5LY2A

Jmjd2a/ kdm4a complexed with ni(ii), nog and macrocyclic peptide inhibitor cp2_r6kme3 (13-mer)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Highly selective inhibition of histone demethylases by de novo macrocyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 348
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ly2A01
5FZMA 4QXBA 5FZ0A 5FZBA 5A7NA 4CCLA 5FY7A 2PXJA 5FXXA 5FJKA 5FY5A 5F5IA 4D6RA 3AVSA 4LXLA 5FY8A 3AL6A 5FZDA 5FYCA 5IVVA 3KV9A 5FYYA 2YU1A 4CSWA 5IVFA 4D6QA 3DXTA 3LDBA 3AL5A 1VRBA 5FYHA 4CCNA 2OX0A 5KR7A 5FZAA 2XUEA 3KV5A 5FBJA 4ASKA 3PUQA 4CCMA 2OS2A 2OT7A 4QU1A 5IWFA 4XDOA 3PTRB 2W2IA 5FYZA 3N9MA 4IGPA 5A7PA 3U4SA 4EYUA 5IVEA 2Q8DA 5FPUA 4BU2A 4DIQA 5FP3A 2WWJA 3NJYA 3PU8A 5FXVA 4NUBA 5FV3A 4HOOA 4IGQA 5FZFA 5FZEA 2YBPA 4CCKA 5F32A 5A7OA 5FZLA 5FZOB 2WWUA 5F3EA 2YU2A 5FZIA 5FYIA 4QXHA 3KVAA 3ZPOA 2GP3A 4TN7A 4DO0A 5FP4A 3K3NA 5F2WA 5FUNA 3ZLIA 5F2SA 5IVCA 2YBKA 5FPBA 5A1FA 2YPDA 5F3IA 5FZ1A 3OPTA 5FZGA 3PUAA 5FP8A 5FYTA 5FY1A 2VD7A 5LW9A 5FYVA 5FUPA 4UF0B 3KV4A 5FZCA 5FXZA 2Q8CA 5F37A 3DXUA 4V2WA 5F39A 5A3TA 5FZOA 5A1LA 2XXZA 4BISA 5FPVA 2OQ7A 5IVJA 5FY0A 3K3OA 3N9PA 3OPWA 3N9LA 5FZKA 4GJZA 4GAZA 4HONA 4AAPA 5CEHA 4E4HA 2YBSA 5LY1A 2Q8EA 4QWNA 4EZ4A 5A3NA 5LY2A 5FYSA 4UF0A 3RVHA 5IW0A 5FZ6A 3N9QA 5ANQA 5FZ7A 5FYMA 3PURA 2XDVA 5FZ9A 4V2VA 3UYJA 4CUGA 2GP5A 5A7SA 4LIVA 5F5CA 5FYUA 4QX7A 5IVBA 5FYBA 4C8DA 5A80A 5FP9A 4CCJA 5FWEA 3KV6A 4IGOA 3LD8A 4LITA 5F3GA 5A7WB 3N9NA 4LIUA 5K4LA 5A7QA 4URAA 4QXCA 4Y3OA 5FZ3A 5F5AA 4XDPA 5F3CA 5FWJA 2P5BA 5FZ4A 3AVRA 5ISLA 5LWBA 4CCOA 5FXWA 4EZHA 5FZHA 2OQ6A 5FPAA 5IVYA 5A3WA 5FZ8A 4GD4A 4BXFA 2XMLA 5FJHA 4GJYA 3K2OA 5A3PA 3U78A 5E6HA 3KVBA 3PDQA 4Y33A 5A7WA 4D6SA 4Y4RA 5FY9A 3PUSA 5FY4A 5FPLA 4AI9A 5FP7A 4QX8A 3N9OA 3PU3A
chains in the Genus database with same CATH superfamily
3WLUA 3INAA 4MO3M 5KHGA 2YGMA 2VXRA 4N43B 2IXIA 2JIGA 5DAQA 2YV8A 5GALA 3HNMA 1RYYA 5CVRA 1UW8A 4PLOA 2QQMA 5BYNA 1DGWA 1SEFA 1NT0A 4N53C 3MIHA 4ZPIA 2VW2A 1I9RA 2H6BA 4WM8B 1PVC3 4AEDB 1WLWA 4CCNA 1IQDC 2F4LA 2C9AA 4GULA 4ASKA 2VW0A 1C3HA 1NZCA 3KZ4C 1XNTA 1SPPB 3MLLA 2DCTA 3RPQA 1HKDA 5ACA1 1AR71 4M0HA 2YPJA 3O1MA 3HIFA 4OUMA 3FHAA 1W8ZA 5C70A 2D5FA 2E7QA 2YDEA 5FP3A 1TG7A 4CDXC 5BNNB 1CJDA 1EV11 1WCKA 4QQ2A 3D8CA 3J7MA 4QX1A 1COV2 2VOWA 3SQOA 5F32A 2ZEZA 2IXHA 3OY8A 2BTVC 2GDFA 1ZBE3 2NZ9A 3ACFA 4YW1A 1GZWA 3FX3A 1F15A 4B3NA 3RZMA 2QZ3A 2SBAA 4QU2A 4C0BA 3FZ3A 2G9FA 3BU7A 2Y0OA 4XZUG 2WAOA 5A70A 1XBFA 5T5JA 3KGLA 2CY6A 5F37A 5L7OA 4TSVA 1A3KA 1Q43A 2OQ7A 5C8CC 2XG3A 1KDKA 1GKBA 2W91A 4PHZA 1E5IA 4A45A 3WINE 1LCLA 2VTXA 3VV1A 2K9ZA 5CEHA 4FPCA 2BBAA 1OC1A 3WG2A 4E4HA 3ALQA 3K48A 3CU7A 2XONA 2QE3A 2B45X 2JE8A 4XHBA 2ARCA 3H7JA 1FOD1 4OHVA 3LAGA 1RUD2 1FXZA 4GWIA 4GWNA 4FCAA 4JVAA 2VBDA 2D6MA 4JKLA 3M3OA 4FPJA 4XF0A 4CCJA 5FMOS 1OSGA 5FWEA 4AVSA 5CFCA 1D7PM 1TME3 2B8MA 4XFIA 4LITA 4CVUA 1CX1A 1GMMA 3PIGA 2ADEA 1KS4A 2UU8A 4MH0E 2BYVE 3OTFA 4Q1RA 2VZRA 3VBUC 3ACLA 1FMD3 3T4VA 2BNMA 3ZSMA 1AR61 4IQPA 4JCKA 3M7AA 4BQXA 1KFUL 2P5BA 4MLOA 3LEIA 4PLNA 2BWAA 5ISLA 2XGXA 2XLFA 3DEMA 3FBYA 1UY0A 5FZHA 4EZHA 2CAVA 3KHBA 4HKWA 4Q4W2 4QHBA 5HPOA 4ASLA 4DFSA 1HRV2 2WYFA 4G3YC 5FJHA 1J59A 4GJYA 4LBQB 3K2OA 1E5HA 3IWZA 2ARXA 4IEPA 1HXS3 4XAAA 2ZEXA 5JSOA 4HN1A 4Y33A 3KQRA 1U5YA 1XYPA 3NJZA 5H9QA 1SLLA 4Q4Y2 4E4DX 4XQWA 1PO11 5FLJA 4KWJA 1GSLA 1NA1B 1QOOA 1N3OA 1W2AX 4CTEA 3CEWA 1TQ5A 4FFHA 3ATGA 1AR82 1HB1A 2WS91 2VCCA 4H7MA 3QH6A 1VAVA 3ZN6B 3HVDA 1EP0A 3AL6A 2ZGNA 3I2HA 4N43C 3VZMA 4BQ4A 1UPSA 2VZQA 1H8TB 1EUTA 1YNAA 1XE0A 4L8QA 2K46A 3DKQA 3DXTA 3NV1A 4HVRA 1JZ2A 1ONAA 4WM8C 2ARAA 1YIPA 5LBCA 4HZFA 1JYCA 4AEDC 3IIAA 5FRAA 4CCMA 3ENRA 2YY1A 1JZ6A 3RZGA 4EN0A 4FPEA 4IGPA 1QH7A 1PM7A 1V6LA 1W6PA 4X8NA 4MGIE 4X8PA 5APAA 1Q8VA 5EHDA 3VGIA 1WCSA 1CAWB 1H6YA 2FMDA 2PA7A 2DTYA 1G86A 3ACHA 4DNYA 5BNNC 3AFGA 3GXUA 5LRSA 3OF1A 2GP3A 3O1VA 4YYOA 5C9AA 4KNCA 1MS5A 1GQPA 4Q5OA 1VP6A 2Y60A 1CPNA 4GMP3 4XMIA 5T5LA 2NQYA 3WW1A 5JSPA 1MS1A 3UNPA 1GU3A 2RS11 2VD7A 1REEA 1VBB1 3U1XA 3H50A 3I4IA 2Q8CA 3VB9A 5HBAA 2KA3A 4X6QB 1WMFA 4HK9A 1MR5A 3VBHA 3WQ7A 1UZ0A 5FPVA 1VBC1 2MNGA 2TBVA 2PQSA 4LUMA 2V4AA 4LA2A 2VMGA 1WA6X 3W59A 4Z1VA 5ABJB 1S0CA 3EJKA 3V0BB 3VD5A 1YIFA 3VZJA 3VKLA 4JZRA 4XIKA 2UWAA 1UZVA 4E8CA 2VE1A 2WQ4A 3HQXA 3ZDVA 1UU5A 5JMOA 1AX0A 1QJZA 2DVGA 5JUVA 4RA0A 3ACIA 5ANQA 4YFZA 5KHIA 1LHUA 2D40A 5DUXA 5I0TA 4IDZA 4P5HA 4CUGA 4XE9A 3ZOIA 1JZ7A 3BUCA 3VD3A 2X5IB 3AKTA 2PHUA 5G05L 1VB2A 2QQUA 1BEV1 2RM22 2WN2A 3WD5A 5FK7A 4OMDA 3FUOA 3LD8A 4LBNA 4OI0A 2RDNA 2NM1A 4M3CB 5F3GA 1RMU3 2D6LX 2WZ8A 5K4LA 1A6CA 1W8TA 4XHXA 2HWE2 2JKXA 3IDAA 2D44A 4LK7A 1ZBA3 1RC6A 1QWRA 2ZX4A 4W8JA 1YYNA 3RJ2X 1ND2B 3VL9A 1HV1A 4B7EA 3POIA 2ZX2A 4QX5A 5GJ6A 2ID4A 4M3CF 1PHMA 2R062 3LSEA 5FDBA 2ZA9A 4HN0A 4JV4A 1JOBA 3U78A 5GZDA 3UKNA 4AVAA 1DZRA 5A32B 5JXGA 3A4UA 4GA9A 4OQ8A 2R073 3H8RA 1OBNA 4LO4B 2V09A 2JB8A 4XUTA 2H0VA 2PMWB 2QCSB 4ZHNA 2AH2A 3WF2A 4HBNA 5JOWA 2XVLA 5FZ0A 4BOWA 3VDCA 4YZ1A 1RXGA 4RFRB 4AGGA 2HWC3 1YCIA 3GBGA 1W6OA 1CAUB 1NA1C 1ULEA 2JDUA 5A3LA 2X8KA 3VBRA 5JZGA 1W28A 2RJKA 3E97A 4XBQA 5DDJ1 3WP5A 2VQAA 3ZX7A 2PAEA 1W2NA 3B02A 3J9SA 4IEXA 3AYCA 3NQHA 3WNPA 3ZYHA 4TYSA 3L9JT 1R1A3 1C28A 4L2NA 1GBGA 4Q0UA 1BYHA 1RUF3 2ZKLA 5FZAA 5FPZA 1NE6A 4CCDA 1WMDA 3POJA 4D0QA 5DPNA 3WDXA 3H9AA 4FQ4A 3SH5A 2ZGOA 2ET7A 3I3BA 4MXWB 5BNOB 1REDA 2MPFA 3PVNA 2HWB3 1Z7S2 4BU2A 4MGYE 2BP6A 2XKPA 1RB8G 2WWJA 5J09A 2V4VA 3BCWA 4BQWA 2VMCA 2W87A 4NUBA 4YVWA 1WMXA 4KMQA 4ONUA 1SCRA 1OVPA 4XJWA 5CBLA 5JAXA 2DTWA 5C5TA 5C3QA 2ZHNA 2IVIB 1W0NA 4RGAA 5F3EA 2AEZA 4UFIA 1W6MA 5CG8A 1CWPA 3JD71 2R071 5T5PA 1CAXA 3AKSA 4J1XA 1S0GA 2R043 3NRUA 5FUNA 1O4ZA 1W9FA 1JYIA 2WSUA 5JI9A 2Y64A 5GZEA 3WZ1A 2E7AA 3LGRA 3RI9A 4AZZA 5FY1A 1JHNA 3FFQA 1PGL2 3PIJA 4LKEA 1CIWA 3MIEA 4LO8A 3GCWA 2VVDA 3BTXA 5I0UA 2ZGPA 3ON7A 5F39A 5GLVA 4IEQA 1D0HA 2RJLA 2VTXJ 4BISA 5ACA2 1AR72 3GBFA 4RL7A 1HRI1 3OPWA 1NG0A 1V6KA 4PCRA 5A33B 2CWSA 2E32A 4Y1UA 1UNBA 1MVEA 2RS31 2VL4A 4O9EA 1LU1A 4LBMA 2W95A 5A6ZA 5KBFA 5LY2A 2P1BA 2W46A 2QTWB 2P37A 4FPOB 5LK7B 1ZRRA 2DBIA 3WX5A 1JYXA 2DVFA 4BQ3A 3O1TA 1VBA2 2XDVA 4JGYA 5FOJB 2VZSA 1IKPA 1WGPA 1GP4A 4DXZA 1C4RA 3CJXA 1SCSA 2WNOA 2WIIB 4QX7A 1GNYA 3LDRA 3KV6A 4A42A 3RS6A 1GYKA 2X5IC 4L11A 2BW8A 4LIUA 3ZMNA 4IEOA 3ZYIB 3KM5A 1BBT1 2N7GA 1S2BA 4GZ9A 4NJ4A 3T2PA 3OPZA 3LA3A 2PLV1 2WYSA 4AQ6A 1QOSA 4BB3A 3KQ4B 4HSJA 3HN3A 5FCCA 4GALA 5FZ8A 1HN1A 2ZGRA 2PHFA 4M3CE 1COV3 1ND2C 4MX3A 5L73A 1S0IA 3OY8B 1YJLA 4XUOA 4KH9A 4D7SA 5DXDA 3M8LA 4UBGA 5JIUA 4YGCA 3I2IA 1S1AA 5CKNA 1MEC1 1YFYA 4PI2A 5AVAA 2ZGMA 4BPZA 1ST8A 3PJQA 4LPLA 4COZA 3USUA 1KEXA 1U0AA 3LOIA 2PELA 5KC5A 3CZUA 3U10A 1RINA 2NMOA 3J8F1 3I2FA 1EUUA 3DPRA 3NV4A 3TYJA 1Y3TA 3LA7A 3POGA 5CA6A 4D6RA 2ORXA 1AX2A 3ELNA 3KS7A 1W2UA 4Q0VA 2QBXA 1DQ1A 4DQAA 1AR62 2RG4A 3POYA 2VUCA 4ORFA 2YMZA 4BIOA 4OYUA 4O7XA 1CD3G 3NAPA 4CCEA 3JXSA 4NMIA 4WVVA 1C5HA 1OA2A 3WG4A 2E53A 3VBFA 3OGVA 2EXIA 1V6NA 5K0UA 3HBKA 1RUD3 3T08A 4XILA 4LORA 5LEJA 3LZZA 4AI2A 4QKFA 1U5IA 3NJYA 2V73A 4RSUA 2P3IA 1GANA 1AYM3 5GLTA 5BV6A 1JI6A 2XHNA 5C5UA 2C4XA 5BNOC 1I1EA 3HQRA 5CFCB 1KXGA 2WS92 4FOYA 4ARYA 1OVSA 3MUY1 2QDRA 4H3WA 3I49A 3D6EA 4GB31 3VHNA 2D98A 3K3NA 4K3UA 5DN2A 3ZSLA 1O7FA 4K8FA 3DUIA 1C57A 3LWCA 3RWNA 2NPIA 4EQVA 5L9VA 2P3YA 2EIDA 3AMMA 1A8DA 1FMD2 4Q4X1 3VKOA 2Z42A 4IETA 3LFIA 1T6BX 2YFZA 2RMU1 4NWWA 1JZ4A 3CJIA 3TAYA 2JDZA 1WW4A 2YBSA 4LK6A 1XSQA 5DG1A 3T2TA 1VMHA 2F4PA 3BODA 2VZTA 2JDNA 1NKGA 1JZ8A 1ND3A 1IPSA 3N9QA 4W6XA 3UKTA 3MIDA 2GNBA 1ZZ6A 2GH8A 4FFGA 4NIAA 4M01A 1AYM1 3B93A 3WDUA 5IATA 2JICA 3SH3A 4AOCA 3K77A 2W68A 4QPYA 2RS12 3B01A 4AHWA 2J1AA 4LE4A 2VOXA 5FKBA 3J7LA 1PGW1 4YLZA 4E2GA 3ZMOA 2L9LA 2BQPA 3WNNA 2JECA 4AHXA 1HQLA 5BUVA 2WO1A 1NYWA 1W6PB 3OGSA 4FPFA 4YG3A 4AGVA 1G9BA 2UYAA 5FZ4A 3AVRA 4PQ9A 3U14A 1G9FA 3GCXA 3PUIA 4QPGB 3VBOA 2DFBA 3S5QA 4BXFA 2YYOA 3RYRA 1EY2A 3DV8A 3A0NA 3I54A 3Q8EA 2WBKA 3UETA 3VHPA 2WO3A 2WNUB 2HJIA 3IT8A 3POBA 3N36A 1RUI1 4CPBD 4XTPA 4YZ3A 2ZJCA 3AMPA 3HAGA 4Q4V3 1TMF3 5FBZA 2WINB 3WEZA 1QDOA 1U12A 2CGNA 2GNMA 1EAH1 1FNZA 2Y6HA 4A44A 1Q8SA 1FPN1 1AL21 5A7NA 3KCXA 1BEV2 3VKMA 2PHWA 2YXSA 2CU5A 1ZRDA 2X10A 3JBG3 1A34A 1JOJA 1ZA7A 3Q8FA 1N1YA 1SLTA 3RG0A 1POQA 3I2OA 2Z4FA 3KT1A 4D6QA 1PO21 4HL0A 5FYHA 3GZEA 3GM8A 3PNAA 3O12A 4NHMA 5FBJA 3T0AA 1QJX3 2BWCA 4NHLA 5LA1A 3DYPA 4EYUA 2W52A 4XYXA 5FXVA 2Y33A 4JX0A 4O9GA 4AI3A 3SCHA 5CADA 3TNQA 1SFPA 2Z69A 4TLFA 5T50A 3RZKA 5A7OA 4QMAA 2XLGA 4PBOA 2GC2A 1XPWA 4NR1A 3ZN5A 2O1QA 2YU2A 4FI9A 4IERA 3RI8A 5CFCC 2JE9A 3ZPYA 5F2WA 3J7NA 2PN5A 2ZGUA 5D8AA 5F2SA 1HJFA 2VZPA 4COVA 2IFWA 3GHMA 5JOXA 2FDKA 1H9WA 4GWMA 4RHV1 1RMU2 1VRH1 3EHKA 4ATFA 5JDBA 1GZCA 2C26A 2ZABA 3SHRA 3TBDA 1QKQA 2VW1A 1ZBA2 5FZOA 4R9CA 4MHUA 5JXJA 4INDA 4AFAA 2BGPA 2WNVA 4IW3A 2VPVA 1F9KA 1V9U1 2DCZA 2QDNA 4UWDA 5L9BA 3A23A 4AAPA 2Y6LA 1V70A 1JU4A 5G04L 2BBVA 1ACCA 1X36A 3PMEA 5CYYA 3ZXDA 4CDUA 3IKWA 2FDFA 5I8YA 2X29A 1W6OB 1DZQA 2VMHA 3WY6A 4MYEA 4CXXA 3V0AA 5F5QA 3VBRB 1QXJA 2PYTA 2OZ6A 4DEQA 5AFBA 1QJY1 2R072 1UO9A 2VECA 1C8M1 1W8OA 1YJKA 2VZVA 3EYPA 4CDQA 