5LXXA

High-resolution structure of human collapsin response mediator protein 2
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
477
structure length
477
Chain Sequence
SDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydropyrimidinase-related protein 2
publication title Collapsin response mediator protein 2: high-resolution crystal structure sheds light on small-molecule binding, post-translational modifications, and conformational flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 187
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 5lxxA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 5lxxA02
4B90A 4LAKA 1S3TC 3IARA 4LAMA 2GWNA 3MJMA 4QTGA 4D8LA 1NFGA 1JGMA 4IFOA 2OOFA 4L6DA 3RN6A 1ONXA 5FSEC 4IQJA 3GTIA 4R7WA 1J6PA 3FEQA 2HBXA 2Z24A 2UBPC 4V1YA 4DLFA 2PGFA 1FWGC 3IV8A 1O5RA 3GU9A 3WYZA 2W9MA 1P1MA 2DVUA 3E0FA 3PNZA 2FVKA 3WZ0E 4NI8A 3BE7A 4DLMA 3JZEA 3QGAC 4HK6A 1EJTC 3GGMA 2Q09A 3RHGA 1V51A 3LSBA 1XGEA 3OU8A 4RDZA 1FWEC 1EYWA 1A5LC 3S2NA 4C6DA 3S2MA 5A6TC 2FTWA 3FDKA 3IACA 4BJHA 4IFRA 1A5MC 2R1NA 4F0RA 3CS2A 1J6OA 1RJRA 4NG3A 1FWFC 1K1DA 4GC3A 3TN4A 2Z4GA 4C6BA 4H9TA 3GIPA 2DVTA 1FWCC 2D2HA 2BB0A 4P5UA 1RJPA 1FWDC 4C6QA 3LGGA 4RDWA 1P6BA 4EPDC 4LH8A 4CQCA 4C6LA 1GKQA 4J2MA 2HBVA 4M51A 4B3ZA 1ITUA 1WXYA 3IJ6A 3GTXA 4H9XA 5HMDA 1ZZMA 2R1KA 2KAUC 1EJUC 1EJVC 3V7PA 4DZHA 3HPAA 3ORWA 2YZ5A 3IPWA 3AUOA 1FWAC 4XAYA 1E9ZB 3TN6A 4XAGA 3MDUA 4IGMA 3EWCA 3K2GA 4DIAA 2VM8A 1NDVA 1A5OC 4GXWA 3URNA 2E1WA 2E25A 2YB4A 3A4JA 4R88A 2HNHA 2Z28A 4E3TA 4C6IA 4H9ZA 2HPMA 1RAKA 3F4CA 4UB9A 2R1PA 1RJQA 3GUWA 4EPKA 1A4MA 3UBPC 1QXLA 1RA5A 1UBPC 4HA0A 4IF2A 2I9UA 3GG7A 2F6KA 4ERGA 4DNMA 1KRBC 1WXZA 1R9YA 3K5XA 4WHBA 1UIOA 1V7AA 2R1MA 2WM1A 3QY7A 4EPEC 1E9YB 4LCQA 1PTAA 4NP7A 3MVIA 1NDWA 3DCPA 4C6JA 4AQLA 2ZC1A 3MTWA 4C6EA 3LA4A 4GOAA 1FWHC 2Z27A 1YNYA 4QROA 2FVMA 2OODA 2D2JA 3B0YA 2GZXA 4PCNA 4GX9A 2WJFA 4DI9A 4GYFA 1QW7A 3SO7A 3KM8A 4LANA 3OOQA 4RZBA 3EWDA 3SFWA 2EG7A 2GSEA 4ICMA 4XD3A 4QS6A 2PAJA 4UBPC 4C6FA 3G77A 3CJPA 1O12A 4L9XA 1YMYA 2QVNA 4BKNA 2Z7GA 3ISIX 2GWGA 1POJA 4I6VA 4QSFA 4WGXA 4KIRA 3K4WA 2EG8A 1PSCA 1EJXC 3QGKC 2RAGA 4B92A 4RE0A 4CQDA 1W1IE 4R85A 4H9YA 3TNBA 2YXOA 3HM7A 4GZ7A 1A5NC 1RK5A 2VUNA 3T81A 1EJRC 3URBA 3TN5A 4G7EA 1V77A 4IFKA 3S4TA 4CNSA 3S2LA 3ITCA 1R9ZA 1ITQA 4C6MA 4C6NA 3UF9A 4ERIA 1EF2A 5E5CA 4DZIA 3TN3A 4EP8C 3E38A 2QPXA 4LEFA 1FWBC 4CQBA 3B40A 3URAA 1J5SA 1VFLA 2WJEA 5AKQA 3OQEA 2G3FA 1P6CA 1UMLA 3O7UA 1R9XA 3E74A 4HJWA 3QY6A 3GIQA 3GTHA 1EJSC 3MKVA 4I6KA 2QS8A 4LCRA 5FSDC 4LFYA 1PO9A 4DO7A 1KCXA 4H00A 3D6NA 4DYKA 1EZ2A 1FKWA 2UZ9A 2WJDA 1BF6A 2ADAA 4KESA 4AC7C 4G7EB 4IFKB 4XD6A 4C6CA 4JOMA 4LCSA 5CH9A 3AU2A 1J79A 4PBEA 3T8LA 4C5ZA 1IE7C 4F0SA 3OVGA 2QT3A 1EJWC 2D2GA 3OODA 4GY1A 2OB3A 2VC7A 2FTYA 4RDVA 3MPGA 1GKPA 1M68A 4XAZA 3GU1A 3OJGA 4KETA 4J35A 5G4HC 1M7JA 3LGDA 2A3LA 2HPIA 3E0LA 4LAOA 3T1GA 1PB0A 3MSRA 4CEUC 1YRRA 3HTWA 2HQAA 1XWYA 2PGRA 4C6KA 3NEHA 3UR2A 3F2CA 2YB1A 3GTFA 5HMFA 4PCPA 4J5NA 2Z2AA 2PUZA 3IRSA 1ONWA 3QY8A 3EGJA 3F2DA 2ANUA 3RCMA 4H01A 1FWIC 4HK5A 4QRNA 2Z00A 4F0LA 4GBDA 2AMXA 2P50A 4HK7A 1FKXA 1M65A 4ZSTA 1YBQA 3DUGA 2ICSA 3R0DA 3PANA 1A4LA 4KEZA 1K70A 4H9MA 2Y1HA 5HMEA 4PE8A 2EG6A 4CNUA 3LS9A 3A3XA 3FDGA 3LSCA 2FFIA 3AU6A 2O4MA 3URQA 1POKA 4MUPA 4OFCA 2Z26A 3DC8A 2IMRA 3WMLA 1GKRA 4C65A 4GK8A 4IG2A 4ZSUA 2I5GA 3C86A 1ADDA 3O0FA 4CEXC 2P9BA 3UR5A 4B91A 4KEUA 2Z25A 1YIXA 3ICJA 5LXXA 4BY3A 2VHLA 2R1LA 4G2DA 3E3HA 3LU2A 4Z42C 2P53A 4YIWA 3MVTA 1FWJC 4KEVA 4KF1A 3UPMA 3IGHX 4IGNA 3LNPA 1YBQB 4INFA 2OGJA 1V79A 1XRTA 4LALA 3PBMA 4RDYA 2VC5A 4GY7A 4PBFA 2PLMA 2CZVA 3S2JA 3E2VA 1XRFA 4XAFA 3A3WA 1NDZA 3GRIA 2Z2BA 4ERAA 1HZYA 4V1XA 3PNUA 4IG2B 1I0BA 1KRCC 4GX8A 3RYSA 2XIOA 4C6PA 4WVXA 1RK6A 4C5YA 2OQLA 2AQOA 4GY0A 2AQVA 4EPBC 1K6WA 3CAKA 1A5KC 4XD5A 1I0DA 4H9UA 3ID7A 1V4YA 2Q01A 1DPMA 3MDWA 3NQBA 3B0XA 3F2BA 1UIPA 4TQTA 4QS5A 2VR2A 3N2CA 2GOKA 1KRAC 3LY0A 4KQNA 4IH3A 3NURA 4KERA 1RA0A 4XD4A 3PAOA 4C6OA 2DVXA 1NDYA 1KRMA 2BGNE 4C60A 2O4QA 3GU2A 3F4DA 4CNTA 2Z29A 4H9VA 4DI8A
chains in the Genus database with same CATH superfamily
2YCIX 1S3TC 2ZZ2A 4B5WA 1R0MA 2R14A 3LPGA 2G3JA 3VDCA 3DFSA 3ECQA 5G2IA 3QMSA 2ISFA 4JZ5A 5FSEC 2V5LA 2V68A 4C7FA 2IUZA 5E6YA 2WPBA 3WO8A 2YCJA 5LYRA 4I9MA 3TZNA 2VDHA 2PGFA 4I7VA 2WANA 5DLGA 3C2OA 2R24A 3LUTA 5AC7A 3FY1A 5C70A 2VX7A 2E9BA 2X1UA 1UH4A 2O0TA 1XG4A 1XLIA 4RUAA 5BNKA 1EC9A 4PCFA 3S2NA 3S1WA 3W1NA 3HPZA 4O3PA 1MW1A 1EPXA 2FTWA 2WSPA 3UU0A 2XCAA 3H4GA 4ECSA 3STCA 1OFRA 1ICQA 2V5KA 2Z4GA 3FLUA 2GGJA 1W3NA 3WQCA 1F76A 4H19A 4Z0SA 1K8YA 3F5LA 1FWCC 2JEJA 1KFJA 4KW2A 1J10A 1QCWA 2E68A 3LOTA 1IEIA 4L5ZA 3EDEA 1GKQA 1REQA 4ADSA 4YWSA 5K2ZA 4C91A 1AH4A 3UR8A 1TSIA 4S3DA 7REQB 4JUZA 4B3KA 1KM4A 4IPLA 1LLOA 1VHNA 1X1ZA 3BJTA 1CCWB 4R27A 1W3HA 3KBWA 2CESA 2E1DA 3PFMA 2O9RA 1FWAC 1TV2A 5BXTA 4CQ9A 3M0IA 5EKYA 1W8SA 3EWCA 4N7QA 4YLWA 4Z1DA 1ME9A 1AJ0A 1KKRA 1PWLA 1XIIA 1FWWA 1H49A 4LXFA 5EWEA 3ARZA 2OT1A 4RNJA 2QUTA 3C2RA 1TZ9A 1XCXA 2R1PA 4MFEA 3WQ4A 1XC6A 1BFNA 4IF2A 3DAQA 