5LXXA

High-resolution structure of human collapsin response mediator protein 2
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
477
structure length
477
Chain Sequence
b'SDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dihydropyrimidinase-related protein 2
publication title Collapsin response mediator protein 2: high-resolution crystal structure sheds light on small-molecule binding, post-translational modifications, and conformational flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 187
structure length 477
sequence length 477
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.40.10 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C, domain 1 5lxxA01
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 5lxxA02
1WXZA 5HMFA 3A3WA 1PSCA 4GX8A 3QY7A 4C6BA 4EPEC 4GK8A 1BF6A 3MSRA 4C6OA 4RDWA 4F0SA 3GTHA 4PBFA 2GWNA 3URAA 1FWIC 1A5NC 5FSEC 2DVUA 1RA0A 3TN5A 2Z7GA 4IG2B 1EJXC 2O4QA 3MJMA 4B3ZA 4CQCA 4IGMA 3WYZA 4IF2A 4E3TA 3F2DA 1J6PA 1S3TC 2QS8A 3ICJA 1NDYA 2R1NA 4CNUA 3GTXA 2Q09A 4MUPA 2OB3A 2BGNE 2EG8A 3NQBA 4NI8A 4BKNA 2KAUC 4OFCA 1XWYA 2A3LA 3GU2A 3URBA 2AQOA 4IFKB 2XIOA 3QGKC 4J2MA 3GRIA 3OU8A 4D8LA 4R85A 2WM1A 2HPIA 4LALA 5HMEA 4EPBC 3WMLA 1EJVC 1O12A 1R9YA 3MTWA 1EJUC 3KM8A 3RCMA 1RK6A 1P6CA 3UF9A 4KESA 4QROA 4XD3A 2Y1HA 4J5NA 3OJGA 2BB0A 1QXLA 4DNMA 1I0BA 5A6TC 4WGXA 4Z42C 3JZEA 4HA0A 3E2VA 4LCRA 2O4MA 5E5CA 3A4JA 1FWDC 1YMYA 1A5MC 1I0DA 2W9MA 2FVKA 1JGMA 3FDGA 4C5YA 2WJEA 2FTYA 2E1WA 4DLFA 3T1GA 4ERIA 2OODA 2FTWA 3TN3A 4C65A 1FKWA 3S2JA 1YBQB 4NP7A 3GGMA 1GKRA 1PTAA 4ICMA 1EJWC 3CS2A 4C6KA 3IPWA 2FFIA 3GG7A 2HBXA 2WJDA 1P1MA 1P6BA 1R9XA 3T81A 4LCQA 1RA5A 2ANUA 2GWGA 4KEUA 4H9UA 1V77A 2OOFA 1R9ZA 4HK7A 3DUGA 4H01A 4LAMA 2HQAA 2P53A 4EP8C 4V1YA 4NG3A 1E9ZB 4LCSA 3V7PA 1M68A 4RE0A 4GOAA 4KEVA 4EPKA 3IV8A 1E9YB 3F2BA 2EG7A 1K6WA 3K2GA 4UBPC 1EJRC 1KRBC 1UMLA 3AU2A 4GY0A 1EJTC 3IRSA 3FEQA 1ADDA 3E74A 4HK6A 3C86A 4DZIA 2F6KA 4GY7A 1RK5A 3LU2A 3OODA 2PLMA 1KRAC 2D2JA 1XGEA 1ITQA 2Z28A 3LA4A 4KIRA 4F0LA 4XD4A 4P5UA 5HMDA 3TN6A 3B0XA 2PGFA 1GKPA 2VM8A 1A5LC 2E25A 3EWCA 1A4LA 3NURA 3F2CA 1V4YA 1J79A 1O5RA 4INFA 2P9BA 3HPAA 1EZ2A 3DC8A 1FWFC 5AKQA 4ZSTA 3HTWA 2DVTA 4H9XA 2VC7A 4XAFA 3A3XA 1EF2A 3O0FA 4DYKA 1NDZA 2Z00A 1NDWA 4HK5A 4H9MA 4DO7A 4ERAA 3ISIX 2QPXA 4XD5A 3S2LA 4CNTA 1HZYA 4XD6A 4C6JA 3K4WA 3OQEA 3ORWA 4QTGA 4L9XA 2AQVA 4WHBA 3RHGA 4QS5A 3URQA 3PAOA 3PNUA 4KERA 2PGRA 4BY3A 2OQLA 3CJPA 3OVGA 4IFKA 3NEHA 4DIAA 2R1LA 3EWDA 3E0FA 4M51A 1M65A 3F4DA 2I5GA 2D2GA 2Z24A 1KRCC 3GUWA 2Z27A 1POKA 1FWGC 2R1PA 4C6FA 1POJA 2UZ9A 4RDYA 4DZHA 4CQDA 3PANA 3ITCA 3QY8A 1IE7C 3S2NA 1FKXA 4QRNA 4RZBA 4LAKA 4QSFA 1VFLA 4AC7C 4WVXA 2QVNA 3S4TA 4EPDC 4C6QA 2R1MA 3E0LA 3QY6A 4C6PA 4KQNA 2Z26A 2G3FA 3UR2A 4DI9A 1ONWA 2AMXA 2Z25A 3B0YA 3GTIA 4I6KA 2OGJA 3GU9A 2YXOA 1RJPA 1FWHC 2D2HA 4LAOA 1EYWA 1A4MA 4G2DA 1ITUA 4IGNA 2CZVA 3TN4A 4B90A 4YIWA 3S2MA 4G7EA 2HNHA 2ZC1A 1FWAC 1NDVA 1YBQA 1YIXA 1ZZMA 2Z2AA 3B40A 4B91A 3LNPA 4CNSA 2ICSA 1FWEC 2Z2BA 3HM7A 4GXWA 4DI8A 1PO9A 2VHLA 3TNBA 3MKVA 2YB1A 4TQTA 1EJSC 2VR2A 3IACA 1V79A 2GSEA 4H9YA 1K70A 4KF1A 2WJFA 3LS9A 4CEUC 1XRTA 3LSCA 3CAKA 2Q01A 3DCPA 4LFYA 4GBDA 3T8LA 3PNZA 1K1DA 4R7WA 4GYFA 3SFWA 1J6OA 3N2CA 4PBEA 2GZXA 4UB9A 5LXXA 1M7JA 3MDWA 4QS6A 4GZ7A 3K5XA 3RYSA 4C6DA 2HBVA 3LGGA 3F4CA 3D6NA 1UIOA 2YZ5A 4PCPA 4L6DA 4XAZA 3IARA 3AUOA 2R1KA 2QT3A 4R88A 4C6NA 4IG2A 2Z4GA 4XAYA 4CQBA 3GIQA 4IH3A 4CEXC 3RN6A 4C60A 1UBPC 3AU6A 4GY1A 3OOQA 1A5OC 3UPMA 2DVXA 2VC5A 4C6EA 4PE8A 3LY0A 4H9ZA 1GKQA 4DLMA 3BE7A 1FWJC 3GIPA 3E3HA 2UBPC 2I9UA 4IFOA 3FDKA 3WZ0E 2ADAA 4V1XA 2IMRA 1FWBC 4C6LA 1V51A 1V7AA 5G4HC 3QGAC 1UIPA 4AQLA 2FVMA 3E38A 1WXYA 1KCXA 4KETA 3GU1A 1YRRA 1W1IE 1ONXA 2P50A 3LGDA 1QW7A 3UR5A 3R0DA 4LANA 4HJWA 4B92A 4C6CA 4I6VA 3MDUA 2VUNA 1XRFA 5CH9A 4J35A 3O7UA 1RJRA 2RAGA 2GOKA 4ZSUA 4XAGA 1RJQA 4GC3A 1FWCC 4C6IA 4JOMA 1DPMA 1NFGA 5FSDC 3ID7A 4C6MA 4IFRA 3GTFA 4G7EB 1YNYA 1J5SA 4LEFA 4KEZA 4F0RA 4RDZA 2HPMA 3MVIA 4H00A 1A5KC 2PUZA 3URNA 1RAKA 4GX9A 2YB4A 3LSBA 4IQJA 3EGJA 3IGHX 3PBMA 4LH8A 2EG6A 4RDVA 1KRMA 4PCNA 3G77A 3MVTA 3MPGA 3SO7A 4C5ZA 1PB0A 4ERGA 4H9VA 3IJ6A 2Z29A 3UBPC 2PAJA 4H9TA 4BJHA
chains in the Genus database with same CATH superfamily
4TVUA 4I7WA 4YL2A 3ZSSA 4UOJA 3V5FA 1MNZA 1EF3A 4HOWA 1DJGA 4CD6A 3URAA 4MGGA 1E6XM 2DVUA 1JVNA 1S2VA 3RB3A 3MW7A 3MUY1 2EEXA 4M24A 5A1AA 5DG9A 3NPUA 3W2LA 2X16A 3MI2A 2ACQA 3DKLA 3ICJA 3R94A 3GTXA 3T4WA 4KRUA 2FDSA 2BY0A 1R0MA 1R3QA 5I3JA 3BUVA 2F2KA 2WPBA 3RCYA 3TYUA 3CIXA 3EA1A 4LBRA 3VCRA 1LLOA 4Z2KA 3U9IA 3VGHA 3T7VA 4Q8FA 2F6UA 4JNYA 4X0NA 5I5RA 4LJ3A 4UOZA 1CWYA 4WIWA 1UC4A 3KTSA 3BC9A 4OJYA 1NQKA 4RKAA 5FJOA 1KV8A 3SDOA 5BNKA 3G8RA 1AJ0A 4XSLA 4IWWA 1PTDA 1W1VA 5L1LA 1TCMA 3HQOA 1E4IA 4WGXA 4U7CA 2XJ7A 2X2GA 4AHOA 3GTNA 4ECUA 4JTDA 4N02A 4E4PA 2R8IA 4JEQA 3GR4A 3O07A 4MSSA 4E6MA 5K7JA 1JCTA 4C7GA 3VC6A 1P0KA 5CAHA 1GQNA 4PZVA 3NVDA 3OB8A 2DW7A 4RE3A 4WF7A 2CITA 3HGSA 4ML9A 4M81A 2RDTA 1KCKA 3XIMA 1OB0A 1RA5A 2GK1A 3IVUA 5A2AA 4HK7A 4FLSA 3TA9A 1OZMA 3S5NA 1NWSA 