5LY2A

Jmjd2a/ kdm4a complexed with ni(ii), nog and macrocyclic peptide inhibitor cp2_r6kme3 (13-mer)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
b'TLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysine-specific demethylase 4A
publication title Highly selective inhibition of histone demethylases by de novo macrocyclic peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 103
structure length 348
sequence length 348
chains with identical sequence B, C, D
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5ly2A01
5A7WA 4QX7A 2XMLA 5A7QA 5FPUA 5IVBA 3U78A 3LDBA 5FP4A 5FP8A 5FUNA 4CCOA 5A3PA 2YU2A 5FZOB 5FYTA 3K3NA 5A80A 3N9PA 5FBJA 4GAZA 5FXZA 3PDQA 5A3NA 5F3GA 5FP3A 5E6HA 1VRBA 4D6SA 2W2IA 5A7PA 5A1LA 4LIUA 3KV6A 3AVRA 3PU3A 4XDPA 4UF0A 4AI9A 5IVEA 3RVHA 4V2VA 5IVFA 5IVCA 5F3IA 5FZMA 5LWBA 4D6QA 4EZHA 4LITA 5K4LA 5ISLA 4EYUA 3AL6A 4QXCA 3N9NA 5FPAA 3KV9A 5CEHA 2OS2A 4AAPA 5IVJA 2OQ7A 5FZ7A 4XDOA 2YBPA 3N9MA 3LD8A 5FYVA 5FV3A 4QXHA 5FZ4A 3PTRB 5FYZA 5FUPA 4ASKA 3ZPOA 4BISA 5FYMA 5FXXA 2GP5A 5FYSA 5F32A 5A7SA 3K3OA 5FZ1A 5IW0A 4HONA 5FZ6A 4CCNA 5FZGA 5A7OA 4BXFA 4E4HA 5F2SA 2Q8DA 3NJYA 2YU1A 4Y33A 3PURA 4IGPA 3PU8A 5A7WB 4URAA 3PUQA 2OT7A 4QU1A 3KVAA 4QWNA 5FXVA 5FZCA 5FWJA 2PXJA 2XXZA 5FJHA 5FY5A 2YBSA 5FZEA 4DO0A 3OPTA 3DXTA 4Y4RA 5FYUA 5FY1A 5FP7A 5FY9A 5LY1A 4CSWA 5F3CA 5FZAA 2WWUA 2YBKA 3PUSA 4UF0B 2YPDA 4QX8A 4Y3OA 5FJKA 5F5AA 4GD4A 5FZDA 4CCKA 5FPVA 5FZOA 5A3WA 3UYJA 4HOOA 5FZLA 2P5BA 5LW9A 4GJYA 3KV5A 5ANQA 2Q8CA 5F37A 5F5CA 3OPWA 5FXWA 2XDVA 4IGOA 2VD7A 3AL5A 5A1FA 3AVSA 4TN7A 4DIQA 4QXBA 2WWJA 5FYYA 4CUGA 3ZLIA 2Q8EA 3DXUA 5FPBA 3KV4A 3PUAA 4IGQA 5FWEA 5FZIA 5KR7A 5A7NA 5LY2A 5F3EA 4C8DA 4CCLA 2GP3A 5F39A 4LIVA 3K2OA 5FZ9A 5FZ3A 5FY7A 5FY4A 5FYBA 3N9OA 5FZHA 2OX0A 3N9LA 4D6RA 5FZ0A 4V2WA 2XUEA 3KVBA 5FZKA 5FZ8A 2OQ6A 4CCJA 5IVVA 5FYHA 4LXLA 5F5IA 5FYCA 5A3TA 4CCMA 5FZBA 5IWFA 4GJZA 4NUBA 3N9QA 5FPLA 5FY0A 5FYIA 5F2WA 5IVYA 3U4SA 4BU2A 4EZ4A 5FZFA 5FY8A 5FP9A
chains in the Genus database with same CATH superfamily
4AHZA 3NNLA 2R063 3AP5A 4DRRA 4XQDA 3HN3A 2HWC3 5A3PA 2YU2A 4ZHNA 5GM0A 2XWJB 2ZTNA 4RFRB 5DAXA 1CPNA 3AKSA 4G3YC 2H6CA 5HCBA 1K12A 1PO21 3S6PA 5E6HA 1AUYA 4ASMB 2ZABA 3RMYA 2VZPA 3NQHA 4XOGA 1STMA 4UF0A 1JU4A 2X5IB 4XF3A 1DQ5A 1GZ9A 5E16A 2RMU1 5D8AC 2GNMA 3KLSA 3LIHA 1BXHA 4QPIC 4K8FA 4YW1A 1OA2A 2EXJA 2P3YA 4DZGA 3B94A 3LFMA 5I0TA 2WZ8A 2B4KA 3FFZA 4JV4A 5ISLA 1GP6A 3TEWA 5EYXA 4CP9B 3KCXA 4PBPA 4FQ4A 5T5OA 1MQTA 3BU7A 5H9PA 2D7FA 2QQVA 2Y6JA 3B3QE 2JENA 3B01A 1UX6A 4MLOA 1DQ1A 2JDNA 3IMMA 3N7MA 1O59A 3J4UH 1HRI2 4KBZA 5FYMA 3DECA 4XZPA 4A42A 1IKQA 3AZXA 5IW0A 3HBKA 5CKQA 2W94A 2ZGPA 2MEV1 3ZFGB 4FFGA 2ID4A 1U0AA 3FHIB 4HK8A 5ACA1 1UMHA 3POBA 4S2HA 5FPZA 4I09A 1PK6B 3CJIC 1U5YA 1GUIA 2YBSA 3E5UA 1NKGA 4KWLA 4DO0A 5J7MA 1P8JA 5CFCA 1ZM1A 1DF0A 5JMCA 2W1SA 4LR4A 5AC91 3MW4A 2V4AA 3MLLA 1V6MA 3FHQA 1UZYA 1WMXA 3PUSA 1DCSA 2E7AA 2VM9A 5F5AA 4XHXA 4BPZA 1UF2C 