3W02A 5KFHA 2QYGA 1UIOA 1WKEA 2R1MA 3P74A 2YBTA 3HZ3A 1WKDA 3WH9A 5CBJA 3ZOAA 2Z1WA 4AC1X 2WJFA 4EANA 3OVRA 4LGXA 4LS2A 4IJCA 4Q4QA 4S3FA 3TOYA 1SR0A 3QBUA 1J0YA 5C7VA 2PTDA 1HKMA 4XD3A 3BLLA 3CJPA 4PRWA 4Z1BA 2A85A 4Q45A 2DDXA 2ZRUA 4F9DA 1Z6KA 2Z7GA 5CBIA 1OFDA 3C8FA 3B8DA 3ISIX 1BEUA 1POJA 5FIPA 4RJEA 3GD6A 4KRUA 2YGYA 3HPSA 2H8XA 3V5OA 5LNRA 3K4WA 4H9YA 2PDQA 4FA3A 3TJIA 3MO7A 4AD5A 4Q8PA 3RBEA 1U83A 2PZNA 4E0CA 1R2TA 3SGZA 2P8BA 4PUUA 2WHMA 1WQ5A 1OB0A 3AXKA 3WD1A 4JTHA 3L5LA 3TW7A 4HCDA 3WQOA 1SMDA 2XM1A 1LQ0A 1B3ZA 5J04A 2JIEA 3VCCA 5LXEA 3WK1A 5PTDA 4LWWA 5KG2A 1FH9A 3DBPA 1NU5A 4TMCA 1DJNA 2V2HA 2TRSA 2CU0A 1VHCA 4NU7A 4E2DA 4IHCA 4BI7A 3L4ZA 2MNRA 4S3EA 2ZWZA 1IHIA 1QPQA 2PDHA 4JPGA 4ZE4A 1KLYA 3EOUA 5FESA 3FYYA 2FH6A 4WR3A 5DG9A 4Y9AA 2AAAA 1QNOA 2VD9A 3MU7A 1H5YA 4RDVA 3EA2A 2X05A 1E1EA 1I75A 5I6SA 1R7OA 3GU1A 3VIKA 1SW0A 4HU4A 5G4HC 4DF1A 4GUGA 4GO9A 1S2VA 2P0IA 4WDUA 4BF5A 4QDWA 4CN1A 1YRRA 2HQAA 3T7VA 4QWBA 3F2CA 1IGSA 5A2BA 3P61A 5IRPA 4I8DA 1JCNA 2PUZA 3KHLA 3WJYA 2X0SA 2GGHA 1NWRA 4REQB 1P7TA 1SSDA 3DFOA 3LXBA 1B57A 1TPFA 3UY7A 3RB4A 3N14A 4QHRA 2ACRA 1ZB5A 2ICSA 2VT0A 1P0DA 4FXRA 5TIMA 4IMCA 1WDRA 3VINA 3W71A 1QBAA 5L6UA 4AZ7A 3AU6A 3GG1A 1TV7A 2QHAA 3ZZ1A 3CV1A 2I5QA 3DDMA 3OQ8A 3W37A 2PDYA 3RNDA 1SGJA 1UD5A 1EQPA 1E71M 2WCAA 5DGAA 3B8WA 5BWAA 2VKZG 3N2BA 3LU2A 4GCAA 4H83A 1P4CA 1LOSA 1LBFA 3WDPP 2C19A 3VGHA 3RPDA 2ZA2A 1NTHA 1EX5A 1V3LA 5DGBA 2Y85A 4DN1A 5FJIA 4CD4A 3W86A 4GY7A 3ITVA 2E67A 2OWXA 2PB1A 2BHYA 1V0KA 3KVMA 2CZVA 4ECLA 4O10A 3VE9A 3H8AA 5BOOA 4QP0A 3G6YA 3K8MA 5FEXA 3PTKA 1ZPTA 3NL3A 5U7SA 3QLDA 1UZHA 4QCFA 4AWSA 1M7PA 1YW1A 1VS1A 3CEPA 4DUVA 3QFWA 4HN4A 3LXCA 4EPBC 3FVDA 1QRQA 4ASTA 4E2VA 1G7UA 3GV5B 1BYDA 4DEFA 1D3GA 3G1HA 4X0NA 1NF7A 5DLFA 2QJHA 3M0KA 1OM0A 1SO4A 2BY1A 1F3WA 3T05A 1O5KA 4ZOCA 2V3DA 1HP4A 4NAEB 4U3AA 4IIEA 5BU9A 2QCEA 4KQNA 2PWUA 3SRHA 4B4FA 5CJ5A 4ZO6A 3WF1A 3EKZA 1TKKA 2P3EA 5KG0A 3U5YA 1ITXA 3NPXA 3LZ3A 1DWIM 4Q6XA 2VEGA 3BQ5A 2EGZA 4U5IA 1O60A 3V16A 3QEZA 3EXSA 3ZR6A 5C9XA 2HVNA 2C28A 5CAHA 5HUPA 1V0NA 1ZNNA 1OC5A 2ZX7A 5CEWA 2REQA 2WVSA 1TX2A 4OHQA 1ZALA 3V6JA 1JX4A 1ZS2A 1XR2A 3P8IA 1XLJA 1Y5VA 3WD0A 1HL8A 4J2PA 1SJCA 1IEXA 4R8UB 1VFHA 4OBRA 1JR1A 5CGTA 5LSMA 3IGSA 4S3CA 2CYGA 1QAPA 4GQBA 1PYFA 4RDZA 5I78A 3PZTA 3MSGA 3W1LA 4HSOA 4WSHA 5E9XA 3B06A 4MTVA 2UVRA 1W9VA 7ENLA 1YX1A 2BR0A 4NZJA 3AZRA 3SADA 5LHEA 2X1SA 3G5EA 2YLAA 3PR4A 5DFAA 1JCXA 4W7VA 1GJUA 3KOYA 1Y0EA 4TVUA 3GXDA 3ALFA 3GVGA 4O1FA 2V67A 4S2BA 4X3ZA 5D2YA 1V93A 3GDBA 1O66A 4HJFA 2W3ZA 3DHUA 1G4TA 2ACSA 3ZLFA 1EDQA 2C16A 1LT7A 2IW0A 3GDTA 1YDYA 2WBGA 2XVGA 3NM3A 3OG2A 3UESA 1VYRA 1A5OC 2CBVA 2CW6A 2G5WA 2Y0FA 4JYDA 2CBIA 2FMNA 2PODA 3HQ1A 4NQ1A 1UKPA 2FZ9A 4UB9A 3F4CA 2QQ6A 2ALDA 1M7XA 3VPLA 5HBFA 2X40A 3EWYA 5A8OA 2WMIA 3TXVA 3BJSA 3CWHA 5CJMA 4J3SA 5D38A 3BAXA 4LVDA 1JZ4A 4B9ZA 1XIHA 2X7WA 3O06A 4A4AA 1G6CA 4N9CA 3G1DA 1ZJAA 1WCGA 2WVUA 1W2VA 3W6LA 3OZPA 3PW5A 3NR0A 4AZGA 3A4AA 3DH7A 2PDFA 1UR3M 2P5NA 3A12A 4IPPA 3CQ0A 3STFA 1JF5A 2FHFA 2EPKX 2FTPA 4A35A 4JX5A 5CPOA 3GK0A 4LANA 2F6UA 4QAIA 3THUA 3TMLA 2IQDA 3CZLA 1LL7A 1B90A 3NSXA 3RR4A 2PFHA 4JEJA 4ACZB 3G1VA 5AHMA 1V0MA 5G4EA 3KOXA 4YCPA 8CGTA 3OIXA 1KFCA 6ENLA 3EDKA 3AISA 1DWJM 2CLHA 4B5VA 4MYAA 3A5FA 3QZ6A 2IPGA 1B31A 2JEPA 2PD9A 3MR5A 2OLAA 4XBSA 1HG3A 4AYGA 2JEGA 1PX4A 1VCVA 3WEOA 2DZPA 3B4UA 1N56A 3S46A 3EZ4A 1A49A 1BKHA 1LRNA 3SUSA 1ZL1A 2W9BB 3WUEA 2G3FA 3GAYA 2PTXA 2I1OA 3CU2A 4L6HA 5CXPA 1G67A 3KXQA 2V5JA 1W17A 4H00A 4WSKA 1DJXA 1MXDA 4ADUA 4Q8VA 5AYIA 4K1WA 4KESA 1DQUA 1RQEA 1TZ7A 1V08A 2ZUWA 3WH8A 5CH9A 3G24A 4JS3A 4EBCA 4AIBA 4S39A 4M7TA 4RR4A 4B4HA 3H55A 4B5UA 3NQ8A 1W56A 3DENA 3MKCA 3T8QA 4FEZA 1NVMA 2I16A 2QUUA 3GIYA 2NWRA 4JQAA 2XPKA 4ZXLA 4AD4A 4UXDA 4J3ZA 1B3YA 4MGGA 5CZKA 1V3IA 4JDBA 2VXNA 5L1IA 5CPTA 3HV8A 2PBOA 1KGWA 3GAKA 2WC7A 3P5ZA 1ZAIA 5A5WA 3WLQA 1V6WA 4MHBA 3WK3A 4RLIA 1K9DA 2OZ8A 4DEZA 4K39A 2J8FA 2HJPA 5CC7A 4CCEA 4JCLA 3GV8B 3SECA 4R7JA 2C13A 4IRKA 3H2OA 1J11A 2P0OA 4O1AA 1UZ1A 3E2QA 3A13A 3GQCA 4D6EA 5I03A 2ZXAA 4KEZA 1M1BA 1YTKA 2UVUA 2EG6A 3WNLA 4I90A 3QMTA 3IJ8A 4GABA 4HMCA 2F84A 3N2XA 1IWAA 2Q3OA 2IS7A 4ECXA 4RE2A 4AHQA 4XKYA 3UPWA 4ES4A 3T08A 3GVQA 4NJJA 3H2NA 1H7XA 4DHGA 3T5LA 4L64A 1N8FA 4WUIA 1PZ0A 4MKNA 3MWCA 4AAJA 3I7RA 4FALA 4NILA 5CC3A 4PRTA 4BQ5A 1BXCA 4HNNA 1IT0A 1FHLA 4HCLA 1D3HA 5ECUA 2VC5A 2E0PA 3KBNA 5DQHA 3OEXA 4KPLA 4OOUA 4LAUA 3A3WA 3GNNA 3MHUA 3G6MA 4Y8EA 1TVPA 2P1FA 2OR2A 1NAL1 3NQ2A 3CH9A 3O9NA 1QOQA 4KGLA 4W89A 4HYWA 1QO2A 3T42A 3KTCA 2PU1A 3BO9A 4AG0A 2XGZA 1SW7A 3R10A 1Z32X 2OYMA 3GR4A 3MMWA 3NZ1A 3MR3A 1IEVA 1JD9A 5HA7A 2Q02A 2XUCA 1S5TA 2OEMA 3PS7A 3C56A 4PTXA 2QCDA 3PBGA 3SR7A 1OD0A 3VNDA 1W3KA 2ZRVA 3AHTA 4DBDA 1ENUA 2QDEA 1JUEA 1GOOA 4YHEA 2WHKA 2X0HA 4AY7A 4ECRA 5D33A 1RD5A 2ONEA 1M04A 1XIDA 2ASHA 4PR4A 4QE4A 3CTTA 3ANYA 1VLWA 1T0OA 4LUIA 4UTTC 2VURA 4P7NA 1XSKA 3BTNA 3CV7A 2DT0A 4PMVA 2EPOA 1OX4B 1O5RA 3GG0A 4OU1A 2G3IA 2DVUA 4NI8A 4DLMA 1E4NA 1AFSA 1ZLPA 2V5DA 2VEFA 5DN1A 4LUJA 2GJRA 4MSSA 3VKCA 3TJXA 