3GM8A 3DAQA 1IEXA 9CGTA 2VGIA 1JCLA 4GHRA 3IJLA 3V7PA 3M9OB 1XR2A 3OGSA 4V2XA 1T96A 3KFTA 3ALFA 3PTKA 3TCEA 3QEZA 4GO8A 4JTTA 2WKGA 5I3GA 2CZFA 4B4HA 5CLWA 4JTRA 3LU2A 1KRAC 3T0DA 1WNOA 4KIRA 3VZZA 2EPOA 3UP8A 2VVNA 1OX6A 5IDIA 4MNKA 2OSWA 2W7PA 2EXOA 5KITA 1V4YA 4CD4A 2QUTA 1OFBA 4O4WA 3DC8A 5EMUA 4B9ZA 2UVRA 3E9AA 3PZVA 2F84A 4P7OA 3A5VA 1HJVA 2DVTA 4GUIA 4A29A 3MBFA 2W91A 1WKYA 3VNLA 3BW3A 3SW6A 4FXFA 4QSHA 4P8VA 4NZCA 1F8IA 3RO6A 1LL7A 1OC5A 4ZZ9A 4F4ZA 4U6PA 4DL3A 2PU1A 4PTDA 5BWFA 3MYPA 3BMVA 4UMBA 4F4WA 1ZLPA 4C6JA 2OYKA 2PC8A 4HA1A 2WMIA 1AL8A 1KWGA 2C16A 5A8OA 1GVRA 1UP3A 2PDFA 5KFAA 3MCMA 1J12A 4HKPA 4LWWA 2XVLA 4OE7A 3P62A 1KRCC 5I00A 4H4IA 4JHZA 5E0FA 1JUBA 3MBDA 1R3YA 1GEHA 1POKA 4MLRA 4RZRA 1QW8A 4GISA 4ZXOA 1GJWA 3G6VA 1TX0A 2PWFA 4QLLA 3QZEA 3CUIA 1DWIM 4ZXLA 3T44A 3VIJA 4C6PA 1DWHM 4GNKB 4PMQA 1JCXA 1ONWA 3HGJA 4IX2A 2FMOA 4JN6A 3N25A 5I79A 4HA3A 3WENA 4AD5A 1ZJIA 5D9PA 4K1WA 1T6MA 3MR6A 5A2CA 7TAAA 3EDJA 3GKAA 1ZP3A 3MMUA 3SY5A 3G1HA 3WDRA 1TWWA 1NDVA 3MS8A 3R8GA 1YIXA 4JNMA 2C71A 3RPDA 2I1OA 1BSIA 2PZ0A 3RLGA 3BARA 3PB0A 3BAKA 5KG0A 1W3NA 4QJ5B 4R34A 2I7GA 3L4TA 3TYZA 1TPDA 4LS1A 3VKDA 3EXTA 2EQDA 1RV8A 1CCWB 2BLEA 3WMSA 1XQLA 3GLCA 2AQWA 4P61A 1XH2A 5FEZA 4A05A 3NPXA 1EC8A 2XM2A 1M53A 3QQ1A 3U5YA 1KBKA 4ZGYA 2R1KA 5FACA 2R8GA 3GIIA 1PS9A 1WDPA 4FOKA 2BY3A 3ARRA 2ZX7A 2Y6ZA 4HOXA 4UTMA 4O1DA 4ASTA 5HANA 2YBTA 4QWAA 2OZ0A 3EPMA 2JEIA 1J93A 3VNDA 1UQYA 2NSXA 4J3SA 1RQHA 3NQAA 1TYGA 4M5PA 1BAGA 5G4EA 1UUMA 3LV5A 2FVMA 2FZ8A 1JXLA 2XN1A 5A8GA 3NYDA 1Q7MA 1QT1A 3QHMA 3OA5A 2C14A 2CLEA 2VELA 2H9AA 5HQEA 4CD8A 4HJWA 3D3FA 4DB7A 4Q8MA 3PTMA 5LNRA 5F2GA 5AHLA 4OZOA 3ITGA 4K39A 5KFWA 3H4WA 2AGPA 4DAFA 4S3DA 2DU2A 4QP0A 1UWUA 4C6IA 2JE8A 1NEYA 3N18A 5D9MA 4ZBCA 1H1ZA 1ZALA 4N9CA 2ZWZA 1YE6A 5TF0A 1HIZA 3OIHA 1XUUA 1M01A 5HJXA 1JDFA 2CEQA 3BURA 2ZZ5A 1JDCA 3DI0A 4RL3A 2PWDA 1JPDX 2V69A 2YL5A 3E5PA 3NO5A 4IQJA 1XI3A 1N55A 4K8GA 1VPYA 3CO8A 3PR2A 1LOSA 2WCAA 2PLKA 3G77A 1G0CA 2C15A 1PB0A 4XKYB 3CC1A 3GYCA 5K2ZA 1DIEA 5I2UA 3U7BA 3VIIA 1D8WA 1F2JA 5DMYA 2GQ9A 1AQHA 3R6IA 3NQ6A 4C6OA 3M41A 1OFQA 1EO5A 3TZFA 5KT6A 4Z2JA 1O5QA 3A4XA 3P5ZA 5JMUA 3K1DA 3WQ4A 2AGKA 4RNHA 3VKCA 4DJFD 2R1NA 1FH7A 3WBYA 3WUGA 1LT8A 5EYWA 3VE9A 3BW2A 3MT1A 3AZRA 1WB0A 1HKIA 1OSEA 2FIQA 4JL2A 3GRIA 1VAHA 1QNQA 1OM0A 4DUWA 3GNOA 1YXDA 1X1ZA 1ECQA 4JTKA 4WJEA 2IKHA 4NVTA 3MTWA 3WCZA 1E40A 1DWGM 3W7HA 2P76A 1NF7A 2OZ3A 1CXKA 5G2IA 1WUFA 2WQPA 1H49A 5FJJA 2OSXA 3LMYA 3ZQ9A 2B7OA 5H1WA 3DFSA 5CLTA 3GIYA 2XH2A 1YADA 1NWTA 1RP9A 2DT0A 1JZ2A 2DT1A 2OJPA 3DECA 3QZAA 2FZMA 4K7YA 3M9YA 1LQ2A 4HYVA 3AMDA 1T7LA 2BQUA 4US6A 3I7SA 4HNVA 8TIMA 1SZNA 1AODA 2Y7DA 3PZQA 5CC5A 2FKPA 3EMQA 2YCEA 2WC4A 4OHQA 2C0AA 3GIMA 7REQB 2J7CA 1EDTA 1R6WA 1X97A 3W7IA 4WY0F 3UZXA 3UD6A 1JX4A 4TTGA 1UHVA 3NQ7A 2XVPA 1E6SM 1P1MA 3RBDA 4MZ1A 1P6BA 3WDQA 3VINA 5DFAA 2CWNA 1E43A 1TQXA 5CPMA 3VCCA 4RPQA 2NLYA 1Q6GA 2W61A 1KA9F 3PPGA 1VCFA 1IXQA 2P53A 2XH4A 4LY8A 4NZJA 3ARWA 4J2PA 3REQA 1S5TA 3FV9A 3O8AA 4E0CA 3PZTA 3CUXA 3EXRA 3PVXA 1P43A 3L5MA 1K77A 1PX3A 2EG7A 3BO9A 1KRBC 1UMLA 1A5UA 4JKKA 4DF0A 3TFCA 4MB5A 1ZCCA 2V30A 1UJPA 2GGHA 3TFXA 4UOQA 3OODA 2GJXB 1XYZA 5H6HA 1ITQA 5CPTA 3VXGA 1FHLA 5MHBA 2ESCA 3W29A 4MVAA 5HQMA 4TV5A 1UWTA 1S10A 3TIMA 2QUNA 2VC6A 3AXXA 3EWCA 1O5RA 1KXVA 3R2GA 2RFGA 1UASA 3ZSTA 2J66A 2QCMA 3P8JA 1UKSA 4PL1A 4O1AA 2WJZA 2W3ZA 5FKYA 1T5AA 4HK5A 1MQPA 4A3YA 1TUXA 4ERAA 4RE4A 4KWUA 3UR7A 3GDTA 3PAOA 5D2VA 4BY3A 4KCTA 1CYGA 4IFKA 3DYPA 5C2GA 1PWLA 1TPC1 4PA8A 4IPIA 2OO0A 1MW3A 1BXCA 2AQ4A 4IRKA 3VM7A 4IXXA 2WMHA 2POTA 3LLDA 2R6OA 4RDYA 4HZ6A 4DZHA 1XYMA 3T2QA 5F9NA 3U0HA 3M07A 4LBSA 2GDQA 5KINA 3IJDA 1D9EA 3ECQA 3CU2A 1F05A 3KS6A 1BTCA 2R8KA 3RJYA 3HZ3A 4NQ1A 3WF4A 2WCSA 4QJ1A 3UR2A 3DFOA 3CHFA 3LDVA 1RJPA 4JTQA 1A4MA 5T9CE 3MV01 1J2BA 2E8ZA 4ADTA 3MO7A 3TTYA 5LGXA 4AD1A 2XTKA 4FNRA 1MDRA 2PI6A 1FWEC 3G0XA 2GVJA 1PO9A 3I7RA 1FVPA 2QPSA 3GQCA 1GVIA 3MKVA 1AQFA 2TODA 4O16A 4H9YA 3FGCA 1RBLA 1RQEA 2WJFA 2VGFA 3AQUA 1KWKA 3WD4A 2E77A 5KFYA 2ZX9A 4ACZB 1U5JA 1XD1A 2A7RA 5L1KA 1FWWA 1EEXA 3N11A 1JZ7A 3MC5A 3U2EA 4UB9A 3AOFA 4AY1A 3HU7A 3K5XA 1R47A 5AHMA 1LP6A 4FP1A 2BSLA 1N8IA 5DMMA 3SRHA 1Y5VA 4O8RA 4DRSA 2G0WA 3N34A 1ISYA 1RH9A 1OBAA 4KGLA 3OVQA 5TIMA 4J9MA 5KFDA 5KETA 2BQRA 3CMJA 5G2HA 4FXSA 3LK6A 5KFQA 4Q33A 2X1IA 4UTWC 2X2YA 3BE7A 2E9MA 1Y8BA 3B05A 2D24A 3WD1A 2UBPC 5DCDA 4WEVX 4Y6GA 4OIFA 1PHQA 2EPHA 2PDIA 2YZRA 3N6HA 3ITOA 1BEUA 1VCGA 4JIIX 1FWBC 3NGDA 1UIPA 4W88A 4HOZA 1BD0A 1XX1A 2YW3A 1WXYA 4KETA 3CV2A 5HWMA 5K4ZA 1QPQA 4GQGA 3FW6A 4I6VA 1Q5MA 5CPLA 3AAMA 3Q4DA 4Q4PA 1MEWA 4GYPA 1U5HA 4ZSUA 3KVMA 4ATWA 3K4AA 4Q4MA 3G2GA 3VGBA 4JOMA 3TR2A 3QYSA 2E09A 4ED3A 3S2CA 4ES4A 3N2BA 1YYAA 3EBVA 3BAIA 4Q43A 1EGZA 4YTUA 3GNNA 2RGLA 4R27A 4DBEA 3A4WA 1BYBA 2RDJA 4DBDA 3M9MB 2CLLA 1XDMA 4U4MA 4TUFA 4YS1A 3SY1A 1PCKA 4LEQA 4HB7A 5AN7A 5KTLA 2B81A 1B90A 2CZDA 3NXLA 4Z1AA 1W54A 1GK8A 4WKAA 2Y62A 3CBWA 4JTCA 5IHRA 4KKXA 2E5BA 1XLLA 2ACRA 3WH6A 1AVAA 4P7NA 3B0UX 3GNDA 2AGOA 3M46A 1YTKA 4Y9AA 4R9OA 2GJRA 4M1RA 4S39A 