1UU5A 2A6ZA 4QGLA 3UYJA 2BGOA 2BZDA 1UY3A 1RUE3 2AUYA 4EJRA 3LEGA 3GBGA 1AYM3 2FHRA 2YGLA 1KITA 3J8F1 4QKBA 4RS5B 3GCWA 3MF6A 4H2AA 1YEWA 4BLIA 4INDA 1GYKA 2D97A 1VBC2 4FTSA 1CAUB 3OGJA 2IZWA 3GZAA 4XJUA 4YG6A 3S7IA 4YVSB 2JIJA 1ASJ1 3CQOA 3O1UA 2FD8A 4ONUA 1OH3A 3T3YA 4GQ7A 1WLDA 2CL2A 3WP4A 4D69A 2VH9A 4QPYA 4LBMA 5C5UA 3CMGA 1VALA 2D3SA 3DN7A 4Y22B 5F39A 1ULDA 3UGGA 2WNUC 3QCWA 3VBSB 1JOBA 1EPZA 3I3BA 4AVTA 2JDPA 4HZFA 3VD7A 2J1RA 2VW0A 2I74A 5FYBA 4LORA 1EYBA 5C5TA 3MW2A 2PAMA 3KT4A 4FXKB 5JI9A 3MIFA 3MEPA 4E8DA 3O7OA 5C8CA 1VBB1 3H7JA 3WW4A 5M0TA 3RPQA 2W52A 2WN2A 5FY0A 5JR2A 3W5NA 1ULGA 2XBO3 5G04L 2WQ4A 4TWTA 4CCEA 5F9TA 3U78A 5HCAA 5FP4A 4CCOA 4S2FA 3WDVA 4CDUC 1IQDC 1JUIA 2VPVA 3DYOA 2VZ1A 4QT6A 3VBFA 4PI2A 1RB8G 2G9GA 1AL21 1Z0HA 4MGQA 5BYNA 4DB5A 4ISRA 4FFHA 3ST7A 2QQWA 3T09A 3ZYGA 2VJXA 4COYA 2OPKA 2BV4A 4FBFA 4GB33 1ZZCA 2EALA 4I3PA 1NLSA 4UFJA 1VJ2A 2FDIA 2QQJA 3KV9A 3RZJA 1US3A 2B45X 4ZXEA 4A41A 1I5PA 1Q8SA 1OHFA 4YM1A 1W6PA 4AI3A 4DUXA 5FZ4A 1YC61 1BEV2 1ZRIA 4OUEA 3S5AA 4Q4Y2 2XR4A 1VBD1 3EO6A 1VMJA 4RGKA 2HWF3 2LALA 3TAYA 1NCQC 3ZYJB 4G9SB 1AR82 2HWC1 4HONA 4MYEA 5FZGA 1GMMA 5B4XA 4NOTA 4QPGC 4N53C 1UU4A 3ZFEA 4IGPA 2NN8A 2A6YA 1PNFA 3JCIA 4LHKA 5E88A 1I1EA 5GALA 3I2JA 4K6BA 5T50A 5BNNC 5FY5A 4FPKA 4QQPA 4XE9A 4L97A 2JE9A 3OPTA 1GOGA 1BZWA 2EF6A 5FYUA 2OA2A 3PUHA 2BOIA 1RUC1 1YIFA 3OD0A 3HNMA 1H9PA 3NNGA 4NROA 1RJ7A 4QB2A 3ZYIB 3O1SA 1UIKA 1NXD1 4P00B 2QFEA 1PO13 4B1MA 2Y64A 5KC5A 1UO9A 3H7YA 1LODA 1VR3A 4QKFA 5GLZA 3SH4A 3V0AB 4Y5TA 4ZU4A 1RUF3 2CY6A 3NRUA 4QD2A 4OQ9A 1FNZA 3HQRA 4META 1FMD2 3JXSA 3C7HA 3PJQA 4LBOA 4AFAA 5GKAC 3CU7A 1JS9A 4IGOA 5EP9A 3MPPG 3WQ1A 2UYBA 4JGZA 2PHRA 4FP3A 4QDQA 4AAXA 3SKVA 4XAEA 4PQ9A 2WZEA 3R4UA 1QQP3 4OUSA 3AK0A 1UZWA 2JX9A 4QKDA 5CA6A 3LOBA 1VBA2 2Y26A 2F4LA 1L7LA 3TN93 4QGMA 4OI0A 2YFUA 4AVVA 5LA0A 2GH2A 3MFAA 4UFIA 5IUQA 2DDUA 1QEXA 2R1DA 2CSGA 4PDWC 4UW5A 4B4PA 3E5XA 1UOBA 2BJSA 2HWB3 2OQ6A 2V09A 5A3TA 2RS52 4QQOA 1RUE1 4GJZA 1PM4A 3LKJA 4M00A 4XF1A 5DMYA 1SCSA 2JG9A 4K21A 4MHUA 1HB3A 1XJAA 3KGZA 4LJHA 2WSVA 3ENRA 5EWSA 4X8NA 4EN9B 5FPUA 5FUNA 1OF3A 1RUH2 1W8ZA 4OYUA 1UY2A 2PHFA 1O6UA 2YPJA 4JGYC 4GIQA 5CFDB 1CD3G 1GV9A 2RR11 1EY2A 1W8UA 5FXZA 5F7UA 3EYPA 2DVGA 5GLTA 2ZXQA 2HJIA 2GDFA 4UBGA 5DDJ3 1GWMA 5FLJA 1AX0A 5L7OC 1Y9QA 3AJYA 3HNBM 4OI4A 3ZR5A 3A0KA 4RQPB 5IVEA 2NMNA 1L7RA 4RR3A 5F3IA 2XL7A 1RUJ2 1WCSA 1HDKA 3V65A 3ZYRA 1RHI2 5JXIA 3E97A 3WNOA 5K9YA 2VVDA 1LGBA 2ZZQA 3AM2A 1ZA7A 4JTOA 1XE8A 4XF9A 3N9NA 5FPAA 3J9SA 4JVAA 3THTA 2J1TA 2YC2A 3VDBA 5DAWA 2OS2A 2BQPA 2P34A 4I2OA 1D4M3 1UMIA 4CEWC 2E32A 1MR5A 4QXHA 1L3JA 3PTRB 1VB4A 1QJU3 3NNFA 1D0HA 2OXBA 3K4DA 2R49A 3ZPOA 2AR6A 1VAMA 3AKRA 1JYIA 2J1SA 4DFSA 4NIAA 1C3HA 3BN6A 1WBFA 3ZN4A 1CZSA 2D6NA 5C9AA 2WT0A 4M3CA 4R8HA 4QMAA 2O0OA 2VW1A 3VBRC 5DXDA 1LOBA 4HFSA 1S1AA 4XFBA 3VKLA 1ND2A 2WFF1 2EIGA 1W6OB 1REDA 1IG3A 2ZX1A 3HNYM 4QQLA 4QKNA 1I5ZA 5BNOA 1TMF3 3O0XA 4Q4W2 4XPVA 1RUG3 4J6GA 5LEJA 