3KL5A 3ONCA 3CQHA 2OFJA 3S2MA 1ZHAA 1UOKA 3STPA 3UVAA 2VZVA 4GGHA 2EJAA 4LSBA 1UUQA 2ISDA 1S2UA 3Q37A 4UTJA 3VZXA 3VU2A 1JYXA 1RJPA 1U5VA 5KG1A 3PZOA 4LH8A 4JYEA 5B7YA 1ITUA 3PY2A 3ATYA 5HMDA 1DP0A 3N2TA 4W85A 2W9CA 3WK0A 3PJXA 4LUSB 3ZR5A 3USZA 1ISYA 3AIUA 3GFZA 2OEKA 3O2LA 3UJSA 4IWWA 2W62A 4V2XA 4YTUA 1N7KA 5CPLA 3WNPA 1BVZA 4XZ9A 3CIXA 4PYSA 4E3TA 1JG9A 2ZWYA 3FHAA 4PEEA 4DUXA 2FYMA 1GNXA 1YQ2A 3S0CA 1UROA 3R89A 4ZQMA 3SGUA 4O4VA 5CGMA 4DJEC 3QF0A 3V4BA 5E9AA 3U2EA 2RJGA 1TB3A 1I2RA 1W1VA 5KFIA 1TTJA 1O4UA 4TIMA 4AYSA 2VI0A 3BMXA 4QROA 3MWAA 3QTPA 1CPUA 4UNLA 4A8IA 2GZXA 4K2SA 5C54A 4PA8A 2D0FA 1LQAA 1TREA 5EFDA 4QX4A 3WLIA 3D3AA 4MKVA 3NDYA 1EGVA 1H50A 3E0IA 4H2HA 3IN5A 2VX6A 3RB0A 2GDUA 3LDVA 1XLBA 3PTMA 1U22A 5CSUA 3UETA 2WHLA 3EKGA 4H8VA 4TXEA 4U33A 1MRAA 4C6FA 4FR6A 5C5JA 2ZUMA 1O12A 2BG5A 4EWND 5D32A 2J74A 4ED2A 2ZZ6A 4EX4A 2EBNA 2QR6A 3QW3A 4FR1A 3NPVA 1PIGA 1AQFA 4FLSA 2GLKA 1W1IE 3TNBA 3B8TA 4EAMA 5J5RA 1PBGA 5A6BA 3NAVA 1LUCB 2XHYA 3B9AA 3R7MA 1ITCA 1RYRA 3TTOA 1JFXA 4G7EA 3S4TA 4PULA 4CD6A 4Z08A 2DZTA 3PJTA 3I7SA 1TVNA 5A2AA 1JDCA 4C1KA 1CI1A 5LNWA 1ZJIA 1MDLA 4ZODA 1OJXA 3PBWA 4RPPA 1YLVA 5GJMA 5T9CE 2BV9A 3UCQA 1J8VA 3H4WA 5KT4A 4JHZA 1V5XA 1JZ8A 3E74A 3GIQA 1QI0A 2H90A 3FN9A 3AHYA 3G1YA 1THFD 2VDGA 4PMQA 3FVMA 3T09A 4NZ3A 4L56A 3WCZA 5C2CA 2E9LA 3PWIA 3G0XA 1U5HA 3P93A 4A2SA 1R38A 4JCMA 2VYOA 1SZEA 3RB3A 4A8LA 3OVGA 3VC6A 2BHUA 3A9IA 2VOMA 4W9TA 2HS6A 4P8UA 3MPGA 3KVJA 4D8ZA 4KETA 2BFGA 2HPIA 2IBKA 3CL6A 3CQIA 1J93A 1WBJA 4GJ1A 3ITOA 4HD5A 4Q8WA 3SY1A 3SCVA 4K68A 4J9LA 3CC1A 3YPIA 2YB1A 3HFTA 1UR8A 2OSXA 3BZGA 1I1WA 3EGJA 3EOSA 4ROQA 1EA9C 4AW7A 1GYNA 2HMCA 2Z00A 3ZT6A 1PZ2A 3THDA 1J4EA 4J3TA 4E38A 1F6PA 5CZJA 3KCOA 3SQLA 3OGSA 1GVIA 2ZZ3A 2A21A 2PDIA 5HMEA 4UZUA 2PE4A 1TE1A 1BXBA 4XZLX 2FFIA 1JDFA 2XVKA 3PAJA 4OFCA 4ECZA 4I9JA 1TPDA 5D37A 1EOMA 3BLOA 2E28A 1R30A 4WGHA 2NVAA 1FP9A 2VHLA 3IJLA 1ALDA 5A95A 5DEZA 4QCEA 1MWOA 4W4QA 4M6QA 4IGNA 1FWTA 3RITA 2NT1A 4ZO8A 4YP3A 1XRTA 2W79A 3ANVA 5L1LA 3BOLA 1H1NA 2DT3A 4L80A 4JD4A 3TYAA 4MUZA 3UNDA 2WSYA 1NDZA 3HGRA 3CZ8A 3A6OA 4V1XA 2ZE0A 2FJUB 4NSBA 3C6CA 1LOLA 3S5ZA 5M2FX 1S5MA 5HWJA 1GEQA 3I3BA 4C5YA 1PXGA 4GXPA 2RKXA 1M6JA 4UTWA 3M9MB 4GVHA 2C15A 4ML4A 4CVWA 3L65A 4Y6GA 2TAAA 4QM1A 1U5JA 4IL2A 2GJPA 1XIJA 2C79A 1W9DM 4JTEA 1I2NA 3AMLA 4C6OA 1RA0A 3QMRA 1WZLA 3LV6A 1KRMA 2WC4A 3CH0A 1VFFA 4IX2A 1KXQA 1OFOA 1R47A 4LAKA 4L4OA 2QJGA 4I5XA 3MJMA 1BG4A 3EPOA 1S46A 2OO6A 1VCGA 1B3OA 2WYSA 4FI4A 5HANA 1DQXA 2DORA 4PMXA 4R33A 1UPMB 1WZMA 4Q4OA 1ZJHA 3I6RA 3NTYA 3PZVA 5ABHA 3C2VA 1J6PA 3H4XA 4QJ3B 4DL5A 2HVMA 3QPEA 3IV8A 2AQ4A 1SQ7A 4L61A 3O15A 3M5YA 3BQ6A 3E0FA 3T44A 3GVWA 4O54A 4UR8A 3JZEA 3ZJ8A 3DFHA 5F1VA 4EWJA 4KFNA 3OU8A 1EYWA 4MB4A 3XINA 1B3WA 4YTSA 2Y89A 3SUUA 3TJLA 3OA3A 4Z1AA 3QM3A 1LP6A 3WQ8A 3NL2A 1UD8A 2QKFA 2YYUA 3RM8A 3B0UX 2WO5A 4KS0A 4FZIA 2E5BA 1RJRA 4GC3A 3TSDA 5EDWA 1UH3A 2HROA 1EEPA 3SCTA 3FS2A 1NP2A 3KCJA 3UWEA 4UTIA 3CTLA 3EDJA 4KWUA 5KG3A 1P0KA 2XC9A 2ZXQA 5AHFA 1OHLA 1CYGA 1GQIA 1IWBA 2WWCA 3JRKA 5A8QA 1FH7A 1WOAA 4WKAA 5HULA 5BRPA 3HJEA 1XBXA 3W53A 4K3ZA 3HPAA 1CGUA 3ORWA 1VYSX 5I3IA 2G95A 5A1AA 2VM8A 4P8XA 2BP1A 1JPKA 4GVIA 1VYPX 2CLEA 2Z28A 1S2AA 4XX6A 4DJFA 2E9MA 3T40A 4HCHA 2QUNA 4AHPA 3QGVA 3BZJA 1UBPC 1AMYA 1CBGA 1GPWA 7XIMA 4DNMA 3MHFA 4HNTA 3C4UA 1R9YA 5KT2A 4H2CA 2VFGA 1L9WA 2POZA 3JS3A 5H8UA 4JIRA 1HL2A 4IMAA 5EPDA 3ZR4A 4LCQA 1E9YB 3NQ7A 2W7PA 3ITXA 3BQ2A 4DPPA 2V4RA 4D6JA 3PZUA 1FWHC 1KLZA 2ASDA 5GNZA 5HDRA 3SJ3A 4EXAA 2PWDA 3LMYA 4JNYA 2PDXA 1OEPA 3WBYA 3WEZA 4AWEA 3N73A 2JEQA 5HNNA 3G3DA 4O53A 3PF3A 3SO7A 3KM8A 4RUCA 4GWEA 1DIOA 4RZBA 3VFLA 3THCA 1K1QA 2BOGX 2GSEA 2UY5A 3GXFA 3REQB 1D8WA 3CWNA 3G77A 1BKSA 1UWIA 1HKIA 1QI4A 3UCDA 4K8HA 2C14A 2H8ZA 1RCOB 1UA3A 3GQYA 3P14A 3VOFA 5KFBA 4CCCA 3ABRA 4UQAA 2WB5A 5KT5A 3WMSA 4RXGA 1A5NC 2WM0A 4O0KA 1O95A 2HE5A 3AYTA 3URBA 3TN5A 1J9YA 3KL0A 3ZSSA 1WAUA 3OYZA 6TIMA 4JTJA 1ZJBA 3ITCA 3NZQA 2J79A 1T99A 3LCGA 3PULA 3AS2A 3ZQ9A 2WWDA 4J9SA 3QOMA 1PKLA 3NO1A 3TN3A 3UXDA 3LK6A 1GQKA 2VVSA 5KZEA 2Q6ZA 4CQBA 4DUOA 1E5NA 2J7DA 1UMLA 2J25A 3O7UA 3IAQA 3KRUA 4HJWA 5M03A 4AD2A 1E1FA 3AYRA 3T2PA 3OP2A 3WKZA 3B9DA 2PPGA 5DCDA 3ZT7A 4KKXA 2E09A 4AIUA 4KRTA 1V3MA 2WKJA 4W5UA 4ED0A 1B5TA 1Q7MA 4K8EA 1UB3A 1OC7A 1LLWA 4JTTA 2V30A 1Q6QA 1X97A 3SI8A 1XICA 1S38A 1PTDA 3KWXA 3B03A 1K02A 1UWAA 3W1RA 4CVUA 2OX4A 2F6XA 2C2DA 3T9PA 1C9DA 1DBTA 5F2LA 1CB2A 3S1VA 1GVYA 1IR2A 1SZNA 1OCNA 2CLKA 4LRTA 3LTPA 4Q22A 3UY8A 1H63A 4F4RA 2CNCA 2ZRYA 3NQEA 4GH3A 3DFQA 5I0DA 3LM3A 3PJWA 4QWCA 3BPWA 3NEHA 1I2PA 1OIMA 2RGMA 2NV9A 4HU3A 2A7RA 3PG9A 1BG9A 4QIUA 4BWLC 1EXBA 1UA7A 3ZWTA 1VIWA 4GUIA 5LA1A 3CPRA 4PE8A 4AVOA 3T0DA 5KFFA 3ME3A 4L1XA 3H6OA 2XGPA 4WKHA 1OZMA 3BXWA 2YXXA 1WDSA 2ZA3A 5EWFA 3B8IA 2TYSA 4H7ZA 2Z26A 1R3YA 3TH6A 1GKRA 1E0VA 3WLRA 1VQTA 1ZBWA 1ZCCA 1FH8A 2YFNA 2AL1A 3N9KA 3U9IA 5LNVA 3C3UA 1XYLA 3PWAA 1HJUA 4G2DA 4BR1A 4M6VA 4YIWA 4B2DA 1FWJC 3MZNA 1CLXA 1KV5A 1E0WA 3W7DA 1KGUA 5EMLA 1JFHA 2OGJA 1VBJA 2RFGA 3NSMA 4IQDA 1H41A 2PLMA 3CLMA 