4ECVA 5A6KA 5CZTA 1Z32X 1TTQA 3SN4A 1UROA 5FF7A 5KEZA 5C8BB 1HJUA 3H40A 1V5XA 1U83A 4Y9PA 3NQCA 3ITLA 1G4TA 1QPKA 4IIBA 4QAIA 4MPKA 4MNLA 1KXTA 2HPIA 2ASDA 1M1BA 1S1PA 4R8UB 3MMTA 2VZVA 3WN6A 4RUAA 3VUSA 3DOPA 1TV8A 3R79A 3A5FA 3QF0A 4FX7A 2BY1A 1XHGA 5H8PA 3EPOA 3JR2A 5A8QA 5CC3A 4A8IA 2Q02A 4AHPA 3B8DA 5I23A 2CYGA 3PG8A 2QCLA 3WBEA 5KFFA 1FHDA 4JTEA 2PGWA 1V6TA 3BGGA 1CI1A 3L2LA 4HU4A 1CEOA 4Z42C 4IMAA 1K9TA 1OVDA 4BQ4A 2PFHA 1CGTA 4J9JA 1FWDC 2HWGA 3H24A 1YKWA 2FVKA 1PZ3A 5KFGA 2WLYA 2O7SA 4PMRA 1BRLB 2F61A 1Q6EA 1CIUA 3S47A 1PZ1A 1JZ6A 4V27A 3SGUA 1FKWA 5DLCA 4ZO8A 3O0KA 1Z41A 2Z6JA 3BG3A 4LPCA 4AXNA 2EJ1A 1A47A 3BGAA 4LUJA 1IGWA 1IT8A 1V7YA 1KFJA 3CYVA 3UYCA 3PZNA 4YNGA 2XFFA 3RU8X 3SR7A 3U7VA 5CG7A 4UR9A 3U57A 1NFPA 1NFBA 2QJIA 4JFVA 4MWAD 3SRDA 4YCPA 4PFMA 1RD5A 2HV5A 2IKGA 5EBAA 4E4FA 1JCNA 5KZMA 2HK1A 3ZLFA 2FB3A 3FA5A 3LHYA 4F0KA 3WKZA 3T2OA 4MUZA 1CB2A 3BTNA 3CTLA 1KV5A 1LL6A 1XL9A 5D30A 3UZYA 1OZQA 3LA4A 2PDKA 3J7HA 4O17A 4P5UA 4IPJA 4QFUA 4A8RA 2V5JA 3M0KA 2IQ0A 1DJNA 4DPQA 5AKQA 4ZSTA 4H7ZA 4AWEA 1W17A 4H6KA 3GAKA 3A3XA 1MXSA 2XC9A 3CZGA 3QH2A 3FYYA 2Z00A 1B57A 2HTMA 2Z1BA 2BY2A 4UTFA 4DO7A 1XLDA 3LERA 4XD6A 1AMYA 2PB1A 1VGAA 3OQEA 2WZEA 3G1RA 2W9BB 4GLEA 2NV1A 3RHGA 5C5YA 2FLLA 1X6UA 2VA3A 1NARA 3AROA 3USBA 4C91A 2NWRA 4JNZA 3WQWA 5HWJA 4MKVA 4O28A 4MAZA 4DJDD 3FA3A 3KCJA 3DFTA 3P14A 5EA9A 3PWGA 2YPIA 2DDXA 5IOBA 1US2A 3B9EA 1I1WA 4WSKA 4LS0A 1W1PA 3QV7A 3GTIA 1FWHC 3M16A 3RAOA 3GUGA 4GMEA 3UY7A 3ZLHA 3AYTA 2YDSA 3DG7A 1ITUA 4IGNA 3B8WA 1WYIA 1DXIA 1HL8A 2Z1WA 1XD0A 4X2RA 2Z2BA 3HM7A 1VYRA 2QLYA 4HD5A 4X2PA 3OLIA 2YFOA 4AX7A 6PTDA 4CNOA 1EPXA 3STPA 2DFAA 4L65A 3M5XA 2HXUA 4LNCA 2CCRA 2FHCA 4P8WA 2VNCA 3RFAA 4HSNA 1LWHA 4DWSA 1MYRA 2XIBA 3ITYA 3KVKA 1G7UA 3EAUA 3MDWA 3RYSA 2HBVA 3IUIA 1L6SA 3RG6A 1UPPA 3ARUA 3R12A 1TWZA 3WEMA 2A3BA 2XZ9A 4EAYA 4AYGA 4YVPA 4ZOEA 4XAYA 1P7TB 2V38A 4GY1A 3PHAA 4GQ0A 4FOJA 3PR4A 4PMNA 3QW4B 4PCFA 1LZOA 3SAZA 1ZTVA 1JRBA 3WLMA 4OUEA 5C70A 3R0KA 1V8EA 3CQIA 3B4UA 4H04A 5CQ1A 1IR2A 3F4NA 4GPNA 1VYPX 1N48A 1ONXA 3W7QA 3H26A 5D8ZA 1J11A 3R0DA 2A7NA 3DDMA 1TVPA 1PJ9A 2ZA2A 2F2HA 2GOUA 3WK1A 1Q63A 3HV9A 2D2OA 3BCJA 3STFA 2PEVA 3DEQA 5E6YA 3GHRA 2WVSA 4O52A 1OFDA 2YW4A 4JN8A 4G7EB 1NWUA 4HT3A 1TV5A 2C18A 5DLFA 4AEFA 3LBCA 2DQXA 1I2QA 1VZWA 2FMNA 1A5KC 3FXGA 3CUZA 4Q8WA 4IIEA 3BQ0A 1NVMA 3PZIA 4XTIA 1KRMA 1S9FA 3PZPA 4JTUA 1UJQA 4JZ5A 2J9ZA 4IMEA 4PMJA 1VFUA 1B3OA 4XSMA 1JI1A 2ASLA 4WGHA 1QHOA 4PBGA 3SQLA 4BJHA 3A3WA 5KG3A 2YBUA 1SM9A 2YBVA 3VIHA 4MWAB 3PBVA 4BCEA 1UZHA 3WQFA 1H0IA 3AHXA 4AVFA 1ZJHA 1AMKA 3UETA 4JUZA 2J6XA 5CJMA 1K9EA 3LPOA 4BI6A 1DQXA 1LOQA 2R24A 3WK3A 3PN8A 4CQCA 4IGMA 3WYZA 4LVDA 1RLDA 2J7FA 1TV4A 3RUBL 1WBJA 2V68A 1TRDA 4CCDA 2FH8A 3U2CA 5JU6A 1WBHA 3GIJA 4JQ4A 1EOKA 4IP7A 4D8ZA 1I6NA 5HMEA 4EPBC 1WPCA 4H41A 1Q6FA 3W71A 1H7NA 2O9OA 2TPSA 3GNXA 2QXWA 1M04A 9RUBA 3UF9A 1XBVA 4QROA 1OG6A 1QHZA 3HPSA 3OJGA 1BXNA 1R3WA 3BZJA 7ODCA 5AHNA 3S42A 4ENLA 2BB0A 2FZDA 4PUMA 4MY8A 1QR7A 1KBBA 2IPFA 5G1TA 2VRJA 1S2UA 3FKKA 3W7PA 4GC7A 5E5CA 1KC7A 1PX8A 1VBJA 3IIXA 4E5TA 3LRLA 3C0SA 3C56A 2PDGA 1XCWA 2WBKA 2E1WA 4YTRA 1P48A 4GI6A 4UTTA 3EX2A 4UFIA 4RUCA 5F1VA 2YFNA 1PTAA 2RDIA 4ICMA 3U3HA 2NLIA 3UZZA 5HWNA 1MFUA 1V02A 4QE1A 1VRXA 3DUGA 1NIUA 1W3LA 2FZBA 3IJ8A 2C7FA 1E1EA 5LIYX 1FCQA 3GH7A 4NG3A 4D1IA 2YLAA 5LHFA 5I6SA 4FBUA 4F50A 4HYRA 3W82A 1EJTC 3SECA 1T0OA 4ZR8A 4HK6A 3C86A 1P6WA 4IT1A 3M0IA 5AHIA 3UQNA 4XKYA 3BOLA 2J24A 1M5WA 1EHNA 4DXVA 1ZP4A 1X1OA 2ZCGA 2OLSA 3LCHA 4GYJA 3V35A 1OD8A 3DFNA 1W9DM 1A5LC 2E25A 1GYMA 1A4LA 1A0DA 3OVPA 3RLVA 3BAWA 1V08A 1FDJA 1RBOB 3W2KA 1KR0A 4M6PA 2C6QA 1QI5A 3KRBA 1XIHA 5HR7A 3B8IA 4WKHA 1EWEA 1YDVA 4PEKA 1Q7ZA 2NVAA 1Z89A 1JR1A 4DL5A 3S2LA 3MKCA 4GUGA 3GDBA 5E6ZA 5F4WA 4QS5A 3I4KA 3MMDA 4B16A 2KX9A 1VEPA 5TNVA 3NWRA 4JX4A 2GUUA 2FHBA 1XGZA 1DKWA 4UFJA 2QCNA 1LRTA 4A2SA 4ATLA 3LV6A 3A47A 3SURA 3SCPA 4HPXA 4IJRA 3RLHA 2CWXA 5IXEA 2BMBA 1US0A 4LAKA 1XRSA 4LB3A 1WV2A 2G3FA 1ZSXA 3AIWA 2I9EA 4DI9A 2A21A 2OGYA 1RLCL 3B0YA 3CGTA 1XGDA 4F48A 3W7EA 4NUWA 4QR6A 4CU8A 4B4FA 4JV1A 2ABBA 3EPIA 1UR3M 7REQA 4JEJA 4QLKA 2ALZA 4QGCA 2IPWA 1FWTA 4J9QA 1IQ8A 4GXWA 3BOFA 1VBHA 1HN1A 3T0TA 1DTNA 1GQLA 1H63A 4UQAA 2W9CB 1L6WA 1LROA 4LFYA 3NL5A 2WLZA 4JTSA 3MO4A 5LA2A 1E0WA 2Y8UA 4NKCA 4LUSA 3B9NA 2VFFA 4QS6A 3W7RA 1F6PA 1GVOA 2AL1A 2VC9A 3VD9A 2A85A 3WDPP 1FFQA 1Q7QA 3VIFA 3W24A 4R88A 5KFJA 1SR9A 3EX6A 2HRWA 2FDMA 3DBPA 5EDWA 2J7HA 1C93A 4UQ9A 1Y7VA 1TJ2A 3A23A 2XYLA 4CQBA 5A94A 5DCBA 3B9AA 2GJXA 4P7QA 3KHJA 2Y8KA 1GVFA 3QC0A 4H9ZA 3AHTA 3M5VA 1U22A 3EXSA 3ZXWA 3KOYA 5T8GA 3FA4A 3LGEA 4AY8A 1MW2A 5G1YA 3NM1A 3W7NA 2ZRYA 1JIHA 2IA6A 1FCVA 1V7AA 2CXEA 4B5TA 4IQDA 3E38A 4R7OA 4FSAA 3F1QA 1N82A 5B7YA 1LOLA 1Q2SA 3GZ3A 4BQ3A 4IX0A 4IPNB 3XINA 1VPQA 4I90A 4J35A 3H2NA 3F5KA 4ACYA 2DSKA 1UH3A 2HMCA 3PF3A 4RW3A 3W2UA 1DPMA 4AHQA 3TYAA 4FNSA 3VX1A 1DBTA 1O5KA 1MUCA 3URNA 2PDMA 2OCZA 1F4HA 3LSBA 2G8ZA 3WLKX 4NNCA 4BEUA 1VH7A 2JIWA 4K8EA 4REQB 3CB8A 4KWWA 2EBNA 3MVTA 4C5ZA 3SQMA 4TQRA 1CXEA 1XYBA 3M0MA 3GDKA 5HMFA 2OTDA 