4JCKA 4AI8A 4AHXA 2OT7A 2Y6GA 3U11A 3WW3A 4BHPA 3ILNA 1AX2A 4QXKA 4WZFA 2Y34A 4Q0VA 5FWJA 4DQAA 1RVF3 1WBLA 1WA4A 3K75B 4YPJA 1V00A 3OEBA 1LOCA 4YZ2A 4E4ZA 5J09A 4J1WA 2QQNA 1U5IA 3T1MA 1OFSA 5FY1A 3FX3A 3AYAA 2UY8A 3MLJA 4H3WA 3EQEA 3JUUA 1KGYA 4CSWA 3V0BA 2IVJA 5GLVA 1IPJA 1NUKA 4UYBA 4IEXA 5GZFA 2R7EB 1Q8PA 3S5QA 4XCAA 5FZLA 4NWWA 4BK4A 1KJRA 3FFQA 1UU6A 2OW4A 1W8HA 4IV1A 1UWWA 1XSQA 2Y0OA 2IFWA 3NAPA 4HKLA 3PTYA 4LEJA 2YFZA 3KWVA 3AXDA 1FAYA 5L7OA 1DGWX 2QBXA 1KFUL 5B4NA 4YM2A 2WWJA 1HN0A 1KS4A 2UY9A 3GGLA 3ZYPA 4XFCA 2E26A 1SG3A 1UYXA 1S2BA 1DQ4A 1YHFA 2J1VA 3LIGA 2DVFA 4IE6A 5A7NA 5LY2A 2FMDA 3FL7A 4LIVA 2YDEA 1PGW1 3AZWA 3DF0A 1PZ7A 2LM3A 1BQPA 1NY72 2ADDA 4HVOA 3OBTA 2GSYA 3WG2A 2YZ4A 5GZCA 3IDAA 1PO11 1IKPA 2CDPA 4ES8A 3QH6A 4BIFA 1A3KA 5FZBA 3KGLA 1OLQA 4QPIB 4XF0A 2NYYA 5F5QA 1AR62 1D4VB 2W47A 4K40A 4D8MA 1AX1A 3RQ0A 5LCWL 1ZBE2 1AR72 1G9DA 3U0ZA 1C5IA 1RGSA 1PVC2 2PELA 3A23A 3PNAA 4P5YA 4Q1RA 4QQ2A 4YVWC 1V0AA 1GWLA 2AC1A 3DPRA 1XNTA 2DCJA 2PHUA 3VBUC 1VRH1 1B35C 2VQUA 1T6BX 3X29B 1QQP1 3I2DA 2VVEA 4FOVA 3RWKX 1QJZA 1VRBA 3LEIA 2PLV3 4IXLA 4H7LA 5LA2A 1HXS3 4AEJA 4SBVA 1YCIA 3RVHA 4CEYA 3DUIA 2VZVA 1SDWA 2A1XA 5FIXA 5FLHA 1HQLA 1PIV3 2OUHA 2WSUA 4NHMA 5C6CA 4CCCA 2ZOEB 3OGGA 2WO7A 3OYWA 4RD7A 1H4GA 1C57A 1W8OA 2Z42A 4WM8C 2HWB1 4NMIA 3BI3A 2VCMA 3I3DA 4Q0UA 3ZSEA 1LR5A 5BNPA 2D43A 4NIIA 1HRV3 4B7EA 1W2AX 2XL9A 1YFWA 2DTYA 2XKOA 3LGRA 3CJIB 3LFIA 4NPMA 4AVBA 5CYYA 3ZYHA 1OUXA 1HJGA 5T5PA 5DPNA 3K3OA 4FQZA 5EV7A 2ES3A 3AZYA 2XQXA 2VU9A 3K4AA 1SBEA 5FZ6A 3WOGA 2P3IA 3POFA 1W9YA 2ORZA 2VUDA 2WS92 2KXLA 2XUMA 5I93A 1W6NA 2EIDA 5KBFA 4DOUA 4YZ4A 4IDZA 5DDJ1 3T2PA 3VN4A 2XJRA 2WZR2 1R1A3 1G8WA 1LNSA 4Q1PA 3A21A 3MIGA 2FZ2A 2NMOA 2AREA 3ATGA 3C7GA 5FMCA 2JKXA 5DUUA 2VR4A 1COV2 4TYSA 2Y60A 3M3IA 2ET1A 3I2FA 4FFIA 2LS6A 3ZOIA 4XFFA 4EN0A 2WWUA 2RS32 2RDRA 1W2UA 2WAOA 1QJU1 1W90A 1W99A 3HVDA 1J3RA 3AYCA 5FZOA 1QMJA 2VL4A 4HOOA 2ZMKA 4YW7A 1FPN3 1R093 2UU8A 5C4WC 2CAVA 4MX3A 2PA7A 2VNGA 3Q8FA 5CNAA 4O9GA 2BU9A 3HN1A 4D0QA 1G86A 4RHV3 4UOJA 2G9FA 1V9U2 1J83A 3AL5A 3WXPA 4L9BA 4DIQA 3AMHA 4UFHA 1CPMA 1RUG1 4M01A 4YW4A 1GICA 1Y7BA 2B46X 1QJX1 5FZIA 3RYKA 5CVRA 5CU1A 1S0BA 4COUA 4ZS2A 1DZQA 3I2IA 3BOPA 4WBBA 1HRI3 3AKPA 2EXKA 1RMU2 5CB7A 4CDUB 4FPLA 1S0GA 3T30A 4XETA 3O1VA 4XJ9A 5FLIA 3VBOC 3PIGA 3QD6A 4KQ7A 3KHBA 4LUMA 2NZ9A 4HMZA 4HANA 3I3QA 4XEZA 1FOD2 3CF6E 4NHLA 2WDBA 2QDRA 2RS12 1IHMA 2R042 4NUBA 3JD71 1QDOA 4FT8A 5EQUA 3WCSA 1UXXX 3JBG2 1O4ZA 2JIGA 3E1F1 1OOPC 1VBE1 5IVBA 1WD3A 5KHJA 4XBLA 4IE5A 1PO23 5FYTA 1YLLA 3J7HA 1REEA 4MADA 3SEPA 2XJSA 4Y22A 4AI0A 5FMBA 2XPJA 5A3NA 1ULOA 2RG4A 3Q8CA 4LKEA 2RMU3 3OOXA 4NE9A 1NCQB 1ZBA1 4IV3A 3CBNA 1NQJA 2HWE1 4IE4A 2WO3A 5JR7B 2GC2A 1H6YA 5IVFA 1W05A 5FZMA 3ZN6A 4FOQA 3MIDA 4URTA 5K0UA 1J3QA 4GMP0 5K7PA 4LKSA 2B39A 3BUCA 5HXMA 1XE7A 5FPXA 3ETPA 2OQ7A 2ADEA 5A32B 1IPSA 2F4PA 4HT1T 3LD8A 4JKLA 4XDOA 5G05L 1Q8QA 5LBCA 4RYDA 5EJ3A 3N7KA 1ONAA 4XUQA 3P5BA 