 1Q0NA 3UN2A 3BQ1A 3PYFA 4JP8A 1X31C 1FDBA 3EZOA 3HJVA 2HBQB 1YSJA 2LA6A 4EZ9A 7AT1B 3QIDA 2B0GA 4ZLPA 5E7OB 4B3MF 2AIRB 2JEJA 4DPTA 4O3QA 2ZD1A 1YLXA 5A0YB 4XAKA 2FUG9 2IRXA 2V8GA 2CNOB 2D3O1 2M0GB 4N77A 5I42B 4CLKA 3HO1A 4DF4A 3OLAA 1N33J 2R8HA 4C6AA 3M8PB 2C3OA 2B9WA 2HFNA 2QL5B 3CCRS 2BANB 3W7BA 3KLGB 4X64J 2NXJA 4K5SA 5LL6d 1VRTA 1H2TZ 3VGTA 3FEXB 4F3MA 4GC7A 2FGCA 2MKIA 2FJWA 4DFMA 3MM9B 2H3EB 2ZEJA 4RKUC 3V81A 2QL7B 1VS3A 1Q82T 1WKLA 4LFCF 1X4HA 2HLUA 2N82B 3OT9A 3Q24A 3LALA 4RW6A 1FWLA 4YN3B 2ZOMA 5FIIA 1S1WB 3NS5A 1LWEB 1LK7A 4ZITA 2JNJA 2Q43A 2MHEA 3UI3A 4RWXA 1SQEA 5IT9U 4F50A 4OHXA 5EX3A 2HNZA 4DL7A 2EG2A 2VA2A 2B4VA 4WTYA 2XO6A 2MKCA 5J1NA 4USKA 4OYWA 2ZITA 3KK2B 3AJDA 3CCUS 2HWTA 2IIHA 4DXLA 3CB4A 4OZ0A 2FJDB 5IOLA 2V9WA 2ZFHA 1YDLA 5D0RA 4DUYF 3M6VA 1BY9A 4F3QA 1D0EA 2L9NA 1B7YB 1DRZA 3WIUA 3OVAA 5KFSA 1X8DA 3POTB 1LWXA 1WUUA 3MPWA 1FD2A 1OS5A 1S99A 4P2XA 3I32A 3G6XA 1MMNA 4NLQA 4ZLLA 1X0FA 3C14A 3CCWA 3N6LA 1T03A 1J2VA 3FRYA 5AXNA 2FZGB 2R7VA 3CMAS 2WCXA 1PJ6A 1EARA 3TJAA 2WVCA 3C3LA 2K3IA 4DX6A 2POKA 4UT4A 4P72A 5A2QY 2A2CA 5GAHI 3BR9A 1S12A 1BC6A 2QMWA 2HVHA 7FDRA 1DQ8A 3HSGA 2AYEA 3W9JA 1LW2B 3KLFB 4NCGB 5KFWA 2QFIA 2EG1A 1W2BR 1HI0P 4Z7CA 4UQTA 4O3OA 1RAJA 2VOOA 3Q8UA 3CW2C 3GJTB 1NJWA 1M5SA 2ZZTA 2B9YA 3MM7A 1HNXF 2RKIB 2SXLA 1SIZA 1OJ4A 4IDKA 3LP0B 2WRMA 4C8NA 3SDEA 4KGKA 3H59A 3NAHA 2MB0B 3IC1A 2ZBCA 5LJ3Y 3IP0A 3JTNA 1VQ8S 2KT2A 3QJPA 1AUDA 2W01A 4HEA9 2ILZA 1E6VB 3FQKA 5B0EA 1F9EB 3KLVA 3CNQP 4M5GA 4P71A 1JLEA 3S01A 2GJ2A 5B0AA 1S57A 5HJYA 2ATLA 2CQDA 3W2WA 4F8RA 2EW9A 2ZE2A 4F26A 4UZBA 2ZH3A 2B51A 2PI5A 1RE1B 2EWHA 2VC1A 1XWLA 2R3VA 1WHXA 2DK2A 5DLFA 3HX9A 2JLEA 5B09A 1B70B 2RT3A 1ZTWA 4K4XA 2BYCA 4ZPBA 3LWMA 4Y6IA 2QTWA 3PCOB 1U8SA 4KV8B 3Q22A 2UU9J 2ZUGA 3A4TA 4K59A 1KVJA 4QBUA 3P49B 4UW2A 1SL2A 