2WNEA 5CZKA 4KI5M 1R091 4XJZA 5FMOL 1OMIA 3LIGA 2OA2A 5IVBA 3AYDA 1NCQA 3EO6A 3TN91 1RJ7A 4IUGA 4Y20B 1U5XA 2WT0A 3DYMA 2FCVA 3KT4A 4AI0A 3EMRA 5DABA 3ZXFA 5F7UA 3WQ1A 3N9NA 4A7YA 1AHSA 1MS9A 4QXCA 4FFFA 3WF1A 1CIYA 2XOMA 1R1A2 2Y34A 3JCIA 1HRI2 1BVVA 1RUF2 1Z7S3 3AP5A 5I0DA 1V0AA 1B09A 1F4HA 1NAEA 2G19A 5J7MA 4YVWB 1YEWA 2RS32 1H6XA 2FDIA 2JD9A 3AZXA 3UESA 4QPGC 1C5IA 1W6MB 4YW2A 3RNSA 4ES8A 1CAXB 4FVVA 5A7WA 1PZ7A 1SFYA 2WNUC 5FPLA 5F6KA 1GLHA 5IHRA 3AC0A 3ZFFB 4G4FA 3BIEA 3VKNA 2HKXA 2LM3A 1TNRA 4RQPA 3QCWA 1OLME 5CKQA 2QQWA 1E5RA 3WOGA 1WW7A 3FHIB 5FREA 4I3PA 3RJRA 4NRMA 3UJQA 2WA4A 5FFOC 2XKOA 4LJHA 5FY8A 1BBT2 2XQRA 5ACA3 4B4RA 1O5LA 2QQIA 4P9GA 2LRPA 1AR73 4EROA 4KWLA 4IE6A 1VLNA 2Q30A 3WNKA 1NOVA 2VBBA 4N9HA 1EV13 4ET7A 1SQ4A 1BZWA 4B7KA 3ZIWA 4BIFA 4YRDA 1AUYA 2JWPA 3I8TA 4MOAA 5IK7A 1NX9A 2XJQA 3BKZA 1JH5A 4RR3A 4XACA 3U11A 2JDMA 4IV1A 1N1SA 1OPMA 1DIWA 1UU6A 3PU8A 2YZ4A 5IYYA 2QJVA 4W50A 3RZZA 5BNPA 4QB2A 4YM3A 5GZFA 2BOIA 2ZS6B 3EB7A 3J8F2 4FFIA 4RYDA 4CCKA 3KHCA 2X53S 5FZIA 5EP9A 4HETA 3ZDSA 5JCTA 5CISA 2AENA 3H1MA 4L99A 3POWA 1BMV1 2YUEA 3RZJA 4QGMA 3FMGA 2P2KA 3OSDA 4YVSA 2AR6A 3ZXGA 3OPTA 3IPVA 3U07A 5FYTA 2ZXQA 4IEUA 2WZPP 1O6UA 1FOD3 1QDCA 1QU0A 1YFUA 2BU9A 5H9PA 3UV9A 1BK0A 2O14A 5A3TA 3HOBA 3LQCA 2VAUA 4DRRA 5FO8B 2R0HA 3M70A 3N9LA 5J96B 2CV6A 4XETA 3USUB 3SEEA 2EXKA 5C4WA 1UWWA 1RUH1 3IAPA 3TWIA 3VDDA 5B2GB 1UIKA 3DPRB 3AX4A 4QKNA 4BHPA 3FC0A 1H0BA 5FYSA 4BXSV 3LKJA 2UY9A 3MPBA 4GB32 1AR63 1K12A 5FZ9A 3UYJA 2RS51 1WZXA 4CPBA 3VBRC 4QXKA 1L7RA 5A7SA 1YQ2A 3P5BA 5CKMA 4LO7A 3RYPA 1RUE1 4ZZ8A 3ZN4A 1JHJA 4UFHA 1NE4A 2WL1A 1CR7A 2GN3A 3AMQA 1ULOA 3MIGA 4FBFA 4D94A 3N7LA 1JMUB 2RMU2 3W5MA 4HSLA 1PO13 1W9WA 1W39A 5LASA 5A3WA 4NOTA 1POV0 1UY3A 1YQ8A 4GD4A 4I01A 4N9IA 2XMLA 3AXDA 3WCRA 5KWRA 1H1AA 2WS93 3BGAA 3KSCA 4CEYA 3VD4A 2AEYA 5E6HA 4OI1A 3WP4A 1QNWA 2VZUA 2WZR1 1SLCA 4YVWC 5FOBB 3PTYA 2ZBJA 2MHFA 2PTMA 3UKVA 1PZ8A 1AYM2 4N8MA 5A6YA 1O4TA 1OI6A 1REFA 3WF3A 5CIRA 1DLLA 3AKQA 1TEIA 1LECA 4AVTA 4QDRA 2BVVA 3ZFFC 4RFT0 2DUOA 3HJRA 3FE5A 1PGW2 3AP9A 2GMEA 1F31A 5F5IA 4BH9A 5GZCA 5I0SA 4QB1A 2W9XA 2GALA 3OBRA 3GJBA 3NMBA 4D7TA 3ZYFA 2XPJA 1JTZX 2VMDA 3PJYA 3ASIA 3CJIB 4NWVA 4BK4A 1R1ZA 2VR4A 2ZGLA 5JLVA 4HPKA 2VVEA 2XBO1 1VBD1 3AP7A 1P8JA 3ZFGB 2QNKA 1W8HA 1ND3B 1RUI2 3MIFA 2JDYA 1QH6A 3N9MA 3T1LA 5FR3A 1HB2A 2DUPA 2Y6JA 4OHXA 1OA4A 4PDWB 2UY8A 3H7YA 1J58A 2P6HA 3KWVA 1TNFA 3UT0A 2LUWA 4UFJA 2BNOA 2DU0A 5FV3A 3E5QA 4IGQA 2RS13 1FPN2 1AL22 4Y5SA 4AE2A 4BMBA 1GUIA 1UZWA 1JUIA 1V6IA 1WWYA 1MZFA 1LEDA 1VBB3 1DF0A 2Y6FA 4LOSA 4XVHA 4MG2A 2YHJA 5T5OA 1HV0A 1VALA 2WFF1 2VUJA 1YUDA 4AYUA 1HX6A 1VBC3 4D7YA 3ORJA 4W6WA 4GH4A 2I45A 5D21A 2YC2A 3LPFA 3VBOB 4E4ZA 1PO22 4RS5A 5FZGA 1LHWA 4PLMA 3DECA 3U37A 4PF1A 3KMHA 1US2A 2MEV1 1AR91 1PMIA 5FYVA 5T54A 2B4KA 3THPA 5L19A 2A71A 4CU8A 1VAKA 3DXUA 1W2OA 2ARBA 5C7GA 1LOEA 4KQ7A 2HYKA 5DZGA 1WD3A 4OHYA 1KGYA 3HMYA 5FY0A 5FZKA 1NY72 1WD4A 3HNBM 4HONA 3KT7A 5EXOA 4QDQA 1CZVA 3M3QA 2BERA 3OBTA 1LHNA 5A3NA 1B35A 1BEV3 1WW5A 3OBAA 1G9CA 1OF4A 2CDPA 3ZM8A 1GQGA 2HWF1 1UZZA 2DV9A 1DP0A 1W3XA 1H2MA 1W2TA 2EALA 3AM2A 1ZA4A 3AXEA 4Q4V2 3P3PA 3DPRC 4OUSA 4WVWA 1TMF2 4FXKB 4JRLA 1PVXA 2C6SA 4CXYA 5B4XA 4NROA 2ZHKA 3OB8A 3SKVA 1JS9A 2A3WA 1UMIA 3NW4A 3VN4A 5JPMB 4C8DA 1NCRA 3S57A 3RQ0A 5JPNB 3BALA 3J4UH 3JBG2 4RHV2 1QEXA 4NRQA 4OI2A 5JI7A 2D3PA 3VDAA 1UL9A 1POV1 2VH9A 4QPIA 4NPRA 2JIJA 5GM0A 3UGHA 3VBSB 3VBFC 5F3CA 1QJU1 4XF3A 3JZVA 5HXMA 1V9U2 1UZYA 5CFDA 4YSFA 4K6BA 4MHRA 4LBLA 1IS3A 5BXXA 1VE0A 2B5HA 2K2SA 5SV8A 4AXOA 3NSTA 3ZSEA 1R081 2W1QA 3GZUC 1L3JA 1QJX2 1VR3A 4GKXA 3KVBA 5DUWA 4O61A 1DYKA 4CYDA 4XDQA 5DDJ3 1W9TA 2IVJA 4B29A 4PJYA 2VMIA 3NJXA 4QX8A 5D8AB 3BIWE 1UYZA 3WW2A 2P17A 1AYN1 3KCCA 2A6XA 2W92A 4N7UA 5FUIA 1R092 5LA9A 1WKYA 1ZM1A 5FZMA 4YM1A 4DUVA 5FZBA 1KRIA 4CP9A 1ZYBA 1NXMA 2VNOA 1GP5A 1G9DA 2Y8KA 3GHNA 2D93A 1W8NA 4IE7A 1KJLA 1GOFA 1XU1A 2BNNA 2JX9A 3ZKYA 5IK4A 3RZLA 3NKGA 1WCQA 1K5MB 3MIBA 4PIZA 3VKFC 1LB2A 4RGKA 4XMAA 4JC1A 4YW3A 3T2QA 4LA3A 5JXIA 3AK0A 2CDOA 2D6OX 3B00A 2VU9A 4AVBA 3VDBA 4CDUB 1VJ2A 4XPVA 3KV5A 2VGDA 1URXA 5F1RA 4IE5A 4N53A 2JG8A 1MS0A 1Z78A 2CGPA 3CJIC 5LBBA 2DF7A 3S30A 2YB7A 4QKBA 3IMNA 3JD73 1XB9A 4AVVA 2Q8DA 3IB3A 1QQP1 3ZFGC 4CDQB 3I3MA 1ND3C 4C0HA 4N90A 1VAMA 3M4FA 3ZXAC 1ZZ7A 4KL1A 4Y1YA 4AQ2A 4DB5A 1BLZA 4PDWC 2BGOA 2GU9A 1CVNA 4LT5A 1UOBA 4YM2A 1W6NA 2WWUA 3NNFA 4JGZA 4BJ0A 4QXHA 1ODNA 1X50A 1O3RA 4DO0A 1GFF2 5FP4A 4BLJA 1GZ9A 2YC4A 3OCPA 1O91A 2HEWF 1HRI3 1Z0HA 2BUKA 2IXLA 2Q8OA 4J6GA 4JHTA 4E2QA 2XR4A 1FATA 1QMJA 2RS33 1G9AA 1CZSA 1RXFA 4LKDA 4UF0B 3LOBA 5FXZA 4LHLA 1M06G 3VBOC 1DDLA 4W6YA 4WM7A 2J22A 4I0WB 3SLIA 2AZ5A 4BQYA 1W3VA 2CNAA 3FFZA 3ZR5A 2E51A 3MICA 3CNAA 3R4UA 2XUMA 4KBBA 1DGWX 4PIXA 4EN7B 1JYVA 2GC1A 3VUOA 4CU6A 4S2DA 5LEKA 3CMGA 3H8OA 4FQZA 4Y1XA 2W1WA 2R0FA 4UXAA 1UU4A 3WW4A 2Y6GA 2WZEA 1RUC1 1MZ5A 2Q8EA 4EZ4A 3BU0A 4LBJA 3OEBA 2VNVA 1KITA 1UN1A 1AXZA 1X8EA 5IW0A 5FZ6A 1BBT3 4OZXA 2DVBA 1HLCA 1H30A 2LALA 2RJ2A 4IESA 5EJ3A 4YW4A 2PLV3 2EF6A 3RWKX 1BMV2 5C71A 1UOJA 1RUNA 2JENA 1AX1A 1OUSA 1T6GC 3NKTA 4AQTA 1LGBA 4DOUA 5FP9A 1BJQA 4OLLA 4XJAA 3KB5A 4MGZE 2EIEA 1H8VA 2RR11 3ILFA 4RD7A 2RV9A 2ZZQA 4RR3B 5FZ3A 3V56A 1D0GA 1MEC3 4XDPA 3WDVA 4IV1B 4B4QA 4LKSA 4M0NA 1EV12 5D1IA 2W3JA 1ASJ1 5FPAA 5BNPB 5K8SA 3VBSC 3NV3A 3O5SA 2ZAAA 4QHZA 3J8F3 1J3PA 4UFLA 3VZNA 5AC93 1PX3A 4AGRA 4E2SA 1TVGA 4NAOA 1JN2P 3T4HB 2SLIA 2AGSA 4MVTA 2LTNA 3VLBB 4AEKA 2RS52 5IK5A 3WNOA 4LBOA 4XBNA 3JQWA 4L92A 4Y5TA 4AEJA 1LKNA 5D8AC 1IPKA 1RUE2 3I3QA 4WZFA 5C6CA 3Q8BA 1O3TA 3CLPA 4Z8BA 5T52A 4NIGA 3WDWA 2J1RA 4DUXA 3HBZA 4PT6A 2FZ2A 4KWKA 3J7HA 2OYZA 3WF0A 4YG6A 5C4WB 4ITCA 3HQUA 2XJUA 4FPGA 5CNAA 1K5MC 2W94A 4XUQA 2WNVC 3ZSJA 5FMCA 1FOD2 3Q9OA 3WVJA 1MZEA 3PUQA 4N43A 1OQEA 2XJSA 1UXZA 1TZOA 4K9SA 1GZWB 4K8RB 2Q1MA 4MGQA 4KG0A 4QAWA 5DAWA 4QX3A 1ZZ8A 5HCBA 5IWFA 4CDUC 4GB33 5FYZA 4DRVA 5DAVA 3H42B 1X8MA 1VB4A 4F83A 5AC91 1GP6A 1UMHA 4P9LA 2V5YA 4WM8A 3KF5A 1GOGA 2PHDA 4CDQC 3BI3A 5L7OB 2XVGA 3WHUA 3AFKA 2O8QA 4OCTA 2HEYF 2OW4A 1FYUA 5FZLA 1O3QA 1F2NA 5D2AA 2C9KA 3FLPA 3OG2A 4Q4X3 2P34A 4ISRA 4MUVA 5ERLA 2VCAA 4IE4A 3BTYA 1SPPA 3GF6A 3QBQA 2QQOA 2R16A 5ANNA 2RMU3 3ZLIA 4MSVA 2VO5A 3T3YA 1OQ1A 5A1FA 5FZ1A 3JB8A 4DEVA 3NNGA 4FOQA 3T09A 4DUWA 1ULGA 2W1UA 3IDCB 1VBD2 1E5SA 4XFCA 4CEYB 5K9YA 4XXAA 3UGFA 1IHMA 5FIXA 4V2WA 2A6YA 1RUJ1 1QXRA 5FLIA 1HB4A 1MACA 1NXD1 1NUKA 1PO12 1UCXA 3AJZA 3K3OA 3LEKA 1UMZA 1WLCA 4NHYA 4P9IA 2QQVA 3MF6A 1Q8PA 4GJZA 5GKAC 3CQOA 3T0DA 2FBEA 3B3QE 2G9ZA 1GQHA 1IG3A 1HB3A 1AJKA 1F35A 1X7NA 3TEYA 2QQPA 2UYBA 1LOFA 2DWRA 3LF7A 3OUIA 2WN3A 1UF2C 1ULPA 5FAXA 4P9YA 1PMHX 1BXHA 4TXWA 3AMHA 3W58A 1UPIA 1LTEA 2VBPA 3ECQA 3RMXA 1Q3EA 5FPXA 3ZFEA 3WXPA 3WUDA 4HPKB 3WUCA 2ATFA 4N7IA 3DYOA 5EYXA 2HH9A 2MEV2 1DLCA 1Q5OA 1G6NA 2DURA 3OOXA 4NPLA 4URAA 1XU2A 5A7QA 2D3SA 4WVZA 1RUI3 2GC0A 1MS4A 4Y1ZA 4Y3OA 3I2KA 4AWDA 2C5DA 3U0ZA 4EN9B 1AJOA 1SFNA 1WA4A 2W0XA 3AJYA 2A75A 2YG0A 1JZ3A 4RR3C 2D43A 1EAH3 3KGZA 4IV1C 3AYAA 1FPN3 1AL23 2E63A 3D0SA 3UJOA 2DUQA 2XJVA 4B1LA 3AP4A 2DVDA 5A6QA 2HWF2 5BNPC 4Z07A 3A7QA 3MPPG 3WNLA 3SC7X 3I7DA 2B46X 4XF1A 1D4VB 5FY9A 4Q0SA 1UYYA 3O0VA 2B42B 3K4ZA 1QY4A 4GH4B 2VM9A 1PIV1 4UW3A 5FTTC 4Q8KA 1IZ3A 1PO23 2Z5WA 3F95A 4LEJA 1EPZA 1VBB2 2VXJA 4YW7A 2X05A 2IXKA 1ULFA 3RZHA 1JODA 5FY5A 4I0AA 1HDKA 3S6PA 5BNQA 3K75B 1VBC2 3D0JA 3DL3A 3R0RA 1S0DA 4COYA 3APBA 1QJU2 3AL5A 3D5OA 1W99A 1BCXA 1O3SA 1B35B 2P4EA 3O14A 5FMBA 1VIWB 3MBWA 2GAUA 5C4WC 1FX5A 4GWJA 3D4KA 2OS2A 2VG9A 5C9AB 3SISA 4SLIA 1PNGA 1VBE1 2UWCA 3LEMA 3Q8AA 4P08A 4E27A 4MV2A 1OQDA 2DU1A 2KXLA 4UOJA 2NN8A 4YW5A 1KD7A 1W9SA 1AYN2 1H8TA 3C8XA 3WP6A 4QQPA 4CP0A 1XSRA 4FXGB 4HLTA 4Q4W1 2EXJA 4XAEA 5J36A 4RHV3 1HRV1 1VRH3 3B7MA 4Y24A 3I59A 3VBHB 3THCA 4IEWA 1RVF1 2ZTNA 4QPIB 4TLGA 1BK1A 4FP2A 5L7OC 2P3KA 1QNYA 4XFGA 4CE8A 4XF9A 2VTFA 5H9SA 3WNXA 4Q4Y1 5CFDB 1V9U3 2RE9A 4FO9A 3LPGA 2GC3A 5DZEA 4NVPA 3H8UA 5C8WA 1DCSA 3FUQA 3EQEA 4PBPA 4TTGA 1CAWA 4FT8A 4AR2A 1RITA 1AR81 1G8WA 3RGBA 3IN9A 2XL9A 4I0BA 4AFBA 2HBUA 3QD6A 5A1LA 5I91A 1QJY3 2WC2A 2OKXA 2XJPA 3OJBA 1UY1A 5SV5A 4CEYC 2E33A 1C8M3 2XWBB 4H55A 4ARXA 4BMEA 1J84A 1QQP2 3MHZA 2OUHA 3HD8B 4QDSA 4CP2A 4JQTA 2XL7A 2TEPA 1R093 1XNKA 3ZVXA 1GWLA 1XYOA 4UYBA 5EV7A 2TUNA 4BA6A 2HYXA 3TN93 2PHLA 5DZFA 3K51A 5C3SA 1OKQA 5DDJ2 4ASMB 1H9PA 1G7YA 5A3UA 4CCCA 1A78A 5FYMA 1RHI1 4NHKA 3K46A 1AL0G 2GP5A 4DY3A 2OPWA 1OXCA 1BKZA 1F5FA 4Y5Z0 2ZHLA 5ABJA 1I5ZA 2WAAA 3LFMA 4JKKA 3V0BA 3NWKA 2JG8B 3WG1A 5HCFA 2IXJA 3ZXEA 4EWAA 4R52A 1L7QA 4R8HA 3MLKA 1SLBA 4JDNA 3TB0A 2XHKA 2ZHMA 5I8SA 4E4SA 2P3JA 3U4XA 1JU3A 4YNIA 1RUG1 3S7IA 2BV4A 2DYCA 3N7JA 2C24A 2AACA 4WBBA 5JZGB 4CUBA 4HKOA 3GJAA 1LOAA 1RJ8A 4TZDA 3JD72 2A6VA 2J1UA 2J1VA 2W39A 2WRAA 3SITA 3JB4C 2XH6A 2B39A 4YGDA 2PAKA 4AI9A 1DQ0A 2CL2A 2A70A 2R32A 3THDA 3CDZB 2HWD1 4LHNA 2JE7A 3WF4A 4AW7A 1OUXA 3O1UA 1M4WA 4GH4C 2PXJA 1J83A 1W90A 4HFSA 1YXWA 5FJKA 3BYWA 1C1FA 2K0GA 2RR12 1UIJA 2VQ0A 1OD3A 4XCAA 4M4PA 4B1MA 4XEZA 1US3A 3ZR6A 4KU7A 2JXAA 5IVVA 5FYYA 3KLSA 1W8WA 5E88A 3RSJA 2OVUA 2QQKA 4HK8A 2G9GA 1CQ9A 3H3UA 