1MVYA 1TV7A 3UCCA 3G1XA 3UA4A 4JIRA 2CESA 3P2VA 1ICQA 1E71M 3LUTA 4J3WA 3GTHA 4JIQA 2CHNA 5J5RA 3EMZA 2DPJA 1HG3A 3MCOA 1ZBKA 1Z44A 1J0HA 3MJMA 2JF7A 3LCWA 4DJDC 3F2DA 4D6HA 4P7LA 2WHMA 5D38A 1V93A 1XSKA 5EGRA 3UR8A 2PF0A 3MKKA 2ISDA 4DO4A 2D73A 3LENA 1UOKA 1DWFM 4ACZA 1XPYA 5AHEA 2G97A 3GU2A 1SYTA 1XS2A 1PBGA 4J2MA 2ZXBA 2JFEX 3CMFA 3H12A 1TA3B 3WFLA 4W86A 2PGEA 1VEOA 4DBUA 1EJVC 4EIVA 3VNMA 2Z7KA 1JPKA 4PN2A 4FEZA 1U2YA 4QG8A 3SCWA 3CHCA 4TIMA 4A3HA 3PUEA 1V02E 1B4EA 4GQBA 1QXLA 3F7JA 1QOQA 4GWEA 4GJIA 1ZAHA 3QTGA 1TVLA 3APYA 1CXLA 4XUYA 3SBFA 4CKQA 3P8IA 2WTFA 1KM0A 2PTDA 1ML1A 3T0BA 1MW1A 4C5YA 2WJEA 4DL2A 4ZO9A 4JX6A 2J62A 4N4QA 5J04A 1YBQB 3KWXA 2QR6A 3UYIA 5DRCA 5EKYA 2R94A 4R53A 1NQ6A 1IIHA 4ICNA 1J4EA 4IM4A 2WVUA 4EYHB 5HPOA 4KS0A 1JDEA 5E9XA 1X6NA 1WOBA 3C0LA 4M82A 1S5VA 2EGZA 4GIYA 4D6IA 4O11A 3LTYA 1G94A 3P61A 3ATYA 1TIMA 5M1TA 3HMCA 4S3BA 2OWCA 4BS0A 5C6MA 1H50A 3T5HA 1E0UA 3IUHA 5EU9A 2CLPA 2E9LA 1XYAA 1ZJBA 4A6GA 2CU0A 2BGSA 5EFDA 2QCCA 2ZA1A 3PP7A 3WFZA 1Q85A 3VKBA 1JYNA 3ARVA 4UMCA 5KT5A 1FX6A 2RJHA 4CVUA 2GLKA 4CN1A 3M0ZA 5HMDA 3E5BA 2NXIA 3L0KA 3MB9A 3IRDA 4O54A 3DHFA 4IJBA 3W87A 5AB3A 3NIYA 2DZPA 2ZUUA 4TV6A 5AC5A 4HCHA 3EKZA 2EO7A 1HKJA 2ZUMA 4O50A 3CO4A 4OV9A 4O18A 4KPLA 2ZRVA 4CQ8A 2V63A 3ITTA 4OTKA 3V5CA 3IANA 2DW6A 4G5DA 1VBRA 3K8KA 3UG3A 2ZADA 1JD9A 3DERA 4C1NB 4NF7A 1W5OA 1SJCA 3SI8A 1PZ2A 3W37A 1EGVA 3VYLA 2WB5A 4Y8FA 3HJEA 5EMMA 4DIAA 3EWDA 1VJSA 1E1FA 3ZWTA 1M65A 3R1ZA 4R8UA 2VEGA 2EF9A 1F3EA 2YGYA 4GINA 4JCMA 4LC6A 5CC7A 1H0GA 3BG5A 2HJPA 3PANA 3PB2A 5EWFA 4TU1A 5DEZA 3TONA 1R3RA 2AOSA 1ITCA 5A8MA 2BDQA 1XLMA 2XCPA 3I68A 2GK1B 1ZGDA 4QSFA 3NSNA 3UY8A 4C6QA 1N8FA 1Q6RA 1HF6A 3L5AA 4B5XA 2XN0A 3GB6A 3FLUA 2JKEA 4FNQA 3BK0A 5M03A 1BRLA 5KFPA 1V0NA 3BW4A 4KFPA 5LHEA 3RCNA 4IIFA 4URIA 3BLKA 2BVDA 1K9FA 2JF6A 4LQ1A 4PCTA 4B91A 4U31A 1REQA 1C29A 3C8FA 4QM1A 3QBUA 1HKMA 2OT0A 4X3ZA 1QU4A 1V79A 3MP4A 3NSMA 1CENA 1HKVA 1XLJA 4H8VA 3H4DA 1KFWA 5DT5A 5B80A 3DZ1A 3ZJ8A 1XXXA 1JF5A 3L66A 2JEQA 2WVTA 1XC6A 4QE4A 5M3WA 3PC0A 4HPGA 2BWGA 4L6DA 3IIZA 2X41A 3TTSA 3TAOA 4C6NA 4JQ2A 1B2YA 1ONEA 4BI7A 5BRPA 3WJWA 2W79A 3HG4A 1OT2A 4FXRA 3CZJA 3KP1A 1TPB1 3HA1A 4NILA 3N4EA 1JGIA 4M6VA 2G3MA 3W70A 3OHIA 4CCCA 1PYMA 3EDKA 2BQ3A 4DLMA 1Q13A 1UQZA 2I9UA 3NR0A 3KBJA 3O63A 4NHVA 1W9BM 2IMRA 4HHMA 1EUAA 1V51A 1ZHAA 4FMVA 1BPLB 1GQKA 3CHDA 3JZUA 1XSJA 4ORIA 2QNEA 3TUUA 1QNRA 5HQLA 3GAYA 1FHVA 1QW7A 1V0MA 3IEBA 2YKKA 4WR3A 3TCSA 2AU0A 1BF2A 3R8RA 1Q45A 3CASA 2J8FA 3Q8QB 2A3EA 2RAGA 2X1TA 5D04C 4GC3A 3CM4A 3PBWA 2W9BA 1FOBA 2QZRA 3MI6A 2G37A 5EMKA 1TTJA 4QBXA 1LBMA 2QUVA 5IFPA 3IVSA 5FJUA 3MVIA 4H00A 2Q6ZA 2CLMA 1RAKA 2WCGA 5XIAA 5A6AA 3UG8A 3NFUA 1J0ZA 4U5IA 4F79A 1ME8A 2OZTA 2J6TA 1S0OA 2EG6A 1X96A 3FSUA 4RXGA 4MB3A 4J9SA 2CXGA 1SU5A 4TVDA 2PTZA 1I75A 1OWQA 2INZA 2Z6IA 4JHOA 2XPKA 3TQKA 3PSWA 4ECZA 3ZJKA 2E28A 4RDWA 3GDMA 3H4GA 3TN5A 5DX7A 1JUKA 2X1RA 3NDZA 1S3TC 3W81A 3W1RA 1L2QA 3M0JA 3G0UA 3NL6A 4MUPA 1JF6A 2WNQA 1FH9A 2O55A 2PTYA 3G0SA 3ZWSA 1C3FA 1Y5XA 3L2IA 1F76A 1XYCA 5REQB 4UQBA 4W7WA 4MMWA 3W74A 1ZUAX 4AUBA 4CCZA 2WM0A 3KBWA 1E70M 1RK6A 4WDUA 3KBVA 2Y7FA 3IIVA 3SADA 2J7BA 3MUIA 4UTKA 2XVNA 3GFYA 3TAKA 1T99A 4F9DA 3S83A 1P7TA 5JXQA 3RB6A 1FXQA 4XG1A 4AY7A 4M56A 4O3NA 1KM4A 4B9YA 1S39A 1H11A 1ZBCA 1I45A 3CEUA 2FLNA 1RVKA 4NJKA 5BU6A 3A4AA 3KZSA 3FDGA 1OYAA 2YXXA 5BOFA 4DLFA 4ERIA 1F6KA 2FZ9A 3PK7A 3S2JA 5G5IA 2NUWA 1QDSA 4N4PA 5F4XA 3VIOA 1E3ZA 1UR9A 4I5UA 5DBUA 5KFHA 2X09A 3S1VA 1EDGA 3LNMA 2L5HA 2ALDA 2XINA 1AA1B 2P3EA 4Q22A 2YDAA 4UWMA 2G41A 2Q71A 3VNIA 4JTHA 1KFKA 5KG1A 3QPEA 5ENLA 1I2OA 4IIHA 3WLLA 4YYCA 4AFYA 5CPOA 1UG6A 3M9NB 7TIMA 1JQVA 4KCVA 2D3LA 1TWDA 4MKSA 4O3QA 3H8AA 3NO3A 1ISVA 4QDMA 3MR2A 1BXBA 3LPFA 5KZ6A 1SO6A 4JTGA 1M03A 4E8DA 1RALA 4IR1A 1WDWA 5FF3A 5HJLA 4GRSA 4GVIA 3UGVA 4D1JA 4IMCA 2PDYA 1WDQA 2GVYA 5FEWA 1HP4A 4HTYA 3VMPA 4HU3A 2VZUA 4POCA 3B8UA 4QCEA 4XD4A 4HCLA 1PDYA 3WK2A 3WLHA 1JEZA 4X63A 4MWAA 2WZHA 3OZMA 1YEYA 2DH2A 2ZDRA 2G96A 5CXPA 3AIEA 3KOXA 4GJJA 2ODOA 3EOEA 4TX8A 3LCFA 3TC6A 1EF2A 2W92A 1CX9A 4DYKA 4GGHA 3BCFA 4ED0A 2ZZ3A 3GXTA 1ADSA 2NZLA 4N9BA 1SVDA 3H53A 3L5LA 3S1WA 1EP2A 2MUCA 4BQ5A 1AH0A 3ORWA 2OG9A 3VMNA 1FWNA 3ES8A 3WQEA 3PNUA 4FOUA 1XUZA 2XCAA 1V6VA 4W8BA 1SR0A 2INFA 4HN8A 2DSZA 2IPJA 3O6DA 5DRIA 4WDTA 5CGQA 3HBLA 3R89A 1JZ3A 1O6IA 5KG7A 2OEKA 1ZNNA 2VCBA 4AD3A 1XW8A 2NX1A 4Q8QA 1B3WA 1OIMA 1TG7A 5IDZA 1Z42A 5AVHA 3A12A 3IK4A 1KLYA 3U5UA 2WSQA 1H62A 1JXKA 3GXMA 3U6WA 4IZGA 5AC7A 1CLKA 1HT6A 5AC8A 1JI2A 4MZ8A 1XH1A 2ZC8A 2OGJA 1FY6A 2YXOA 3REQB 3CPGA 2RDUA 4D8AA 1B3XA 4WKFA 4WOQA 1TIWA 3TLLA 2HNHA 1Z48A 3PPFA 3VNKA 3A9BA 4Q7BA 4DF1A 4NAFA 4RU9A 2C91A 1OCJA 3TX9A 3PUGA 2ICSA 1E3XA 3CIWA 1QOXA 4WUIA 4MTVA 2D0HA 3N4AA 4QX4A 2GSEA 3MP3A 4US5A 1E56A 4M0XA 3EOUA 3O05A 2CW6A 3CH9A 4A3QA 2Q01A 3G22A 4MNMA 4JYEA 2IMWP 4UXDA 3WMCA 3QFEA 5H8UA 3PW2A 4AH7A 1O7AA 3M6DA 1Y65A 4I5RA 3A9IA 4XAZA 2I17A 4JXCA 1G5AA 2GFTA 1OF8A 3HJZA 1LG2A 1WDDA 4Z2HA 4GUJA 1E9LA 3G6LA 1NY1A 5FD0A 1K4HA 4NY2A 4S3EA 3M43A 2ISFA 1ZETA 4GZEA 4WXZA 