5E3AA 1PJ5A 3GCXP 4DV0J 1M5OC 5J2MA 2ZD1B 4QZVB 2RQ4A 5HJXA 2W9BB 4J9LA 2XMVA 3H5XA 3H0PA 3LWLA 4OJHA 3R97A 3TUPA 5E3QA 3HK2A 1VRTB 4A8OA 4LR7A 2IYIA 2XLJA 2BR0A 1JXVA 1LQ9A 1NXIA 3M30A 2VJVA 4OX6A 3GYXB 2DTJA 1ZA1B 2XG8A 1ICEB 1SJRA 4HH1A 5K8PA 3HHKA 3FSXA 4CLLA 3T5JA 1S9EA 1M5HA 4ED8A 2IRUA 2Y8WA 2UXCJ 1CPZA 4YFUA 2J0QD 3PJ9A 3QSYB 1NK4A 1Q7YT 3GIRA 4TNOA 4LF4F 2Y9HA 5LXYA 1QUPA 2X1GA 3I9V9 3CCJS 5AXKA 4N47A 2AYBA 4KHPJ 1KS2A 1KLNA 1G1XA 2HGNA 3E8OA 4JI6F 1U2CA 1TKXA 2BQUA 3QGPA 1UEVA 5HQMA 2W4CA 5E33A 2OHDA 1L3KA 3P5BP 3VQTA 3Q8SB 3CCTA 1RABB 2XHWA 3PR5B 2MDAA 2V69A 1XTZA 4DR6J 4DSLA 1RT5B 3GFZA 2CPXA 1U02A 4PRFA 3V5RA 1FI4A 3C14B 4USIA 5LM7E 4CCHA 1F5BA 3IA0A 1RWXB 5HROA 3W60A 3BF4A 4Y0FA 2F40A 5LOQA 4RW9A 2VD3A 4QYRA 1VFJA 2DHGA 4DR5J 4C0HA 4GO5X 2K8GA 1KR4A 1IBLF 5A8KB 5HVHA 4J37A 1V3ZA 2DGXA 1FWPA 2YQ1A 3UVJA 3W65A 4OHZA 3MEGB 1KFDA 1ZM4A 5KFOA 3IRWP 3Q2SC 2L3MA 1LWFA 2Y0SD 3D0IE 1ZA2B 5KG1A 3ZZ0A 3GYGA 2OJ3A 1FTRA 3DU6A 2F63A 2F9JA 1P27B 2M52A 3HZEA 3P8BB 3WZ0A 1UZDA 3NOCA 4B3RJ 3QNWB 2OEMA 3TANA 3MM7B 3HHDA 3HHLA 3CO9A 1M5KC 4ECQA 4JI1F 3SDEB 3PHTA 2VICA 1RT1A 3M8YA 2V50A 4X2BA 4AQYJ 1RZMA 2HFVA 3I0RB 4I7FA 5CYMA 2NUUG 4NLPA 1V3SA 1HNIB 3IGNA 4M5MA 1SJ4P 1WG1A 5L9XA 3DM2A 3KUEA 2ZH7A 1JLEB 3D5MA 4HKQA 3OHBA 1GMWA 4ZK7M 4CM0A 1KQFB 3W63A 3W2WB 4KJIA 2ZE2B 2FGOA 1FKAF 1RI7A 2QMUB 4K0KJ 5DG8A 1Q7LB 2QMXA 2YKQA 3L95X 3D68A 4LF9F 5IV3A 3OW2R 5IM0A 5MAOA 1Q95G 2UXDJ 1VK8A 1FK9A 1PJ7A 4LF7F 3UPFA 3NCPA 1U0SA 4JI0J 5L38A 4DV3F 1WKKA 4CRJA 3OLBA 3G82A 2CQ3A 4QR1A 1NSKL 5DO2A 3GJRB 1OPIA 2CADA 5DQIA 1Q78A 4ANDA 3VAGA 5F9LA 1GNKA 5C24A 5GVQA 3DRSA 5J2MB 6FDRA 4M5LA 5BXIA 1RB0A 3BGRB 2J9DE 5KFTA 5KT2A 3NAIA 2GA7A 2V4JB 1NH8A 3R2CJ 1R27B 4C3KA 3VVUA 1CS4A 1ROFA 4FVCA 4F67A 2FDNA 5ETSA 4KY3A 1UVJA 2YQ3A 1U1MA 1XMQJ 4DSEA 2ROPA 