5IDZA 4PTDA 5B7ZA 1XRFA 2D24A 3V6HA 3W84A 3T2OA 4AX7A 3VMPA 4UWMA 3TDFA 3LV5A 4ZCWA 1WP6A 3LX9A 4QGCA 5KFNA 4PB4A 3S6DA 2XIOA 3BJYA 3MUY1 2FZMA 3B9NA 3W1AA 3U7BA 4UFIA 3CAKA 3TTQA 1I0DA 3LYEA 4GYKA 3UXKA 4O3OA 1FX6A 3SRDA 3W70A 1LL4A 3R25A 1VEPA 2EJ1A 3N2CA 3C0JA 4NF7A 3DBNA 4FP1A 1QPNA 4OBTA 2V9WA 1XIBA 4KERA 3H7VA 5I06A 3QQ0A 3W2LA 4DI8A 4JKLA 1TWWA 5EMKA 4LAMA 1GYLA 2P8CA 3V35A 3WUGA 3P3BA 1OWQA 5FKYA 2HCVA 3WD4A 1H5VA 5ABTA 1JCLA 1XSIA 4DX3A 3FEQA 5A8NA 1BRLB 3CL8A 4UCGA 1ADSA 3E12A 4HMNA 3M44A 4IIGA 3ARSA 1LG2A 1DOSA 2FVKA 3WZ0E 4HK6A 3FHQA 3I6EA 4DJED 2QAFA 3T5KA 4NJHA 3EPMA 5AOUA 4C6DA 2VRJA 4GRSA 4OBSA 1BVWA 3RX3A 4F0RA 1EO7A 3WF0A 4WY0B 4XZBA 5AZ1A 3PJUA 1FWFC 1XL9A 1PX8A 3TKFA 1KW1A 1C8YA 1VFUA 3GIPA 1DWFM 1KFWA 5T91A 1R6WA 4D8AA 1K3UA 2QPSA 1JYVA 1AZ2A 3RRXA 2PCEA 4HGXA 4PUWA 4AFYA 3QHNA 3U7VA 2VELA 3B0PA 1B30A 1FWSA 3FXYA 1QDSA 1H60A 3L4WA 3UFYA 1KFEA 4HTBA 4ED8A 4D1JA 9RUBA 1QI3A 1KR1A 2A5HA 2HDJA 3TV8A 2GDQA 2I14A 4JFWA 3LPFA 1KCZA 3EEGA 2E5DA 3QXBA 4HBKA 3SAZA 2Y70A 3GIIA 3S3GA 3URNA 1TV8A 1S3HA 3JW7A 3TQPA 1ZAJA 2IA6A 3ARPA 3N4AA 5FOOA 3LHWA 2BVTA 2RUSA 1BSIA 2W91A 4O18A 4AUBA 2OYLA 3S8HA 1M7OA 1RYSA 1H11A 2D22A 3QY7A 3UZZA 2R8WA 4UOZA 3FA4A 4U6PA 1OINA 3R1ZA 1B1YA 4HA3A 3OVQA 2Z27A 1KO0A 5G1TA 4FMVA 4HIBA 2DV0A 2J8GA 3CO4A 1JPMA 3VGEA 5I2UA 1X38A 2G3MA 5JUVA 1HFBA 3NSNA 3BMVA 3FEMA 1JNDA 3VDBA 4FHAA 4K7YA 1FWNA 5IM51 3O16A 4QLKA 1XDMA 1GVQA 4H3DA 1JXKA 3CNYA 4GHRA 3KBSA 5A6JA 3PZIA 4Q8OA 1J0JA 4L9XA 2PSNA 3NO5A 3WLJA 1VFMA 3VOIA 1F05A 3NQGA 2GWGA 1TPH1 3N12A 4YMZA 4ZEPA 2B4GA 3IK2A 2CZDA 3QJAA 3O6DA 1PSCA 1R86A 4WZHA 2ZZ5A 1C3FA 3TQKA 2WNZA 4HNCA 1FDZA 4AF0A 2V3FA 2OJPA 3MR6A 1ZFJA 4QE5A 3AS0A 3C2YA 3WN6A 4AISA 1JCTA 3RILA 1WDPA 1ITQA 4DJDA 3M5XA 1BQGA 1XS2A 1JPHA 4HYRA 3AJXA 3GH4A 3QKZA 5KG7A 2WJEA 3M46A 4X2PA 4OTKA 2CLPA 4J9RA 5KINA 1JEZA 3AYVA 3S5NA 1OADA 3G8RA 3OVPA 4QEHA 3O63A 4HNLA 2WJDA 1B54A 2DZUA 4DBWA 4AZCA 1NEYA 2XIJA 4PMJA 3VIPA 2W5FA 5REQA 2PLJA 4TQSA 5DO8A 2QMKA 4OECA 3RR1A 3BSMA 3OODA 3IUIA 1SZRA 1UP2A 4HU8A 3N6HA 4ENLA 1RP8A 1XF0A 4AZ5A 4R53A 3W1UA 1PB0A 1V7YA 1KM0A 2VR4A 4OV9A 4IQLA 3SUVA 3UR2A 2VGBA 4LU0A 4O1DA 2YA0A 2CITA 3IRSA 4YQWA 3ZFHA 3SBFA 3RCMA 4M19A 1OFEA 2BGQA 5E1QA 2AMXA 3DFTA 1HJXA 1IZCA 5FL0A 4NX5A 1TMLA 1M65A 2I57A 3QQWA 4B5TA 4MB1A 2C1HA 3W85A 4H9MA 4MJMA 4JHOA 3N9RA 1TA3A 3VGDA 3LS9A 4EYIB 3NPWA 1SFSA 3CZKA 1TRDA 2J4GA 4IP7A 1GZ1A 3DHPA 1OFQA 2BODX 4C65A 2ON3A 1ESWA 3RLVA 2CIPA 1KC7A 3VZYA 4KEUA 3JVAA 3ZIZA 1QUMA 2Z7KA 3LENA 3H4BA 4C1NA 2P53A 1H0IA 3GIMA 1M3UA 5EMYA 5DANA 3RF9A 3MP3A 3I4KA 3QC3A 4O17A 3RGTA 1WZKA 3RBDA 4KGJA 2J7GA 1GG1A 4FF5A 3B9EA 3SCRA 2G50A 3PBMA 1EFZA 4GI8A 3VD7A 2DU2A 3VILA 2Z2BA 3SQSA 3ITGA 1VFOA 4LUTB 2PDKA 4Z2JA 1GHSA 4DQWA 1W1B1 1KM2A 5A2CA 3GC2A 1LWHA 4QAWA 4U5KA 2X1RA 1OABA 3T55A 3DESA 1D9EA 2VZSA 1EP3A 3Q45A 4U31A 3M5VA 4HOZA 3KCLA 4IMEA 4MFDA 5C0QA 1I6NA 3NG3A 2RDXA 4QS5A 1YKWA 1N82A 5CSSA 2VRKA 3RLHA 5J8LA 3N9SA 1N8WA 3QV9A 3OLDA 3G22A 1K8ZA 4HA1A 3TR9A 1LF1A 4RZ5A 2YPIA 3NQCA 4PODA 3W75A 3KS6A 1RLDA 3WQPA 4TU1A 2GUUA 4IX0A 4J3XA 4MIMA 4H8UA 4ZQCA 3POCA 3WJXA 4QE1A 2QCFA 3NNTA 5HK4A 4ECQA 1P1MA 2XIBA 5AZ0A 1S10A 3H4DA 3RHGA 4U2YA 1CIUA 3PUDA 3M0VA 5LKYA 2XIQA 1F3XA 3MT1A 4XZMX 3LMZA 2CZEA 1WPCA 2D1ZA 1M53A 3PBUA 3ABQA 1R3RA 1CLKA 2NX9A 5DY3A 1PWMA 3UA4A 1H09A 2PGWA 5BXRA 1N55A 4XISA 4JL2A 1QATA 5GNXA 3TLLA 3VOJA 3CHFA 4LT9A 1DXIA 1YPIA 2ZDSA 3GIJA 2AL2B 3W81A 3I7QA 2E6DA 2WCGA 1QK0A 4FS9A 7ODCA 4ECUA 2V82A 1UKTA 1BPLB 2ZUNA 3IJ6A 3MCOA 1Q6OA 4GUJA 4TO8A 4NVTA 1I9CB 1ZBCA 4PZVA 2NSXA 5A6BD 1QI2A 3T6CA 4ACYA 1YNQA 2CKRA 2I5IA 3GNOA 1W5PA 3O3RA 5FF3A 3KLLA 3NVDA 4JHMA 4MZ1A 3IV3A 1FDJA 2DSZA 5DRCA 3W7HA 3IPWA 3M0YA 5SWUA 3TN6A 4XAGA 4IGMA 3ZVIA 2OZ3A 4DIAA 3ATZA 1E56A 1MNZA 3KRBA 3UPBA 4RE4A 5MHBA 5AC4A 4DM2A 1DTUA 1RJQA 4GC4A 4ZOEA 1A4MA 3UBPC 2OSWA 2Y8VA 4JICA 4ZZ9A 1C9WA 4FNQA 4JIIX 1EWEA 3RX4A 4WHBA 5JMUA 4LAZA 3SSJA 4OT7A 1VFTA 1Z69A 4FXSA 3HB9A 3IJIA 3MTWA 3LA4A 3NOYA 1TTIA 4AVNA 1R3QA 3PZPA 4UQBA 1G4EA 3LHYA 2GQ9A 2ZDRA 4YXGA 3LM7A 3G1SA 3WNKA 4FBUA 4PCNA 4LVGA 3GR8A 3M64A 2D2OA 5LHFA 2EQDA 3CUFA 3L12A 4G1KA 3EWDA 2NXGA 3S1GA 5D02A 1PZ1A 3TONA 4GMEA 4UFKA 1T8XA 3RPTA 1SJAA 4M6UA 1GOQA 4G9PA 1TQXA 2PC8A 1B3XA 1H4PA 5IDIA 5A8GA 5FJRA 4AWTA 1MFVA 1XGDA 2J9YA 1MZRA 3LRMA 4PTMA 3GBDA 4JIQA 1Z42A 3CWOX 1OGGA 2VA3A 4TOQA 3TC7A 3THQA 2I9EA 4NZCA 4P8WA 5JBDA 1MQQA 4GNKB 1KV8A 4IGSA 3GKFA 1DJQA 3P81A 3VABA 3VGGA 3W2NA 3VDGA 4CNSA 2TPSA 3P5YA 5HQEA 4QJ1A 4KWSA 2ALZA 4XZHA 4XK2A 3CUZA 2VP8A 4YYCA 4CU6A 3IIZA 3F5KA 1EIBA 1JRBA 2VC9A 1T3NA 4H7VA 1HVQA 1MW3A 3OQEA 4ZB2A 2OOGA 3TW6A 2CERA 4YR2A 5AC8A 4F2UA 1XFCA 5AYXA 4LYQA 1XD1A 3EMZA 3WX7A 1Q4NX 3CHDA 1XH1A 4MDPA 4D71A 2CLLA 1RQBA 5D9PA 3AS1A 1R3WA 2VJXA 1PEZA 3SY5A 4PBEA 4C5ZA 4JX4A 3GDRA 1W3LA 1CZ1A 5KFWA 4ED7A 1DE5A 3MI6A 1KD0A 4MOZA 4FPSA 1EJWC 3R58A 2OB3A 1OGBA 3PFRA 3N17A 2BX7A 1EWDA 4XUGA 4J35A 4HHPA 3VKKA 2BMBA 4UQEA 2FKPA 4B5NA 4HNOA 4PCSA 3T0AA 2Y6ZA 4NRRA 1TO3A 2PWEA 1CXFA 4M0XA 5IHSA 4TV6A 1XSJA 1ODUA 3P84A 5EFFA 