3CEWA 4Y26A 3MZHA 5F32A 3ZN5A 1WCDJ 1N3QA 1Q43A 2MEV3 5A7SA 3WF2A 3VZJA 3AMMA 2WUHA 4HSJA 3O1OA 4CDWB 2O14A 5A7OA 4BYYA 4BXFA 3C7EA 4OZOA 3W58A 5IK4A 4P9JA 3Q8AA 4B1LA 4JKKA 4ZU7A 5HBAA 2PLV1 2RJ2A 4GH4A 4GWJA 3LA7A 4FOYA 1RC6A 2VBPA 1HXS1 4FPHA 2JG8C 3Q9OA 4HXCA 1JYWA 4YW2A 1CZTA 1QY4A 1NA1B 2IC1A 4IE0A 4DXTA 4NAOA 5AC93 5I8TA 5JSOA 2ZAHA 2Q30A 2DF7A 4Q4V2 1CAVB 1GU3A 4JC1A 1BBT1 1H8TB 3J7LA 1W9SA 2MNGA 1SFYA 2I45A 4JDOA 2ZGRA 5C3PA 1X8EA 4NWVA 3J8F3 3LSDA 5IFPA 1MS9A 2FDHA 4G4FA 4N43A 3IAQA 5J37A 4YRDA 4PDWB 2QZ2A 1EAH1 1FYUA 2V73A 1W9WA 1HQWA 2E7TA 4FP2A 5LW9A 4LBLA 1O8SA 2C24A 1T6GC 2YROA 3OY8A 3ALQA 2VD7A 3AP4A 1C8M1 4XABA 5L9VA 1YIPA 3CIHA 3FWEA 4TTGA 3ACLA 3NNJA 1F15A 4I01A 3SHRA 3WEZA 5A3OA 5A6XA 1NX9A 3I49A 4IEUA 5F3EA 1BEV3 4JHZA 3M8LA 4Q5OA 4ZPIA 3RNSA 2W1UA 5HPOA 4Q4Y3 2QQIA 2W0XA 4Z2WA 4JGYB 3R6SA 3BIEA 1UD1A 1EUUA 2QTWB 3BB6A 4YGBA 3ZKUA 2DU0A 3MYXA 4CXWA 2I07B 4LTAA 4D7YA 3ELNA 2XUEA 2JXAA 4BB3A 1LOFA 3JZVA 2QKDA 2SLIA 3CZJA 5F5IA 1MQTC 4XACA 2A5ZA 4KWKA 1QNYA 4CU9A 3VZOA 4D7SA 3VHNA 1CAXA 4ZKTB 1FPN1 1R091 1J84A 3U4SA 3LEMA 2VUCA 2QQMA 4RHV1 4D3WA 5IATA 3SKJE 1HN1A 2DCKA 2A70A 4HK9A 1CAWB 2G9ZA 4HPKB 3ZMNA 4CEWB 4CDQB 4TZDA 3AFGA 3ZXEA 3GZTB 3EMRA 4FOWA 4MXWA 1JU3A 4ZXKA 1QJY3 2UWCA 1OLMA 3ZDVA 2EICA 3AFKA 5A7PA 3MW3A 2Q0AA 3THDA 3R4DB 3VBRB 1HRI1 4R4XA 1W6MB 2H6BA 2E63A 2BP6A 5J36A 1ENQA 2LW8A 2YB7A 4Z07A 1XQNA 2MPFA 1N3PA 5CFCC 4AEDA 3RI8A 2ARBA 2ZX4A 1UOFA 1A34A 5HI0A 4Y1YA 1F5JA 3B69A 4BQ5A 4Q4X2 2GALA 1IG0A 3D6EA 4P9IA 3UGFA 1VBD3 5FR3A 1MS4A 2XLAA 3CNAA 3ITQA 3H1WA 5FUPA 2ILMA 3OD4A 2JDUA 3ON7A 5JOWA 3EHKA 2C9KA 3I2GA 2WKKA 4ITCA 2VECA 1AR92 3INAA 5JXGA 2Y8KA 4HKOA 2DUQA 2XVLA 4A3ZA 3FLTA 3J7NA 2CGPA 2WN3A 4XVHA 5JDBA 2WR9A 3NJYA 4JDNA 4CU7A 1MACA 4XJZA 4A7YA 3D82A 3WUCA 1UNBA 4OMDA 5A7WB 3FJSA 2YG0A 4BZ4A 5FAXA 3CZUA 4JAAA 3BTYA 5FO9B 4HBNA 3VUOA 5H9QA 5GJ6A 1RUC3 1H1IA 4MOAA 1AVBA 3POGA 5JIAA 5FZEA 4XURA 5BPXA 4WM7A 3UESA 3FZ3A 5T55A 4AFMA 4YLZA 4KNCA 2GC3A 4BQ3A 1EV12 1HKDA 1IS6A 1G6NA 2D6LX 2YBKA 5E89A 3NV3A 3PVBB 3VD3A 3WNXA 4CTEA 5C8CC 4AQTA 3AP7A 5JXJA 4CPBA 4UXAA 5JPNB 4BK5A 1OVPA 2ET7A 2VMHA 2EIBA 3OUJA 5HV4A 1X82A 2PHDA 4XILA 3KM5A 3VD4A 5A33A 3MBWA 2VOVA 5TSWA 3GCXA 5FXWA 1RHI3 2XDVA 1SACA 2WWSA 3UGHA 3DKWA 5ABJA 3RZKA 2W92A 2A6VA 3VBFC 4YVWB 1ND3B 4A4AA 4EROA 4DMIA 2D98A 5KR7A 3VBUB 2C6SA 3IWZA 4AEKA 3WNKA 2RM23 1B35B 4F3JA 2EXHA 4AW7A 2PFWA 5KHGA 3VKFC 1W06A 1JBCA 5FY7A 3VDDB 4K7JA 2JWPA 5SV8A 4B8EA 5FZ0A 5FZKA 5JLVA 3L2HA 5KWRA 4LK6A 4Q29A 2WNVA 3C7FA 3H1MA 2HWD3 1UYZA 4LOSA 1JOPA 2JECA 3HD8B 3NKGA 3QBQA 4K20A 4KMQA 3TBDA 4WM8B 1ENSA 5EHDA 5FZFA 2Y0IA 5FY8A 4C90A 3ACFA 4HKWA 2RR13 2P1BA 3LDBA 5FP8A 3ZSJA 3VD5A 1WD4A 1GZWB 2ZGSA 4BCUA 3ZFFA 4P9GA 2Q8OA 2A7AA 2C26A 1DGWA 3ZFEC 4AVAA 4CP2A 1BEV1 2VOXA 2W2IA 4M4RA 4DNYA 5C3SA 2B9VA 4UFKA 4Q4Y1 1D0GA 5C8WA 1FXZA 3FLPA 2VCAA 4NJ4A 3WDWA 4JRAA 3IAPA 4V2VA 1AR81 1TME3 3PHMA 2A3WA 4WVMB 4W6YA 1WLWA 4KWJA 1Q5OA 4OLLA 