2OX0A 1ASJ2 3N7KA 1CONA 4ZS3A 4TWTA 4EWEA 4LLFA 3VZLA 3W5NA 1W6QA 2RM21 2AC1A 1VPHA 1ALYA 1OF3A 4CEWA 1DFQA 2VMEA 5JR7B 3F2ZA 2JJ6A 2OT7A 1F5JA 2BEOA 1CAUA 1MS8A 1YFXA 3I2JA 4EN8B 1B35C 3PTRB 4F3JA 4Q0PA 4FAHA 2HWE1 3BPZA 5FPUA 3N4MA 2WLPA 3IBMA 4LULA 4QX2A 1QJFA 5C9AC 4HT1T 2WKKA 3WR0A 3GYDA 2J1TA 1LOCA 1J1LA 5FZEA 2R061 1W8UA 5A6XA 4L97A 2QFEA 3M1HA 1DG6A 1W05A 2D3RA 4BQ5A 3LE0A 1NCRC 2J1EA 4JHZA 3MO4A 5IAXA 3GGLA 3MZHA 2PLV2 4COUA 1LENA 1S2EA 3HR9A 3VBHC 2FCUA 2JG9A 3ZXLA 4FSJA 3ME2A 2ZCWA 4IV3A 3TEWA 3P1IA 4QPIC 3MYXA 1Y4WA 1FT9A 1PM4A 2QQLA 1STMA 1RUH3 2ZGKA 3G6JB 4NIDA 3LCPA 2WO2A 4LNVA 2VMFA 4PF5A 4ZU4A 5EZWA 5FZCA 1ZREA 5CFDC 3TEZA 3W9AA 1FAYA 3ZYPA 2ZEYA 1D4M1 4JGYB 1MEC2 3HN1A 3W21A 3ZYRA 3JUUA 2ZX1A 5J1XA 2ZMLA 1ENQA 3A21A 1SBDA 2RS53 4BCUA 4DS0A 2NLRA 3BN6A 3VL8A 1APNA 5K7PA 5FO7B 5AC92 4FPYA 1OLQA 2PAMA 1YHFA 4A7KA 1LULA 3NNLA 3ES4A 2GZWA 5C3RA 1RUE3 2JEMA 2D6KA 5LBFA 2XLAA 1YQCA 2VQTA 3SKJE 5L9RA 2UWBA 3OD4A 1RGSA 5J48A 5IFPA 2CSGA 3BPSA 5LA2A 3HPNA 2Q1FA 5E16A 4META 4W65A 5A33A 1SLIA 1D2QA 3MFAA 5DG2A 3EBRA 1DBNA 5KXBA 3NJVA 3DN7A 1LJ7A 2FDGA 1RUJ2 2WZR3 3WP3A 1AZDA 1SZBA 3I2GA 4V1PA 1NLRA 4H2AA 2JG8C 3ES1A 1DU3D 5TSWA 4ES9A 3CHXA 2B9VA 4YZ4A 5LWBA 3E6DA 1DGRA 4EE2A 1UOGA 3O1RA 3MW2A 2LROA 1ODMA 2A6WA 2DCYA 4Q8LA 1PGL1 2PFWA 1JXNA 3PDQA 4P9JA 3H0OA 4QGNA 3OUJA 4XW3A 4C91A 5JZGC 2Y26A 5DQ0A 1YO8A 1CAVA 2O0OA 2ZEWA 3N9OA 2XJTA 3PU3A 4JGZC 5FP7A 4AI1A 4BDVB 4FTSA 1ENRA 3IIIA 2CYFA 3NAPB 4R4ZA 4XUNA 1UKGA 3B9IA 5T55A 3AMNA 1Y7BA 3VBFB 5K0UB 1H1MA 1LGNA 3N7MA 3PHMA 4Q4X2 1GOHA 2XBO3 1VBD3 1N3PA 2ES3A 1IGOA 4XZPA 5FZDA 4AL9A 1RIRA 3B9CA 2XVKA 4I30A 2ZMKA 5C33A 5FQ0A 2WUHA 3BOWA 4WM7C 1VBA1 3JQXA 1K3IA 3POSA 2YU1A 5JVVA 4D69A 2Z2SB 4QT6A 3O1OA 1YFWA 2P6CA 4R9BA 5LK5A 1NLQA 1UOFA 3DGTA 4QGLA 3T30A 2VCBA 4A4AA 4O65A 3AYEA 3CKHA 1UYPA 1UX7A 4QU1A 1JBCA 2WFF3 1KDMA 3IMMA 4UW4A 3QACA 3C2UA 1QF3A 2TNFA 3WT3A 2OPKA 4S2GA 1PZ9A 1PVC1 1A8MA 1WMEA 1MQTA 4QKDA 1LOBA 1PIV2 2YFUA 4P9XA 2BOJA 4QM8A 3ZFEB 5LBEA 5KXCA 2BFUS 3RFRA 4HOOA 4YM0A 4QM9A 4CRQA 3OBZA 2LS6A 2MEV3 1AR93 3TEXA 1BVP1 4XURA 2WDBA 5FYIA 3KVAA 1GZTA 2PQQA 2D6PA 2C0ZA 1OLRA 4XUPA 4JTOA 2JDAA 1GV9A 1PK6A 5F3IA 3NO8A 5FP8A 2WSVA 4OHWA 2VULA 4D8MA 1PMJX 4Y26A 1ZBE1 1CX4A 2HWF3 4ISQA 3ZXKA 3B69A 1LEMA 1IS5A 1VBE2 4KG8A 3KF3A 4AFDA 3N9PA 1I5PA 2WFPA 4NN0A 4UFKA 1OFSA 2ERFA 4XJUA 4JGYC 1EAH2 1QIQA 3O0WA 1Q56A 1OOPA 4XFAA 2O8OA 5FLHA 5LY1A 3OGJA 4JDMA 1HW5A 2A73B 1JW6A 2FDJA 1QGLA 1ZZBA 1GICA 2H0BA 3E5UA 3PVOA 3SXWA 4GMP0 1POV3 1RVF2 2W08A 4F8AA 4XC9A 3PURA 3IAQA 2Y6KA 3M3IA 1S0FA 3AKPA 4L0PA 4P02B 4FOWA 5HV0A 1QJU3 3C7HA 4CDWA 1N1VA 4LIVA 5F5CA 1LOGA 5FYUA 3VZKA 1JOPA 1S0BA 1LHOA 3WHTA 1GWMA 2VUDA 5F9TA 1R083 2VVFA 1OFNA 2VZOA 1W9YA 3KCYA 4LTAA 5HCHA 1AXKA 2GNTA 5JWPA 4QQOA 1DQ2A 2G1MA 2XWJB 4CCOA 3ACGA 4QB6A 5LRRA 2OQ6A 1AYN3 1Y9MA 2R49A 4H14A 4K1YA 3RYKA 4LR4A 1N47A 4I3GA 1FNYA 5FO9B 1TME1 3VZOA 3WNMA 1NLSA 2KD7A 2JKBA 1ZRCA 3I59B 4IEVA 4LBKA 3BB6A 3S5AA 1V00A 3CL1A 1FMD1 2FMYA 3IDBB 3LA2A 3NL1A 4JQRA 4KWUA 4FTEA 1XNCA 5T3NA 1DZTA 2V72A 4C90A 1RHI2 1SDDB 1YWKA 3V64A 2IFRA 3H3ZA 5DAXA 3J26N 3M2MA 2WABA 5FMDA 4X6RB 3GZAA 1VRH2 3MF9A 4K1ZA 4QPGA 4Q0QA 4UW5A 1QXPA 4QPWA 3W20A 1HXS1 5DUUA 4BM8A 3NAPC 1W03A 3GBWA 2RDSA 2WQZC 2WNUA 3HNYM 3AVSA 1OLMA 2JB4A 4I02A 4AVCA 5FYCA 5K0UC 2PHXA 3KV9A 1Q8QA 2R6QA 3BOPA 4K20A 4UAPA 3T0BA 2R7EB 4GIQA 4EN6B 1XC6A 1QQP3 5IVFA 2BPA2 1RUG2 4L9BA 1VRBA 2E31A 3AZWA 2ZGTA 2W47A 2E9QA 2JD4A 3I97A 3R05A 1ZZ9A 4FP3A 4P9WA 4A41A 1QJY2 3ST7A 3O1SA 3WQ0A 4EWDA 5H9RA 5I0RA 1C8M2 4CU7A 4IXLA 1AF9A 5A7PA 1LOFC 2JDHA 3IDEA 4HANA 1HN0A 5M0TA 5CG9A 4XCBA 3FN9A 2NYYA 3T2OA 1O8PA 4DIQA 5B4NA 3C7GA 2HWD2 1XE8A 3AZVA 4OHZA 3EXUA 2EXHA 3TN92 2PHTA 2YROA 3WW3A 1W0OA 3ZYJB 4DY5A 4YW6A 2I2SA 4NIIA 1OH4A 1H2KA 5FZOB 1SBFA 3HEIA 3ZFEC 5JMCA 2BDRA 2PHRA 3AZYA 3TOJA 2WNVB 3M3EA 4GQ7A 4BQ1A 5DUVA 1O8SA 3VD9A 4MADA 2WQ8A 5IVCA 2YBKA 3P3NA 5EPAA 1R64A 4WVMA 5L36A 2DCKA 1HJGA 4G9SB 4C1XA 4QQLA 5JOYA 1RUC3 3V0AB 1UAIA 4UW6A 3MUZ1 4PQQA 4DMIA 4FTBA 5CAZA 1N1TA 2HLEA 4KGQA 4XTMA 4UI9L 2AYHA 4Q2FA 2A3YA 2ZPXA 2Y0IA 4F7ZA 3T1MA 2AREA 4E9KA 4GMP1 2VOTA 1NCQB 2F17A 4Y22A 1OD5A 3A22A 4LBQD 1ZNPA 3CBNA 4AHYA 2ETEA 2E6VA 4OZOA 1W0PA 3OYWA 2GNDA 2X09A 2V5DA 5HCAA 4ZXEA 2RR13 3BVCA 1XQNA 3RMYA 2ZACA 1ENXA 1IKQA 2CWMA 4CDXA 3AP6A 2DDUA 5KHKA 3USSA 3WSOA 3E5XA 1ASJ3 2D5HA 2KR2A 5FYBA 1IS6A 4DPNA 3NNMA 1W6QB 1DQ4A 4AK3A 1OT5A 4CEWB 3OD0A 4OMCA 2E7TA 5A7WB 3C7FA 1XJAA 1DQ5A 5A3OA 1D4M2 4UBHA 4Z2WA 3TNPB 3CF6E 3D82A 4BWOA 2GSYA 4ZY9A 3D3AA 1UXXX 2OIIA 2VOKA 4P00B 4RQPB 4DZGA 1X9PA 1YRZA 4ZONA 5FXWA 3DCQA 2WR9A 1J3RA 1NQDA 3QLQA 3WG3A 2VNRA 1EPWA 1H2NA 3CO2A 4LLOA 4A6SA 5C8CA 4DXSA 1H8TC 1RMU1 4Y20A 2ZAHA 5J37A 1Q8OA 4KU8A 5JIAA 4D6SA 2J7MA 1YC61 1LODA 1ZBA1 5FY4A 1DHKB 4CZSA 5JR2A 2JG9B 3SH4A 4HG6B 2VY0A 3MW3A 4IV3B 4A3ZA 5LZ6A 5EJ1B 4NIHA 2QVSB 1KFXL 2Q1ZB 1Y9GA 3RRDA 2QQJA 3LDKA 3ZIXA 2BZDA 3SMHA 5LATA 1JYNA 4CA9A 3IZOA 3WCSA 1LESA 3BTZA 3LEGA 3ROUA 1LAJA 3ABZA 4YZ5A 4URTA 2W1SA 1ULDA 3GALA 3N35A 3VD7A 1RUH2 2OXBA 4CSWA 1ZRFA 3ZFFA 4BZ4A 2RDRA 3G7DA 1GWKA 3VBUA 4ZKTB 2HWC1 2XUEA 3FL7A 3DF0A 4FPHA 1WCDJ 1YI9A 4C1WA 5C3OA 1NQJA 5AFEA 4H7LA 4XDOA 1S2KA 4AQSA 1XNDA 5IVEA 4Z92B 4YVSB 4LHKA 1R1A1 2OZJA 3IPVB 2ADDA 2A7AA 2JDPA 1RUF1 2RVAA 1TE1B 1I3HA 1SDWA 1FV3A 1V6JA 2Z79A 5GLUA 2IWGB 3H8XA 2R30A 3ZO0B 3U75A 5ABJC 1DGLA 1DQ6A 1RUJ3 1SHWB 2VZ3A 4HXCA 4XFHA 1H2LA 2FHRA 3AKRA 5EJZB 2HWB1 2Y38A 5JSRA 3VDDB 5JXHA 3OGRA 3OUHA 3P6BA 2FDHA 1MZ6A 4LQRA 3MV01 3R4DB 3TRSB 3AZZA 4MXVA 3URFA 4FAGA 1X33A 2EIGA 2WZR2 2EAKA 3M3CA 3HWJA 1SACA 4AHZA 1XE7A 1LRHA 4OFGA 1S0EA 3MLJA 4HVQA 1IG0A 2R041 3PLQA 1CAVB 1YQ5A 1WUVA 1RTVA 1XXNA 3POFA 4YG0A 4K7JA 3ZSKA 4AG4A 1L7LA 3VHOA 1PVC2 4J25A 1O59A 4AEDA 2BJSA 1LNSA 2VQUA 5E89A 2G4IA 1SLAA 5IJRA 2WT1A 2GMMA 2E26A 1NCQC 1IPJA 3LIHA 4BK5A 2ENRA 3UGGA 4XJ8A 5FZ7A 5FQ0B 4V2VA 1JZ5A 1GR3A 4YGEA 5EQUA 3ILNA 3THTA 2Q4SA 1CPMA 5DAPA 4XFFA 3MW4A 2WO7A 2QKDA 3AB0A 5BNNA 2A6ZA 1HQNA 2XBO2 1PX4A 4XFBA 3O0XA 1K42A 1O4YA 5BPXA 1C1LA 1C8NA 2ORZA 1OKOA 3E6BA 3FHQA 3R4SA 4J1WA 4NAMA 1ZBE2 4Z2AA 1Y43B 3O7OA 3RDIA 4XF4A 4PI0A 1J1TA 4XQ4A 5GZGA 4MZUA 2AUYA 4IEYA 4CEWC 1OPOA 1UD1A 4EV0A 2CHHA 4FPKA 1MQTB 1PIV3 1I6XA 4Q29A 1PGSA 2ZMNA 4NRPA 4BYYA 4YARA 4ZU5A 2ZOEB 2LW8A 1FV2A 4RQPC 3OGGA 2FQPA 1D2SA 4JKMA 4CXWA 3C7OA 3H1WA 2WFF2 5A3MA 3RVHA 4A3XA 2FD8A 4ZU7A 1LU2A 1SMVA 3NVCA 4U2AA 1UY2A 4MGKE 3PUSA 4RN5A 1E57A 3N3HA 1UY4A 3QOPA 3C3VA 1PK6B 2NP0A 1WBLA 4GXLA 3ETPA 3FWEA 5AVPA 2NMNA 3SCGA 4MGSA 4M4RA 1UKRA 4QXBA 1COV1 1AR92 2JG9C 5GLZA 5FY7A 2VOVA 2A3XA 3FBMA 4IV3C 1KJRA 1CN1A 1OA3A 4NPMA 2DCJA 2BVBA 4BLIA 1K5JA 4LXLA 2IC1A 2QZ2A 4NO4A 4XXPA 1VBE3 4XIOA 2ZZJA 5J98B 2WA3A 4HMZA 1NZIA 4OVEA 3LDBA 4XJ9A 1KS5A 1OOPB 2I74A 3DKWA 1JUHA 1QOTA 2D7FA 4I09A 4LMFA 4Y4YA 4OUEA 1TME2 4Q4W3 2FCTA 4AF9A 3UK9A 1HRV3 4JAAA 1QJEA 4B8EA 2HEVF 3ZKUA 4A6OA 1DYOA 1RVF3 3C7EA 2IUWA 1IQAA 4RS5B 4LOTA 4CDWB 1GNHA 2BGCA 3LSDA 4ZXKA 5I93A 5KXEA 4Q4Y3 4A7ZA 1FI2A 5EYYA 4YVSC 1YQ6A 4BQ2A 2YBPA 4NHXA 4M00A 4LBQA 1HXS2 1AR83 4U36A 5J3UA 1RUD1 3SCFA 3NV2A 1BQPA 3ZFGA 1CGPA 3R6SA 2B9UA 5DMYA 1ENSA 2QUOA 3E1F1 1CESA 1T2XA 2H6CA 5FPBA 4PDWA 4R9DA 1NA1A 3MDPA 4YZ2A 4LUKA 3LB9A 1KQRA 2BRTA 1R082 4OI4A 3VDDC 4YFWA 1UQXA 4FOVA 1UYXA 3GZTB 2RHPA 3MGUA 3ZYGA 3E6CC 4FPLA 4KGGA 3ZN6A 1MVQA 3MFCA 5IVJA 3PVBB 1RHI3 4AAXA 4A2UA 1NCRB 4GAZA 1XRUA 4IEZA 1S0JA 4PIYA 4ZS2A 1LHVA 1X82A 5HV4A 1XYNA 5FK8A 2R1DA 4K21A 4AEMA 4COWA 4WV8A 4DINB 4E8DA 4LHSA 3WDYA 3IM0A 1K45A 4DXTA 3ILRA 5IUQA 5I8TA 3X29B 4EJRA 1N3QA 2ZKNA 4GKYA 4R9AA 2ZX0A 3HT1A 2OUJA 2F6BA 3WQBA 4MGTA 2VJXA 1IS4A 4Q1PA 1RUG3 4K40A 1OHFA 4QQHA 2EVXA 5CU1A 4XABA 1WBFA 2VZ1A 5A80A 4CUAA 3K4AA 4CU9A 4Y1VA 4P5YA 3B94A 5LCWL 5HXVA 3HT2A 2J42A 2VUAA 3FLRA 1AVBA 2WWSA 2DBNA 3PVEA 1WCUA 3CIHA 5F5AA 2ILMA 3ZXJA 1CJPA 4SBVA 3S7EA 5IAVA 2VC9A 2Q5TA 3ETQA 2HWD3 4CP9B 5IVYA 4NE9A 4S2HA 1S55A 3GDBA 2EIBA 1ULCA 1OURA 2A1XA 2IXCA 3ITQA 1MQTC 2C1FA 5A3PA 1BHGA 2FZ1A 5IT6A 3MEPA 3MI8A 1V6OA 3NNJA 5EIYB 2ZX3A 1DGRN 3I3EA 4JRAA 4OQ9A 1QHDA 3VHRA 3VBSA 4R4XA 4AFMA 4WVMB 1NY71 1JYWA 2W5FA 4N53B 4OULA 2ZGQA 3OEAA 5LB6A 4CCLA 4ZZ5A 4HVOA 4XOGA 1PK6C 5FXXA 2RM23 3QH7A 1ZVFA 3K4DA 3H1YA 2HBTA 1WW6A 1J3QA 4Q26A 5EFUA 2VCMA 1ZRIA 3SEPA 1UX6A 4Q4V1 2A5ZA 1TMF1 2HWE3 1H4HA 1ZZCA 4S2FA 4LO5B 3SNMA 2IZWA 1VMJA 2X5IA 1ZX5A 1RUC2 2DFCA 4LKFA 4LO6B 4P14A 4WZCA 4Y22B 4B4PA 5KR7A 2CGOA 1W06A 2WT2A 3V65A 1W6NB 2Q0AA 3OYWB 2R063 1H1IA 4JGZB 2JDKA 5IK8A 3JBG1 1OOPC 4M3CA 2EAAA 5C3PA 2ET1A 2XJRA 3PL0A 4JTNA 1F8VA 4CDXB 3U4SA 2W2IA 3FJSA 4YPJA 4YWAA 1ND2A 4QHOA 1K5MA 2UURA 2BFUL 2I07B 2KM2A 3CZJA 2WLQA 4CP1A 1XNAA 5FZFA 4RS5C 1OH3A 4WM7B 5A1AA 4CDWC 4QD2A 1W8FA 1U5ZA 3POEA 1S4CA 2GMPA 1QJX1 2YGLA 3B5LB 2DVAA 1LR5A 1D4M3 1V6MA 3ZPOA 2EICA 5A32A 4TN7A 5IFTA 4W4ZA 2B7YA 3GNEA 2XQXA 2D6NA 2YPDA 4HKLA 3PUAA 2CAUA 4XQDA 1SG3A 1Y9QA 4LE3A 5LW9A 4YGBA 2HWC2 5FUPA 4D3WA 5C8CB 3S0MA 3KV4A 3WDTA 3L2HA 4XBLA 2EA7A 2YC0A 2XXZA 1XNBA 3KD4A 1DYPA 1W04A 4RGGA 3WV6A 5KHHA 1SBEA 1X9TA 5KHJA 2D97A 4Z82A 3A0KA 5CB7A 1LGCA 1WLDA 2ZGSA 4CUCA 1HIXA 1PNFA 4KBZA 4QWNA 3ZYBA 3L2YA 5FKCA 3PMSA 1RUOA 1O5UA 1MPXA 2R1BA 4UF0A 1MS3A 3BTAA 4AI8A 4IL7A 4MXWA 5BNOA 1H4GA 2HWB2 3I2DA 3I3DA 4Q27A 1JYTA 3MV11 2VNGA 1HQWA 3VBUB 2CTVA 3UL2A 4DXRA 1CZTA 4IGOA 2GH2A 5KXDA 5HI0A 4QX0A 4AFCA 2RDQA 1AXYA 5E8AA 3PUHA 4JDOA 2J1SA 2XB6C 4BE3A 2R042 5FWJA 1WLTA 4IE0A 1GNZA 4ATEA 1RL3A 5GLWA 1XOYA 5JOZA 5EWSA 2GN7A 1IOAA 1VMFA 4I2OA 5KC6A 4UFMA 1EYBA 3O1PA 4UT5A 3H3LA 3JU9A 2QQNA 3Q8CA 5E1RA 4Y4RA 5F6LB 1YI7A 5LA0A 1F4AA 5BY5A 2WJSA 1Z7S1 3FLTA 1VBA3 5F8PA 1YLLA