3W6MA 3CBWA 3K46A 1NWSA 4JYFA 4YL2A 2EPNA 4BQ2A 4UTFA 2DFAA 4OJYA 3E5PA 2X7VA 2YL8A 4M8UA 1J96A 1GVOA 1MQPA 2C2EA 1V02E 4BHYA 1KM1A 2BS9A 3A3XA 3L4VA 1TWZA 3WDIA 3WBAA 3QTGA 2V4QA 2BVWA 2HSAA 3AQUA 5BRQA 3WNOA 1CGWA 1UBSA 2JKPA 2IPWA 4GK8A 1ONRA 1TRIA 1S2CA 5FACA 3ICJA 2HS8A 3AFBA 1A5AA 3W25A 1LDCA 5BROA 1RSCA 3MVTA 3S83A 2Y5EA 5GVJA 1XKYA 2Y2WA 2NQHA 3SSZA 2UV8G 1T8QA 3TQ0A 4NNCA 2JQXA 5GJNA 4FIRA 1AW5A 1XBVA 1Q6DA 4XKMA 2PTZA 2V5CA 3R11A 4RZ4A 2FLLA 3RLUA 4AB4A 4P7LA 2J7BA 4J7RA 4XIMA 5KFVA 4ZTXA 1JQVA 5KG5A 4MMWA 3H22A 2UVVA 1UHVA 2GGGA 4H4IA 4WVXA 1S97A 2QCHA 1EQCA 4HB7A 4Q33A 1PTGA 2ZE3A 4URIA 2VTFA 1A5KC 4UQCA 3SY8A 2QF7A 4L65A 2DPJA 1D2KA 4L9ZA 2FHBA 4CNPA 2DJLA 4YR0A 4O19A 1V02A 3W7OA 2QCCA 1QFEA 3ZJ7A 3SDOA 2GSJA 4B5XA 2OG9A 3UG3A 3RU8X 1KWKA 3TA6A 2BGNE 4JIHA 1FHUA 3VGFA 3WFZA 4QBXA 1IEWA 3W6YA 2XJ7A 3QV7A 3SQMA 4B5SA 1GVEA 3B04A 4IZGA 3BCJA 4N4QA 3HMJG 3NQVA 1XLCA 3UZWA 2XH0A 2V2DA 1AJZA 1W91A 2DZWA 1A3XA 4O0QA 4M6PA 5CLTA 4W84A 1LQ2A 3SCQA 5MKGA 4JBRA 2XSBA 4R7WA 4XBJA 1XIMA 1E1CB 1M5WA 2GQ3A 5CC6A 5KFEA 3VCNA 3L68A 4UR9A 5KFMA 3W2UA 4BEUA 3AICA 3BE7A 1SO3A 3G6XA 4NJKA 1UKQA 1W32A 3I3EA 3NXFA 1FWEC 4GO8A 1XLDA 1DJZA 1OG0A 3N13A 5JIPA 2R1NA 3VNLA 2AQWA 1OK4A 4NG3A 5D9NA 5A8PA 4KCWA 3UG5A 1JQXA 5AECA 1GQJA 4V15A 4NLGA 2E40A 4M80A 4LTSA 4YPJA 3TU9A 4MWAE 3MYPA 3BAWA 5BOEA 1PPIA 3MV11 3F03K 1VBUA 4F40A 3OHAA 3QLLA 2ZZ1A 2KAUC 3TSBA 1HW6A 4GC7A 1LYXA 5GQBA 1VRXA 3ES8A 2GGEA 3T78A 3VD4A 2E1WA 4IR9A 2VCBA 5EU9A 3W0KA 3N4EA 4C6IA 2OKOA 1C91A 4JY9A 1VD6A 4V27A 3ZS4A 1GOIA 3LCIA 2GVJA 1XLLA 5CZTA 1WXZA 3K5XA 2HRWA 4L4MA 4RNIA 3DHDA 4QXIA 5IBXA 5KFTA 3LG3A 3MUCA 1S5WA 1W31A 2W0UA 4Q8MA 1K77A 3IRDA 3DCPA 1AZ1A 3S42A 3QYSA 3EWWA 3UD6A 5HWNA 4RU9A 3CQJA 2ZRXA 4HOXA 4LF1A 2EO7A 3T0TA 1V3KA 2FVMA 2D2JA 3ARRA 3H2CA 1XLHA 3B0YA 4ZOAA 2I56A 2WQDA 5HJXA 1DJIA 2YCLA 4J27A 3WL0A 2CFFA 1H2JA 3VIFA 1MNSA 5KMYA 1QVBA 2B0MA 5I77A 3WH6A 4M29A 2ALRA 1I60A 6TAAA 3DI0A 1FA2A 2NZLA 2YA2A 1PKYA 3SI9A 1WXJA 3GNXA 4O16A 3L7RA 3AXXA 5E0FA 3HBLA 1YDNA 3ZVHA 4HTYA 5XIMA 2PI6A 1VBHA 2BQRA 4JV1A 3N3TA 2QPUA 2OQHA 4LRSA 4DWSA 5IOBA 3M1ZA 4F2TA 2B7QA 2J62A 3EEZA 1AH3A 1KXVA 1N2VA 4S1FA 5EL1A 2KZHA 1RY0A 2VUNA 4DF0A 1XLMA 2XSAA 3CB8A 2XN0A 5I00A 3C61A 4WOZA 4IFKA 5A69A 3MFIA 3M4HA 1S5NA 3U4FA 2ZXDA 1MXGA 3GXPA 3TTSA 3C0QA 4FOKA 1R2SA 2WK2A 4J9NA 1JDAA 3K30A 1E0UA 2RH9A 4JIEA 3BG3A 2OLHA 2OKTA 1KXHA 5C9UA 1ZAHA 1UKOA 5TQLA 1AQHA 3U2CA 3MKVA 2WMGA 1W5MA 2WSQA 1XYZA 3L67A 1A5CA 3BG9A 3E96A 2ISSA 4NI3A 3GXMA 1FKWA 2GJXB 2Z1KA 3CYVA 3NL5A 2YKKA 2WLYA 4FK9A 2XFFA 2R9RA 1UUOA 4X9SA 3RXZA 3T8LA 1X6NA 4PB5A 3QR1A 4AX6A 2BGSA 4OVXA 2D69A 1XLGA 3M43A 3LHUA 4ED3A 3V18A 1E3XA 1QBBA 5K9XA 1X1NA 3DERA 1GKPA 4XAZA 3FJNA 3V36A 1M7JA 3LLFA 1T7LA 4KH2A 1QR7A 3UZYA 2PD5A 2X2YA 1XDJA 4LYPA 1VPYA 2W63A 3GXIA 1V8EA 3N6JA 2HE8A 3KBMA 3QZEA 4JTAA 5ABFB 3KVLA 2QV5A 2WV8A 4O8RA 4FB7A 1F6KA 1GONA 1YTDA 2QEZA 2F61A 1UYQA 1S9FA 3CUJA 4H01A 3S5OA 5DQIA 1HGWA 3BAKA 2R8HA 4MY9A 2PDJA 4KWOA 1T6MA 1YBQA 1W6TA 3VIIA 4JL1A 3BV4A 3OTRA 4WLCA 3H26A 2Y1HA 4Q7BA 2QV4A 2C71A 4IL0A 3E1F1 1G0CA 1HNYA 1J12A 3EPNA 1W1ZA 4UQ9A 3WQ6A 3NVTA 4TV5A 2CLOA 3PPFA 3VNYA 4IG2A 3C86A 4B16A 3WF4A 1P48A 3OLGA 4LEQA 2OO0A 4WK9A 1R3TA 2YBUA 1DORA 2R6OA 3NOEA 2GJNA 2GVYA 3VOHA 4M1BA 3IGHX 4IPJA 3CHCA 1JYWA 2RDTA 3CMJA 1XH0A 2V6AA 1YPXA 2OTDA 1SJBA 2DP3A 4PL1A 1I2QA 5T9BG 1NJJA 2ATSA 4NAFA 2R8KA 1XCFA 2WNNA 5F4WA 1TJ1A 1V6UA 5DXYA 4ERAA 1HZYA 3M7SA 4A3UA 4XIAA 3JR2A 3RX2A 5AVHA 3WLMA 2WVVA 4B15A 2OQLA 4POCA 4LW7A 1EGMA 4E5TA 3E0WA 3DOPA 3MO4A 3IGXA 4P2VA 2Y5JA 5HNTA 2PLCA 1LM1A 2GOKA 2QZRA 3NURA 4RNHA 4DAIA 3DFNA 1WB0A 4IPNB 3UXLA 1IEQA 3D47A 3DKJA 3OSNA 1GZJA 4FAMA 5BRBA 4U10A 3GVVA 4GNVA 4JTQA 4KCVA 4HSNA 2FHCA 4M5PA 4MF4A 3DFPA 3B97A 2YLLA 2GK1A 2QMJA 3TWBA 3ARXA 4BCEA 2A7PA 3CMGA 2FMOA 2Z24A 3PB2A 2H9AB 4DO4A 4V1YA 3ES7A 1AQ0A 4L1WA 1PKNA 2Z1VA 4EE9A 2GUYA 2PDGA 3G8EA 3CHEA 2IXUA 2WMJA 3GGMA 3KW3A 3LSBA 2H3DA 4EBEA 4QFUA 1UMYA 1M01A 5C8BB 1CDGA 1Z7AA 4RXFA 5I09A 4LBRA 1JJKA 2FB2A 1H1YA 5A6TC 1QPKA 3QQ1A 1DWAM 3AS3A 4J4KA 5TD4A 4CUCA 1J6OA 2C91A 4I3GA 3KWSA 7TAAA 1HT6A 4A21A 2BWGA 3UJEA 3I10A 3TFXA 4R9OA 1P6BA 4N4PA 2BSLA 2G96A 2W66A 4UOQA 2PRLA 2NLYA 5IXEA 4JV0A 3P6LA 4YS1A 4OZOA 1EJVC 5DQPA 4MZYA 2PC4A 2UY2A 4MNJA 4AU0A 4DJDD 3ZSTA 4F9JA 4DNHA 3SRKA 3W38A 5HJYA 3NDZA 4O3SA 2UY4A 1JUKA 1G4PA 4LB3A 3KUMA 4TMBA 2WNWA 3A22A 3LBCA 2FQIA 4Y90A 1PCKA 2WJZA 3PBYA 5KITA 1EDTA 3GHRA 2B7PA 4MWAC 4ATWA 2XFYA 4FX8A 3MCNA 4N0RA 3EA3A 2NQJA 2FLNA 1NOFA 2VENA 3TP4A 1OT2A 4ATDA 4QQUA 4PMRA 3L23A 4WSJA 3EPIA 7CGTA 4H1ZA 1GORA 1QASA 5FA5A 1OYAA 4IIHA 2HTMA 3WENA 2QUMA 2ZX9A 4QS6A 4LF2A 4WJEA 2PAJA 3SN4A 3QFEA 3FA3A 4YHGA 4A05A 5LIUX 3UJFA 3HURA 2O92A 4GI9A 3LTSA 1EX1A 2NXIA 1EJXC 4CQDA 1EC7A 1VRDA 3W7KA 2ASJA 3BW3A 4M56A 4JY8A 4DL2A 4JN7A 1IYXA 3VK5A 3WJWA 6REQB 3TXZA 2IKIA 3S2LA 3I6TA 1RP9A 1R9ZA 5KFZA 1NSJA 1RXOB 2WCSA 3O6YX 3GH7A 2PGEA 4HHLA 1E72M 3AC0A 3EDFA 5FEPA 1AL8A 1MDRA 3HFYA 1P6WA 4A8NA 3UWYA 3NA8A 5HR7A 3NQDA 3SM0A 8XIAA 5AKQA 3SURA 4HPXA 