2A18A 3DRRB 4UTGA 3MR6A 3MF5A 1TUGB 4HACA 2H1YA 2RU9A 2WSEC 4NI2A 2M7SA 2RNEA 3MPUB 3C46A 1RLDA 3CC4S 3SQOP 4CP5A 2QA4G 4ZPCA 1TL7A 3W5XA 2AF6A 4QWCA 3D1QA 4CO0A 5D4PA 3WC0A 3KK3A 1S9EB 3T5HA 1QSSA 1RT6A 3OUYA 1X5TA 1DQ9A 2Q6BA 2DRDA 2VF3A 1QDUB 4RBVA 1F3VA 2BKOA 4H4KC 4F36A 1IBMJ 3I5AA 4C0OC 2HFUA 2IDLA 1VRUA 4O23A 1S0MA 4ELUA 4GVBA 5F8LA 1FNOA 1X7VA 1HIYA 2V2KA 2DHSA 2V67A 2UUCJ 2QA4S 4A4JA 2EPIA 3TVYA 2BKNA 3K5PA 2IHR1 2JLFA 4JI8F 1O6XA 1N0VC 4LF8F 1J5EF 3ET6A 3RYLA 3H2LA 4DV6J 5CD4H 4V19X 1SUQB 1ZAWA 4DLEA 2VZ9A 3PX4A 2YPZA 1HWUA 3KKFA 2DNHA 4P73A 5HROB 4Q43A 4TU8A 3EGNA 5MLCV 2ZUAA 2MZRA 3O44A 3VAMA 4AL5A 4RW9B 4X84A 4G1IA 3RRKA 2NS1B 2HVZA 2XS2A 2HBYB 4ED3A 3D4JA 3MM6A 2OAUA 1VQ5S 1MROB 2KZZA 2VH7A 3KLIB 3BPDA 2HHHJ 3UVJB 1IKXA 3NGDA 2VPZB 1JLAA 1NHVA 2WONB 5ETOA 4IH5A 3UN3A 4MKYA 1UVMA 2AU0A 2GVDA 4DV5J 4RW4A 2DD8S 4JI2J 4ZMMA 3KJNB 3U02A 1NJIT 1W7WA 1X5SA 1IKVB 1H7XA 2GW8A 2APOA 3TNVA 2J6TA 1IBKF 4F7VA 2LDIA 1RAGB 3MURP 4ZIWA 3M8QB 4ITSA 1JQGA 1KQKA 3ETMA 3HFZB 2W25A 4B02A 1REVA 3R27A 2DEIA 4OV1A 5KG5A 1N6QA 1RWMB 5CYMB 1QAIA 3FQLA 2JEIA 1RWUA 1APSA 4IYQA 1GXTA 4J9OA 1FERA 4CDIA 3TZWA 2EKYA 4TU9A 3ENWA 1KQSR 2AV5A 2NSBA 5AE2A 1R43A 5F3ZA 1IKWA 3JTPA 2F4VJ 3CSKA 3H5SA 1HLWA 2Q6CA 3UD4P 3LTOA 1TFWA 1Z2ZA 5IM0B 3G4SS 5HLFB 3CEDA 1FK9B 2KJWA 2RH3A 3QT6A 2NQPA 2R7OA 4O3RA 3UW1A 3RAXA 2LU2A 2YNIA 2V94A 4LF6F 3VAHA 3MAAA 3WC2A 5HMXA 3FNNA 4DR4J 4N5SA 2I6WA 3HXMA 4O0IA 4CQ1A 5F8GA 3LAMA 3PHEA 4ZP6A 1EAYC 2GX8A 2E7XA 1PBAA 1S7HA 3PO5A 1DZ5A 1BWVA 4LT6A 1V6HA 2E1AA 2MZQA 4LRAA 2HBRB 3T1YJ 3K0JA 3K89A 2Y0BB 1CJUA 2CQ2A 2RS8A 3CCES 1YITS 4KTQA 2YKNA 3H8YA 3FJ2A 2WB1D 2C3YA 4NA2A 3IG1B 4B9VA 1XMOF 4ECXA 1NK7A 4PABA 1TL7B 4S0MA 2D9PA 4FKXA 1NHUA 1YTYA 3FSYA 1LWCA 2CJ9A 2XGQA 3M8WA 2Z2MA 2VL1A 4PKDB 4ID5A 3TQ1A 3KK3B 3RB4A 