1GKQA 3G8EA 2C8NA 3C0JA 5CBIA 3GC2A 4JL1A 5FI8A 5L9FA 2PP0A 1K8ZA 3PPCA 3L2MA 3UXAA 4L61A 1ECEA 1JAEA 1VIZA 1PE1A 3E96A 1GOXA 1PVNA 1GPWA 4HMDA 3FJ4A 4IICA 3STGA 3B0VC 2J6UA 4Q4RA 3SQSA 2ZQ0A 1G7VA 4ILSA 2RJGA 3WH7A 3STCA 2ACUA 4DL7A 2YYUA 4QIUA 1HGYA 1GHSA 4GJ1A 4MYXA 2WANA 1W9PA 4H8NA 1TE1A 1TMQA 5KFKA 1XJBA 2X7VA 1QI2A 3LTPA 4QDWA 1XFBA 1XLFA 3PAJA 3BJTA 4TR9A 1VFSA 5AYXA 3PJUA 4PODA 3HV8A 3PJXA 4N0RA 3T4CA 2YB4A 2DIKA 1LORA 4PMYA 2XVKA 5L1IA 2WSYA 1UMYA 2YDRA 3GVWA 4S38A 1N2VA 3II1A 2VWSA 3LM7A 2NSOA 3UJSA 4ERGA 3IJ6A 4PMOA 2PAJA 4JKLA 4MG4A 2O9TA 1PIFA 3SY8A 5GVJA 3VK5A 3QV9A 1LT7A 5MKGB 2TYSA 3APTA 3WJXA 3GFXA 1L8NA 3E1F1 1NP0A 2O4QA 4X22A 3UWVA 4GQRA 2E67A 2XISA 2V81A 5KT7A 1EYEA 4E3TA 4KMQA 1RSCA 4IL0A 1ODUA 1RCOB 2Y2WA 3W1PA 4J1OA 3AS2A 4QQ3A 3UXLA 3HQPA 1EP1A 4X9SA 4LRSA 2W9CA 1Q6CA 2MANA 1B0IA 1XKYA 3GXNA 1SZFA 3K30A 1KTBA 2XG9A 3GIKA 2ZICA 5I77A 1JDAA 3HPFA 4GZJA 3FDSA 2WM1A 2FTPA 1DJHA 3W25A 4ZO7A 1N8WA 2NXHA 3WQPA 1FHUA 3GNRA 5C54A 3MQTA 3FK4A 2WW5A 4X60A 3EOLA 3LRMA 3W84A 4G8TA 1KNWA 4O3OA 3K1GA 2DPIA 2I57A 3DHPA 2CNCA 1SO3A 2W27A 2EPLX 4HJFA 4LCRA 5ABHA 3UU0A 3DGRA 1O94A 1I0DA 1TMLA 2OU4A 6ENLA 1ESWA 2E7FA 3NL3A 4NRSA 3V18A 1QRQA 2WKJA 5DXXA 1IEVA 2OODA 1Q2RA 2GSHA 3GW3A 1G4SA 3S5ZA 1QPNA 4BFAA 3NL2A 5AFDA 3CLWA 2HVNA 2XFRA 3GH4A 2VENA 4KWVA 1DQUA 1W5NA 4DWSD 4PTMA 4PMVA 2V9DA 1DTUA 4O0KA 4ZL1A 3FVMA 1A5BA 1UBSA 2A3AA 1VBGA 4LAMA 1WKEA 1YLVA 4YN5A 3SIMA 1KQYA 4WJ8A 4KWSA 2CLOA 4J28A 2V4RA 4JBRA 4LCSA 4LAZA 4WLCA 3VTRA 4GOAA 3UXKA 2ATMA 1RY8A 1TTPA 4ECRA 3M5ZA 5CAKA 2CIPA 4GY0A 3OP2A 4HQVA 1JDDA 4L4OA 4REQA 1H61A 3E74A 3E12A 5DO8A 2D23A 5KFUA 1V6XA 3OHMB 2W63A 5KFOA 4FX6M 5HUPA 1LQAA 5PTDA 1CTNA 1SQ7A 1O4UA 5E1QA 4CD5A 1T94A 4KT2A 4O10A 1BLIA 4DF2A 3D5HA 5AC4A 4AWSA 4ECQA 1BYCA 2HS8A 1JZ8A 1Q6LA 2J4GA 2F9RA 1GNXA 3O6YX 1E6NA 1S1RA 4K36A 2VEPA 4IXHA 2VFEA 4AXKA 4UFLA 1W5QA 4QTGA 5KFTA 3N2XA 1Q6OA 3PBUA 2YCKX 1PKNA 3E2SA 3WD0A 3L67A 2YA0A 4AZGA 3UZWA 3E0FA 4ADSA 1TA3A 4V28A 3O6CA 2XGBA 5F2IA 3M0HA 4FF5A 1OC6A 5F1UA 4IMDA 3W9ZA 1RPXA 2C19A 3OGRA 5FJPA 3WQVA 4LVGA 4IL2A 1P4CA 2R8HA 4U2YA 2YXGA 5KFZA 1TB3A 1AG1O 5HBFA 2CBVA 2D2HA 2DGAA 2A79A 3O16A 3E0IA 3VD3A 2VT0A 2CZVA 2ZZ2A 3ZFHA 1QNOA 1S5WA 4FX8A 3KHDA 3SZ8A 1BTMA 8A3HA 3EB3A 1YBQA 3FKRA 3CUGA 1KKRA 3C2FA 3LNPA 3M5YA 4Q3MA 3N04A 4DI8A 4FR1A 2YB1A 5D33A 5JIPA 3VIGA 3EDFA 3NQVA 3LCXA 2YL8A 4GZIA 5FCZA 3D47A 1TJ1A 1A5AA 1XRTA 3BXWA 3P74A 2GVEA 1ZAJA 2ZUTA 3U4AA 4GYFA 3SFWA 4OWGA 3BZGA 2PDUA 4HNUA 1A80A 3SUVA 5BXRA 2XFWA 3S46A 4DN1A 3SRFA 1DHPA 1OQFA 5D9NA 5A6MA 4JIPA 1JD7A 1LBLA 3BCDA 3AS0A 3DFHA 5ABEA 4XIMA 1R7AA 4UNKA 3TQ1A 3EA3A 1CXIA 3LEPA 4YHGA 3NZ1A 5DQGA 4UUIA 3VGEA 4J9KA 5ABFA 1U33A 5D2WA 3P60A 4DAIA 7A3HA 4S3CA 2WZMA 3W72A 5CGMA 3AU6A 1C7SA 2IW0A 3ME3A 3N73A 4J3ZA 2HISA 4PR4A 1E4MM 4U3CA 4FIRA 1GPFA 3G1SA 1F3WA 4S2CA 1K8YA 4LVFA 4KEMA 3H2AA 1GG1A 4ZQPA 5C5JA 2XGIA 3WH5A 1FP8A 3AUJA 1DOSA 5FJRA 3W3OA 1PUDA 1Q65A 2YA2A 3TR9A 1LM1A 1I9CB 2J25A 3BSHA 2ONEA 4EE9A 2WHJA 3EEGA 4LB4A 1E15A 2AGQA 2DUAA 1MQRA 4NAEB 3W07A 4C1NA 4ECXA 3WUEA 4H6RA 4GI9A 1JFXA 2PP3A 5DCEA 4IP5A 4F40A 4M1BA 1NSJA 1U1JA 4ZE5A 4H2HA 4AZBA 1VHNA 3TZNA 4ZOCA 3EKLA 3AI0A 3FX4A 4J7RA 3N6QA 1SJDA 1EC7A 1CLXA 1HL2A 3ZLGA 4GCXA 3M64A 5EL1A 2FB2A 4OBRA 4CNNA 1TE6A 3OIXA 3H55A 1GYNA 2FH6A 4DWSB 3QRHA 2AAMA 3R43A 4G56A 1A49A 2Z1XA 3L0NA 2PU0A 1YHTA 2DZXA 4H2CA 2RUSA 1VLWA 3MUXA 1X8FA 1RA0A 3LOTA 2Z7GA 1M7PA 1N7KA 2GQAA 4L4PA 1BWKA 1FFRA 2A6NA 5GJNA 1O68A 4A2RA 1IWPA 2F8QA 4OBSA 1E5JA 4IUOA 1Z3NA 1JL8A 2Y5EA 1L6YA 1MZHA 3VOCA 1EO7A 3T55A 1W9VA 4D6CA 3NDYA 4W7UA 3QTPA 2PLCA 2DPEA 1TPFA 3S3GA 1C92A 3KHHA 3GILA 1RYRA 4OOUA 3KE0A 1S2WA 5A6LA 3PS7A 4MADA 3BJYA 4XUGA 4J9LA 4W4QA 4YR3A 3GYEA 2X0YA 5HMSA 1Q3NA 5TD4A 3PPHA 2D0GA 2PSNA 3EDEA 1W8GA 3LZ3A 3E2VA 4FLRA 2WSPA 1JPHA 4B3LA 2Q8LA 1UWAA 3W86A 4CU7A 4A21A 3TQPA 5K9CA 2FJUB 4C65A 4R33A 1SPQA 3NPWA 4DJED 1J0KA 3TQ0A 3MU7A 4GG9A 3GXFA 2QEZA 2VEIA 2C22A 1S97A 1TVNA 3W7CA 3AXHA 3H2EA 5H2ZA 2R14A 5JH2A 3EPNA 1QAPA 4GKTA 4B2DA 2WOQA 3VGGA 5AYZA 2ZX6A 1KFLA 3S1GA 2A3HA 4GI4A 5A3HA 1V3JA 3MR3A 3L4ZA 4EP8C 2VI0A 4V1YA 2YIHA 2ZYFA 1DXFA 3AIQA 2YX0A 3AIRA 3NPVA 3ZM8A 2UWFA 3M44A 1PZ0A 4TXEA 3FHQA 4DUOA 1ZL1A 1O1HA 5BXSA 4GH1A 3LG3A 3GDLA 3HQNA 4J9NA 4XZ9A 3PZUA 2IXVA 3EWZA 3FVDA 4DZIA 2DZVA 4L6HA 1SZEA 1G1YA 2QKFA 2QDDA 1XGEA 3COTA 3TW7A 1W9UA 4HNNA 4XWUA 3GE7A 3SCTA 1J18A 1NWRA 2VM8A 1KW1A 5HUOA 3S0CA 2E6FA 2O56A 5BU9A 4INFA 2ISWA 4CQ9A 3STEA 3AZSA 4UTJA 3R8HA 1DIDA 1VRDA 2X0SA 2JGQA 4GI8A 4S1FA 3R0UA 1AJ2A 3M6YA 3LCIA 3POHA 2PA6A 2WV8A 3IWPA 3KLKA 5FJIA 1DVJA 1W3IA 1U1UA 4AMCA 2B7PA 1S2TA 3IGSA 3ZR6A 1Q4NX 2UV8G 3OVRA 5REQA 5F7UA 1SW0A 5KFBA 5XINA 5T91A 4JR5A 2GVGA 3F4DA 3NNTA 3C52A 4JD4A 4AWTA 1JZ4A 1VFMA 3AYSA 4DHGA 2DT2A 2CERA 3VD5A 5F9LA 3I6RA 4S3KA 3ZIZA 1H5YA 3BANA 4NU7A 3YPIA 1KFEA 4JQ1A 4LSBA 1XICA 1RR2A 4AC7C 1OABA 4RZ4A 4F0MA 3V6JA 3NQGA 1J2WA 5DGAA 1NOUA 3A3HA 3C2VA 4XZWA 3O6AA 1GVSA 1W1TA 1CNVA 4EBEA 3LMZA 4AW7A 4LAOA 5BWAA 2PCEA 4PRTA 3OEXA 3TN4A 2VR4A 3R10A 1CXFA 1C9DA 4FAMA 2BHUA 