2RE9A 4B7KA 4CP0A 3NO8A 4DY5A 1SQ4A 3ACGA 3I59B 4XIKA 2C9AA 4PHZA 5FYVA 4AL9A 3PLQA 4MGZE 5KXDA 3BPZA 1AYN2 4GZ9A 2XVKA 1LB2A 4JZRA 3VZNA 1K5JA 3HIFA 1JI6A 3T0DA 3ZSLA 3IPVB 2XJPA 3LCPA 2WFF3 2VBBA 3WDUA 1LESA 1K5MA 3MDPA 3UJQA 4JGZC 1Z7S2 2ZCWA 1LHOA 1QJY1 3IIIA 4LBQB 4QX5A 2Q8DA 5C4WB 5A70A 4IESA 4W4ZA 4X6QB 2DBNA 2WBKA 2CGOA 2VE1A 2VOKA 3AP6A 4M3CE 1WGPA 3S30A 3VHRA 4RA0A 1L7QA 2ZJCA 5LK5A 3WP3A 1FMD1 3ZIXA 1JW6A 1O3RA 4QM8A 2JE7A 3LF7A 4Y5Z0 4BWOA 3M3CA 1W0PA 1NCRC 1CN1A 2XVGA 2XJVA 5FY9A 5JZGA 2Z5WA 1UOGA 2VCCA 4F8AA 4AEMA 2K9ZA 1SBDA 1DDLA 3BKZA 1F31A 1F9KA 3ASIA 2JG9C 3M3QA 4XTMA 1ASJ2 4YGEA 2Q1FA 2HH9A 3VBOB 4E4SA 1W9FA 2A3YA 2LRPA 2VZSA 1WZXA 3H3UA 3KZ4C 1JHJA 1OSGA 2C1FA 3RGBA 5I0UA 2V5DA 2W1WA 4L0PA 4XMAA 4C0HA 5I8SA 3KS7A 4GKYA 5FYYA 1RUD3 3ZLIA 3FBYA 2IXKA 4LKDA 2BERA 2XJQA 5DABA 1OFNA 5CBLA 5J3UA 2QNKA 1OOPB 1RIRA 2VZ3A 3HOBA 1NZIA 3WF1A 4GA9A 1LULA 2BVBA 3AKTA 2ZHMA 3K2OA 4RR3C 1OVSA 3A4UA 3UNPA 5FY4A 2NLRA 1CESA 1VBB2 4NAMA 3KMHA 4LO8A 1YQ8A 3N9OA 1GP5A 2OX0A 3GBWA 1Y9GA 4L92A 3WDTA 2IXHA 3T2QA 5FYCA 2FCUA 2F6BA 4FSJA 3USUB 3O0VA 3N9QA 2WZR3 3NJVA 3R0RA 1RJ8A 5FPLA 3WP5A 1VIWB 1I6XA 5IVYA 4UFLA 3W5MA 5LASA 1VRH3 1CONA 1XNBA 1YFUA 4J1XA 5LA9A 5C3OA 1IOAA 1RUJ1 5C9AC 4OQ8A 2DFCA 4XIOA 1RHI1 1UZVA 2QQUA 3LDKA 4QX7A 1JUHA 3BTAA 1AL22 3IDEA 4BDVB 1IZ3A 1ND2C 1UQXA 3NV4A 4NHKA 2E6VA 5FMOL 5FFOC 2QUOA 5BNOC 3ZO0B 2JDHA 3PL0A 3DKQA 4YM0A 3ES1A 1W6QB 1NCRA 2RM21 5A1LA 3P6BA 1QXRA 1LCLA 3NJXA 4KGQA 4M0NA 1SPPB 4YWAA 1MS0A 3HMYA 3WHUA 3BVCA 5T5JA 4CUAA 1CJDA 1JYCA 4COVA 1H4HA 3IB3A 2R062 2HWD1 4Q4W1 3RWNA 1PMJX 4B3NA 3JQWA 1SFPA 1RINA 4NPRA 2W08A 4FPOB 3DCQA 4W50A 1CX4A 3H8OA 1X7NA 4ARXA 2GZWA 4DS0A 2WQZC 4IV1C 4EN6B 4KU7A 1PVXA 1RMU3 3NAPC 5F8PA 3ZXJA 1N1TA 3KT7A 4LA3A 4CA9A 1POV0 1UIJA 4E2QA 3T08A 4HVQA 3I7DA 3J7MA 1LEDA 2GH8A 2X10A 2AH2A 4LBQD 2QQPA 2JKBA 2DU1A 2Z69A 2WJSA 3WT3A 1BMV2 4Z8BA 3WDXA 4YGCA 3PJYA 2E31A 4FTEA 3WF0A 2L9LA 4NHYA 4Q27A 1TME1 1RXFA 3GBFA 4W6WA 1F8VA 3VDAA 2Q5TA 2BFUL 5GZGA 3EJKA 4IEOA 4S2DA 4BJ0A 2RJLA 4OZXA 4DEQA 4XJWA 2VQ0A 1K3IA 2DCZA 2CDOA 3AZVA 4MO3M 4FPYA 3I2OA 4KG0A 4UF0B 4NR1A 4L2NA 1Q3EA 2HEVF 1SLBA 3SMHA 5IHRA 2BRTA 3ES4A 2KM2A 2WLPA 2DV9A 3UT0A 4LBNA 4WZCA 2ZX3A 1J3PA 2ZKLA 1SLCA 1YFXA 4XQ4A 4PF5A 1NY71 1N47A 3VV1A 2D6PA 3DPRC 4CDWA 4Q8KA 1E5IA 1MQTB 4BMEA 5I91A 5KC6A 1F5FA 1MS8A 4O61A 1PMHX 3THCA 1QJX3 2CWMA 4MSVA 4CUBA 1LAJA 1LHUA 1X9TA 2NQYA 2WA3A 2D40A 2WC2A 1XB9A 1SBFA 3HPNA 1NA1A 1AR61 1J58A 3BU0A 5T3NA 4CCLA 4FFFA 1AR71 1ZBE1 3OTFA 1C28A 4CEYC 1U5ZA 1PVC1 4IW3A 3U07A 4BQ2A 2E53A 2ZACA 2WIIB 1A78A 4A44A 1CAVA 2VTXA 1H8TA 1AYM2 4EWEA 1CQ9A 2FDJA 4Q26A 1X36A 4HSLA 4XC9A 4V2WA 4XYXA 3WNNA 1ENXA 3VBHB 3JD73 5BNPC 2UYAA 4LXLA 2ZEZA 2JDAA 2ZHLA 2XOMA 1ZZ8A 1JYNA 2BVVA 4X8PA 1F35A 3E5QA 3RMXA 5CFCB 3LPFA 1VBE3 5F2WA 3G6JB 3RSJA 4AI1A 4XFHA 3WNPA 4EE2A 4HN1A 1WMFA 1BK1A 3OBZA 1EP0A 2YMZA 4ZONA 3O14A 1ULFA 2DFBA 3POEA 4XXAA 2WO1A 3QOPA 4S2GA 1RUD1 2VY0A 