1DLOB 1WORA 2GHPA 3CMES 3OUYB 4NLDA 1WHYA 5LMUF 1MMLA 1S6PB 5GMEA 3G8SA 2OH2A 3PW5A 2W2MP 3N4WA 1RYRA 4CH0S 2OUGA 1S7IA 1FXRA 1VQMS 3O2IA 1Y7PA 4TY9A 4G3IA 3BGLA 1VRUB 3V4MA 1HNVA 2XGPA 4GVBB 4TYAA 1KONA 3HULA 3OTDA 3EZ5A 1JLGA 4NLSA 3IMQJ 2HHXA 5KFXA 4DPXA 4QW9A 4B3OA 3HD1A 1S59A 2IMOA 4HYKA 2YH0A 2VG7A 4Q44A 4CO4A 2JVOA 4OYBA 1HHTP 2C3PA 3DU5A 3T6BA 3BEGB 3MUTP 1SPBP 1GTHA 4JI4J 4W90B 2KJVA 2ATCB 4L72B 1VJWA 2VQFF 3FDSA 1JLCA 3Q8QB 1DTQA 1QUVA 2HFZA 3IM8A 3NNCA 1S5ZA 2OI2A 1O5JA 5JUMA 5E3RA 3MM6B 5SUHA 2ZKUA 4FXVA 2F9DA 3UCGA 2J8AA 3LF0A 1FJEB 1RQ0A 3KHGA 1BQNA 2XULA 2C2RA 1SJ1A 1PILA 1U1PA 2AJQA 3QATA 5KG7A 3IGVA 4ZJQA 3KG4A 1I6JA 2VC0A 3G6VA 3GCWP 3SSQA 3F0NA 1GAOA 2JDJA 1NPPA 2Z2LA 4KIAA 2GMHA 2GVDB 3RRHA 5JJBA 4DV1F 1R6VA 3ICLA
chains in the Genus database with same CATH topology
3ZZTA 4ZHRA 3MECB 4ED1A 2YVSA 3IWLA 1BD6A 1VMBA 2KU7A 4YMEA 2GIQA 2KT3A 2QA1A 4BWMA 3UR0A 4YB1P 2FHKA 4YB6A 4BS2A 1JK9B 1VQ4S 3NCQA 5LJ5Y 3AJ2A 3DRXA 3MMAA 2CQIA 2EI5A 3B4DA 3QIPB 4N76A 1HWJA 1NJXA 5F8HA 5L1JA 1DLOA 4KQZA 1G7CB 1RDRA 3ISZA 3MM8B 2B7BB 5L8RC 2HQ3A 3ULHA 3VALA 3MM9A 1TV6B 3SEOA 4A8QA 2N3LA 3LGMA 3M1VB 1K1QA 1S6PA 5F0UA 2K1RA 3MMBB 3QWUA 4YDDB 2QV6A 2LYVA 4IOBA 1M0SA 1SJ3P 1TK0A 1TUVA 3H2VE 4WKYA 3OTBA 4MFBB 4UUXA 1S0OA 2KDOA 2D41A 2J7UA 3QAUA 5LMNF 2GQQA 2R2SA 2ZHAA 4R8UB 5EHHA 2OTLS 4DBQA 5F8JA 1Y00A 4AUKA 4MKAA 2DPIA 6FD1A 4LJMA 2J0WA 1G2EA 1S1WA 2V8HA 3N9UC 1LWEA 1NAQA 2J7KA 4A8XA 3TAMA 2J6UA 4OJ3A 3J80Y 1HD0A 1VIOA 2LQJA 2ROEA 1MMDA 4M8LA 3CTRA 5KFAA 4DHVA 2XSJA 2BVZA 3C8YA 2R4FA 4WFXA 3MFHA 3J7YI 2CZVC 2OPSB 3QO9A 2DISA 2FLOA 2RVJA 4YDXA 5KG3A 2JLGA 4EYIB 1I1GA 2ADCA 1U2FA 2P6SA 4IG3A 1HHSA 1T8EA 2E29A 3OSNA 2O67A 1IKWB 1S6QA 4DN9A 2G13A 4XPCA 3BSAA 1CSJA 4WE1A 2HHUA 1OO0B 2F8MA 2NXUA 1N5VA 1FRHA 4OJGA 3KK2A 3NLCA 1UA1A 