chains in the Genus database with same CATH topology
5FZMA 4QXBA 5FZ0A 5FZBA 5A7NA 4CCLA 5FY7A 2PXJA 5FXXA 5FJKA 5FY5A 5F5IA 4D6RA 3AVSA 4LXLA 5FY8A 3AL6A 5FZDA 5FYCA 5IVVA 3KV9A 5FYYA 2YU1A 4CSWA 5IVFA 4D6QA 3DXTA 3LDBA 3AL5A 1VRBA 5FYHA 4CCNA 2OX0A 5KR7A 5FZAA 2XUEA 3KV5A 5FBJA 4ASKA 3PUQA 4CCMA 2OS2A 2OT7A 4QU1A 5IWFA 4XDOA 3PTRB 2W2IA 5FYZA 3N9MA 4IGPA 5A7PA 3U4SA 4EYUA 5IVEA 2Q8DA 5FPUA 4BU2A 4DIQA 5FP3A 2WWJA 3NJYA 3PU8A 5FXVA 4NUBA 5FV3A 4HOOA 4IGQA 5FZFA 5FZEA 2YBPA 4CCKA 5F32A 5A7OA 5FZLA 5FZOB 2WWUA 5F3EA 2YU2A 5FZIA 5FYIA 4QXHA 3KVAA 3ZPOA 2GP3A 4TN7A 4DO0A 5FP4A 3K3NA 5F2WA 5FUNA 3ZLIA 5F2SA 5IVCA 2YBKA 5FPBA 5A1FA 2YPDA 5F3IA 5FZ1A 3OPTA 5FZGA 3PUAA 5FP8A 5FYTA 5FY1A 2VD7A 5LW9A 5FYVA 5FUPA 4UF0B 3KV4A 5FZCA 5FXZA 2Q8CA 5F37A 3DXUA 4V2WA 5F39A 5A3TA 5FZOA 5A1LA 2XXZA 4BISA 5FPVA 2OQ7A 5IVJA 5FY0A 3K3OA 3N9PA 3OPWA 3N9LA 5FZKA 4GJZA 4GAZA 4HONA 4AAPA 5CEHA 4E4HA 2YBSA 5LY1A 2Q8EA 4QWNA 4EZ4A 5A3NA 5LY2A 5FYSA 4UF0A 3RVHA 5IW0A 5FZ6A 3N9QA 5ANQA 5FZ7A 5FYMA 3PURA 2XDVA 5FZ9A 4V2VA 3UYJA 4CUGA 2GP5A 5A7SA 4LIVA 5F5CA 5FYUA 4QX7A 5IVBA 5FYBA 4C8DA 5A80A 5FP9A 4CCJA 5FWEA 3KV6A 4IGOA 3LD8A 4LITA 5F3GA 5A7WB 3N9NA 4LIUA 5K4LA 5A7QA 4URAA 4QXCA 4Y3OA 5FZ3A 5F5AA 4XDPA 5F3CA 5FWJA 2P5BA 5FZ4A 3AVRA 5ISLA 5LWBA 4CCOA 5FXWA 4EZHA 5FZHA 2OQ6A 5FPAA 5IVYA 5A3WA 5FZ8A 4GD4A 4BXFA 2XMLA 5FJHA 4GJYA 3K2OA 5A3PA 3U78A 5E6HA 3KVBA 3PDQA 4Y33A 5A7WA 4D6SA 4Y4RA 5FY9A 3PUSA 5FY4A 5FPLA 4AI9A 5FP7A 4QX8A 3N9OA 3PU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZM A;  4QXB A;  5FZ0 A;  5FZB A;  5A7N A;  4CCL A;  5FY7 A;  2PXJ A;  5FXX A;  5FJK A;  5FY5 A;  5F5I A;  4D6R A;  3AVS A;  4LXL A;  5FY8 A;  3AL6 A;  5FZD A;  5FYC A;  5IVV A;  3KV9 A;  5FYY A;  2YU1 A;  4CSW A;  5IVF A;  4D6Q A;  3DXT A;  3LDB A;  3AL5 A;  1VRB A;  5FYH A;  4CCN A;  2OX0 A;  5KR7 A;  5FZA A;  2XUE A;  3KV5 A;  5FBJ A;  4ASK A;  3PUQ A;  4CCM A;  2OS2 A;  2OT7 A;  4QU1 A;  5IWF A;  4XDO A;  3PTR B;  2W2I A;  5FYZ A;  3N9M A;  4IGP A;  5A7P A;  3U4S A;  4EYU A;  5IVE A;  2Q8D A;  5FPU A;  4BU2 A;  4DIQ A;  5FP3 A;  2WWJ A;  3NJY A;  3PU8 A;  5FXV A;  4NUB A;  5FV3 A;  4HOO A;  4IGQ A;  5FZF A;  5FZE A;  2YBP A;  4CCK A;  5F32 A;  5A7O A;  5FZL A;  5FZO B;  2WWU A;  5F3E A;  2YU2 A;  5FZI A;  5FYI A;  4QXH A;  3KVA A;  3ZPO A;  2GP3 A;  4TN7 A;  4DO0 A;  5FP4 A;  3K3N A;  5F2W A;  5FUN A;  3ZLI A;  5F2S A;  5IVC A;  2YBK A;  5FPB A;  5A1F A;  2YPD A;  5F3I A;  5FZ1 A;  3OPT A;  5FZG A;  3PUA A;  5FP8 A;  5FYT A;  5FY1 A;  2VD7 A;  5LW9 A;  5FYV A;  5FUP A;  4UF0 B;  3KV4 A;  5FZC A;  5FXZ A;  2Q8C A;  5F37 A;  3DXU A;  4V2W A;  5F39 A;  5A3T A;  5FZO A;  5A1L A;  2XXZ A;  4BIS A;  5FPV A;  2OQ7 A;  5IVJ A;  5FY0 A;  3K3O A;  3N9P A;  3OPW A;  3N9L A;  5FZK A;  4GJZ A;  4GAZ A;  4HON A;  4AAP A;  5CEH A;  4E4H A;  2YBS A;  5LY1 A;  2Q8E A;  4QWN A;  4EZ4 A;  5A3N A;  5LY2 A;  5FYS A;  4UF0 A;  3RVH A;  5IW0 A;  5FZ6 A;  3N9Q A;  5ANQ A;  5FZ7 A;  5FYM A;  3PUR A;  2XDV A;  5FZ9 A;  4V2V A;  3UYJ A;  4CUG A;  2GP5 A;  5A7S A;  4LIV A;  5F5C A;  5FYU A;  4QX7 A;  5IVB A;  5FYB A;  4C8D A;  5A80 A;  5FP9 A;  4CCJ A;  5FWE A;  3KV6 A;  4IGO A;  3LD8 A;  4LIT A;  5F3G A;  5A7W B;  3N9N A;  4LIU A;  5K4L A;  5A7Q A;  4URA A;  4QXC A;  4Y3O A;  5FZ3 A;  5F5A A;  4XDP A;  5F3C A;  5FWJ A;  2P5B A;  5FZ4 A;  3AVR A;  5ISL A;  5LWB A;  4CCO A;  5FXW A;  4EZH A;  5FZH A;  2OQ6 A;  5FPA A;  5IVY A;  5A3W A;  5FZ8 A;  4GD4 A;  4BXF A;  2XML A;  5FJH A;  4GJY A;  3K2O A;  5A3P A;  3U78 A;  5E6H A;  3KVB A;  3PDQ A;  4Y33 A;  5A7W A;  4D6S A;  4Y4R A;  5FY9 A;  3PUS A;  5FY4 A;  5FPL A;  4AI9 A;  5FP7 A;  4QX8 A;  3N9O A;  3PU3 A; 
#chains in the Genus database with same CATH topology
 3WLU A;  3INA A;  4MO3 M;  5KHG A;  2YGM A;  2VXR A;  4N43 B;  2IXI A;  2JIG A;  5DAQ A;  2YV8 A;  5GAL A;  3HNM A;  1RYY A;  5CVR A;  1UW8 A;  4PLO A;  2QQM A;  5BYN A;  1DGW A;  1SEF A;  1NT0 A;  4N53 C;  3MIH A;  4ZPI A;  2VW2 A;  1I9R A;  2H6B A;  4WM8 B;  1PVC 3;  4AED B;  1WLW A;  4CCN A;  1IQD C;  2F4L A;  2C9A A;  4GUL A;  4ASK A;  2VW0 A;  1C3H A;  1NZC A;  3KZ4 C;  1XNT A;  1SPP B;  3MLL A;  2DCT A;  3RPQ A;  1HKD A;  5ACA 1;  1AR7 1;  4M0H A;  2YPJ A;  3O1M A;  3HIF A;  4OUM A;  3FHA A;  1W8Z A;  5C70 A;  2D5F A;  2E7Q A;  2YDE A;  5FP3 A;  1TG7 A;  4CDX C;  5BNN B;  1CJD A;  1EV1 1;  1WCK A;  4QQ2 A;  3D8C A;  3J7M A;  4QX1 A;  1COV 2;  2VOW A;  3SQO A;  5F32 A;  2ZEZ A;  2IXH A;  3OY8 A;  2BTV C;  2GDF A;  1ZBE 3;  2NZ9 A;  3ACF A;  4YW1 A;  1GZW A;  3FX3 A;  1F15 A;  4B3N A;  3RZM A;  2QZ3 A;  2SBA A;  4QU2 A;  4C0B A;  3FZ3 A;  2G9F A;  3BU7 A;  2Y0O A;  4XZU G;  2WAO A;  5A70 A;  1XBF A;  5T5J A;  3KGL A;  2CY6 A;  5F37 A;  5L7O A;  4TSV A;  1A3K A;  1Q43 A;  2OQ7 A;  5C8C C;  2XG3 A;  1KDK A;  1GKB A;  2W91 A;  4PHZ A;  1E5I A;  4A45 A;  3WIN E;  1LCL A;  2VTX A;  3VV1 A;  2K9Z A;  5CEH A;  4FPC A;  2BBA A;  1OC1 A;  3WG2 A;  4E4H A;  3ALQ A;  3K48 A;  3CU7 A;  2XON A;  2QE3 A;  2B45 X;  2JE8 A;  4XHB A;  2ARC A;  3H7J A;  1FOD 1;  4OHV A;  3LAG A;  1RUD 2;  1FXZ A;  4GWI A;  4GWN A;  4FCA A;  4JVA A;  2VBD A;  2D6M A;  4JKL A;  3M3O A;  4FPJ A;  4XF0 A;  4CCJ A;  5FMO S;  1OSG A;  5FWE A;  4AVS A;  5CFC A;  1D7P M;  1TME 3;  2B8M A;  4XFI A;  4LIT A;  4CVU A;  1CX1 A;  1GMM A;  3PIG A;  2ADE A;  1KS4 A;  2UU8 A;  4MH0 E;  2BYV E;  3OTF A;  4Q1R A;  2VZR A;  3VBU C;  3ACL A;  1FMD 3;  3T4V A;  2BNM A;  3ZSM A;  1AR6 1;  4IQP A;  4JCK A;  3M7A A;  4BQX A;  1KFU L;  2P5B A;  4MLO A;  3LEI A;  4PLN A;  2BWA A;  5ISL A;  2XGX A;  2XLF A;  3DEM A;  3FBY A;  1UY0 A;  5FZH A;  4EZH A;  2CAV A;  3KHB A;  4HKW A;  4Q4W 2;  4QHB A;  5HPO A;  4ASL A;  4DFS A;  1HRV 2;  2WYF A;  4G3Y C;  5FJH A;  1J59 A;  4GJY A;  4LBQ B;  3K2O A;  1E5H A;  3IWZ A;  2ARX A;  4IEP A;  1HXS 3;  4XAA A;  2ZEX A;  5JSO A;  4HN1 A;  4Y33 A;  3KQR A;  1U5Y A;  1XYP A;  3NJZ A;  5H9Q A;  1SLL A;  4Q4Y 2;  4E4D X;  4XQW A;  1PO1 1;  5FLJ A;  4KWJ A;  1GSL A;  1NA1 B;  1QOO A;  1N3O A;  1W2A X;  4CTE A;  3CEW A;  1TQ5 A;  4FFH A;  3ATG A;  1AR8 2;  1HB1 A;  2WS9 1;  2VCC A;  4H7M A;  3QH6 A;  1VAV A;  3ZN6 B;  3HVD A;  1EP0 A;  3AL6 A;  2ZGN A;  3I2H A;  4N43 C;  3VZM A;  4BQ4 A;  1UPS A;  2VZQ A;  1H8T B;  1EUT A;  1YNA A;  1XE0 A;  4L8Q A;  2K46 A;  3DKQ A;  3DXT A;  3NV1 A;  4HVR A;  1JZ2 A;  1ONA A;  4WM8 C;  2ARA A;  1YIP A;  5LBC A;  4HZF A;  1JYC A;  4AED C;  3IIA A;  5FRA A;  4CCM A;  3ENR A;  2YY1 A;  1JZ6 A;  3RZG A;  4EN0 A;  4FPE A;  4IGP A;  1QH7 A;  1PM7 A;  1V6L A;  1W6P A;  4X8N A;  4MGI E;  4X8P A;  5APA A;  1Q8V A;  5EHD A;  3VGI A;  1WCS A;  1CAW B;  1H6Y A;  2FMD A;  2PA7 A;  2DTY A;  1G86 A;  3ACH A;  4DNY A;  5BNN C;  3AFG A;  3GXU A;  5LRS A;  3OF1 A;  2GP3 A;  3O1V A;  4YYO A;  5C9A A;  4KNC A;  1MS5 A;  1GQP A;  4Q5O A;  1VP6 A;  2Y60 A;  1CPN A;  4GMP 3;  4XMI A;  5T5L A;  2NQY A;  3WW1 A;  5JSP A;  1MS1 A;  3UNP A;  1GU3 A;  2RS1 1;  2VD7 A;  1REE A;  1VBB 1;  3U1X A;  3H50 A;  3I4I A;  2Q8C A;  3VB9 A;  5HBA A;  2KA3 A;  4X6Q B;  1WMF A;  4HK9 A;  1MR5 A;  3VBH A;  3WQ7 A;  1UZ0 A;  5FPV A;  1VBC 1;  2MNG A;  2TBV A;  2PQS A;  4LUM A;  2V4A A;  4LA2 A;  2VMG A;  1WA6 X;  3W59 A;  4Z1V A;  5ABJ B;  1S0C A;  3EJK A;  3V0B B;  3VD5 A;  1YIF A;  3VZJ A;  3VKL A;  4JZR A;  4XIK A;  2UWA A;  1UZV A;  4E8C A;  2VE1 A;  2WQ4 A;  3HQX A;  3ZDV A;  1UU5 A;  5JMO A;  1AX0 A;  1QJZ A;  2DVG A;  5JUV A;  4RA0 A;  3ACI A;  5ANQ A;  4YFZ A;  5KHI A;  1LHU A;  2D40 A;  5DUX A;  5I0T A;  4IDZ A;  4P5H A;  4CUG A;  4XE9 A;  3ZOI A;  1JZ7 A;  3BUC A;  3VD3 A;  2X5I B;  3AKT A;  2PHU A;  5G05 L;  1VB2 A;  2QQU A;  1BEV 1;  2RM2 2;  2WN2 A;  3WD5 A;  5FK7 A;  4OMD A;  3FUO A;  3LD8 A;  4LBN A;  4OI0 A;  2RDN A;  2NM1 A;  4M3C B;  5F3G A;  1RMU 3;  2D6L X;  2WZ8 A;  5K4L A;  1A6C A;  1W8T A;  4XHX A;  2HWE 2;  2JKX A;  3IDA A;  2D44 A;  4LK7 A;  1ZBA 3;  1RC6 A;  1QWR A;  2ZX4 A;  4W8J A;  1YYN A;  3RJ2 X;  1ND2 B;  3VL9 A;  1HV1 A;  4B7E A;  3POI A;  2ZX2 A;  4QX5 A;  5GJ6 A;  2ID4 A;  4M3C F;  1PHM A;  2R06 2;  3LSE A;  5FDB A;  2ZA9 A;  4HN0 A;  4JV4 A;  1JOB A;  3U78 A;  5GZD A;  3UKN A;  4AVA A;  1DZR A;  5A32 B;  5JXG A;  3A4U A;  4GA9 A;  4OQ8 A;  2R07 3;  3H8R A;  1OBN A;  4LO4 B;  2V09 A;  2JB8 A;  4XUT A;  2H0V A;  2PMW B;  2QCS B;  4ZHN A;  2AH2 A;  3WF2 A;  4HBN A;  5JOW A;  2XVL A;  5FZ0 A;  4BOW A;  3VDC A;  4YZ1 A;  1RXG A;  4RFR B;  4AGG A;  2HWC 3;  1YCI A;  3GBG A;  1W6O A;  1CAU B;  1NA1 C;  1ULE A;  2JDU A;  