3L9JT 1W8NA 1ZBA3 1B09A 1S4CA 2HWE3 1HV0A 3POIA 3CO2A 3OG2A 3BYWA 1I9RA 2VXJA 1W8TA 2WO2A 1AXZA 1H1MA 2SBAA 1O8PA 2VUAA 2LUWA 3HEIA 1YQ6A 3KV6A 4Y1UA 3AVRA 4COZA 1N1VA 4HVRA 4Z1VA 3O1PA 3MIHA 3N3HA 2VMCA 3FHAA 1VMFA 5L9BA 3WX5A 2DVDA 1O7FA 2C0ZA 3VHOA 4K9SA 5IT6A 5D8AB 4LITA 5K4LA 1SLAA 3TB0A 4DUVA 2XBO2 3E6DA 2WS91 4EV0A 1SLTA 3AL6A 1URXA 1XOYA 3OJBA 4XFAA 5DZGA 1G9CA 1ZA4A 5GZDA 1LTEA 1R64A 2WZR1 2W46A 2WL1A 3IT8A 4AVCA 2RVAA 4AWDA 1PHMA 4NN0A 4PT6A 4FI9A 2DUPA 2VMIA 3F2ZA 3R05A 4ARYA 4YNIA 4CDQA 1AJOA 4Q0PA 3ZFGC 5BNNA 3OF1A 1GR3A 5C8CB 2J42A 5EJZB 5JUVA 4A6OA 1JZ6A 2RS31 3HT1A 1FI2A 2VNRA 4GB32 5JOYA 3J26N 2OUJA 4IEYA 4Y33A 4PLOA 3HT2A 5DN2A 4QHZA 3RZGA 3OPZA 1W6MA 1XPWA 3U4XA 3RZMA 1HIXA 2MHFA 2Y38A 2WZPP 3IIAA 1ACCA 1NLRA 3M3EA 3D3AA 3O12A 3QH7A 5ERLA 4CDXA 1BBT3 5DAVA 1W0OA 1IS3A 2GMPA 1NOVA 1V9U1 4XQWA 2Y6FA 3ZMOA 5FQ0A 1UYYA 2HWF2 1QXJA 2YHJA 3S0MA 5CZKA 2YPDA 1AF9A 5IAVA 5EZWA 4Q0SA 3FN9A 3GXUA 3T4HB 4LKFA 3BPSA 1EAH3 5FK8A 4CCKA 2OKXA 4JDMA 1GBGA 4P9WA 4PLNA 1LRHA 5CADA 2Q1MA 4QHBA 1R083 4IEPA 4GJYA 3K46A 1RMU1 1C8M3 3VL8A 2K0GA 4ATEA 1PMIA 1GFF2 1PGSA 1VAKA 3G7DA 2W1QA 5F37A 4AFCA 1W6PB 2IFRA 1OLRA 2X5IA 1CX1A 4NRQA 4XHBA 1UY0A 5EIYB 2ZEWA 5C7GA 4LK7A 1DU3D 4MGKE 2R073 3I4IA 3BTXA 4AFBA 4IV3C 2E7QA 2XG3A 3TOJA 2FBEA 5D2AA 1E5SA 3CL1A 3GZEA 4Y1ZA 4CP9A 1KEXA 4B4QA 1PO12 2FCTA 4FTBA 1SEFA 2WNUB 1XXNA 2BTVC 4WVWA 4YYOA 5K0UC 5CG9A 3ZFEB 3MHZA 1RUF2 3P1IA 1BVVA 4M4PA 1YWKA 3HJRA 1CWPA 3WW1A 4HETA 2KR2A 1S2KA 2VMDA 3ZFGA 1H9WA 4KGGA 3SC7X 4DXRA 2XH6A 2Q1ZB 1JMUB 2HBTA 1TZOA 2WFPA 5EFUA 4FAGA 4FVVA 5FO8B 3PVNA 5L36A 2C5DA 3IKWA 1MEC2 3BOWA 1UOJA 1IGOA 1SCRA 3ZXDA 3TN92 2PHTA 3TNPB 5BV6A 2IXJA 2O8OA 1E5RA 3DV8A 4W65A 2CWSA 4XF4A 1PK6A 2JE8A 2BBVA 1DHKB 4GH4C 4OHWA 4BIOA 4AHYA 5FKCA 2H0BA 2HWB2 2ZZJA 4CCDA 1DQ2A 1DYOA 3GALA 4JGZB 3VDCA 4DRVA 3VDDA 4NRMA 4QM9A 3OUIA 3H3ZA 1F4HA 4A7ZA 3U37A 1TNFA 1MVEA 1OLME 4IERA 3ME2A 3OGVA 1QJEA 1WLTA 2WRAA 4RS5A 4KWUA 4RSUA 1H1AA 1OC1A 5CEHA 5IVJA 2P3KA 1CAUA 3ZDSA 2YBPA 4BQWA 3ZSKA 3U1XA 4YVSA 4ET7A 1PZ8A 3WY6A 4N43C 1QWRA 3WF3A 4O9EA 5FYSA 5H9RA 2BGPA 2R32A 1ZREA 2Y33A 1REFA 5DDJ2 1QU0A 1JN2P 3BALA 1E57A 3U14A 3IN9A 3IMNA 3O5SA 4C1XA 4Q4V1 1DIWA 2JJ6A 3F95A 3VBSA 1H2LA 2JG9B 2ZHNA 3UV9A 5LZ6A 4XJAA 3MIEA 3VGIA 4FPEA 4C1WA 3ECQA 1PZ9A 4QX1A 1O3SA 1PGL2 4QPGB 3CLPA 4N53B 2LTNA 2GC0A 1VBC3 2JEMA 2DURA 4QB6A 4QWNA 1AJKA 5FZCA 5K8SA 1D4M2 4OHVA 4IEZA 4W8JA 3BIWE 4KI5M 5IYYA 3VZMA 2TEPA 1WW4A 1NQDA 3S57A 1QJU2 3WVJA 5I0DA 2VNVA 1F2NA 1LU2A 2J22A 4Y5SA 5FP7A 1OURA 2BYVE 3SCGA 5E8AA 1LOFC 1JZ5A 3TWIA 3RZZA 3GDBA 4GWNA 4UW6A 1PNGA 4KL1A 1OT5A 3H42B 4RR3B 4AG4A 1MPXA 1S0FA 2IVIB 1EUTA 1GNZA 3IPVA 1LGNA 1TMF2 2R1BA 2ZX0A 3I8TA 1RUG2 5JAXA 2EIEA 2N7GA 5ANQA 4E8CA 4K3UA 4GULA 1GQGA 1V6LA 1JZ3A 2EVXA 2W68A 5E1RA 1RVF2 3WG3A 3RYPA 2F17A 4QXBA 3ZXAC 4LHSA 4CUGA 4DPNA 2CV6A 5F6LB 3KB5A 4IETA 1BLZA 2JDKA 5C9AB 4IGQA 3PVOA 4M3CB 5FRAA 2VZOA 2D93A 1NZCA 2IXCA 5B2GB 3UKVA 