2X51A 3CIZA 2IRYA 3KLEB 2G1DA 4R25A 3IBWA 4ECWA 1FKPB 4DUZF 3KHLA 2F8EX 4I64A 3CF5Q 3E3XA 3RU0A 4Y00A 2UUWA 3T5LA 1GX6A 1N54B 2Q79A 2IA0A 3O1LA 4K5RA 1AROP 5A8WA 2HHVA 4FS1A 2R7UA 4IO1A 1JLQA 3D1HA 5KG0A 1S6OA 4PG5A 4RU9A 4I6YA 2C2DA 2XMUA 1WF0A 4F4YA 3FMBA 2QO3A 4BC9A 2XWYA 3CD0A 4NCAA 2VKZG 5EGYA 4PCQA 2AJ0A 2C42A 2ZM6F 2UXDF 5DG9A 4PWUA 3QWPA 1C1BA 2VFVA 2YNIB 4ALZA 2UVUA 4FBTA 3B82A 4WFYA 1UVNA 4CH1A 1UFLA 2DIUA 2Q1LA 1EP4A 3BN4A 4M63A 3SCKE 2IYGA 3BO3A 2VBZA 4BDPA 1RTIA 2YH1A 3CDEA 4L6V3 3ZC4A 3DOKA 3MR5A 4GMKA 4ZVHA 2VODA 4NYZA 4CO1A 3P96A 3I82A 2JOQA 4WK3A 1Y3KA 2RQMA 2O01C 2XO7A 3CULA 1UAWA 3BM7A 2PC6A 4K4TA 2GIRA 3DGPA 2X1FA 5KT4A 3N28A 4F4WA 2LMIA 4MJKA 1ZYQA 2AYGA 2W4PA 2AJ1A 3C66A 4PWDA 3FFIB 4NOHA 2ABYA 2MQMA 4C3MA 2K2PA 4Y3CA 1N5YB 5CCLA 5KT3A 1BLUA 3UCUP 2VKRA 2J5AA 3KNGA 4G6VB 3B78A 2EC0A 2KFYA 3MR2A 1CQMA 1K0TA 2FVCA 2HYIB 2F1FA 4ZPVR 5FD1A 3M9MB 2AGPA 1ELOA 4ECUA 3PM9A 3DLGA 3SQGB 3UDLA 4H54A 2GJIA 1Q53A 2MZSA 1Y5IB 3DHWC 4EU0A 1M1KT 4OX8A 3U1NA 1S6UA 2W9AA 3JSYA 1FEEA 3OL6A 1FF2A 4KHMA 1JLFB 3MTJA 4NCBA 2KRRA 2YKNB 3NS6A 3KWMA 2JH3A 4USJC 5CYQB 2Z0GA 3Q8PB 4LUBA 3TOQA 1R0AA 3NGKA 5F0WA 4CZCA 3A8EA 2VQEF 4RNNA 3LPYA 4JI5F 2YNFA 1PC4A 5DDPC 3CCZA 1XMQF 1LW2A 3GR1A 1ZPWX 3DOMA 4ZS6A 2B4UA 1R8CA 3K58A 3IAS9 4ECVA 2WOMA 4NCGA 3I96A 2CRLA 2YKPA 5KFGA 5SZTA 2XLIA 2YKMA 4JI3F 2DBBA 4M5DB 3NBPA 2G0CA 4XDDA 2CKWA 4TYBA 1U47A 3J7Z5 3RB0A 2K7KA 2LVWA 5LSOA 3CVKA 3HVWA 5AE3A 3OXGA 1S1XA 1N48A 3JSRA 4B9MA 2IVMA 1L3VA 3BGUA 2BJEA 4FPRA 2QSWA 3MD3A 2I38A 5M2PA 1NZAA 4QIEA 3AA8A 3QIPA 4MH8A 4E8UA 4C98A 2LXFA 3GILA 2W4DA 2YTCA 3FMWA 1ZPVA 4J9KA 3VZHA 5F41A 3V81B 3JB9k 4YQWA 4W92B 2ZZMA 4NLYA 4X66F 3DLEB 4H4KA 4CT9A 3DLLQ 1HBMA 2HNDB 3M1VA 3OXLA 4IFYB 1OSCA 1U09A 2CVIA 2RKIA 2YY3A 3MMBA 2HHTA 4WFBQ 3UCZP 5L39A 2DNNA 1VC6A 