5A3L A;  2X8K A;  3VBR A;  5JZG A;  1W28 A;  2RJK A;  3E97 A;  4XBQ A;  5DDJ 1;  3WP5 A;  2VQA A;  3ZX7 A;  2PAE A;  1W2N A;  3B02 A;  3J9S A;  4IEX A;  3AYC A;  3NQH A;  3WNP A;  3ZYH A;  4TYS A;  3L9J T;  1R1A 3;  1C28 A;  4L2N A;  1GBG A;  4Q0U A;  1BYH A;  1RUF 3;  2ZKL A;  5FZA A;  5FPZ A;  1NE6 A;  4CCD A;  1WMD A;  3POJ A;  4D0Q A;  5DPN A;  3WDX A;  3H9A A;  4FQ4 A;  3SH5 A;  2ZGO A;  2ET7 A;  3I3B A;  4MXW B;  5BNO B;  1RED A;  2MPF A;  3PVN A;  2HWB 3;  1Z7S 2;  4BU2 A;  4MGY E;  2BP6 A;  2XKP A;  1RB8 G;  2WWJ A;  5J09 A;  2V4V A;  3BCW A;  4BQW A;  2VMC A;  2W87 A;  4NUB A;  4YVW A;  1WMX A;  4KMQ A;  4ONU A;  1SCR A;  1OVP A;  4XJW A;  5CBL A;  5JAX A;  2DTW A;  5C5T A;  5C3Q A;  2ZHN A;  2IVI B;  1W0N A;  4RGA A;  5F3E A;  2AEZ A;  4UFI A;  1W6M A;  5CG8 A;  1CWP A;  3JD7 1;  2R07 1;  5T5P A;  1CAX A;  3AKS A;  4J1X A;  1S0G A;  2R04 3;  3NRU A;  5FUN A;  1O4Z A;  1W9F A;  1JYI A;  2WSU A;  5JI9 A;  2Y64 A;  5GZE A;  3WZ1 A;  2E7A A;  3LGR A;  3RI9 A;  4AZZ A;  5FY1 A;  1JHN A;  3FFQ A;  1PGL 2;  3PIJ A;  4LKE A;  1CIW A;  3MIE A;  4LO8 A;  3GCW A;  2VVD A;  3BTX A;  5I0U A;  2ZGP A;  3ON7 A;  5F39 A;  5GLV A;  4IEQ A;  1D0H A;  2RJL A;  2VTX J;  4BIS A;  5ACA 2;  1AR7 2;  3GBF A;  4RL7 A;  1HRI 1;  3OPW A;  1NG0 A;  1V6K A;  4PCR A;  5A33 B;  2CWS A;  2E32 A;  4Y1U A;  1UNB A;  1MVE A;  2RS3 1;  2VL4 A;  4O9E A;  1LU1 A;  4LBM A;  2W95 A;  5A6Z A;  5KBF A;  5LY2 A;  2P1B A;  2W46 A;  2QTW B;  2P37 A;  4FPO B;  5LK7 B;  1ZRR A;  2DBI A;  3WX5 A;  1JYX A;  2DVF A;  4BQ3 A;  3O1T A;  1VBA 2;  2XDV A;  4JGY A;  5FOJ B;  2VZS A;  1IKP A;  1WGP A;  1GP4 A;  4DXZ A;  1C4R A;  3CJX A;  1SCS A;  2WNO A;  2WII B;  4QX7 A;  1GNY A;  3LDR A;  3KV6 A;  4A42 A;  3RS6 A;  1GYK A;  2X5I C;  4L11 A;  2BW8 A;  4LIU A;  3ZMN A;  4IEO A;  3ZYI B;  3KM5 A;  1BBT 1;  2N7G A;  1S2B A;  4GZ9 A;  4NJ4 A;  3T2P A;  3OPZ A;  3LA3 A;  2PLV 1;  2WYS A;  4AQ6 A;  1QOS A;  4BB3 A;  3KQ4 B;  4HSJ A;  3HN3 A;  5FCC A;  4GAL A;  5FZ8 A;  1HN1 A;  2ZGR A;  2PHF A;  4M3C E;  1COV 3;  1ND2 C;  4MX3 A;  5L73 A;  1S0I A;  3OY8 B;  1YJL A;  4XUO A;  4KH9 A;  4D7S A;  5DXD A;  3M8L A;  4UBG A;  5JIU A;  4YGC A;  3I2I A;  1S1A A;  5CKN A;  1MEC 1;  1YFY A;  4PI2 A;  5AVA A;  2ZGM A;  4BPZ A;  1ST8 A;  3PJQ A;  4LPL A;  4COZ A;  3USU A;  1KEX A;  1U0A A;  3LOI A;  2PEL A;  5KC5 A;  3CZU A;  3U10 A;  1RIN A;  2NMO A;  3J8F 1;  3I2F A;  1EUU A;  3DPR A;  3NV4 A;  3TYJ A;  1Y3T A;  3LA7 A;  3POG A;  5CA6 A;  4D6R A;  2ORX A;  1AX2 A;  3ELN A;  3KS7 A;  1W2U A;  4Q0V A;  2QBX A;  1DQ1 A;  4DQA A;  1AR6 2;  2RG4 A;  3POY A;  2VUC A;  4ORF A;  2YMZ A;  4BIO A;  4OYU A;  4O7X A;  1CD3 G;  3NAP A;  4CCE A;  3JXS A;  4NMI A;  4WVV A;  1C5H A;  1OA2 A;  3WG4 A;  2E53 A;  3VBF A;  3OGV A;  2EXI A;  1V6N A;  5K0U A;  3HBK A;  1RUD 3;  3T08 A;  4XIL A;  4LOR A;  5LEJ A;  3LZZ A;  4AI2 A;  4QKF A;  1U5I A;  3NJY A;  2V73 A;  4RSU A;  2P3I A;  1GAN A;  1AYM 3;  5GLT A;  5BV6 A;  1JI6 A;  2XHN A;  5C5U A;  2C4X A;  5BNO C;  1I1E A;  3HQR A;  5CFC B;  1KXG A;  2WS9 2;  4FOY A;  4ARY A;  1OVS A;  3MUY 1;  2QDR A;  4H3W A;  3I49 A;  3D6E A;  4GB3 1;  3VHN A;  2D98 A;  3K3N A;  4K3U A;  5DN2 A;  3ZSL A;  1O7F A;  4K8F A;  3DUI A;  1C57 A;  3LWC A;  3RWN A;  2NPI A;  4EQV A;  5L9V A;  2P3Y A;  2EID A;  3AMM A;  1A8D A;  1FMD 2;  4Q4X 1;  3VKO A;  2Z42 A;  4IET A;  3LFI A;  1T6B X;  2YFZ A;  2RMU 1;  4NWW A;  1JZ4 A;  3CJI A;  3TAY A;  2JDZ A;  1WW4 A;  2YBS A;  4LK6 A;  1XSQ A;  5DG1 A;  3T2T A;  1VMH A;  2F4P A;  3BOD A;  2VZT A;  2JDN A;  1NKG A;  1JZ8 A;  1ND3 A;  1IPS A;  3N9Q A;  4W6X A;  3UKT A;  3MID A;  2GNB A;  1ZZ6 A;  2GH8 A;  4FFG A;  4NIA A;  4M01 A;  1AYM 1;  3B93 A;  3WDU A;  5IAT A;  2JIC A;  3SH3 A;  4AOC A;  3K77 A;  2W68 A;  4QPY A;  2RS1 2;  3B01 A;  4AHW A;  2J1A A;  4LE4 A;  2VOX A;  5FKB A;  3J7L A;  1PGW 1;  4YLZ A;  4E2G A;  3ZMO A;  2L9L A;  2BQP A;  3WNN A;  2JEC A;  4AHX A;  1HQL A;  5BUV A;  2WO1 A;  1NYW A;  1W6P B;  3OGS A;  4FPF A;  4YG3 A;  4AGV A;  1G9B A;  2UYA A;  5FZ4 A;  3AVR A;  4PQ9 A;  3U14 A;  1G9F A;  3GCX A;  3PUI A;  4QPG B;  3VBO A;  2DFB A;  3S5Q A;  4BXF A;  2YYO A;  3RYR A;  1EY2 A;  3DV8 A;  3A0N A;  3I54 A;  3Q8E A;  2WBK A;  3UET A;  3VHP A;  2WO3 A;  2WNU B;  2HJI A;  3IT8 A;  3POB A;  3N36 A;  1RUI 1;  4CPB D;  4XTP A;  4YZ3 A;  2ZJC A;  3AMP A;  3HAG A;  4Q4V 3;  1TMF 3;  5FBZ A;  2WIN B;  3WEZ A;  1QDO A;  1U12 A;  2CGN A;  2GNM A;  1EAH 1;  1FNZ A;  2Y6H A;  4A44 A;  1Q8S A;  1FPN 1;  1AL2 1;  5A7N A;  3KCX A;  1BEV 2;  3VKM A;  2PHW A;  2YXS A;  2CU5 A;  1ZRD A;  2X10 A;  3JBG 3;  1A34 A;  1JOJ A;  1ZA7 A;  3Q8F A;  1N1Y A;  1SLT A;  3RG0 A;  1POQ A;  3I2O A;  2Z4F A;  3KT1 A;  4D6Q A;  1PO2 1;  4HL0 A;  5FYH A;  3GZE A;  3GM8 A;  3PNA A;  3O12 A;  4NHM A;  5FBJ A;  3T0A A;  1QJX 3;  2BWC A;  4NHL A;  5LA1 A;  3DYP A;  4EYU A;  2W52 A;  4XYX A;  5FXV A;  2Y33 A;  4JX0 A;  4O9G A;  4AI3 A;  3SCH A;  5CAD A;  3TNQ A;  1SFP A;  2Z69 A;  4TLF A;  5T50 A;  3RZK A;  5A7O A;  4QMA A;  2XLG A;  4PBO A;  2GC2 A;  1XPW A;  4NR1 A;  3ZN5 A;  2O1Q A;  2YU2 A;  4FI9 A;  4IER A;  3RI8 A;  5CFC C;  2JE9 A;  3ZPY A;  5F2W A;  3J7N A;  2PN5 A;  2ZGU A;  5D8A A;  5F2S A;  1HJF A;  2VZP A;  4COV A;  2IFW A;  3GHM A;  5JOX A;  2FDK A;  1H9W A;  4GWM A;  4RHV 1;  1RMU 2;  1VRH 1;  3EHK A;  4ATF A;  5JDB A;  1GZC A;  2C26 A;  2ZAB A;  3SHR A;  3TBD A;  1QKQ A;  2VW1 A;  1ZBA 2;  5FZO A;  4R9C A;  4MHU A;  5JXJ A;  4IND A;  4AFA A;  2BGP A;  2WNV A;  4IW3 A;  2VPV A;  1F9K A;  1V9U 1;  2DCZ A;  2QDN A;  4UWD A;  5L9B A;  3A23 A;  4AAP A;  2Y6L A;  1V70 A;  1JU4 A;  5G04 L;  2BBV A;  1ACC A;  1X36 A;  3PME A;  5CYY A;  3ZXD A;  4CDU A;  3IKW A;  2FDF A;  5I8Y A;  2X29 A;  1W6O B;  1DZQ A;  2VMH A;  3WY6 A;  4MYE A;  4CXX A;  3V0A A;  5F5Q A;  3VBR B;  1QXJ A;  2PYT A;  2OZ6 A;  4DEQ A;  5AFB A;  1QJY 1;  2R07 2;  1UO9 A;  2VEC A;  1C8M 1;  1W8O A;  1YJK A;  2VZV A;  3EYP A;  4CDQ A;  2WNE A;  5CZK A;  4KI5 M;  1R09 1;  4XJZ A;  5FMO L;  1OMI A;  3LIG A;  2OA2 A;  5IVB A;  3AYD A;  1NCQ A;  3EO6 A;  3TN9 1;  1RJ7 A;  4IUG A;  4Y20 B;  1U5X A;  2WT0 A;  3DYM A;  2FCV A;  3KT4 A;  4AI0 A;  3EMR A;  5DAB A;  3ZXF A;  5F7U A;  3WQ1 A;  3N9N A;  4A7Y A;  1AHS A;  1MS9 A;  4QXC A;  4FFF A;  3WF1 A;  1CIY A;  2XOM A;  1R1A 2;  2Y34 A;  3JCI A;  1HRI 2;  1BVV A;  1RUF 2;  1Z7S 3;  3AP5 A;  5I0D A;  1V0A A;  1B09 A;  1F4H A;  1NAE A;  2G19 A;  5J7M A;  4YVW B;  1YEW A;  2RS3 2;  1H6X A;  2FDI A;  2JD9 A;  3AZX A;  3UES A;  4QPG C;  1C5I A;  1W6M B;  4YW2 A;  3RNS A;  4ES8 A;  1CAX B;  4FVV A;  5A7W A;  1PZ7 A;  1SFY A;  2WNU C;  5FPL A;  5F6K A;  1GLH A;  5IHR A;  3AC0 A;  3ZFF B;  4G4F A;  3BIE A;  3VKN A;  2HKX A;  2LM3 A;  1TNR A;  4RQP A;  3QCW A;  1OLM E;  5CKQ A;  2QQW A;  1E5R A;  3WOG A;  1WW7 A;  3FHI B;  5FRE A;  4I3P A;  3RJR A;  4NRM A;  3UJQ A;  2WA4 A;  5FFO C;  2XKO A;  4LJH A;  5FY8 A;  1BBT 2;  2XQR A;  5ACA 3;  4B4R A;  1O5L A;  2QQI A;  4P9G A;  2LRP A;  1AR7 3;  4ERO A;  4KWL A;  4IE6 A;  1VLN A;  2Q30 A;  3WNK A;  1NOV A;  2VBB A;  4N9H A;  1EV1 3;  4ET7 A;  1SQ4 A;  1BZW A;  4B7K A;  3ZIW A;  4BIF A;  4YRD A;  1AUY A;  2JWP A;  3I8T A;  4MOA A;  5IK7 A;  1NX9 A;  2XJQ A;  3BKZ A;  1JH5 A;  4RR3 A;  4XAC A;  3U11 A;  2JDM A;  4IV1 A;  1N1S A;  1OPM A;  1DIW A;  1UU6 A;  3PU8 A;  2YZ4 A;  5IYY A;  2QJV A;  4W50 A;  3RZZ A;  5BNP A;  4QB2 A;  4YM3 A;  5GZF A;  2BOI A;  2ZS6 B;  3EB7 A;  3J8F 2;  4FFI A;  4RYD A;  4CCK A;  3KHC A;  2X53 S;  5FZI A;  5EP9 A;  4HET A;  3ZDS A;  5JCT A;  5CIS A;  2AEN A;  3H1M A;  4L99 A;  3POW A;  1BMV 1;  2YUE A;  3RZJ A;  4QGM A;  3FMG A;  2P2K A;  3OSD A;  4YVS A;  2AR6 A;  3ZXG A;  3OPT A;  3IPV A;  3U07 A;  5FYT A;  2ZXQ A;  4IEU A;  2WZP P;  1O6U A;  1FOD 3;  1QDC A;  1QU0 A;  1YFU A;  2BU9 A;  5H9P A;  3UV9 A;  1BK0 A;  2O14 A;  5A3T A;  3HOB A;  3LQC A;  2VAU A;  4DRR A;  5FO8 B;  2R0H A;  3M70 A;  3N9L A;  5J96 B;  2CV6 A;  4XET A;  3USU B;  3SEE A;  2EXK A;  5C4W A;  1UWW A;  1RUH 1;  3IAP A;  3TWI A;  3VDD A;  5B2G B;  1UIK A;  3DPR B;  3AX4 A;  4QKN A;  4BHP A;  3FC0 A;  1H0B A;  5FYS A;  4BXS V;  3LKJ A;  2UY9 A;  3MPB A;  4GB3 2;  1AR6 3;  1K12 A;  5FZ9 A;  3UYJ A;  2RS5 1;  1WZX A;  4CPB A;  3VBR C;  4QXK A;  1L7R A;  5A7S A;  1YQ2 A;  3P5B A;  5CKM A;  4LO7 A;  3RYP A;  1RUE 1;  4ZZ8 A;  3ZN4 A;  1JHJ A;  4UFH A;  1NE4 A;  2WL1 A;  1CR7 A;  2GN3 A;  3AMQ A;  1ULO A;  3MIG A;  4FBF A;  4D94 A;  3N7L A;  1JMU B;  2RMU 2;  3W5M A;  4HSL A;  1PO1 3;  1W9W A;  1W39 A;  5LAS A;  5A3W A;  4NOT A;  1POV 0;  1UY3 A;  1YQ8 A;  4GD4 A;  4I01 A;  4N9I A;  2XML A;  3AXD A;  3WCR A;  5KWR A;  1H1A A;  2WS9 3;  3BGA A;  3KSC A;  4CEY A;  3VD4 A;  2AEY A;  5E6H A;  4OI1 A;  3WP4 A;  1QNW A;  2VZU A;  2WZR 1;  1SLC A;  4YVW C;  5FOB B;  3PTY A;  2ZBJ A;  2MHF A;  2PTM A;  3UKV A;  1PZ8 A;  1AYM 2;  4N8M A;  5A6Y A;  1O4T A;  1OI6 A;  1REF A;  3WF3 A;  5CIR A;  1DLL A;  3AKQ A;  1TEI A;  1LEC A;  4AVT A;  4QDR