3AIBA 4FXFA 5KFOA 4DO7A 1KCXA 1HTIA 5KT3A 4DXVA 2ADAA 1KBKA 1EIXA 4AC7C 5ENLA 4S23A 2V5BA 3O8AA 1LJYA 3SUWA 4ZA0A 2WOQA 3KRSA 3L4UA 2UWFA 5CZSA 1QNPA 1J0KA 1JULA 4Y2WA 5CG0A 4B9YA 2Z1BA 4IM4A 2A79A 2CHRA 3RLGA 2Y5SA 4JXCA 3VI2A 4QWEA 1JCYA 4RV3A 1G1YA 2JGYA 2DGAA 1OCQA 3WQ5A 4A6GA 3BLFA 2ZOXA 3MSRA 3M6YA 4HNUA 7TIMA 1XHGA 3N6QA 3HTWA 1J18A 4BQ3A 2D0HA 2ISWA 5D9MA 1E9LA 1A0EA 1S39A 1YYAA 2PWGA 4ILSA 4J5NA 2R8IA 3PR5B 4HT3A 1YXDA 1JIHA 4N2YA 1TELA 3B05A 3L4TA 3VNZA 2BNJA 4IRDA 4FS1A 1OC6A 2FJKA 3H70A 4GH1A 5HNRA 4AY8A 3ZT5A 2JALA 4F0LA 4FX6M 2GSHA 4QWAA 2QUVA 3UYIA 1FKXA 5I02A 2J6SA 4QSHA 3E9AA 1O1ZA 1G7VA 3ARWA 3LSCA 1Q4WA 5T8GA 2RHGA 1Y8BA 5DMMA 4LC6A 3RO6A 1AW2A 2W61A 3GXNA 2G4FA 3DC8A 4MWAB 5DBUA 1UH2A 3BUVA 3UR5A 1GUVA 4KMQA 4JTGA 1YE6A 3FGCB 1XP3A 1SR9A 1CWYA 2PF8A 4BF7A 3ABSA 3DG7A 2FFCA 4Q4RA 2RDJA 2DUZA 3L9CA 3V0TA 4JFVA 1YNPA 3ANUA 3WQGA 4GYPA 4UNKA 3M0MA 2CPUA 4JKMA 3GW0A 2Z6IA 3AMGA 3QC0A 3GRIA 3MP5A 1GOXA 3A23A 4H8HA 3PNUA 1PHWA 1E4LA 1KRCC 3CIVA 3LERA 3TC3A 1RPKA 1S2TA 3LCFA 1C7TA 3RK8A 3IIVA 3WDJA 4AEFA 3W7CA 2A3BA 4I5UA 3U48A 4C6PA 1MVYA 3AIWA 3W88A 4PSRA 3N11A 5BOFA 4A2RA 4XD5A 3KBJA 1CXLA 3ID7A 3MC5A 5KFYA 3FCPA 3F2BA 3UG8A 3H40A 3WLOA 4O3NA 4NXSA 1U1UA 4ZBCA 3WMCA 3BAIA 4GNJA 1XUZA 1QHOA 3GWQA 5HMSA 3ARQA 1ODZA 3G0UA 3VKBA 4XG1A 4FLQA 3M47A 4A29A 3QSTA 3IUHA 3UGVA 1NFGA 3I4EA 1GTEA 1XRSA 4FNSA 4UZSA 4DAFA 2OOFA 5LNSA 1PJ9A 2IQ0A 3VYLA 4ZB5A 2ABAA 5JIWA 1EOKA 3QOKA 1E9IA 3W74A 2O9PA 1UP0A 3M6DA 2FPVA 3HA1A 4FXJA 3WLSA 1DJHA 3VDHA 5HJLA 7REQA 1XGEA 4JAWA 5E93A 4QEEA 5HNUA 1JZ7A 4Q8EA 2JF6A 3SIZA 4R34A 3LQLA 1EPVA 4E4UA 1T41A 4A3YA 1HO4A 4GZEA 4C6BA 4H9TA 1M9HA 4QNWA 3R12A 4DB7A 3VNJA 2WPGA 4F4WA 4ZQNA 4LQ1A 1BXNA 4CQCA 4WDWA 2HBVA 3PSWA 5KEZA 3CPGA 4RUBA 4H9XA 3SFKA 3BCFA 3OSPA 5I3JA 1DVJA 1OD8A 3WNNA 5AYZA 5RUBA 1QT1A 4GIRA 1X98A 5A8MA 4XAYA 2AAMA 1WV2A 4AD3A 1GVSA 1MUMA 3A4WA 1KFKA 1NQ6A 3K2GA 4RNOA 3ABXA 5D04C 2JK2A 1NDVA 3KAOA 3IUDA 1BYAA 3A4JA 1KFBA 2J7HA 3CHVA 3M16A 3TYDA 1NELA 2HNHA 4DL4A 3EB4A 1D3CA 1KBBA 2J75A 3VIGA 3N19B 1HKKA 2A6LA 1RA5A 1VPXA 1ZP4A 4HA0A 1REQB 1VEMA 3MB9A 2QIIA 4YYFA 4KEMA 4DRSA 2V0TA 2ZZ4A 4RNFA 2D73A 3E49A 3WH5A 2BXYA 1KQYA 4C6JA 2ZC1A 4N9BA 5F2IA 3G0SA 1ZETA 1DWGM 3PW4A 5IFPA 1HKVA 1OT1A 3KRZA 4AMAA 1F73A 1IT7A 1E51A 4PUJA 2Y8UA 4Q4MA 3HG2A 2O55A 1JGIA 3LRKA 4U2ZA 1MO0A 4GACA 3WDRA 3DGRA 3HOJA 1C7SA 4XAPA 3WLKX 4N9DA 3WNMA 2ZA1A 3BCDA 3PR2A 3ELFA 1GW9A 1GGOA 3L0KA 3UWQA 2Z0IA 3KVKA 3W24A 2CWNA 3GDLA 2GL5A 3Q8SB 3DG6A 3KHRA 1UD2A 4X2RA 4GFIA 4JTCA 1TIWA 4WGXA 2EG8A 2RAGA 3NZGA 3ZMRA 1ZU8A 3OW1A 1JF6A 3G1AA 3HM7A 4GZ7A 3AJ7A 4ADTA 4HPHA 4YU1A 2NX1A 3CK5A 4AY1A 3OGVA 3K8KA 2ZTKA 1MEWA 2C2RA 1UWSA 4JN6A 3WLLA 1Q45A 5IHRA 2J7EA 1T40A 2FVLA 4C6MA 6ALDA 4ERIA 4DZIA 3T0CA 4DM1A 3EKLA 4HPNA 3SEPA 1MW2A 2ZYFA 3TCSA 1BAGA 2W8KA 4FOUA 3SZ8A 3RIKA 1JZ2A 1Z48A 5FSDC 2QCLA 4LFYA 1QNRA 5XIAA 1EZ2A 4CNNA 2UZ9A 1BF6A 1UWUA 2DUAA 3WLPA 4W87A 1QOPA 1E0XA 4JOMA 4LCSA 5A6LA 3AU2A 4DYEA 1CW2A 1CXHA 1DXEA 5TBOA 4KCTA 1K7XA 4LBSA 3GUGA 3CLWA 3EWUA 2QT3A 3GYEA 3GSMA 4REQA 3VC5A 3QH2A 3W27A 4Z2HA 3BC9A 2YW3A 4FO4A 4S3JA 2FTYA 3TOPA 4D6GA 3MYOA 3PUGA 2HEJA 2GDVA 4GI6A 3A9BA 2OYKA 3TFCA 4GYJA 5KFLA 1XI3A 1FHDA 1QNQA 3PK7A 1IT8A 2R82A 4GD0A 5DQGA 2R8GA 3GTFA 1JZ3A 5D09A 3W76A 2W6RA 1CT5A 3BOXA 3KBVA 4RNNA 4J3UA 8XIMA 1NH6A 1LOQA 2J66A 3FK4A 1Q63A 3FW6A 1BF2A 2VL4A 4GZIA 5CJNA 1IZJA 2WZHA 3G2GA 3ZYZA 3WD2A 3PC0A 1POKA 2VA2A 2CHNA 2XH7A 3WMLA 3M9OB 1HP5A 2YDQA 4PMNA 2XFRA 3O0FA 4PUEA 3DIPA 3W7LA 3NPUA 3CUHA 4S3KA 1X39A 3M41A 3H2MA 3R2GA 4XVEA 4KF1A 1P7TB 3LQGA 1JI1A 4HHMA 2YCEA 4PMOA 3U4AA 3L2LA 4INFA 1V79A 2XGIA 4HMDA 4O0ZA 4W8AA 3ZXWA 1XYBA 4NAEA 4J9MA 3H53A 4PN2A 4G7FA 3QR3A 3FA5A 1G69A 3RAXA 3VTRA 5JQ9A 2G0WA 4EKJA 3TE9A 2W67A 1W5NA 4MJ2A 4A3RA 2VWTA 4RL3A 5H8PA 2VUYA 4JQ1A 3H2FA 2IKHA 3V3WA 5AYYA 1PKMA 3RG6A 5CGQA 2R94A 3W2MA 4S38A 4G6CA 2XIMA 2BY0A 2Q01A 2J9ZA 1DPMA 1S0OA 2YL6A 3KEHA 6CGTA 4AHOA 1CGVA 3OG3A 2DZAA 4R8UA 3QYQA 3LY0A 4GCXA 4U7CA 1EGZA 5H6HA 2VO5A 3GU2A 3W1PA 3BLDA 2VMFA 2OU4A 3R8GA 1RZMA 2E6AA 1QK2A 1Q2RA 3BDKA 3F4WA 3W2KA 3H2AA 1P0NA 3ERPA 3U2ZA 4Y9MA 3GH5A 5E6ZA 4IFOA 5DF0A 4L6DA 4EK7A 3RN6A 3PHAA 4XVDA 3S9YA 1IM4A 1XQLA 4DPQA 1YE4A 3OHMB 3OPSA 2WMFA 4NT0A 3POHA 3RM9A 1RVKA 3ARTA 1Q5MA 4GVGA 1V0LA 4AXKA 2NSOA 1A5BA 3UZXA 1XRVA 2YA1A 4D6DA 3R13A 1XLEA 3BANA 2DEPA 1EJTC 1TPEA 3PZMA 3TYBA 3FYPA 4IIBA 4UTHA 1RY8A 4MWAD 1ZTVA 3KHHA 1FDYA 2X1IA 2REQB 3NCOA 2XZ7A 4O8AA 3MW7A 4HZ8A 3TAKA 4WIWA 2A2IA 1VH7A 2FDSA 2PWFA 3NXLA 2D2HA 3STEA 9XIMA 4YN5A 2VQUA 2NT0A 4DWSD 1E0TA 4D72A 4EPDC 4GVFA 4XWUA 4WRHA 5HR6A 2ZC8A 3RCNA 5LA2A 2Z1XA 4DZHA 1KA9F 1PCWA 5FF2A 4WF7A 3TLQA 2BXVA 3EOEA 2QULA 2G37A 5EBAA 1KNWA 3T0BA 1RD6A 3E0VA 3TYUA 1XGZA 4R88A 1VB9A 1OX6A 2RDWA 4AMCA 1Q6LA 2J8TA 4H9ZA 1IGWA 2IPJA 1HQTA 3LXAA 5C5YA 2WTFA 3VD9A 1KCKA 2V69A 1FBAA 3CPUA 2HVOA 3S5YA 3ZO9A 1VBGA 1MI3A 4ACZA 2WNQA 1P1XA 3C3NA 1Q6CA 1VP5A 5HATA 3LEPA 3NQFA 1UD6A 3ONBA 4Q8FA 4MPKA 3WF2A 4C1LA 4O57A 3KHGA 3TW9A 2NXHA 4XTDA 3VKDA 1W3IA 1RR2A 3G6VA 