2ZC3A 4IR9A 2R7SA 2Z4PA 1VOMA 3HI9A 4RW6B 2GQ2A 5KFUA 5H1SV 3ENQA 3UR3C 2HS0A 4DQRA 4B17A 1L3TA 2B3TB 3HHLC 1U49A 5I3PA 2KHDA 5EUHA 4R8UA 3M32B 2L9DA 5GMKa 5DDRC 4C97A 4WFAQ 1RTJB 3OR1B 1CVJA 1O8BA 1HW9A 2DHAA 3J7A1 4ED0A 4EGLA 2WHOA 2AJ4A 4H4MB 2X3GA 4X4TA 4DV2F 2DR5A 2DO0A 4U7CA 4D3GA 4X65F 2DR7A 3GFHA 4DOZA 1WHWA 1HNVB 3C2PA 2V4RA 1KEKA 3BDEA 1C2PA 2HNZB 4AYBD 1NK9A 5K8NA 2QLWA 4ATNA 2Q66A 1JLGB 4LSLB 4QR2A 3SCIE 1KOOA 1WWHA 3I5BA 2JL9A 4AFFA 2XNQA 3KJVB 4CNZA 2V5HG 4QWDA 2BJDA 4MMOA 2GHVC 5HN0A 3MUVP 4B3OB 1FVQA 3GMGA 4OMFG 3I55S 2UVWA 3PIOQ 4PXDA 4IRCA 1QAXA 4ED5A 4F4ZA 1FKPA 4QWEA 3RTVA 1SXLA 2OLWA 1RTDA 1D8YA 4JYAF 2VASA 4U67Q 2W7OA 1KHWA 1B0TA 5B0GA 2MPUA 4HDGA 4DFKA 2PFFB 2GMLA 5K14B 1HBUB 5K8OA 3KOAA 5C25B 4O3SA 2IBOA 3MPVA 3M2UB 3CD7A 3D28A 1IN0A 4RNFA 1UEUA 1LOUA 3OL8A 1U1OA 2R8KA 3CC7S 2CZ4A 1ZZFA 1TAQA 4TN2A 5CZXA 1JWWA 3HFKA 2BM0A 3BSCA 2VPWB 3IRXA 1RA7A 3MMCA 2W9CB 3HM9A 3U7JA 1XK8A 3GV7B 2I1RA 3R3TA 2EFQA 4OX7A 2RF2A 1TAUA 2B5JB 1NK5A 3KTQA 2KH9A 1MWYA 1TL1B 2J0SD 5KTQA 4KBIA 5KG6A 3UWTA 2RJZA 2YX7A 1H2UX 4DQSA 1UJ5A 1FDAA 4HLBA 1XERA 4KV8A 4B08A 1ZBTA 2OMOA 2CQ4A 5DQGA 3K59A 1JLCB 2QT7A 1DFDA 2UU9F 3VR1A 2UZAA 1JMTA 3FRZA 1S9FA 3QGIA 4Q8FA 1DTQB 2RE1A 2FHJA 4WJBA 3T9NA 4ETZA 3CUNA 2DNMA 1FD8A 3G86A 3BQ1A 3V6DB 1HPZB 3JSMB 2R7WA 2HNYB 3IWXA 1FDBA 2HQIA 2O1PA 3DYAB 3IAM9 4HT7A 1T03B 2E5IA 4C9DA 1YSJA 2LA6A 2P9GA 1FJ7A 2DH7A 4EZ9A 1BQNB 2DGUA 3DRYA 3FFIA 3QIDA 2B0GA 4ZLPA 4M94A 5E7OB 2ASYA 1J5OA 4B3MF 4PG4A 3NL0A 2JEJA 1OIAA 3M6UA 4O3QA 4DDFA 4X4SA 2ZNZA 1R8AA 2ZD1A 3WBZA 5A0YB 4WCEQ 1HQUB 2CQBA 4XAKA 1FKOB 2FUG9 5HMZA 2KHCA 4RU2A 2IRXA 1VC5A 4LQ3A 1UVIA 3BGFA 2ZJRQ 2V8GA 3QLHA 2M0GB 4N77A 5JVGQ 4DL3A 5I42B 3VAJA 1N8RT 1P8GA 3HO1A 4DF4A 4FNHA 1LFWA 3FCHA 4NLRA 3N6MA 5CYQA 4FF4A 2RQKA 4DV7F 2NREA 3OLAA 2HHHF</