A;  2BVV A;  3ZFF C;  4RFT 0;  2DUO A;  3HJR A;  3FE5 A;  1PGW 2;  3AP9 A;  2GME A;  1F31 A;  5F5I A;  4BH9 A;  5GZC A;  5I0S A;  4QB1 A;  2W9X A;  2GAL A;  3OBR A;  3GJB A;  3NMB A;  4D7T A;  3ZYF A;  2XPJ A;  1JTZ X;  2VMD A;  3PJY A;  3ASI A;  3CJI B;  4NWV A;  4BK4 A;  1R1Z A;  2VR4 A;  2ZGL A;  5JLV A;  4HPK A;  2VVE A;  2XBO 1;  1VBD 1;  3AP7 A;  1P8J A;  3ZFG B;  2QNK A;  1W8H A;  1ND3 B;  1RUI 2;  3MIF A;  2JDY A;  1QH6 A;  3N9M A;  3T1L A;  5FR3 A;  1HB2 A;  2DUP A;  2Y6J A;  4OHX A;  1OA4 A;  4PDW B;  2UY8 A;  3H7Y A;  1J58 A;  2P6H A;  3KWV A;  1TNF A;  3UT0 A;  2LUW A;  4UFJ A;  2BNO A;  2DU0 A;  5FV3 A;  3E5Q A;  4IGQ A;  2RS1 3;  1FPN 2;  1AL2 2;  4Y5S A;  4AE2 A;  4BMB A;  1GUI A;  1UZW A;  1JUI A;  1V6I A;  1WWY A;  1MZF A;  1LED A;  1VBB 3;  1DF0 A;  2Y6F A;  4LOS A;  4XVH A;  4MG2 A;  2YHJ A;  5T5O A;  1HV0 A;  1VAL A;  2WFF 1;  2VUJ A;  1YUD A;  4AYU A;  1HX6 A;  1VBC 3;  4D7Y A;  3ORJ A;  4W6W A;  4GH4 A;  2I45 A;  5D21 A;  2YC2 A;  3LPF A;  3VBO B;  4E4Z A;  1PO2 2;  4RS5 A;  5FZG A;  1LHW A;  4PLM A;  3DEC A;  3U37 A;  4PF1 A;  3KMH A;  1US2 A;  2MEV 1;  1AR9 1;  1PMI A;  5FYV A;  5T54 A;  2B4K A;  3THP A;  5L19 A;  2A71 A;  4CU8 A;  1VAK A;  3DXU A;  1W2O A;  2ARB A;  5C7G A;  1LOE A;  4KQ7 A;  2HYK A;  5DZG A;  1WD3 A;  4OHY A;  1KGY A;  3HMY A;  5FY0 A;  5FZK A;  1NY7 2;  1WD4 A;  3HNB M;  4HON A;  3KT7 A;  5EXO A;  4QDQ A;  1CZV A;  3M3Q A;  2BER A;  3OBT A;  1LHN A;  5A3N A;  1B35 A;  1BEV 3;  1WW5 A;  3OBA A;  1G9C A;  1OF4 A;  2CDP A;  3ZM8 A;  1GQG A;  2HWF 1;  1UZZ A;  2DV9 A;  1DP0 A;  1W3X A;  1H2M A;  1W2T A;  2EAL A;  3AM2 A;  1ZA4 A;  3AXE A;  4Q4V 2;  3P3P A;  3DPR C;  4OUS A;  4WVW A;  1TMF 2;  4FXK B;  4JRL A;  1PVX A;  2C6S A;  4CXY A;  5B4X A;  4NRO A;  2ZHK A;  3OB8 A;  3SKV A;  1JS9 A;  2A3W A;  1UMI A;  3NW4 A;  3VN4 A;  5JPM B;  4C8D A;  1NCR A;  3S57 A;  3RQ0 A;  5JPN B;  3BAL A;  3J4U H;  3JBG 2;  4RHV 2;  1QEX A;  4NRQ A;  4OI2 A;  5JI7 A;  2D3P A;  3VDA A;  1UL9 A;  1POV 1;  2VH9 A;  4QPI A;  4NPR A;  2JIJ A;  5GM0 A;  3UGH A;  3VBS B;  3VBF C;  5F3C A;  1QJU 1;  4XF3 A;  3JZV A;  5HXM A;  1V9U 2;  1UZY A;  5CFD A;  4YSF A;  4K6B A;  4MHR A;  4LBL A;  1IS3 A;  5BXX A;  1VE0 A;  2B5H A;  2K2S A;  5SV8 A;  4AXO A;  3NST A;  3ZSE A;  1R08 1;  2W1Q A;  3GZU C;  1L3J A;  1QJX 2;  1VR3 A;  4GKX A;  3KVB A;  5DUW A;  4O61 A;  1DYK A;  4CYD A;  4XDQ A;  5DDJ 3;  1W9T A;  2IVJ A;  4B29 A;  4PJY A;  2VMI A;  3NJX A;  4QX8 A;  5D8A B;  3BIW E;  1UYZ A;  3WW2 A;  2P17 A;  1AYN 1;  3KCC A;  2A6X A;  2W92 A;  4N7U A;  5FUI A;  1R09 2;  5LA9 A;  1WKY A;  1ZM1 A;  5FZM A;  4YM1 A;  4DUV A;  5FZB A;  1KRI A;  4CP9 A;  1ZYB A;  1NXM A;  2VNO A;  1GP5 A;  1G9D A;  2Y8K A;  3GHN A;  2D93 A;  1W8N A;  4IE7 A;  1KJL A;  1GOF A;  1XU1 A;  2BNN A;  2JX9 A;  3ZKY A;  5IK4 A;  3RZL A;  3NKG A;  1WCQ A;  1K5M B;  3MIB A;  4PIZ A;  3VKF C;  1LB2 A;  4RGK A;  4XMA A;  4JC1 A;  4YW3 A;  3T2Q A;  4LA3 A;  5JXI A;  3AK0 A;  2CDO A;  2D6O X;  3B00 A;  2VU9 A;  4AVB A;  3VDB A;  4CDU B;  1VJ2 A;  4XPV A;  3KV5 A;  2VGD A;  1URX A;  5F1R A;  4IE5 A;  4N53 A;  2JG8 A;  1MS0 A;  1Z78 A;  2CGP A;  3CJI C;  5LBB A;  2DF7 A;  3S30 A;  2YB7 A;  4QKB A;  3IMN A;  3JD7 3;  1XB9 A;  4AVV A;  2Q8D A;  3IB3 A;  1QQP 1;  3ZFG C;  4CDQ B;  3I3M A;  1ND3 C;  4C0H A;  4N90 A;  1VAM A;  3M4F A;  3ZXA C;  1ZZ7 A;  4KL1 A;  4Y1Y A;  4AQ2 A;  4DB5 A;  1BLZ A;  4PDW C;  2BGO A;  2GU9 A;  1CVN A;  4LT5 A;  1UOB A;  4YM2 A;  1W6N A;  2WWU A;  3NNF A;  4JGZ A;  4BJ0 A;  4QXH A;  1ODN A;  1X50 A;  1O3R A;  4DO0 A;  1GFF 2;  5FP4 A;  4BLJ A;  1GZ9 A;  2YC4 A;  3OCP A;  1O91 A;  2HEW F;  1HRI 3;  1Z0H A;  2BUK A;  2IXL A;  2Q8O A;  4J6G A;  4JHT A;  4E2Q A;  2XR4 A;  1FAT A;  1QMJ A;  2RS3 3;  1G9A A;  1CZS A;  1RXF A;  4LKD A;  4UF0 B;  3LOB A;  5FXZ A;  4LHL A;  1M06 G;  3VBO C;  1DDL A;  4W6Y A;  4WM7 A;  2J22 A;  4I0W B;  3SLI A;  2AZ5 A;  4BQY A;  1W3V A;  2CNA A;  3FFZ A;  3ZR5 A;  2E51 A;  3MIC A;  3CNA A;  3R4U A;  2XUM A;  4KBB A;  1DGW X;  4PIX A;  4EN7 B;  1JYV A;  2GC1 A;  3VUO A;  4CU6 A;  4S2D A;  5LEK A;  3CMG A;  3H8O A;  4FQZ A;  4Y1X A;  2W1W A;  2R0F A;  4UXA A;  1UU4 A;  3WW4 A;  2Y6G A;  2WZE A;  1RUC 1;  1MZ5 A;  2Q8E A;  4EZ4 A;  3BU0 A;  4LBJ A;  3OEB A;  2VNV A;  1KIT A;  1UN1 A;  1AXZ A;  1X8E A;  5IW0 A;  5FZ6 A;  1BBT 3;  4OZX A;  2DVB A;  1HLC A;  1H30 A;  2LAL A;  2RJ2 A;  4IES A;  5EJ3 A;  4YW4 A;  2PLV 3;  2EF6 A;  3RWK X;  1BMV 2;  5C71 A;  1UOJ A;  1RUN A;  2JEN A;  1AX1 A;  1OUS A;  1T6G C;  3NKT A;  4AQT A;  1LGB A;  4DOU A;  5FP9 A;  1BJQ A;  4OLL A;  4XJA A;  3KB5 A;  4MGZ E;  2EIE A;  1H8V A;  2RR1 1;  3ILF A;  4RD7 A;  2RV9 A;  2ZZQ A;  4RR3 B;  5FZ3 A;  3V56 A;  1D0G A;  1MEC 3;  4XDP A;  3WDV A;  4IV1 B;  4B4Q A;  4LKS A;  4M0N A;  1EV1 2;  5D1I A;  2W3J A;  1ASJ 1;  5FPA A;  5BNP B;  5K8S A;  3VBS C;  3NV3 A;  3O5S A;  2ZAA A;  4QHZ A;  3J8F 3;  1J3P A;  4UFL A;  3VZN A;  5AC9 3;  1PX3 A;  4AGR A;  4E2S A;  1TVG A;  4NAO A;  1JN2 P;  3T4H B;  2SLI A;  2AGS A;  4MVT A;  2LTN A;  3VLB B;  4AEK A;  2RS5 2;  5IK5 A;  3WNO A;  4LBO A;  4XBN A;  3JQW A;  4L92 A;  4Y5T A;  4AEJ A;  1LKN A;  5D8A C;  1IPK A;  1RUE 2;  3I3Q A;  4WZF A;  5C6C A;  3Q8B A;  1O3T A;  3CLP A;  4Z8B A;  5T52 A;  4NIG A;  3WDW A;  2J1R A;  4DUX A;  3HBZ A;  4PT6 A;  2FZ2 A;  4KWK A;  3J7H A;  2OYZ A;  3WF0 A;  4YG6 A;  5C4W B;  4ITC A;  3HQU A;  2XJU A;  4FPG A;  5CNA A;  1K5M C;  2W94 A;  4XUQ A;  2WNV C;  3ZSJ A;  5FMC A;  1FOD 2;  3Q9O A;  3WVJ A;  1MZE A;  3PUQ A;  4N43 A;  1OQE A;  2XJS A;  1UXZ A;  1TZO A;  4K9S A;  1GZW B;  4K8R B;  2Q1M A;  4MGQ A;  4KG0 A;  4QAW A;  5DAW A;  4QX3 A;  1ZZ8 A;  5HCB A;  5IWF A;  4CDU C;  4GB3 3;  5FYZ A;  4DRV A;  5DAV A;  3H42 B;  1X8M A;  1VB4 A;  4F83 A;  5AC9 1;  1GP6 A;  1UMH A;  4P9L A;  2V5Y A;  4WM8 A;  3KF5 A;  1GOG A;  2PHD A;  4CDQ C;  3BI3 A;  5L7O B;  2XVG A;  3WHU A;  3AFK A;  2O8Q A;  4OCT A;  2HEY F;  2OW4 A;  1FYU A;  5FZL A;  1O3Q A;  1F2N A;  5D2A A;  2C9K A;  3FLP A;  3OG2 A;  4Q4X 3;  2P34 A;  4ISR A;  4MUV A;  5ERL A;  2VCA A;  4IE4 A;  3BTY A;  1SPP A;  3GF6 A;  3QBQ A;  2QQO A;  2R16 A;  5ANN A;  2RMU 3;  3ZLI A;  4MSV A;  2VO5 A;  3T3Y A;  1OQ1 A;  5A1F A;  5FZ1 A;  3JB8 A;  4DEV A;  3NNG A;  4FOQ A;  3T09 A;  4DUW A;  1ULG A;  2W1U A;  3IDC B;  1VBD 2;  1E5S A;  4XFC A;  4CEY B;  5K9Y A;  4XXA A;  3UGF A;  1IHM A;  5FIX A;  4V2W A;  2A6Y A;  1RUJ 1;  1QXR A;  5FLI A;  1HB4 A;  1MAC A;  1NXD 1;  1NUK A;  1PO1 2;  1UCX A;  3AJZ A;  3K3O A;  3LEK A;  1UMZ A;  1WLC A;  4NHY A;  4P9I A;  2QQV A;  3MF6 A;  1Q8P A;  4GJZ A;  5GKA C;  3CQO A;  3T0D A;  2FBE A;  3B3Q E;  2G9Z A;  1GQH A;  1IG3 A;  1HB3 A;  1AJK A;  1F35 A;  1X7N A;  3TEY A;  2QQP A;  2UYB A;  1LOF A;  2DWR A;  3LF7 A;  3OUI A;  2WN3 A;  1UF2 C;  1ULP A;  5FAX A;  4P9Y A;  1PMH X;  1BXH A;  4TXW A;  3AMH A;  3W58 A;  1UPI A;  1LTE A;  2VBP A;  3ECQ A;  3RMX A;  1Q3E A;  5FPX A;  3ZFE A;  3WXP A;  3WUD A;  4HPK B;  3WUC A;  2ATF A;  4N7I A;  3DYO A;  5EYX A;  2HH9 A;  2MEV 2;  1DLC A;  1Q5O A;  1G6N A;  2DUR A;  3OOX A;  4NPL A;  4URA A;  1XU2 A;  5A7Q A;  2D3S A;  4WVZ A;  1RUI 3;  2GC0 A;  1MS4 A;  4Y1Z A;  4Y3O A;  3I2K A;  4AWD A;  2C5D A;  3U0Z A;  4EN9 B;  1AJO A;  1SFN A;  1WA4 A;  2W0X A;  3AJY A;  2A75 A;  2YG0 A;  1JZ3 A;  4RR3 C;  2D43 A;  1EAH 3;  3KGZ A;  4IV1 C;  3AYA A;  1FPN 3;  1AL2 3;  2E63 A;  3D0S A;  3UJO A;  2DUQ A;  2XJV A;  4B1L A;  3AP4 A;  2DVD A;  5A6Q A;  2HWF 2;  5BNP C;  4Z07 A;  3A7Q A;  3MPP G;  3WNL A;  3SC7 X;  3I7D A;  2B46 X;  4XF1 A;  1D4V B;  5FY9 A;  4Q0S A;  1UYY A;  3O0V A;  2B42 B;  3K4Z A;  1QY4 A;  4GH4 B;  2VM9 A;  1PIV 1;  4UW3 A;  5FTT C;  4Q8K A;  1IZ3 A;  1PO2 3;  2Z5W A;  3F95 A;  4LEJ A;  1EPZ A;  1VBB 2;  2VXJ A;  4YW7 A;  2X05 A;  2IXK A;  1ULF A;  3RZH A;  1JOD A;  5FY5 A;  4I0A A;  1HDK A;  3S6P A;  5BNQ A;  3K75 B;  1VBC 2;  3D0J A;  3DL3 A;  3R0R A;  1S0D A;  4COY A;  3APB A;  1QJU 2;  3AL5 A;  3D5O A;  1W99 A;  1BCX A;  1O3S A;  1B35 B;  2P4E A;  3O14 A;  5FMB A;  1VIW B;  3MBW A;  2GAU A;  5C4W C;  1FX5 A;  4GWJ A;  3D4K A;  2OS2 A;  2VG9 A;  5C9A B;  3SIS A;  4SLI A;  1PNG A;  1VBE 1;  2UWC A;  3LEM A;  3Q8A A;  4P08 A;  4E27 A;  4MV2 A;  1OQD A;  2DU1 A;  2KXL A;  4UOJ A;  2NN8 A;  4YW5 A;  1KD7 A;  1W9S A;  1AYN 2;  1H8T A;  3C8X A;  3WP6 A;  4QQP A;  4CP0 A;  1XSR A;  4FXG B;  4HLT A;  4Q4W 1;  2EXJ A;  4XAE A;  5J36 A;  4RHV 3;  1HRV 1;  1VRH 3;  3B7M A;  4Y24 A;  3I59 A;  3VBH B;  3THC A;  4IEW A;  1RVF 1;  2ZTN A;  4QPI B;  4TLG A;  1BK1 A;  4FP2 A;  5L7O C;  2P3K A;  1QNY A;  4XFG A;  4CE8 A;  4XF9 A;  2VTF A;  5H9S A;  3WNX A;  4Q4Y 1;  5CFD B;  1V9U 3;  2RE9 A;  4FO9 A;  3LPG A;  2GC3 A;  5DZE A;  4NVP A;  3H8U A;  5C8W A;  1DCS A;  3FUQ A;  3EQE A;  4PBP A;  4TTG A;  1CAW A;  4FT8 A;  4AR2 A;  1RIT A;  1AR8 1;  1G8W A;  3RGB A;  3IN9 A;  2XL9 A;  4I0B A;  4AFB A;  2HBU A;  3QD6 A;  5A1L A;  5I91 A;  1QJY 3;  2WC2 A;  2OKX A;  2XJP A;  3OJB