1PS9A 3NGJA 1J2BA 1TYGA 4MPQA 1ME7A 1JCJA 4PUDA 3LBMA 2JEIA 1LROA 2VFDA 2FGZA 4JN8A 3T5HA 2Q71A 4NX0A 2FZNA 4MLRA 3N4FA 2WMIB 1RUSA 3LB0A 1Y5WA 3R8RA 3W73A 1KCLA 5JUMA 5I24A 1IF2A 2BVDA 2PEVA 2W9BA 4J3VA 2V3GA 2DH3A 1K4GA 3TYEA 3QGKC 1ECEA 5F2GA 1YPFA 2X16A 1DEDA 4KIEA 3KL3A 4U28A 2DIJA 1HKWA 3VAVA 1K7EA 1M03A 4LX4A 2Y88A 3CB3A 4QW9A 4M82A 4Z1YA 1X7FA 2BY3A 1OY0A 3ITYA 2UVWA 2AOSA 1KKOA 2FGBA 1KQZA 5HUOA 3P8JA 1WAWA 3RRAA 1FWBC 2W4XA 3B40A 3W1QA 4QJ5B 2Q8XA 3KZSA 2MUCA 4JNMA 4D6CA 4MJZA 1BSLA 4J28A 1EJSC 2D3LA 3VGBA 4F2BA 2XM2A 1B9ZA 1ZGDA 1VJIA 3G6LA 4CCDA 4RX0A 2YXGA 1QI5A 2XWEA 3BICA 1TG7A 2YDSA 2DZVA 4ZB0A 2Y8KA 4Q8NA 1PHQA 2ODOA 1A50A 1I4NA 2B31A 4CD5A 1IE7C 4B3LA 4O12A 4ALDA 2WZEA 3NJ3A 1SFJA 4UR7A 3WQDA 1BWLA 4UFMA 4YNGA 2ZUSA 4NZ5A 2JBMA 3LHZA 3KP1A 3G1FA 3MHGA 3W7EA 4CD7A 3GDMA 1SPQA 3FNDA 1OSEA 5TF0A 5DXXA 1CGYA 3SCWA 3C52A 1LBLA 4UFLA 1H3GA 1PL9A 1GOWA 4CEUC 2BVYA 4CD8A 3P0XA 2EEXA 2JKEA 3AYSA 4L6OA 1E4IA 4RW5A 2Z2AA 1SMAA 3USBA 2ZVIA 3PZQA 3VD3A 1JXJA 3MSDA 1GOKA 1PDZA 4NASA 1BD0A 3LCXA 3N25A 3EB2A 1XW8A 2XH4A 1C90A 3FSTA 1I8JA 3E2RA 4DWDA 1A4LA 1SZFA 4RZRA 1CXKA 2IXVA 1R3SA 2C3ZA 4WXZA 2FIQA 4AZIA 5L1KA 4HPGA 4LVFA 3DGBA 4Q4PA 2WZTA 3SW6A 2YFOA 4MUPA 3QR0A 2E6FA 3UQNA 3AMDA 4PB3A 1YIXA 4D1IA 1HGYA 4JIPA 4E6MA 5DY2A 2R1LA 2POTA 5AHEA 1H62A 4Z2GA 2FGLA 3WBEA 2D0GA 4FBTA 3N1AA 3LLDA 1QNVA 3IK4A 2Y62A 4ZENA 2DZXA 3QRHA 5BWFA 3QV8A 2J78A 4PRRA 3PP7A 1TPWA 4R3UA 2JE8A 1CXIA 4EYHB 3T2QA 1AUSL 4G1NA 3RM4A 3Q65A 4UIOA 4NIRA 3VZZA 4GQRA 4W7UA 1XYFA 3CAQA 4CN6A 1K7FA 4C90A 1QU4A 4XKYB 4US6A 3A4XA 1BVNP 5C55A 1BGAA 3FAXA 2IMWP 3WSUA 1RK6A 3N15A 4KWVA 2AQOA 3U57A 2BXZA 1HJWA 1E70M 1K6WA 5AHIA 3GNPA 3MQTA 2CBJA 4GUFA 1G5AA 4FNPA 2Z1SA 4TQTA 3LBOA 4XSLA 1GQLA 1OX4A 4S2CA 2X8RA 4DUWA 3HV9A 4Q3MA 1DYSA 3PWGA 2DVXA 4IQEA 2O4QA 4H6KA 2VCAA 3UGRA 5L9XA 3FJ6A 1R2RA 4ICCX 3WL1A 1IV8A 2XINA 1PYMA 1ONXA 3W7GA 1OYCA 1W1YA 2J9XA 3RJYA 1C92A 1HJQA 4Y8FA 1FCVA 2QCDB 2FPTA 2Z6JA 5IFTA 3WYZA 3H2EA 1WYIA 5MF5A 5D30A 1TPB1 1XM3A 1CEOA 3KDNA 4Z17A 3CZEA 2PDWA 1R85A 3R94A 1ZUAX 2C7FA 3PTDA 4LUSA 4MAVA 3VVGA 1EXPA 1VFSA 1L2UA 5E09A 3R0KA 3Q94A 3BJFA 3GHSA 4JFUA 2PDUA 1E6XM 3CS2A 1V3JA 3DEQA 4YTRA 4AZ6A 2XVNA 6XIMA 1ICPA 3QSRA 3MBDA 3WLTA 3CIWA 4MDOA 1TWIA 4GKTA 4DBUA 3W7PA 4P61A 1EZWA 1FWDC 4IICA 4C6QA 4MJ4A 2DZBA 1X1OA 1K6AA 4C6LA 2BHZA 1WXYA 2J6VA 3GTXA 2WVTA 4O3RA 1XBZA 1F61A 1NQKA 3AO0A 4K6AA 5F7UA 3AWNA 3R43A 5AVNA 1AG1O 4ZQRA 3I65A 1HN1A 1EBHA 2AGOA 3S9IA 1OBAA 4W8LA 3HGJA 4G3IA 3TROA 2YB4A 3SJNA 4PEKA 2YDAA 1GOMA 2HPMA 1IXOA 3V5CA 2NX3A 3R5EA 3E2SA 5CPNA 1OK6A 4FOJA 3EDDA 3UEQA 2EF9A 1WX0A 1UZ4A 2XZ9A 3GM8A 5M3WA 3CYJA 3BMWA 3LCHA 1QPRA 2W9CB 2W7OA 4LNCA 3GX9A 2X30A 1NM9A 2WW5A 4AQLA 3ARVA 1TPC1 3SCPA 5EWGA 5FCZA 5D2TA 4M81A 1F7BA 1KFLA 3MUAA 4O1BA 4PUMA 4J9KA 1Q66A 3N2MA 2Y63A 3MS8A 1RV8A 1YXYA 3AMKA 1JZ6A 4KBXA 3VIMA 3WJSA 1LUCA 1CXEA 4AEEA 1S0NA 1OGSA 4LOCA 3TYZA 3BWWA 2QJIA 1LT8A 3QPZA 3P82A 3APGA 4QW8A 1KWGA 4WCJA 4ONVA 5U4NA 1IXNA 2GJLA 5I5RA 4AZBA 1VZWA 3M7WA 5CZ0A 3WH7A 2PDBA 4UTTA 3H24A 3MV01 1F4AA 3G1RA 3W7MA 4H6QA 5DCEA 3L5MA 3LCWA 4LVBA 1FHVA 1XJBA 3W82A 3AIVA 4O14A 2NVCA 4GE8A 5HXMA 1TCDA 2NUYA 4F0KA 4WJ8A 3BAYA 3LPOA 2P88A 1ZBKA 4PUKA 5FAJA 5L9FA 4WXYA 3UF9A 2XDFA 5DT5A 2J24A 1XPGA 4M7SA 1Q85A 5KFSA 1FCBA 1W3JA 1TIMA 3URAA 4JTUA 3EAUA 1UASA 4UTWC 5T26A 3GTHA 5HPCA 4WKFA 2VCCA 2QS8A 4LCRA 5I07A 4XUYA 1WO2A 4Q43A 1BHGA 5CPSA 1VENA 3N34A 1LRTA 2XH2A 1IXQA 1E43A 2VX4A 1DV7A 4JFSA 4G7EB 3F5JA 3EXRA 4O11A 4RZ6A 3BG5A 2ZFAA 3W07A 3PW0A 1PX3A 5CQ1A 3T5JA 3P0WA 2O7SA 5F4XA 5M17A 5H8MA 1ZRQA 1GTHA 1LBMA 1EEXA 3EA1A 1WUFA 1GEHA 4D2JA 5G2HA 5EMMA 1B4KA 2PU0A 4H6EA 3LGDA 2A3LA 5LZLA 4A8RA 3M0HA 2C0AA 1RQHA 1ZCOA 5KZDA 3GR7A 2C18A 3U0HA 4LB4A 4DJEA 4E2BA 2BLEA 3JZUA 1ML1A 4EACA 1B3VA 2X1TA 4W88A 3BV7A 6PTDA 1HJSA 4X60A 5KFQA 1IZKA 1LORA 3NGFA 1E73M 4GJJA 2ANUA 3MI3A 2J77A 3C2EA 3AHXA 3BLIA 1UC5A 3GHUA 2PMQA 3UNTA 1XIFA 5I3DA 4GBDA 1JRCA 3LI0A 5D8WA 4HHHA 1P0EA 3DUGA 1W9BM 1L6YA 3R6IA 4EAYA 2O9TA 3B9OA 2ZX8A 1LL6A 2E3ZA 9XIAA 1HF6A 3URQA 2NUXA 3QN3A 2DW7A 3HGOA 1EP1A 3RPMA 2Q3RA 1EB3A 1MEIA 2IMRA 4Q8TA 2QGHA 4IUGA 4ZSUA 1ADDA 2PP0A 4IMDA 2B81A 1F8MA 2YX0A 3WFAA 1NARA 1AD4A 3TSMA 5A3HA 4CU8A 3E3HA 2NVDA 4QDMA 1AODA 3LN3A 4KEVA 5EA9A 3WIJA 4ZQPA 2ZX6A 1WZAA 1W5QA 3L2MA 4I5RA 2GQ8A 3L4YA 3OZOA 4EXQA 4IIDA 1JL8A 1BYCA 3TQ1A 1RPXA 3UWVA 4DJFC 3D0CA 3S2JA 5I7GA 3ZJ6A 1JPDX 2HNEA 3UP8A 1ZY9A 5DCBA 1L2QA 4CQAA 3ITLA 3OBEA 3NZPA 2AGKA 1CENA 5K4XA 2CHOA 1AD1A 1OQFA 4OUIA 3MI2A 1FCQA 3GNRA 1AJ2A 5BYWA 5LIYX 5KZMA 1FP8A 3QPYA 4Y7EA 3PW7A 4ZFMA 5CSRA 3LLXA 3GV7B 3CGTA 1X8CA 4UCFA 3B0XA 1GYMA 3TC6A 1XXXA 1A3WA 4YCOA 1UIPA 5EMUA 3GKAA 2QCNA 3U6WA 1UQZA 8TIMA 3TQVA 4X0VA 2AKMA 2INEA 3F7JA 4HYVA 4AVFA 4C60A 1XISA 2Z29A 5F9NA 1RVGA 2DUXA 4UTUA 2ZICA 3W7NA 3TNOA 3VX1A 1VR6A 1QW9A 3QV6A 4QTGA 1NY1A 1JGMA 3S6TA 2AGPA 1U33A 4Z2IA 4QR6A 3BW4A 1XIEA 2J6XA 1Q13A 4JQ3A 2ZXBA 3GTIA 1JCMP 2ZRZA 3XISA 3W00A 5HINA 2XGBA 2HXTA 2UBPC 4F0MA 5CLWA 3W87A 4MVAA 1AMKA 2CC0A 2QCMA 4AD0A 5LNUA 2A7NA 