1C8XA 1ZZMA 3B40A 3GR7A 4OVXA 4TQTA 1WXJA 2WMGA 1K70A 3OGVA 5KFNA 2ZVRA 3V0UA 3CUHA 3CEPA 2J47A 1JNDA 3BGJA 3WIJA 5ABGA 2EHHA 1UCWA 2GSJA 2QF8A 1DJQA 3PNZA 1PTGA 5M5DA 3UJ2A 4HU8A 2J6SA 3QOKA 4LOCA 2ZE3A 1XLEA 2DP3A 1R38A 1DE6A 4XZBA 3LLXA 4O1FA 3VFCA 2VQUA 2QGYA 5GNZA 3VFLA 4YP3A 3MSDA 2CFFA 1FP9A 3W75A 1GOKA 5KFLA 6TIMA 4L64A 3A22A 4J4KA 3GIQA 2CHOA 4C60A 4J3XA 4ECSA 3M1ZA 1A5OC 5AOUA 3W1UA 3BLEA 2D22A 2XHYA 3LY0A 4GABA 3M0VA 4IMFA 3BLLA 5D2XA 3W76A 3WLPA 4HNTA 1IHIA 3NM3A 1F4AA 1ZCOA 4HU0A 2QGHA 3KHLA 3QOMA 2WVVA 5E93A 3WNKA 5HNNA 1YDNA 1W1IE 1EHAA 1TPWA 4PB3A 5C0QA 1OFOA 4AZCB 4B92A 3B8VA 3ARSA 4U3AA 1RP8A 3R25A 3THCA 1FWCC 4MDOA 1RXOB 4ZMGA 2WSRA 2YCJA 4IFRA 1YPIA 2ZKMX 4NXSA 1B9ZA 3R4IA 3S9IA 2PUZA 4G7FA 5U4NA 5GJPA 1D7FA 4RNNA 5CKSA 5KFXA 1E6QM 2JKPA 2I5IA 1H7XA 5BRBA 3MPGA 1WA3A 2V8ZA 3VOHA 2XGZA 3FN9A 3L68A 3LQLA 3RMJA 1KGXA 1QVBA 3W1QA 4CN4A 4WSHA 1OF6A 1PSCA 5EY5A 4LUSB 3QY7A 1HJQA 2VUYA 1M7OA 4RCXA 4RJEA 4UC5A 2XZ7A 3AYRA 1EBHA 4O0ZA 2X7WA 3VKAA 4FXJA 3N9RA 1UW9A 3V16A 3MYOA 1XBYA 4FZIA 5DY2A 3BLIA 1SFSA 2ZA3A 4C1LA 2OR2A 4X61A 3LLFA 1LTDA 1I2RA 3BH4A 4QDPA 3NQBA 2WSKA 4BKNA 1JFHA 1HO4A 1XWYA 3SUUA 3C61A 3M7WA 1H51A 1HO1A 3HN3A 4R85A 3LB0A 2QW5A 2CLKA 2J88A 2NW0A 4PC8A 1VC4A 2C0HA 2W8KA 1A3XA 3H4BA 4OT7A 4MOZA 1EJUC 3KM8A 4RV3A 3QFWA 5CG0A 4KBXA 5JBFA 1J10A 2QDGA 4KESA 4MJ2A 4YWIA 2Y1HA 1CT5A 1OD0A 1IV8A 3VU2A 1HNYA 2RDWA 3R11A 2WYSA 5EWEA 2NVCA 3LHVA 2GQ8A 1VF8A 2Q8ZA 1K03A 1DJIA 3DI1A 2QJMA 3USZA 2FTYA 3DXIA 1QATA 2B4GA 4W8LA 4BHYA 1XDJA 1IXOA 3TXZA 2EJAA 3GGMA 1EKOA 1QW9A 1ME9A 2GUBA 4ZA0A 3RX4A 3C5QA 3RIKA 1V3LA 1OINA 2XWDA 4MKNA 4A22A 3T81A 4K6AA 2ZX5A 3PTQA 1HW6A 1K02A 2ANUA 3OZYA 4FNTA 3BG9A 3OZPA 1J8VA 1V77A 3RGTA 1TMHA 2PZNA 3QJAA 4O3PA 4N6FA 1GVEA 3FOKA 1GONA 2FQIA 1OX4A 3H7RA 4DO6A 4UTTC 1E0XA 4P8UA 4EPKA 3TQVA 3RM8A 1XC4A 4W9TA 5H8MA 3AU2A 1OCBA 3T9PA 4A3RA 3P0WA 5LYRA 3G1VA 4XB3A 1AQMA 1QNVA 3VPLA 3EX1A 4EEYA 1H3GA 1XG3A 1B9BA 4XKMA 3TN6A 5JUVA 3B0XA 4HP5A 2PGFA 1W2VA 3MWCA 4H3DA 3HPZA 4GGBA 2REQB 3IGXA 4FBTA 2V6AA 5MKGA 1WX0A 3VD4A 3V0SA 4MFDA 1FWFC 2HVMA 2ACSA 2JALA 1GW1A 4AZ6A 1EA0A 2VC7A 2J7DA 2CPUA 1NDZA 3MV11 1CBGA 1HUVA 1LBFA 1V6YA 2VFHA 1CECA 4QHRA 1H7WA 3A64A 3DGBA 3PUDA 1Q4WA 3CMGA 3BMWA 3ARPA 3HGRA 4E38A 3G3DA 4LV4A 4ED7A 1S38A 3OA3A 2QCGA 4K38A 2UY4A 1EXPA 2XSXA 1VBUA 4J9RA 4WDXA 4QXIA 1WCGA 4Q45A 1GZJA 3NGFA 3LPPA 3LYEA 4GO9A 4ONVA 3FFSA 3VMOA 4RR4A 1V03A 1VENA 3V3WA 4ED1A 3QY8A 1B54A 5I3DA 4JDBA 2AKZA 4UCFA 1J5TA 3DYMA 1FKXA 2TSYA 4QRNA 5KG4A 1K9DA 1LLWA 3TJ4A 3MSGA 3O1NA 1YNQA 1I60A 2QVNA 4LW7A 2J74A 4GXMA 2ZE0A 3SUWA 3I6EA 4ADUA 3B3DA 4AIBA 1LUCB 3NXFA 1XLIA 4E2BA 1CGUA 3T07A 2DUZA 1FQ0A 2OEMA 4B5VA 3BSGA 1I2NA 4JIEA 3WUBA 4PTNA 1A3WA 2J7EA 4DQWA 2R91A 3W1MA 3RXZA 3G6YA 4PCSA 1S0NA 1O1ZA 1QI3A 3NSXA 2EPNA 5HJYA 5AYBA 1SFTA 3ZO9A 1OG0A 5KG5A 5DG7A 2HVOA 4O53A 3VUPA 2Y88A 1ZBVA 2GPTA 4XBSA 5KMYA 4AF0A 1IEWA 2BXZA 5B7ZA 4W93A 5A95A 4MIMA 5JUMA 2CLIA 3Q8RB 2GGIA 4PUEA 2HZGA 3WL1A 3NAVA 4C6DA 4BF5A 1BSLA 3CL6A 3IARA 1Z7AA 2V2CA 3N19B 2PLJA 2VX5A 3WQ6A 4AC1X 1ME7A 4G3IA 4Z1DA 4HZ8A 4I9MA 2GGGA 3PSVA 1RYSA 4PFHA 3U2OA 1SW3A 2W5FA 1MRAA 2HNEA 2VC5A 3M0YA 5I78A 1FXPA 6ALDA 4PE8A 4A35A 5BMWA 1SZGA 2NUYA 3E3HA 1QBBA 4MHBA 2Y85A 4Q8EA 3PW4A 3H2MA 2DJXA 4Y7EA 3WH9A 4LX4A 3Q45A 3V1PA 3N6JA 4FS1A 3OSPA 2QCHA 4UNIA 5CGTA 4RV8A 3LBOA 2PDJA 1ICSA 1KCXA 1TWIA 2YSWA 3SN1A 4IHCA 5C9UA 5LNUA 2QJJA 4ZB0A 2VUNA 5CPNA 1D3HA 2VZOA 5DG8A 1NAL1 3PZMA 3TWAA 3QKZA 5D32A 3ARQA 1Z69A 5LXEA 2IKIA 3S6TA 1ZS2A 3CYJA 1GG0A 2G3IA 2ZIDA 4L4LA 3NA8A 1XF0A 4JFSA 2CETA 4UFMA 4F0RA 1BGGA 1F6YA 2D69A 1REQB 2H3BA 1JRCA 3GDRA 2QQ6A 2X1UA 3IIPA 1H2JA 2BXYA 3I3DA 1OX5A 4BWLA 1KB3A 2R8JA 1IT0A 1TV3A 1GOOA 2J8TA 1QO2A 1KXHA 3B9OA 2DZAA 3VNZA 3F4VA 4W89A 4Z0JA 3CUFA 1UD5A 4CNPA 3AJXA 4HHHA 2QDHA 3THUA 3SCOA 4ZQOA 1UUQA 4ROQA 3MSRA 1FDZA 4PBFA 1RCXB 5D09A 2FGBA 4W87A 2WZIA 3N9KA 1WUEA 4KH2A 2OLHA 3TKFA 2WBGA 3L4WA 3ZVHB 1SJAA 1WAUA 3LXAA 2X8RA 3Q67A 1B3VA 4O8AA 1K8CA 3BVJA 4TTUA 1PHWA 3MUZ1 5FOOA 3WJYA 2BGNE 1J96A 1IEQA 4CD7A 1PYFA 1KM5A 1R86A 2VFIA 4OFCA 2AQOA 1YE4A 1R30A 2I16A 3RAXA 4D8LA 3QXBA 3T5JA 4Q8NA 4JTIA 4CUCA 2DSVA 4JQAA 1V3KA 4X0VA 3WBAA 4W84A 1MNSA 4WZHA 1TQJA 2X40A 3UPBA 4UTIA 3TLQA 2NQ9A 3QR1A 1C91A 1UH4A 3EB2A 5J8LA 1IZJA 3I4EA 3PBYA 1P5BA 4YPJA 4FR6A 3OYXA 3KBNA 2YJQA 5HNTA 4EBCA 3JZEA 3VDGA 2HDJA 2DY3A 1VCVA 3QMSA 1PL9A 1MUWA 1OC7A 2WK2A 5T9BG 5KFMA 1SW7A 4EXAA 3UG4A 4WRHA 3OBEA 4BF9A 4NL1A 3ABXA 3W7LA 4O0QA 3N3TA 1JUEA 4DJFC 4M8UA 4FALA 3P84A 3GG7A 3V75A 4US5D 3AYVA 1R9XA 4FIQA 1TV2A 3TTQA 3VVGA 1A5SA 1DIOA 2OX1A 4NAEA 3GXDA 2GWGA 4JPGA 1BVNP 1KGWA 2OOFA 3PZ9A 2HE5A 1KM3A 1QO5A 3H6OA 2ZX8A 4H01A 1FA2A 3AWOA 4AYSA 2YL6A 3GZAA 2P8BA 3APGA 3CWNA 1KXQA 4IPPA 4K7VA 4AWUA 3N15A 1PIIA 4KEVA 3VIMA 3NQEA 5JVLA 1K6WA 5F4SA 3WDIA 3HG3A 4ZB5A 1JCJA 5FESA 3DX5A 3TYCA 1EGMA 5K9DA 3CHEA 1XFCA 2OQYA 3FAWA 3BV7A 3SJ3A 3W0KA 2Z0IA 3VOJA 4MPQA 3W4RA 1UR4A 3K8LA 1HGWA 3SGZA 4J3UA 1IM4A 3LD5A 3LZ5A 2V3DA 3NG3A 4PMXA 5BYWA 2QIWA 1NP2A 2XM1A 4GBUA 2BHYA 3FS2A 2V5BA 3W38A 