1LHVA 4CU6A 4BH9A 3ZPYA 3MICA 5L73A 5BUVA 4AEDC 5BNOB 2O8QA 1HJFA 4AGVA 3NVCA 2R0HA 3TEXA 1Z7S3 3WQ0A 1CR7A 1AL0G 4PLMA 4RGGA 1OQDA 1IS5A 1G7YA 1G9BA 1R081 3K77A 5KXBA 4EZ4A 3NV2A 4OVEA 4CU8A 1LENA 2PTMA 3WZ1A 4WV8A 2W39A 2BW8A 2XLFA 1YO8A 2RV9A 1RL3A 2IWGB 4AE2A 4YFZA 1DYPA 3NWKA 4LPLA 5A80A 3N9PA 4GAZA 2FMYA 4Q4X1 5L9RA 5LBBA 3GZUC 2R071 2GNBA 4MZUA 5AVAA 2ZMLA 1VPHA 4IV1B 3NAPB 3WLUA 1AR83 1NYWA 4ZZ8A 2K46A 4JRLA 1MZFA 4E2SA 5L7OB 3LDRA 1OD5A 1GZTA 2BNNA 2E33A 1NLQA 1AR91 2OZJA 3V0AA 3AXEA 3MFCA 4WM7C 4BMBA 2XLGA 4OULA 2A6XA 4Y20B 1XRUA 5C3RA 4MGTA 4EYUA 1XYPA 1JHNA 2ZX2A 4MGYE 3USUA 5CG8A 1QIQA 2JB8A 4AGRA 1CGPA 1I3HA 1O4YA 1LHWA 2FQPA 4AFDA 1QH6A 4ASKA 1NE4A 3FE5A 5FXXA 4UW3A 4Z92B 3ACHA 1E5HA 2VXRA 3M70A 5GLUA 2PLV2 3H3LA 1GNYA 1GOFA 2GN7A 3OCPA 5F6KA 4CCNA 2H0VA 3U10A 1A8DA 3VZLA 5ABJC 2B8MA 1EV11 4UAPA 3LOIA 1PIV2 1RUI2 1W6QA 1BK0A 4XJ8A 5AFEA 2P2KA 2B5HA 5DG2A 3WSOA 1FMD3 1HQNA 2HEYF 3FBMA 4URAA 3DPRB 2ZGNA 4BXSV 1ZX5A 1QKQA 3C3VA 1HRV2 4YZ5A 2B7YA 2XXZA 5FJHA 3SCFA 3OB8A 2YGMA 4JTNA 4TLFA 4EWDA 4LT5A 1T2XA 4OHXA 4ZZ5A 3UKNA 3PIJA 1QOTA 4B29A 3VB9A 2D6KA 4XUOA 3JB8A 4XBNA 5LY1A 1RXGA 1VBA3 2VCBA 2WABA 5JVVA 3TEZA 2WNVC 3KSCA 4Y3OA 4O65A 1IPKA 3IDCB 2A6WA 1JZ2A 3OYWB 4HL0A 2AGSA 5CFDA 5I0RA 1M06G 4PQQA 4PBOA 5AVPA 4I30A 2QZ3A 1R1A2 1V70A 4LO5B 3SISA 5BNPB 4XFIA 2QQLA 3ZSMA 1ULPA 3A7QA 3VD9A 1U12A 2R0FA 2RS53 2XGXA 3AKQA 4XCBA 4RQPA 1OPMA 1ZNPA 3E6BA 1K42A 2PHLA 2ZGMA 1K45A 3AVSA 1NT0A 2VG9A 3ZFFC 5KHHA 4ASLA 1SFNA 1UAIA 3LWCA 4BQ1A 2DTWA 1YUDA 3KV4A 1Y4WA 1VBC1 2VC9A 5FWEA 2GP3A 5EXOA 3WW2A 1W2TA 1RUH3 2CNAA 3NKTA 4XDQA 5KXEA 5FZ3A 1JYTA 1DLLA 3WQBA 1UN1A 1W6NB 2GN3A 1CJPA 3AYDA 1RTVA 1FPN2 1R092 2P6HA 3POJA 5FZHA 3VLBB 3VKOA 2VULA 4QDRA 1KXGA 2EAAA 5IVVA 4RHV2 4AF9A 1QH7A 1FX5A 4E4DX 2EXIA 5EYYA 1RUJ3 3N7JA 5H9SA 4W6XA 5FMOS 1W6OA 4BU2A 2V4VA 1OQEA 5T54A 3K51A 2P3JA 2PQSA 3D8CA 1K5MC 5FTTC 5FMDA 2DVBA 5FZOB 2J1UA 3R4SA 1N3OA 3KCCA 1OKQA 1BVP1 2G1MA 2JDMA 5KHKA 1HX6A 3GF6A 3T2OA 5CKNA 2PYTA 1H2NA 1AYN1 1OA3A 2GMEA 4R9BA 5A3UA 3OBAA 2BBAA 3FLRA 1CIWA 5FK7A 1DBNA 4AOCA 5A3LA 4UW4A 3RS6A 2DBIA 2QVSB 1DP0A 4D6QA 2ZGLA 3VBHA 4CXXA 4Q4W3 5FOBB 2VQTA 5JZGC 1Z7S1 4AK3A 1ST8A 3OUHA 3T0AA 3T0BA 1LKNA 1YI9A 2QE3A 2WT1A 5DUVA 1XYOA 2D5FA 5DAPA 2ZGTA 3M7AA 4P9YA 1PO22 1BCXA 4XUNA 4IQPA 2VW2A 4OI1A 4MV2A 2GU9A 4AGGA 2WNEA 2RMU2 3TRSB 5JSRA 5FZ1A 3EXUA 4AQSA 3POSA 5A6QA 4YFWA 2YUEA 3EB7A 3GHMA 3QLQA 1XC6A 3SH5A 3VL9A 4BQYA 2VZUA 1VLNA 2WINB 1OMIA 1N1YA 3MUY1 1ZRFA 4PIZA 3T1LA 4TLGA 5F2SA 3W20A 1G9AA 2DCTA 1AXKA 3DYMA 3GYDA 1ODNA 4X6RB 2BFUS 5SV5A 1H2KA 5JI7A 4C91A 3RZHA 2AZ5A 3KF3A 3H8UA 2BDRA 1WW5A 2HYKA 3KVAA 1O5UA 1Q56A 1QF3A 4QU1A 5IFTA 1TE1B 3H8RA 1A6CA 2PXJA 3HQXA 5J1XA 5D8AA 2A73B 1UKGA 2HYXA 4QPIA 1PX3A 3NSTA 3I3MA 2K2SA 2D3PA 1WW7A 4Y4RA 3V64A 1X50A 3SQOA 4LO7A 5D21A 3T4VA 2AEYA 2IXIA 1SMVA 4IV3B 2MEV2 2ZAAA 1O3QA 5BNQA 3DGTA 4OCTA 5IK5A 3ZXLA 5ACA2 5FBZA 3C8XA 1XBFA 5FZDA 1KFXL 4AI2A 3ZN6B 