5F4SA 1UP3A 4IOTA 2ZIDA 3CL7A 2VFHA 4NL1A 4UNIA 1QWGA 2VOTA 1VAHA 4WDTA 5F9LA 3CM4A 1F07A 1L6SA 1NOWA 3N3MA 5AY7A 1L6FA 1K1SA 1T96A 1QNSA 5JH2A 2EPLX 4FF7A 3A47A 4J1OA 3D46A 1DHKA 2GGIA 2G41A 1YDVA 4LPCA 3TYCA 5KFJA 1KTCA 5JXQA 1T5AA 3O6AA 1SW3A 4MNKA 3VOCA 4FS2A 4J2MA 3WY1A 4WEVX 2OQYA 1EUNA 1JDDA 5C2GA 2R1KA 1R46A 4IUOA 3O0KA 1J01A 4D9PA 1RLCL 3SCNA 4O1CA 3V1PA 2ACQA 1E9ZB 4ECVA 2BQUA 4RK8A 1RALA 4LUYA 1VPQA 5EMJA 1DL3A 1XH2A 1MUCA 1XX1A 3GUWA 3S5SA 3EX1A 4V28A 5BXSA 4IMFA 5KFCA 4DBEA 1VGAA 1J2WA 3L2IA 4PTNA 1RBAA 3CUXA 3REQA 5DMNA 3SCSA 3GBEA 4GIAA 3SIMA 1E4MM 1E6SM 1Q8JA 2VC6A 3RCYA 1F4HA 1TV4A 1EYEA 4HVXA 2B7OA 2CLIA 1K9EA 1CECA 4O3QA 2OODA 1VJZA 3EB3A 3K1GA 1EA0A 4MYXA 4DI9A 1JAKA 3MP4A 4FX7A 5BZAA 3RB6A 4NYUA 2VD8A 5KT6A 1DXFA 2QJJA 2YCKX 1TFVA 4JFTA 3HJZA 1WE5A 1I1XA 1YMYA 2PTWA 1IXPA 1W1A1 2QVNA 3TX9A 4F4YA 1YHTA 4J9PA 2HV5A 4IISA 4J9QA 3D5HA 4E4PA 4H04A 4WY0F 3KOFA 4KIRA 3W1TA 4RV8A 2F7FA 2OVLA 4XZNX 3J7HA 5AC5A 1A0CA 4GGBA 1V77A 4R9XA 2Y4SA 3GFXA 1U1HA 4XO7A 4C6NA 7A3HA 5GPRA 3VXGA 3KP0A 2INZA 3NYZA 2QPXA 4A3QA 4E8DA 5HPOA 2YL5A 3AZTA 1UC4A 5K9CA 3GZAA 4WOQA 3W7QA 4E4FA 1E6NA 3KX6A 4IP5A 3GG8A 3G1XA 3BOFA 3TZFA 1XUUA 4IP4A 4IJRA 1DIKA 4HZMA 3V0UA 4GISA 1D7FA 1OF8A 4QJ4B 1H7WA 1JD7A 2DH2A 2GYIA 2INFA 2WBKA 1P43A 1X7IA 1ONEA 3W7IA 3QHMA 1H7PA 1BWKA 2CLFA 3CAWA 1KR0A 3IJQA 3BSGA 1GW1A 1W3TA 1Q65A 3NYDA 1EBGA 2YR1A 1OG6A 3OJGA 5KT7A 2FZBA 1QJWA 5I23A 1VBRA 5KFKA 4LAOA 2Y7EA 2FPYA 5KETA 3BQ1A 3MUZ1 1GG0A 4Q7NA 1XKJA 4DF2A 3QW4B 1O94A 1H51A 4CGTA 4TQRA 2J27A 2J6TA 4FIQA 5KFDA 2J7CA 2XFWA 5TNVA 9CGTA 5G2WA 3ARYA 1XD0A 3MA8A 2C22A 3DHFA 4LV9A 3K1DA 4HK5A 5F2MA 3V6KA 1NFBA 4LS1A 4UQDA 2GVLA 2P50A 3LCLA 4HK7A 2HZGA 1DTNA 2TSYA 2RDUA 4CN4A 4NKCA 4MADA 3PSVA 1OCBA 4AWUA 4CNUA 3E5BA 4E2OA 2DPEA 2O4MA 1V6VA 3UWUA 1WA3A 3IVTA 3CV6A 3JU2A 4EF9A 1WNOA 1MFUA 1A53A 3TTEA 2PLKA 3A64A 4MB3A 5D2XA 1TV5A 1ADOA 4BY3A 2PTYA 4Z42C 4Z2KA 4JTDA 1UR9A 1OFBA 3HIJA 5DT7A 5I3FA 2HISA 3CUIA 2NQ9A 4CKQA 1NOUA 4ZTYA 4UOJA 2DPIA 3SN0A 4ZL1A 3UZ5A 2DT1A 1JIBA 3EWZA 2QJMA 1US2A 4DVOA 3HN3A 3FJLA 1H0GA 1LLZA 3MMUA 5AFDA 3MSYA 2E8YA 4K36A 4JTSA 3NGDA 3C2FA 3UJRA 4GX8A 4HP5A 4F3HA 3K4DA 2FZ8A 3H7RA 4NHVA 5EGRA 1J0ZA 1OF6A 1PUDA 4M3PA 4H9UA 1V4YA 3ALGA 3DKLA 3NQBA 1F74A 4WQ6A 1BRLA 2VFFA 3A3HA 3CZJA 5CCZA 4AIOA 3PZNA 3DG3A 1U1JA 1JNEA 5GNYA 4HA4A 2Q8LA 3R0UA 5HOSA 3CEUA 3VCRA 2GWNA 2PDCA 4HU0A 1L6WA 5F1UA 2VEIA 4BZYA 2W9AA 5KFGA 1OFPA 3FYOA 1VCFA 4WY0A 1U30A 4OE7A 4MNLA 2A3CA 1E5JA 3IVUA 5EY5A 1Q3NA 1JUBA 1KGXA 3IWPA 1R5YA 1RCQA 1FWGC 2EPHA 2V3EA 5AHNA 5FJPA 2D20A 4R5EA 3HGSA 2VFIA 3F1QA 3PVFA 3B8VA 4PL2A 4F8XA 1UR4A 2XYLA 1J5TA 1V51A 1KTBA 1LRQA 1K8CA 2P10A 1GJPA 4UMCA 4BWLA 1Q6RA 2OSYA 4ZFCA 1Q6EA 4DJDC 1HJVA 2IKJA 3KTXA 4EBDA 1TJPA 2BQ3A 1TUFA 5CSYA 2J6UA 1PV8A 3BW2A 1O5QA 3EYPA 2PWVA 3NO3A 3GS6A 1K1DA 4LJ3A 1F6YA 1O6IA 1XYAA 4GBUA 4CCZA 1QHZA 4J9JA 3GILA 3M07A 1X6LA 2BB0A 4P5UA 2GUBA 3WEMA 1H7OA 2CEQA 4RDWA 4Q44A 1G4SA 2ZZ7A 4B3ZA 3MCMA 1UD4A 2NQZA 5M1TA 1SFTA 4YVVA 1SO6A 3C8NA 3VUPA 3MMTA 3AHZA 2VGFA 3GE7A 1OVDA 5D2WA 1ZSXA 2WC3A 3V7PA 3UZJA 3EOOA 3M0JA 2YZ5A 3W3OA 3AUOA 1SM9A 3P2VA 2VZOA 4P8VA 3OYXA 5HQMA 3CQKA 4XV0A 4F4XA 3HO8A 1CLVA 2A4AA 3GG7A 1TCMA 4HN8A 3UVIA 3P67A 3WQEA 1CGTA 1SYTA 5H91A 1SZGA 3VA8A 1FY6A 4PUNA 2ZKMX 1EHAA 3W72A 1SSGA 4L1GA 4XTIA 2DY3A 4DXKA 5A6KA 1XPYA 2VWSA 1NIUA 3VMOA 3CASA 2MANA 3SUTA 1G94A 1QW7A 3PM6A 3RDKA 3V5FA 4HSHA 3SFWA 4MY8A 1TJ2A 3RAOA 3H54A 1SU5A 1TWSA 1MEHA 1QOXA 3LTYA 4A22A 1E6QM 3DYPA 3WMBA 1SVDA 4ZOBA 1ZENA 1UR2A 5DMLA 4DO6A 1VLIA 5EYWA 4XSMA 4D6IA 3I68A 3CV2A 3B0VC 1K9FA 4R85A 2F9RA 4IPIA 5FEZA 1RK5A 5JBFA 1IQ8A 2ZUVA 1EJRC 4Q8UA 4GC6A 3O07A 3VDAA 3BK0A 3DN5A 1MRQA 3OO2A 4QDPA 1Q6GA 4PTVA 4US5A 3DYMA 4LEFA 3BLPX 3DECA 4H6RA 3S6OA 2W27A 5FJUA 1JYNA 2QDDA 2NQLA 4I6KA 1FCUA 1W5OA 1RBOB 1GPFA 4AF0B 4GI4A 3VKAA 3D6NA 1OX5A 3WUFA 4DYKA 2CZ5A 5LGXA 4W7WA 3ABOA 4A3HA 1TMQA 4XD6A 2PP3A 1GVRA 3OBAA 4C6CA 4GINA 2QLYA 3GIKA 7PTDA 4C7GA 2VFEA 4F0SA 3CMFA 3H21A 1KM5A 3WF3A 4CNOA 4YVPA 5C9WA 2XG9A 3AIQA 1F3TA 4RCXA 4GY1A 2VC7A 2BZNA 2F38A 2PS2A 1K8XA 3DI1A 3OBKA 4G56A 4DZ5A 2VGIA 1SUXA 1KB3A 4GQQA 2NW0A 1L0PA 1V6YA 3GHTA 2OELA 3TEVA 1H7NA 3RFAA 4JTIA 3TWAA 4DJFD 3AI0A 4FNTA 3FXGA 4AZCB 2Y7DA 1XWYA 3TIMA 4C6KA 2VDIA 1G01A 3UERA 4ZR8A 5CPQA 1L6GA 5REQB 3PUOA 3UJ2A 1ONWA 1ISZA 3CZGA 4KCUA 4AEOA 3W9ZA 2DQWA 4U3CA 2YBVA 5FL1A 3GLCA 4BI5A 2E77A 1Z89A 1VIZA 3VKJA 1K70A 2BASA 1XV8A 4HYKA 1D7KA 4F4ZA 1MYRA 5I79A 2PRMA 3RJXA 2L5HA 3RAQA 1S1PA 1F8IA 1RBLA 4K37A 1GVFA 4GZJA 4LUTA 2I5GA 3WUBA 4B91A 4CEXC 2J7FA 4HPJA 2Z25A 1PZ3A 4WX2A 5C9ZA 4S3BA 3UR7A 2J88A 1F2JA 1UWRA 4NZFA 1ICSA 2OWCA 3KOWA 3PZGA 1XYMA 1X96A 1WKFA 4GFSA 3PVXA 2YSWA 3C0LA 1K4HA 2D3NA 1S1RA 1TWDA 5DBTA 1PE1A 2QAPA 4EOUA 1TA3B 4F79A 2IKGA 3R8HA 3L0GA 4NZ1A 3QVQA 4W8BA 3WLNA 2XISA 5C9RA 2YW4A 4S3AA 2E6YA 2FDMA 3E2VA 2XN1A 3APYA 3Q4DA 2JF7A 2H3BA 5BW6A 4Q4KA 5AB3A 1W1TA 2JIWA 2Y61A 3RYSA 5I3GA 1GZGA 2QGYA 1FWRA 4C1NB 1XQKA 3N18A 1L8PA 1SFLA 3I3DA 3AOFA 3WDQA 1UOZA 4GPNA 4GLEA 3GFYA 2X42A 2XN2A