A;  1UY1 A;  5SV5 A;  4CEY C;  2E33 A;  1C8M 3;  2XWB B;  4H55 A;  4ARX A;  4BME A;  1J84 A;  1QQP 2;  3MHZ A;  2OUH A;  3HD8 B;  4QDS A;  4CP2 A;  4JQT A;  2XL7 A;  2TEP A;  1R09 3;  1XNK A;  3ZVX A;  1GWL A;  1XYO A;  4UYB A;  5EV7 A;  2TUN A;  4BA6 A;  2HYX A;  3TN9 3;  2PHL A;  5DZF A;  3K51 A;  5C3S A;  1OKQ A;  5DDJ 2;  4ASM B;  1H9P A;  1G7Y A;  5A3U A;  4CCC A;  1A78 A;  5FYM A;  1RHI 1;  4NHK A;  3K46 A;  1AL0 G;  2GP5 A;  4DY3 A;  2OPW A;  1OXC A;  1BKZ A;  1F5F A;  4Y5Z 0;  2ZHL A;  5ABJ A;  1I5Z A;  2WAA A;  3LFM A;  4JKK A;  3V0B A;  3NWK A;  2JG8 B;  3WG1 A;  5HCF A;  2IXJ A;  3ZXE A;  4EWA A;  4R52 A;  1L7Q A;  4R8H A;  3MLK A;  1SLB A;  4JDN A;  3TB0 A;  2XHK A;  2ZHM A;  5I8S A;  4E4S A;  2P3J A;  3U4X A;  1JU3 A;  4YNI A;  1RUG 1;  3S7I A;  2BV4 A;  2DYC A;  3N7J A;  2C24 A;  2AAC A;  4WBB A;  5JZG B;  4CUB A;  4HKO A;  3GJA A;  1LOA A;  1RJ8 A;  4TZD A;  3JD7 2;  2A6V A;  2J1U A;  2J1V A;  2W39 A;  2WRA A;  3SIT A;  3JB4 C;  2XH6 A;  2B39 A;  4YGD A;  2PAK A;  4AI9 A;  1DQ0 A;  2CL2 A;  2A70 A;  2R32 A;  3THD A;  3CDZ B;  2HWD 1;  4LHN A;  2JE7 A;  3WF4 A;  4AW7 A;  1OUX A;  3O1U A;  1M4W A;  4GH4 C;  2PXJ A;  1J83 A;  1W90 A;  4HFS A;  1YXW A;  5FJK A;  3BYW A;  1C1F A;  2K0G A;  2RR1 2;  1UIJ A;  2VQ0 A;  1OD3 A;  4XCA A;  4M4P A;  4B1M A;  4XEZ A;  1US3 A;  3ZR6 A;  4KU7 A;  2JXA A;  5IVV A;  5FYY A;  3KLS A;  1W8W A;  5E88 A;  3RSJ A;  2OVU A;  2QQK A;  4HK8 A;  2G9G A;  1CQ9 A;  3H3U A;  2OX0 A;  1ASJ 2;  3N7K A;  1CON A;  4ZS3 A;  4TWT A;  4EWE A;  4LLF A;  3VZL A;  3W5N A;  1W6Q A;  2RM2 1;  2AC1 A;  1VPH A;  1ALY A;  1OF3 A;  4CEW A;  1DFQ A;  2VME A;  5JR7 B;  3F2Z A;  2JJ6 A;  2OT7 A;  1F5J A;  2BEO A;  1CAU A;  1MS8 A;  1YFX A;  3I2J A;  4EN8 B;  1B35 C;  3PTR B;  4F3J A;  4Q0P A;  4FAH A;  2HWE 1;  3BPZ A;  5FPU A;  3N4M A;  2WLP A;  3IBM A;  4LUL A;  4QX2 A;  1QJF A;  5C9A C;  4HT1 T;  2WKK A;  3WR0 A;  3GYD A;  2J1T A;  1LOC A;  1J1L A;  5FZE A;  2R06 1;  1W8U A;  5A6X A;  4L97 A;  2QFE A;  3M1H A;  1DG6 A;  1W05 A;  2D3R A;  4BQ5 A;  3LE0 A;  1NCR C;  2J1E A;  4JHZ A;  3MO4 A;  5IAX A;  3GGL A;  3MZH A;  2PLV 2;  4COU A;  1LEN A;  1S2E A;  3HR9 A;  3VBH C;  2FCU A;  2JG9 A;  3ZXL A;  4FSJ A;  3ME2 A;  2ZCW A;  4IV3 A;  3TEW A;  3P1I A;  4QPI C;  3MYX A;  1Y4W A;  1FT9 A;  1PM4 A;  2QQL A;  1STM A;  1RUH 3;  2ZGK A;  3G6J B;  4NID A;  3LCP A;  2WO2 A;  4LNV A;  2VMF A;  4PF5 A;  4ZU4 A;  5EZW A;  5FZC A;  1ZRE A;  5CFD C;  3TEZ A;  3W9A A;  1FAY A;  3ZYP A;  2ZEY A;  1D4M 1;  4JGY B;  1MEC 2;  3HN1 A;  3W21 A;  3ZYR A;  3JUU A;  2ZX1 A;  5J1X A;  2ZML A;  1ENQ A;  3A21 A;  1SBD A;  2RS5 3;  4BCU A;  4DS0 A;  2NLR A;  3BN6 A;  3VL8 A;  1APN A;  5K7P A;  5FO7 B;  5AC9 2;  4FPY A;  1OLQ A;  2PAM A;  1YHF A;  4A7K A;  1LUL A;  3NNL A;  3ES4 A;  2GZW A;  5C3R A;  1RUE 3;  2JEM A;  2D6K A;  5LBF A;  2XLA A;  1YQC A;  2VQT A;  3SKJ E;  5L9R A;  2UWB A;  3OD4 A;  1RGS A;  5J48 A;  5IFP A;  2CSG A;  3BPS A;  5LA2 A;  3HPN A;  2Q1F A;  5E16 A;  4MET A;  4W65 A;  5A33 A;  1SLI A;  1D2Q A;  3MFA A;  5DG2 A;  3EBR A;  1DBN A;  5KXB A;  3NJV A;  3DN7 A;  1LJ7 A;  2FDG A;  1RUJ 2;  2WZR 3;  3WP3 A;  1AZD A;  1SZB A;  3I2G A;  4V1P A;  1NLR A;  4H2A A;  2JG8 C;  3ES1 A;  1DU3 D;  5TSW A;  4ES9 A;  3CHX A;  2B9V A;  4YZ4 A;  5LWB A;  3E6D A;  1DGR A;  4EE2 A;  1UOG A;  3O1R A;  3MW2 A;  2LRO A;  1ODM A;  2A6W A;  2DCY A;  4Q8L A;  1PGL 1;  2PFW A;  1JXN A;  3PDQ A;  4P9J A;  3H0O A;  4QGN A;  3OUJ A;  4XW3 A;  4C91 A;  5JZG C;  2Y26 A;  5DQ0 A;  1YO8 A;  1CAV A;  2O0O A;  2ZEW A;  3N9O A;  2XJT A;  3PU3 A;  4JGZ C;  5FP7 A;  4AI1 A;  4BDV B;  4FTS A;  1ENR A;  3III A;  2CYF A;  3NAP B;  4R4Z A;  4XUN A;  1UKG A;  3B9I A;  5T55 A;  3AMN A;  1Y7B A;  3VBF B;  5K0U B;  1H1M A;  1LGN A;  3N7M A;  3PHM A;  4Q4X 2;  1GOH A;  2XBO 3;  1VBD 3;  1N3P A;  2ES3 A;  1IGO A;  4XZP A;  5FZD A;  4AL9 A;  1RIR A;  3B9C A;  2XVK A;  4I30 A;  2ZMK A;  5C33 A;  5FQ0 A;  2WUH A;  3BOW A;  4WM7 C;  1VBA 1;  3JQX A;  1K3I A;  3POS A;  2YU1 A;  5JVV A;  4D69 A;  2Z2S B;  4QT6 A;  3O1O A;  1YFW A;  2P6C A;  4R9B A;  5LK5 A;  1NLQ A;  1UOF A;  3DGT A;  4QGL A;  3T30 A;  2VCB A;  4A4A A;  4O65 A;  3AYE A;  3CKH A;  1UYP A;  1UX7 A;  4QU1 A;  1JBC A;  2WFF 3;  1KDM A;  3IMM A;  4UW4 A;  3QAC A;  3C2U A;  1QF3 A;  2TNF A;  3WT3 A;  2OPK A;  4S2G A;  1PZ9 A;  1PVC 1;  1A8M A;  1WME A;  1MQT A;  4QKD A;  1LOB A;  1PIV 2;  2YFU A;  4P9X A;  2BOJ A;  4QM8 A;  3ZFE B;  5LBE A;  5KXC A;  2BFU S;  3RFR A;  4HOO A;  4YM0 A;  4QM9 A;  4CRQ A;  3OBZ A;  2LS6 A;  2MEV 3;  1AR9 3;  3TEX A;  1BVP 1;  4XUR A;  2WDB A;  5FYI A;  3KVA A;  1GZT A;  2PQQ A;  2D6P A;  2C0Z A;  1OLR A;  4XUP A;  4JTO A;  2JDA A;  1GV9 A;  1PK6 A;  5F3I A;  3NO8 A;  5FP8 A;  2WSV A;  4OHW A;  2VUL A;  4D8M A;  1PMJ X;  4Y26 A;  1ZBE 1;  1CX4 A;  2HWF 3;  4ISQ A;  3ZXK A;  3B69 A;  1LEM A;  1IS5 A;  1VBE 2;  4KG8 A;  3KF3 A;  4AFD A;  3N9P A;  1I5P A;  2WFP A;  4NN0 A;  4UFK A;  1OFS A;  2ERF A;  4XJU A;  4JGY C;  1EAH 2;  1QIQ A;  3O0W A;  1Q56 A;  1OOP A;  4XFA A;  2O8O A;  5FLH A;  5LY1 A;  3OGJ A;  4JDM A;  1HW5 A;  2A73 B;  1JW6 A;  2FDJ A;  1QGL A;  1ZZB A;  1GIC A;  2H0B A;  3E5U A;  3PVO A;  3SXW A;  4GMP 0;  1POV 3;  1RVF 2;  2W08 A;  4F8A A;  4XC9 A;  3PUR A;  3IAQ A;  2Y6K A;  3M3I A;  1S0F A;  3AKP A;  4L0P A;  4P02 B;  4FOW A;  5HV0 A;  1QJU 3;  3C7H A;  4CDW A;  1N1V A;  4LIV A;  5F5C A;  1LOG A;  5FYU A;  3VZK A;  1JOP A;  1S0B A;  1LHO A;  3WHT A;  1GWM A;  2VUD A;  5F9T A;  1R08 3;  2VVF A;  1OFN A;  2VZO A;  1W9Y A;  3KCY A;  4LTA A;  5HCH A;  1AXK A;  2GNT A;  5JWP A;  4QQO A;  1DQ2 A;  2G1M A;  2XWJ B;  4CCO A;  3ACG A;  4QB6 A;  5LRR A;  2OQ6 A;  1AYN 3;  1Y9M A;  2R49 A;  4H14 A;  4K1Y A;  3RYK A;  4LR4 A;  1N47 A;  4I3G A;  1FNY A;  5FO9 B;  1TME 1;  3VZO A;  3WNM A;  1NLS A;  2KD7 A;  2JKB A;  1ZRC A;  3I59 B;  4IEV A;  4LBK A;  3BB6 A;  3S5A A;  1V00 A;  3CL1 A;  1FMD 1;  2FMY A;  3IDB B;  3LA2 A;  3NL1 A;  4JQR A;  4KWU A;  4FTE A;  1XNC A;  5T3N A;  1DZT A;  2V72 A;  4C90 A;  1RHI 2;  1SDD B;  1YWK A;  3V64 A;  2IFR A;  3H3Z A;  5DAX A;  3J26 N;  3M2M A;  2WAB A;  5FMD A;  4X6R B;  3GZA A;  1VRH 2;  3MF9 A;  4K1Z A;  4QPG A;  4Q0Q A;  4UW5 A;  1QXP A;  4QPW A;  3W20 A;  1HXS 1;  5DUU A;  4BM8 A;  3NAP C;  1W03 A;  3GBW A;  2RDS A;  2WQZ C;  2WNU A;  3HNY M;  3AVS A;  1OLM A;  2JB4 A;  4I02 A;  4AVC A;  5FYC A;  5K0U C;  2PHX A;  3KV9 A;  1Q8Q A;  2R6Q A;  3BOP A;  4K20 A;  4UAP A;  3T0B A;  2R7E B;  4GIQ A;  4EN6 B;  1XC6 A;  1QQP 3;  5IVF A;  2BPA 2;  1RUG 2;  4L9B A;  1VRB A;  2E31 A;  3AZW A;  2ZGT A;  2W47 A;  2E9Q A;  2JD4 A;  3I97 A;  3R05 A;  1ZZ9 A;  4FP3 A;  4P9W A;  4A41 A;  1QJY 2;  3ST7 A;  3O1S A;  3WQ0 A;  4EWD A;  5H9R A;  5I0R A;  1C8M 2;  4CU7 A;  4IXL A;  1AF9 A;  5A7P A;  1LOF C;  2JDH A;  3IDE A;  4HAN A;  1HN0 A;  5M0T A;  5CG9 A;  4XCB A;  3FN9 A;  2NYY A;  3T2O A;  1O8P A;  4DIQ A;  5B4N A;  3C7G A;  2HWD 2;  1XE8 A;  3AZV A;  4OHZ A;  3EXU A;  2EXH A;  3TN9 2;  2PHT A;  2YRO A;  3WW3 A;  1W0O A;  3ZYJ B;  4DY5 A;  4YW6 A;  2I2S A;  4NII A;  1OH4 A;  1H2K A;  5FZO B;  1SBF A;  3HEI A;  3ZFE C;  5JMC A;  2BDR A;  2PHR A;  3AZY A;  3TOJ A;  2WNV B;  3M3E A;  4GQ7 A;  4BQ1 A;  5DUV A;  1O8S A;  3VD9 A;  4MAD A;  2WQ8 A;  5IVC A;  2YBK A;  3P3N A;  5EPA A;  1R64 A;  4WVM A;  5L36 A;  2DCK A;  1HJG A;  4G9S B;  4C1X A;  4QQL A;  5JOY A;  1RUC 3;  3V0A B;  1UAI A;  4UW6 A;  3MUZ 1;  4PQQ A;  4DMI A;  4FTB A;  5CAZ A;  1N1T A;  2HLE A;  4KGQ A;  4XTM A;  4UI9 L;  2AYH A;  4Q2F A;  2A3Y A;  2ZPX A;  2Y0I A;  4F7Z A;  3T1M A;  2ARE A;  4E9K A;  4GMP 1;  2VOT A;  1NCQ B;  2F17 A;  4Y22 A;  1OD5 A;  3A22 A;  4LBQ D;  1ZNP A;  3CBN A;  4AHY A;  2ETE A;  2E6V A;  4OZO A;  1W0P A;  3OYW A;  2GND A;  2X09 A;  2V5D A;  5HCA A;  4ZXE A;  2RR1 3;  3BVC A;  1XQN A;  3RMY A;  2ZAC A;  1ENX A;  1IKQ A;  2CWM A;  4CDX A;  3AP6 A;  2DDU A;  5KHK A;  3USS A;  3WSO A;  3E5X A;  1ASJ 3;  2D5H A;  2KR2 A;  5FYB A;  1IS6 A;  4DPN A;  3NNM A;  1W6Q B;  1DQ4 A;  4AK3 A;  1OT5 A;  4CEW B;  3OD0 A;  4OMC A;  2E7T A;  5A7W B;  3C7F A;  1XJA A;  1DQ5 A;  5A3O A;  1D4M 2;  4UBH A;  4Z2W A;  3TNP B;  3CF6 E;  3D82 A;  4BWO A;  2GSY A;  4ZY9 A;  3D3A A;  1UXX X;  2OII A;  2VOK A;  4P00 B;  4RQP B;  4DZG A;  1X9P A;  1YRZ A;  4ZON A;  5FXW A;  3DCQ A;  2WR9 A;  1J3R A;  1NQD A;  3QLQ A;  3WG3 A;  2VNR A;  1EPW A;  1H2N A;  3CO2 A;  4LLO A;  4A6S A;  5C8C A;  4DXS A;  1H8T C;  1RMU 1;  4Y20 A;  2ZAH A;  5J37 A;  1Q8O A;  4KU8 A;  5JIA A;  4D6S A;  2J7M A;  1YC6 1;  1LOD A;  1ZBA 1;  5FY4 A;  1DHK B;  4CZS A;  5JR2 A;  2JG9 B;  3SH4 A;  4HG6 B;  2VY0 A;  3MW3 A;  4IV3 B;  4A3Z A;  5LZ6 A;  5EJ1 B;  4NIH A;  2QVS B;  1KFX L;  2Q1Z B;  1Y9G A;  3RRD A;  2QQJ A;  3LDK A;  3ZIX A;  2BZD A;  3SMH A;  5LAT A;  1JYN A;  4CA9 A;  3IZO A;  3WCS A;  1LES A;  3BTZ A;  3LEG A;  3ROU A;  1LAJ A;  3ABZ A;  4YZ5 A;  4URT A;  2W1S A;  1ULD A;  3GAL A;  3N35 A;  3VD7 A;  1RUH 2;  2OXB A;  