4RNJA 4ZVJA 4G9PA 3TYEA 3UNTA 3BICA 4IUGA 1JYXA 1AH3A 1E0VA 1UB3A 4NXKA 1HZYA 3C8NA 2J9XA 4LT9A 4XZNX 1A3HA 2PGRA 3N9SA 4IQLA 1CGWA 3KS5A 1YDOA 4F4XA 4MM1A 2XIJA 2BNJA 1XSIA 1M41A 3W2JA 3BLOA 3HF3A 1VFOA 3NQDA 1CB7B 2UZ9A 4IRDA 3UXDA 3WEZA 1MXGA 1XLGA 2XGPA 4LU0A 4GC4A 1L9WA 1E6ZA 3CZLA 5JQ9A 4IIGA 5LGZA 1V3MA 4WVXA 4YCOA 1PPIA 3CL7A 2B7QA 2YDQA 2OO6A 3HO8A 5JH1A 3VOFA 4ATDA 4BA0A 4I8DA 3C0QA 4QG9A 1TCDA 1UP0A 3WQGA 1BQCA 2QYGA 1Z9AA 2PTXA 5IBXA 1Q8JA 6XIMA 5AYYA 4XIAA 1F61A 1MSSA 4Z2GA 2Z2AA 1ALDA 1GVQA 4YJ5A 5EBUA 1ELSA 2UY2A 1QPRA 1XINA 5ABTA 3P3BA 1W1ZA 3B8TA 3T5KA 4JS3A 2BV9A 1O95A 1T41A 5DGBA 3AWNA 2DUXA 1EX5A 2EKGA 1UWIA 3DCPA 4RK8A 5I07A 5HNUA 2FFCA 2X0HA 4UCGA 5AYIA 1VFFA 3BOXA 2GZXA 2ATSA 5LXXA 4QWEA 4XO6A 2A3CA 4P2VA 2QAFA 4ZQNA 3AUOA 5FA5A 3I3BA 5A6BD 2QT3A 2ZDSA 1PX4A 4H8HA 4HNOA 2Z1VA 1D3CA 3AHVA 2TRSA 4GIAA 4ED2A 1QK2A 3S5YA 2Z4GA 1GCYA 4IH3A 4CEXC 4ICCX 2XSAA 3IAPA 3WJSA 5HA7A 3N2OA 3UPMA 4MLJA 1G69A 1IWBA 3FHAA 2SFPA 3HMJG 4Q44A 3CV6A 1UWRA 3G6MA 1M6JA 1LG1A 4YTTA 3AHYA 2J7GA 1US3A 5CC6A 1XRVA 3BQ5A 1OGBA 3AIUA 1GORA 5G4HC 3IJIA 3TOYA 1VHCA 5C9ZA 1WAWA 3PZOA 3DC0A 3MDUA 4HYKA 1RJRA 1W3HA 1KQZA 3ANUA 3UG5A 4JX5A 5LIWX 4NYYA 1VS1A 3MA8A 4V33A 5FIPA 4LAUA 1O60A 2XWEA 5HATA 4KFNA 3CWOX 4NAFB 3LI1A 3AC0A 5F2MA 3UFYA 4A8LA 4Z2IA 3AMCA 4Q32A 1KFBA 1W37A 3W00A 1KD0A 3V6KA 3KAOA 3OHBA 3ALGA 4KRZA 1FCUA 3K46A 3MUCA 3NZPA 1H60A 1VB9A 3OG2A 1KFCA 3MSYA 1TO3A 4MJZA 1TJPA 2V3GA 4ZQCA 4H7CA 5SWUA 2ASHA 1P1XA 3LXCA 4L7ZA 1PAMA 4EPEC 5KFEA 4JV2A 5BW6A 1EUNA 2GWNA 1XLKA 3SUSA 5EWGA 4QJ3B 2GDUA 4ED8A 1OYCA 3PVFA 1EJXC 1X1NA 2VZSA 5LNSA 3EX3A 4IF2A 2QS8A 1C8VA 1WDRA 2V82A 2QJHA 4J9OA 4QAWA 4C7FA 1JULA 1E4NA 3ZJ6A 1IXPA 5F2LA 1DEDA 2VCCA 2E4TA 4GIRA 2NWSA 4RNFA 3PULA 2PWHA 2Y7GA 1ZU8A 5CJNA 2B31A 3TW6A 1EWDA 1O12A 1MRQA 3WNMA 3MJYA 1S0MA 1MEHA 1HKWA 4WSJA 3N2TA 3QN3A 3BLFA 1PDZA 4YMZA 3B8SA 4FHAA 3V6HA 3P67A 4GE8A 2H8XA 5JBDA 3WD2A 1IT7A 4E2OA 2DSUA 1NELA 3H2FA 1QMLA 2FLPA 3AJ7A 4HA4A 3CQHA 3S6DA 4Z1YA 2VD9A 3OLGA 3T1GA 4KFOA 3O3RA 3N13A 2Y70A 1X38A 3DFQA 3K4DA 3OBKA 1IF2A 3B9DA 3DHDA 2HBXA 4F66A 4AZCA 1TZ9A 4OQVA 1B4KA 2VEFA 1YXCA 4DO5A 3I10A 2VXNA 2OX4A 1U30A 1QNSA 5DBTA 1YXYA 1Z8AA 4HHLA 5CSSA 1A0EA 3L4VA 5AZ1A 4Q8OA 3NUKA 1W5PA 1BG9A 4RE0A 1SSDA 3CAQA 1RPKA 1GJUA 2PP1A 3KWSA 1FDYA 2AKMA 2HSAA 5KT4A 3F2BA 4DJEA 1ADOA 1UR1A 3AHZA 5I24A 3VC5A 2FGZA 1XP3A 4Z2LA 3TOPA 2UVUA 4JY8A 2RKXA 5LKYA 3LBMA 3F4WA 2OLAA 3F2CA 4HIBA 4OU1A 3I7QA 1EXBA 3VOIA 2BODX 3WLTA 3GKFA 3HTWA 3HG2A 3OZOA 4PUJA 1M7XA 3QC3A 2VX4A 2Q8XA 4BZYA 4HBKA 1NDWA 1XCFA 4K8HA 1EEPA 2QPXA 4NLGA 4LYQA 3Q94A 2ZFAA 1IXNA 3LPGA 1UZDA 4WHBA 3QR0A 3CPRA 3ARYA 4MWAC 5AVNA 4ZQMA 2DZTA 3G3MA 2I5GA 2XH0A 5HDRA 3ZT7A 2H6RA 3E2RA 2GYIA 3N1AA 1PV8A 1E51A 4MDPA 1POJA 2O92A 4W5UA 3JU2A 3GC4A 2VOTA 3FY1A 3S9YA 1SJBA 4LY4A 4Y96A 3S1XA 3ZJ7A 3WNLA 3Q37A 3S2NA 4MAVA 1B30A 2C3ZA 1FBAA 4FNPA 1VQTA 4EPDC 4PRRA 1J0JA 2O9PA 2R1MA 3RX3A 4ZODA 3O2LA 4WX2A 5CBJA 2CKSA 4QQUA 3MFHA 1UD8A 4OBTA 1K1QA 2Z25A 3GU9A 1UA3A 1NM9A 2XN2A 1EYWA 3TWBA 1BYAA 3W23A 5FF4A 1LDCA 4PSRA 4B90A 2PBOA 3RILA 3R13A 1FWAC 1P0BA 1LQ0A 4YU1A 1BKSA 3H54A 2C1HA 2C1IA 2J9YA 4Y9NA 3CZEA 4Y2WA 3OG3A 4D71A 1XIBA 1BGAA 3BAXA 4IGSA 2WMFA 2WNWA 2XGQA 1QPOA 3LS9A 3G1YA 1HJWA 4U33A 1W2PA 2V2DA 3VDHA 2QV4A 3T2PA 1VIWA 2RHGA 3ANVA 1K3UA 4E2VA 4JY9A 1AK5A 3F4CA 3ARTA 4I8YA 1GEQA 4PH6A 3KX6A 3W7DA 2QCEA 4FI4A 2JEPA 5EMLA 4IG2A 2FLIA 1OIFA 4OGZA 1W0MA 1WO2A 2FYMA 4U28A 2OKOA 4YR2A 2PE4A 2VTFA 5FF0A 3AISA 2JEGA 3P81A 2REQA 4XX6A 4EF8A 1AZ1A 2I5QA 2ZUNA 1CGVA 5I09A 1HFBA 4XK2A 1ZBWA 1E72M 5DF0A 4QWBA 3KOWA 1TELA 4H6EA 5JBEA 1N56A 4CQAA 4AIOA 3UR5A 5I7GA 3QZ6A 1XH0A 4LANA 1XCXA 4L1GA 5G1MA 3TA6A 1RBAA 2W6RA 3G24A 4B2DD 3QPZA 3W85A 2GOKA 4XAGA 3AIVA 1RJQA 1ZJAA 4GACA 2WNNA 2WO5A 3GR8A 4AZIA 4C6MA 3WLSA 1NOWA 3HG5A 4XAPA 3CH0A 4YQWA 2OT1A 1L8PA 3MZ2A 4UFHA 3BMXA 3CB3A 1R8LA 1YW1A 2VEMA 2OZ8A 5BRQA 3EGJA 4XTDA 1DJWA 2NUXA 3I3EA 5KT3A 1F73A 4TOQA 3VKJA 4AZ5A 4RDVA 3KUMA 4W8AA 2OELA 4HNLA 5GNXA 2PDQA 4FB7A 2Z29A 1XIDA 5CCZA 4QW8A 3PJWA 3ATZA 4EXQA 3L0GA 4GX8A 2CLFA 4DYJA 4N6EA 4C6BA 1H1NA 3NCOA 1LUCA 2VRKA 4Z17A 1KR1A 2DQWA 3ES7A 4F0SA 3I65A 2NX3A 5I03A 4Q7NA 1XQKA 1FWIC 3N17A 2Z1KA 3TC3A 8XIMA 3AZTA 2AMGA 4AIUA 4Z08A 5EMYA 5ABFB 4QEHA 2VDHA 5CJ5A 3XISA 4Q8VA 4CNUA 4DX3A 2Q09A 4G6CA 1KM6A 5DLGA 1GOMA 3V0TA 1VP5A 4NZFA 3URBA 3EYPA 3GV7B 5GNYA 4ZB2A 1HX0A 3INPA 4S3AA 3WMLA 1R9YA 3AICA 4AD2A 1HJSA 1H4PA 4ZENA 3AXKA 3KHGA 5I02A 1JCMP 6TAAA 4ZCWA 1PIGA 1FTXA 5DELA 3BQ6A 3N12A 1W3KA 4J5NA 4K1GA 4LV9A 1OHLA 4OKDA 4PEEA 4NJIA 5HK4A 2PWVA 1GUVA 5C2XA 4FS9A 1DIKA 2UVVA 4FLOA 3QQWA 1J01A 1H5VA 2GDVA 1GVYA 2VDGA 4HA0A 4S3JA 2OPJA 1GOIA 5T14A 3A4JA 4NJGA 3DHUA 3RRXA 2ZTKA 4PB4A 3ABOA 3HPXA 1DP0A 1UOZA 1HL9A 4IR9A 1BKHA 3QYQA 3R58A 1SFJA 4NZ3A 3BQ2A 2DIEA 4GH3A 2VJXA 2D0FA 3W1NA 3OLEA 3RF9A 2FFIA 3FIGA 2GGJA 3FAXA 4L5ZA 3RDKA 1R46A 4UQEA 3WQCA 3RK8A 3G1AA 1R2SA 4LCQA 1A0CA 2J27A 1ZQ5A 1Z6KA 1RVGA 3UA3A 4KEUA 3CUJA 1TR1A 4F2TA 4H9UA 3WLOA 1NH6A 1IZCA 5EFFA 2YOCA 4W5ZA 4ZFMA 1JIBA 4PRWA 1DV7A 2PURA 1EA9C 2J78A 4D6EA 4JTLA 3G5EA 2BOEX 4AMAA 3MI3A 4H7VA 3ERPA 4L6OA 3GG1A 2UY3A 4QG6A 1C8QA 2PRHA 4JFTA 5FL0A 4GXPA 2WAGA 4K68A 4NIRA 4ZEPA 3WLIA 1AFSA 1EJRC 2G50A 5LA1A 3IRSA 4DY1A 3FEQA 2VDIA 3N3MA 2DZUA 1FWRA 2F6KA 2BVWA 4ZE4A 3VGFA 3AO0A 4JFWA 1PWMA 3KRUA 1ONRA 2IUZA 1ICPA 3SSJA 3IJ9A 2ZRUA 4GKLA 3C2EA 4PUKA 1GKPA 4EBDA 4DPPA 4JYDA 2OKTA 2YL9A 4NX5A 1UD4A 3NURA 1J79A 4RUBA 3HPAA 5KFIA 1EZ2A 4DL6A 4S23A 2ZZ6A 4FF7A 1M9HA 2C1GA 1DJYA 2Y0FA 4KCWA 1B5TA 4YLWA 4R9XA 2XH7A 1C90A 3ZVHA 1VLIA 4IP4A 3ZOAA 2Y5SA 4QLJA 4UZUA 4XD5A 1JG9A 4HVXA 2V5LA 3NDOA 1W3JA 4EACA 3BL3A 3E49A 2AQVA 1E55A 1TFVA 1OFAA 4YR0A 1EQCA 3OVGA 3VOGA 1XISA 1E1CA 3NEHA 5JIWA 4B5SA 3VE7A 2D1ZA 3AMKA 4BK9A 4DVOA 4M51A 3JUGA 4DEFA 1QFEA 2BOGX 4AISA 2UVWA 4DXXA 4DUXA 2O0TA 3DESA 1RY0A 2CBUA 3SGGA 2HK0A 1IE7C 1J0IA 3NQFA 2QAPA 4LS2A 2ZUSA 3GK0A 1UYQA 1TUFA 5AZ0A 3W2NA 3SCNA 2QF7A 4O19A 3JW7A 4NNAA 2VA2A 4MB1A 1HVXA 2QMJA 3EOOA 1I1XA 2QUUA 1I4NA 2C13A 5KFVA 2H8ZA 5CSYA 2A4AA 4DZ5A 1OFPA 3UWZA 1EJ7L 1CLVA 1R3SA 3V36A 5A8NA 3ZS4A 3QMTA 2ZC1A 3IAQA 4HPNA 1XLCA 6XIAA 1Y0EA 2FJKA 1GJPA 5I3HA 2QJNA 3WY1A 3ZVIA 4O1BA 3DYOA 4MNJA 3UWWA 1NJJA 4NJHA 1B3YA 3CQ0A 4D6DA 3KCOA 3AMLA 2BP1A 1Q66A 3RITA 3T8LA 2ALRA 5CZJA 1J6OA 2PDLA 2W62A 1PCWA 2EAWA 1M7JA 1FRBA 3LGGA 4HN4A 2YZ5A 4PCPA 1K6AA 4EAMA 4BF7A 4O57A 1V3HA 2QPUA 2OOGA 3AMGA 1CPUA 3W22A 5FJTA 3WEOA 2PS2A 2PDXA 2XUCA 3KTXA 2V9WA 4B3KA 3N4FA 3OW1A 3MMWA 3Q65A 3RN6A 4B5NA 5E0CA 4GVGA 2X1SA 3KZPA 1F9CA 3U2ZA 2DVXA 2EPKX 3KEHA 2JQXA 3ZT5A 4W7VA 3ELFA 4E8GA 3OLDA 1EQPA 1EH9A 5MF5A 3QZ8A 1WZMA 5IFTA 1K7EA 3QSRA 3UCDA 2AGTA 1AL7A 3WQOA 4UQCA 1SSGA 1AJZA 3GU1A 3W26A 1QWGA 1K7FA 2E5DA 5DY3A 4L4MA 3T8QA 4PB5A 1AZ2A 1CGXA 1XRFA 1HTIA 2IXUA 3P93A 1E4LA 3W7OA 1U1HA 2D3NA 3RPTA 4GVHA 4EWND 2B0MA 3QHNA 1T8XA 4I9AA 5LIXX 1O66A 1TX2A 1XBXA 2V0TA 3CHVA 1YNYA 4ZOBA 2FZNA 2VQTA 4N7QA 5FEPA 4RDZA 2QVHA 3O06A 1RUSA 1P0NA 3H7VA 4HPHA 5CEWA 1CZ1A 4KW2A 4D2JA 2CBJA 4YVXA 4GX9A 4L56A 2CBIA 3EWBX 3PY2A 5DQHA 4OOZA 4PCNA 3M0XA 2OWXA 3I6TA 2WHLA 4AVOA 3QQ0A 3WLNA 4GNJA 3TSBA 3AALA 1UD6A 3KCLA 3CAVA 1XV8A 5K3VA 4GA8A 2HE8A 5L9XA 1DYSA 3VD7A 2F38A 4UMAA 1KM1A 2AL2B 4GK8A 4JTFA 4DUVA 3P5YA 5KFCA 1BF6A 4RZ5A 3W1XA 5FSEC 5LNVA 3M4HA 1GOWA 2PC4A 1J6PA 3SCRA 4LUTB 1RCQA 4XVEA 1MMFA 3IIOA 1EIBA 3GVGA 1MDLA 3LHUA 2PDPA 1UWSA 4HPJA 4N9DA 2WWCA 4PUNA 2YCLB 2G5WA 4RZ6A 3TH6A 4LF1A 3KOFA 2XIOA 3LN3A 3OU8A 3HQ1A 3DH7A 4XISA 3ZMRA 2F6XA 1QHPA 1E6PA 5C71A 2WVVB 3KRSA 1TR9A 1L0PA 5LA0A 3S1UA 2XU2A 4AX6A 4M7SA 4PSPA 4CLMA 3MR5A 2A1YA 4GVFA 4HYWA 3LHZA 2JIEA 4AD4A 3WJZA 1TPVA 1ISWA 3CK5A 3GHTA 1XM3A 2RH9A 1YMYA 3CAWA 4E8CA 4A8NA 1HVQA 1CW2A 5D2TA 1HJXA 4XZMX 2E3ZA 5KZDA 2ATLA 5KFRA 1F3TA 2DSWA 3R5EA 2DV0A 4NP7A 4DELA 5E09A 4S3GA 4YTQA 4DNHA 1DJZA 3CS2A 3CLMA 2VP8A 3EEZA 1JXJA 5CBBA 3B4YA 3TE9A 3UW6A 4UFKA 1VEMA 2VKZG 1SGJA 2J13A 2R8WA 3PW7A 3THQA 2CZEA 4E4UA 1WKDA 3PFMA 1TJ0A 4FLQA 4M6QA 1L6GA 3ZYZA 1Q6DA 3GHUA 3L12A 2O9RA 2QULA 4NASA 3TJIA 2HQAA 3ONBA 2P8CA 5DMLA 1VJIA 1HKKA 4XV0A 4AU0A 3PR5B 4I7UA 3W6LA 3ABQA 5H91A 1OT1A 2W67A 1RHCA 4LYRA 4F4RA 3BAYA 3B0PA 3GHSA 2NX9A 2DZSA 1ZFJA 3MHGA 1QCWA 2IKJA 2Z28A 4MF4A 4F0LA 2VGBA 3MY9A 2WMKA 1EB3A 1OCNA 3VGDA 2OVLA 3QR3A 4H1ZA 2VR5A 1GZGA 3T6CA 3E2QA 3KBSA 2P5NA 3BLPX 3Q8PB 5C7HA 3UJEA 3VIPA 3KBMA 1OYBA 3D46A 4H9XA 3GX9A 4XAFA 4HMEA 2C2RA 2CZ5A 5D03A 4JN7A 1KKOA 5D8WA 1FH8A 1QWKA 2VD8A 3UWQA 3VNYA 4H9MA 4O14A 3RLUA 2E6YA 3TP4A 3KW3A 3ITXA 4IISA 3KLLA 3WNOA 4KERA 4AVNA 4ZO6A 4JICA 3TJLA 3SCVA 4QJ4B 2PMQA 1DHKA 2R1LA 1OY0A 2A5HA 4TQSA 3GVQA 3TJXA 2XIQA 3AXMA 3RRAA 3GUWA 3W1LA 2V4QA 5BXPA 4HMCA 1VD6A 3V1HA 1JYWA 4WY0B 1C7TA 4CQDA 3ITCA 4M7TA 3L65A 3B06A 3KL3A 1CGYA 3IK2A 3ZR4A 4M19A 3UT0A 1E73M 4RZBA 1X98A 2VZTA 3Q2DA 4PGLA 3QMRA 4GD0A 2HS6A 4YHEA 5ECUA 4IMGA 5A69A 3H23A 4DWDA 1AW5A 1OX4B 3L7RA 1EL3A 2B7NA 2E1DA 3GQYA 1OFEA 4YIWA 3CTTA 2NQLA 2YR1A 1V6WA 4YTSA 3S9ZA 3VZYA 3MHFA 3K13A 3L21A 4FS2A 1VR6A 3Q58A 1U5VA 3EX4A 1DE5A 2EKCA 5BXTA 3T05A 2R9RA 3WQ5A 1BWVA 5G4WA 3OSNA 2PF8A 3SCQA 3WBXA 4UTWA 4I5XA 3VCNA 4GBDA 2IBKA 2PRMA 2Q3RA 3CWHA 2XSBA 4PBEA 4HTBA 4JFUA 3IVTA 4BI5A 2PD5A 4GZ7A 5IRPA 1TJRA 3JVAA 4JV0A 2CC0A 3ABSA 3QGVA 3NO1A 2WMJA 4NZ4A 3RBEA 5C9RA 3NZGA 1ITXA 1TTIA 1IEIA 2JKAA 5CZSA 4CVWA 2P3ZA 2VFGA 3VX0A 2FPYA 4C6EA 2PDNA 3TXVA 3SEPA 1BG4A 3GXIA 3KVJA 1NOFA 1GW9A 3KTCA 3W2MA 3IN5A 4M80A 5CPSA 4KCUA 5D4YA 3WZ0E 2TAAA 1LJYA 2WPGA 1C8YA 3NZRA 4O3SA 2OMAA 4AQLA 3HIJA 1V0LA 2VX6A 4YVVA 4JCLA 5A6BA 4JQ3A 5FF2A 1W5MA 2DH3A 3LGDA 1NU5A 3RB4A 4MZYA 3G1DA 3ABRA 5LIUX 1UZ4A 3WDHA 4MFEA 4GUFA 4RXFA 1BFNA 2ZWYA 7XIMA 4R7JA 1E6RA 2Y63A 3LTSA 2PRLA 3UVAA 4LRTA 2RDXA 1NFGA 3EWUA 3V5OA 1AD4A 4NZ1A 3HOJA 1R3TA 4Q8PA 4PMUA 2BGQA 2V3FA 5BROA 3WDJA 3UPWA 4JDYA 1QASA 3IGUA 4WD0A 8CGTA 3WF0A 1I8JA 4N9EA 2QIIA 3FNDA 1L6FA 2PTWA 1UR2A 4AF0B 3SO7A 4H9VA 3UCQA 1JYVA 3KP0A 1WDSA 1G01A 1KCZA 1A50A 1MUMA 2G3NA 4NX0A 4GFSA 2AAAA 1XDLA 1FCBA 1S2CA 2ZOXA 1YDYA 2DORA 3BLDA 2E5CA 2YCIX 4MY9A 1IIGA 4TMBA 5GJMA 4Y8EA 2VMFA 5KG2A 1A5NC 1WP6A 2RGMA 4HSOA 3OQ8A 3UESA 5TBOA 2FHFA 3C2YA 3FXYA 1R3VA