4CSW A;  1ZRF A;  3ZFF A;  4BZ4 A;  2RDR A;  3G7D A;  1GWK A;  3VBU A;  4ZKT B;  2HWC 1;  2XUE A;  3FL7 A;  3DF0 A;  4FPH A;  1WCD J;  1YI9 A;  4C1W A;  5C3O A;  1NQJ A;  5AFE A;  4H7L A;  4XDO A;  1S2K A;  4AQS A;  1XND A;  5IVE A;  4Z92 B;  4YVS B;  4LHK A;  1R1A 1;  2OZJ A;  3IPV B;  2ADD A;  2A7A A;  2JDP A;  1RUF 1;  2RVA A;  1TE1 B;  1I3H A;  1SDW A;  1FV3 A;  1V6J A;  2Z79 A;  5GLU A;  2IWG B;  3H8X A;  2R30 A;  3ZO0 B;  3U75 A;  5ABJ C;  1DGL A;  1DQ6 A;  1RUJ 3;  1SHW B;  2VZ3 A;  4HXC A;  4XFH A;  1H2L A;  2FHR A;  3AKR A;  5EJZ B;  2HWB 1;  2Y38 A;  5JSR A;  3VDD B;  5JXH A;  3OGR A;  3OUH A;  3P6B A;  2FDH A;  1MZ6 A;  4LQR A;  3MV0 1;  3R4D B;  3TRS B;  3AZZ A;  4MXV A;  3URF A;  4FAG A;  1X33 A;  2EIG A;  2WZR 2;  2EAK A;  3M3C A;  3HWJ A;  1SAC A;  4AHZ A;  1XE7 A;  1LRH A;  4OFG A;  1S0E A;  3MLJ A;  4HVQ A;  1IG0 A;  2R04 1;  3PLQ A;  1CAV B;  1YQ5 A;  1WUV A;  1RTV A;  1XXN A;  3POF A;  4YG0 A;  4K7J A;  3ZSK A;  4AG4 A;  1L7L A;  3VHO A;  1PVC 2;  4J25 A;  1O59 A;  4AED A;  2BJS A;  1LNS A;  2VQU A;  5E89 A;  2G4I A;  1SLA A;  5IJR A;  2WT1 A;  2GMM A;  2E26 A;  1NCQ C;  1IPJ A;  3LIH A;  4BK5 A;  2ENR A;  3UGG A;  4XJ8 A;  5FZ7 A;  5FQ0 B;  4V2V A;  1JZ5 A;  1GR3 A;  4YGE A;  5EQU A;  3ILN A;  3THT A;  2Q4S A;  1CPM A;  5DAP A;  4XFF A;  3MW4 A;  2WO7 A;  2QKD A;  3AB0 A;  5BNN A;  2A6Z A;  1HQN A;  2XBO 2;  1PX4 A;  4XFB A;  3O0X A;  1K42 A;  1O4Y A;  5BPX A;  1C1L A;  1C8N A;  2ORZ A;  1OKO A;  3E6B A;  3FHQ A;  3R4S A;  4J1W A;  4NAM A;  1ZBE 2;  4Z2A A;  1Y43 B;  3O7O A;  3RDI A;  4XF4 A;  4PI0 A;  1J1T A;  4XQ4 A;  5GZG A;  4MZU A;  2AUY A;  4IEY A;  4CEW C;  1OPO A;  1UD1 A;  4EV0 A;  2CHH A;  4FPK A;  1MQT B;  1PIV 3;  1I6X A;  4Q29 A;  1PGS A;  2ZMN A;  4NRP A;  4BYY A;  4YAR A;  4ZU5 A;  2ZOE B;  2LW8 A;  1FV2 A;  4RQP C;  3OGG A;  2FQP A;  1D2S A;  4JKM A;  4CXW A;  3C7O A;  3H1W A;  2WFF 2;  5A3M A;  3RVH A;  4A3X A;  2FD8 A;  4ZU7 A;  1LU2 A;  1SMV A;  3NVC A;  4U2A A;  1UY2 A;  4MGK E;  3PUS A;  4RN5 A;  1E57 A;  3N3H A;  1UY4 A;  3QOP A;  3C3V A;  1PK6 B;  2NP0 A;  1WBL A;  4GXL A;  3ETP A;  3FWE A;  5AVP A;  2NMN A;  3SCG A;  4MGS A;  4M4R A;  1UKR A;  4QXB A;  1COV 1;  1AR9 2;  2JG9 C;  5GLZ A;  5FY7 A;  2VOV A;  2A3X A;  3FBM A;  4IV3 C;  1KJR A;  1CN1 A;  1OA3 A;  4NPM A;  2DCJ A;  2BVB A;  4BLI A;  1K5J A;  4LXL A;  2IC1 A;  2QZ2 A;  4NO4 A;  4XXP A;  1VBE 3;  4XIO A;  2ZZJ A;  5J98 B;  2WA3 A;  4HMZ A;  1NZI A;  4OVE A;  3LDB A;  4XJ9 A;  1KS5 A;  1OOP B;  2I74 A;  3DKW A;  1JUH A;  1QOT A;  2D7F A;  4I09 A;  4LMF A;  4Y4Y A;  4OUE A;  1TME 2;  4Q4W 3;  2FCT A;  4AF9 A;  3UK9 A;  1HRV 3;  4JAA A;  1QJE A;  4B8E A;  2HEV F;  3ZKU A;  4A6O A;  1DYO A;  1RVF 3;  3C7E A;  2IUW A;  1IQA A;  4RS5 B;  4LOT A;  4CDW B;  1GNH A;  2BGC A;  3LSD A;  4ZXK A;  5I93 A;  5KXE A;  4Q4Y 3;  4A7Z A;  1FI2 A;  5EYY A;  4YVS C;  1YQ6 A;  4BQ2 A;  2YBP A;  4NHX A;  4M00 A;  4LBQ A;  1HXS 2;  1AR8 3;  4U36 A;  5J3U A;  1RUD 1;  3SCF A;  3NV2 A;  1BQP A;  3ZFG A;  1CGP A;  3R6S A;  2B9U A;  5DMY A;  1ENS A;  2QUO A;  3E1F 1;  1CES A;  1T2X A;  2H6C A;  5FPB A;  4PDW A;  4R9D A;  1NA1 A;  3MDP A;  4YZ2 A;  4LUK A;  3LB9 A;  1KQR A;  2BRT A;  1R08 2;  4OI4 A;  3VDD C;  4YFW A;  1UQX A;  4FOV A;  1UYX A;  3GZT B;  2RHP A;  3MGU A;  3ZYG A;  3E6C C;  4FPL A;  4KGG A;  3ZN6 A;  1MVQ A;  3MFC A;  5IVJ A;  3PVB B;  1RHI 3;  4AAX A;  4A2U A;  1NCR B;  4GAZ A;  1XRU A;  4IEZ A;  1S0J A;  4PIY A;  4ZS2 A;  1LHV A;  1X82 A;  5HV4 A;  1XYN A;  5FK8 A;  2R1D A;  4K21 A;  4AEM A;  4COW A;  4WV8 A;  4DIN B;  4E8D A;  4LHS A;  3WDY A;  3IM0 A;  1K45 A;  4DXT A;  3ILR A;  5IUQ A;  5I8T A;  3X29 B;  4EJR A;  1N3Q A;  2ZKN A;  4GKY A;  4R9A A;  2ZX0 A;  3HT1 A;  2OUJ A;  2F6B A;  3WQB A;  4MGT A;  2VJX A;  1IS4 A;  4Q1P A;  1RUG 3;  4K40 A;  1OHF A;  4QQH A;  2EVX A;  5CU1 A;  4XAB A;  1WBF A;  2VZ1 A;  5A80 A;  4CUA A;  3K4A A;  4CU9 A;  4Y1V A;  4P5Y A;  3B94 A;  5LCW L;  5HXV A;  3HT2 A;  2J42 A;  2VUA A;  3FLR A;  1AVB A;  2WWS A;  2DBN A;  3PVE A;  1WCU A;  3CIH A;  5F5A A;  2ILM A;  3ZXJ A;  1CJP A;  4SBV A;  3S7E A;  5IAV A;  2VC9 A;  2Q5T A;  3ETQ A;  2HWD 3;  4CP9 B;  5IVY A;  4NE9 A;  4S2H A;  1S55 A;  3GDB A;  2EIB A;  1ULC A;  1OUR A;  2A1X A;  2IXC A;  3ITQ A;  1MQT C;  2C1F A;  5A3P A;  1BHG A;  2FZ1 A;  5IT6 A;  3MEP A;  3MI8 A;  1V6O A;  3NNJ A;  5EIY B;  2ZX3 A;  1DGR N;  3I3E A;  4JRA A;  4OQ9 A;  1QHD A;  3VHR A;  3VBS A;  4R4X A;  4AFM A;  4WVM B;  1NY7 1;  1JYW A;  2W5F A;  4N53 B;  4OUL A;  2ZGQ A;  3OEA A;  5LB6 A;  4CCL A;  4ZZ5 A;  4HVO A;  4XOG A;  1PK6 C;  5FXX A;  2RM2 3;  3QH7 A;  1ZVF A;  3K4D A;  3H1Y A;  2HBT A;  1WW6 A;  1J3Q A;  4Q26 A;  5EFU A;  2VCM A;  1ZRI A;  3SEP A;  1UX6 A;  4Q4V 1;  2A5Z A;  1TMF 1;  2HWE 3;  1H4H A;  1ZZC A;  4S2F A;  4LO5 B;  3SNM A;  2IZW A;  1VMJ A;  2X5I A;  1ZX5 A;  1RUC 2;  2DFC A;  4LKF A;  4LO6 B;  4P14 A;  4WZC A;  4Y22 B;  4B4P A;  5KR7 A;  2CGO A;  1W06 A;  2WT2 A;  3V65 A;  1W6N B;  2Q0A A;  3OYW B;  2R06 3;  1H1I A;  4JGZ B;  2JDK A;  5IK8 A;  3JBG 1;  1OOP C;  4M3C A;  2EAA A;  5C3P A;  2ET1 A;  2XJR A;  3PL0 A;  4JTN A;  1F8V A;  4CDX B;  3U4S A;  2W2I A;  3FJS A;  4YPJ A;  4YWA A;  1ND2 A;  4QHO A;  1K5M A;  2UUR A;  2BFU L;  2I07 B;  2KM2 A;  3CZJ A;  2WLQ A;  4CP1 A;  1XNA A;  5FZF A;  4RS5 C;  1OH3 A;  4WM7 B;  5A1A A;  4CDW C;  4QD2 A;  1W8F A;  1U5Z A;  3POE A;  1S4C A;  2GMP A;  1QJX 1;  2YGL A;  3B5L B;  2DVA A;  1LR5 A;  1D4M 3;  1V6M A;  3ZPO A;  2EIC A;  5A32 A;  4TN7 A;  5IFT A;  4W4Z A;  2B7Y A;  3GNE A;  2XQX A;  2D6N A;  2YPD A;  4HKL A;  3PUA A;  2CAU A;  4XQD A;  1SG3 A;  1Y9Q A;  4LE3 A;  5LW9 A;  4YGB A;  2HWC 2;  5FUP A;  4D3W A;  5C8C B;  3S0M A;  3KV4 A;  3WDT A;  3L2H A;  4XBL A;  2EA7 A;  2YC0 A;  2XXZ A;  1XNB A;  3KD4 A;  1DYP A;  1W04 A;  4RGG A;  3WV6 A;  5KHH A;  1SBE A;  1X9T A;  5KHJ A;  2D97 A;  4Z82 A;  3A0K A;  5CB7 A;  1LGC A;  1WLD A;  2ZGS A;  4CUC A;  1HIX A;  1PNF A;  4KBZ A;  4QWN A;  3ZYB A;  3L2Y A;  5FKC A;  3PMS A;  1RUO A;  1O5U A;  1MPX A;  2R1B A;  4UF0 A;  1MS3 A;  3BTA A;  4AI8 A;  4IL7 A;  4MXW A;  5BNO A;  1H4G A;  2HWB 2;  3I2D A;  3I3D A;  4Q27 A;  1JYT A;  3MV1 1;  2VNG A;  1HQW A;  3VBU B;  2CTV A;  3UL2 A;  4DXR A;  1CZT A;  4IGO A;  2GH2 A;  5KXD A;  5HI0 A;  4QX0 A;  4AFC A;  2RDQ A;  1AXY A;  5E8A A;  3PUH A;  4JDO A;  2J1S A;  2XB6 C;  4BE3 A;  2R04 2;  5FWJ A;  1WLT A;  4IE0 A;  1GNZ A;  4ATE A;  1RL3 A;  5GLW A;  1XOY A;  5JOZ A;  5EWS A;  2GN7 A;  1IOA A;  1VMF A;  4I2O A;  5KC6 A;  4UFM A;  1EYB A;  3O1P A;  4UT5 A;  3H3L A;  3JU9 A;  2QQN A;  3Q8C A;  5E1R A;  4Y4R A;  5F6L B;  1YI7 A;  5LA0 A;  1F4A A;  5BY5 A;  2WJS A;  1Z7S 1;  3FLT A;  1VBA 3;  5F8P A;  1YLL A; 
#chains in the Genus database with same CATH homology
 5FZM A;  4QXB A;  5FZ0 A;  5FZB A;  5A7N A;  4CCL A;  5FY7 A;  2PXJ A;  5FXX A;  5FJK A;  5FY5 A;  5F5I A;  4D6R A;  3AVS A;  4LXL A;  5FY8 A;  3AL6 A;  5FZD A;  5FYC A;  5IVV A;  3KV9 A;  5FYY A;  2YU1 A;  4CSW A;  5IVF A;  4D6Q A;  3DXT A;  3LDB A;  3AL5 A;  1VRB A;  5FYH A;  4CCN A;  2OX0 A;  5KR7 A;  5FZA A;  2XUE A;  3KV5 A;  5FBJ A;  4ASK A;  3PUQ A;  4CCM A;  2OS2 A;  2OT7 A;  4QU1 A;  5IWF A;  4XDO A;  3PTR B;  2W2I A;  5FYZ A;  3N9M A;  4IGP A;  5A7P A;  3U4S A;  4EYU A;  5IVE A;  2Q8D A;  5FPU A;  4BU2 A;  4DIQ A;  5FP3 A;  2WWJ A;  3NJY A;  3PU8 A;  5FXV A;  4NUB A;  5FV3 A;  4HOO A;  4IGQ A;  5FZF A;  5FZE A;  2YBP A;  4CCK A;  5F32 A;  5A7O A;  5FZL A;  5FZO B;  2WWU A;  5F3E A;  2YU2 A;  5FZI A;  5FYI A;  4QXH A;  3KVA A;  3ZPO A;  2GP3 A;  4TN7 A;  4DO0 A;  5FP4 A;  3K3N A;  5F2W A;  5FUN A;  3ZLI A;  5F2S A;  5IVC A;  2YBK A;  5FPB A;  5A1F A;  2YPD A;  5F3I A;  5FZ1 A;  3OPT A;  5FZG A;  3PUA A;  5FP8 A;  5FYT A;  5FY1 A;  2VD7 A;  5LW9 A;  5FYV A;  5FUP A;  4UF0 B;  3KV4 A;  5FZC A;  5FXZ A;  2Q8C A;  5F37 A;  3DXU A;  4V2W A;  5F39 A;  5A3T A;  5FZO A;  5A1L A;  2XXZ A;  4BIS A;  5FPV A;  2OQ7 A;  5IVJ A;  5FY0 A;  3K3O A;  3N9P A;  3OPW A;  3N9L A;  5FZK A;  4GJZ A;  4GAZ A;  4HON A;  4AAP A;  5CEH A;  4E4H A;  2YBS A;  5LY1 A;  2Q8E A;  4QWN A;  4EZ4 A;  5A3N A;  5LY2 A;  5FYS A;  4UF0 A;  3RVH A;  5IW0 A;  5FZ6 A;  3N9Q A;  5ANQ A;  5FZ7 A;  5FYM A;  3PUR A;  2XDV A;  5FZ9 A;  4V2V A;  3UYJ A;  4CUG A;  2GP5 A;  5A7S A;  4LIV A;  5F5C A;  5FYU A;  4QX7 A;  5IVB A;  5FYB A;  4C8D A;  5A80 A;  5FP9 A;  4CCJ A;  5FWE A;  3KV6 A;  4IGO A;  3LD8 A;  4LIT A;  5F3G A;  5A7W B;  3N9N A;  4LIU A;  5K4L A;  5A7Q A;  4URA A;  4QXC A;  4Y3O A;  5FZ3 A;  5F5A A;  4XDP A;  5F3C A;  5FWJ A;  2P5B A;  5FZ4 A;  3AVR A;  5ISL A;  5LWB A;  4CCO A;  5FXW A;  4EZH A;  5FZH A;  2OQ6 A;  5FPA A;  5IVY A;  5A3W A;  5FZ8 A;  4GD4 A;  4BXF A;  2XML A;  5FJH A;  4GJY A;  3K2O A;  5A3P A;  3U78 A;  5E6H A;  3KVB A;  3PDQ A;  4Y33 A;  5A7W A;  4D6S A;  4Y4R A;  5FY9 A;  3PUS A;  5FY4 A;  5FPL A;  4AI9 A;  5FP7 A;  4QX8 A;  3N9O A;  3PU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...