3GHNA 1N1SA 3KT1A 5CISA 1FATA 1JTZX 1H2MA 4IEVA 5K0UB 4JKMA 4B4RA 3WV6A 1TEIA 4I02A 2P5BA 1V6OA 4XBQA 2XJUA 3K4ZA 3SH3A 1UMZA 4XFGA 4YGDA 1KDKA 3EBRA 3Q8BA 3OPWA 4AVSA 1HB2A 5A1FA 2W95A 5AC92 4UT5A 4GWIA 1AR63 4YM3A 1FV2A 2PHXA 4NVPA 2ZGUA 3ILFA 3I2KA 1AR73 1WUVA 1ZBE3 2R16A 1VAVA 2VQAA 3AC0A 1PVC3 2UWBA 3IM0A 1UZZA 2Q8EA 1W0NA 1OPOA 1W8FA 3ZX7A 2ATFA 5IK7A 1D2QA 1UZ0A 3JB4C 5HXVA 2TBVA 1C1FA 1C5HA 4P08A 3UJOA 3J8F2 3CJIA 4KU8A 4Z2AA 4CXYA 4GH4B 1MZ6A 1UL9A 3N9LA 2ETEA 1VBA1 2PN5A 3RJ2X 2VZRA 4D6RA 2VBDA 1GKBA 1S0DA 1XU1A 3TEYA 3K48A 5GZEA 2FDKA 3D4KA 1OXCA 2RJKA 1VE0A 3DL3A 1JODA 2BNMA 2VUJA 3ZXKA 1YI7A 4QHOA 4K8RB 2ZGKA 4LUKA 3KF5A 4CCMA 4I0AA 1QXPA 3P3NA 2XB6C 1GLHA 2D6OX 4COWA 3AJZA 2ZMNA 5LRSA 2JB4A 5IK8A 2RS51 1YYNA 2XMLA 1W3XA 4UFMA 1LJ7A 2TUNA 4Y24A 4RL7A 2CYFA 4N43B 2R061 4YW5A 1GWKA 3H9AA 3NNMA 1ULEA 1QDCA 1V6JA 4D6SA 1OQ1A 4EN7B 3OY8B 1APNA 4AZZA 1RUH1 3LZZA 3PU3A 4XZUG 3BCWA 2WNUA 1XNCA 2PAKA 2XONA 4KH9A 2WS93 2WNOA 3D0JA 5IVCA 4DY3A 5FOJB 1VP6A 4EZHA 1O5LA 3MO4A 1RITA 2XJTA 3MGUA 3OSDA 3ZKYA 3BTZA 2VGDA 1C1LA 5DQ0A 3I3EA 3ZXFA 5FZ7A 2JDYA 3N9MA 1DG6A 1BMV1 3LB9A 5A6YA 2IUWA 4R52A 3TNQA 2FZ1A 3LAGA 2YC0A 2YYOA 1COV3 5ANNA 4BISA 1Y3TA 2QDNA 2GP5A 2Q4SA 3GM8A 1QJY2 4IEWA 3ABZA 4E27A 5KXCA 4CDWC 2RS33 2I2SA 3UK9A 1ZVFA 1KD7A 1CAXB 4TSVA 3IDBB 4HG6B 1DQ0A 1JYXA 4CDUA 4F83A 3ACIA 1S0CA 2HLEA 3KQRA 5HCHA 1H8VA 1S0EA 2XWBB 3WR0A 1NA1C 4P02B 5J96B 3AMNA 4SLIA 3N4MA 4QB1A 3LQCA 1V9U3 1O91A 1Q8OA 5FXVA 2JG8B 1VBD2 1XNKA 3GJAA 4MVTA 1QNWA 1POV3 2WA4A 1U5XA 3RDIA 3T2TA 4MXWB 3A22A 2VNOA 1MEC3 3W59A 2HWC2 3WD5A 1H8TC 5A6ZA 3RFRA 1MZ5A 4NIDA 5LBEA 1WCQA 2BUKA 5F3CA 1C4RA 5CIRA 5LA1A 2PMWB 4QX8A 1MVQA 4Y1XA 3AB0A 4RFT0 3O1MA 1EPWA 1UXZA 4QQHA 5T5LA 2BWCA 4AEDB 4XMIA 1POQA 4ZY9A 4CZSA 3KV5A 4LBJA 1NE6A 1NCQA 3AP9A 1FOD3 2YV8A 1AYM1 2P4EA 2RS13 2X09A 5JIUA 1Y43B 1ENRA 3TYJA 2R043 1A8MA 1RUC2 1Z78A 5FO7B 4YW6A 4QPGA 4N53A 3JBG3 3HBZA 1DGRN 3NL1A 4MH0E 4NPLA 1XNDA 2JD4A 2V72A 3ILRA 5APAA 2KD7A 5J98B 3ROUA 4XAAA 1ZZ6A 4BM8A 5A32A 2CGNA 5JPMB 1GZCA 2HEWF 3JQXA 2JD9A 1NG0A 5I0SA 1ZZ7A 4I0WB 5JXHA 2GMMA 1ZRRA 2Y6KA 4AR2A 5FZ8A 2WYSA 3WUDA 4CCJA 4Q0QA 5FYHA 2PQQA 4MHRA 2J1EA 3FC0A 1GSLA 3C2UA 1OUSA 4PIYA 4NIHA 4WM7B 4FXGB 1CZVA 3JU9A 4JQRA 4P9LA 5FP9A 4CDQC 2DWRA 2W9XA 4I3GA 2W87A 3DEMA 1MS5A 1SDDB 2Y6LA 2XBO1 5A7QA 2NM1A 2RM22 3HAGA 3ZYFA 4R9CA 3RJRA 2XHNA 5LRRA 4BA6A 5JCTA 3USSA 1LU1A 4LQRA 4LNVA 1Q8VA 4LO4B 3ZYBA 1ODMA 5FP3A 3ETQA 5A33B 1SLLA 1UX7A 4LIUA 1RUE2 1VMHA 1V6IA 5J48A 5JWPA 4P5HA 4A6SA 4J25A 3MF9A 5ABJB 2HWD2 5DG1A 2QQOA 1RYYA 3RG0A 3WG4A 4CDXC 3LSEA 4K1ZA 4FO9A 1PM7A 4LOTA 1VB2A 1YNAA 2XQRA 1KRIA 4PDWA 2ORXA 2W5FA 1YJLA 4H55A 4HLTA 4GB31 4H14A 4M0HA 1J59A 2RR12 5LEKA 1XSRA 2CTVA 1GOHA 5FV3A 1AXYA 4U36A 3ZVXA 2OIIA 1X8MA 5EJ1B 1YRZA 4Q4V3 3KCYA 2AEZA 3WNLA 1TVGA 1US2A 2FCVA 2IXLA 2WNVB 4MUVA 5HCFA 4AQ2A 3H50A 2ZEXA 2X5IC 4ZU5A 1OA4A 2E9QA 2HWF1 3MV11 1TME2 4JGYA 5L19A 1RUNA 1WMDA 2YU1A 1KJLA 4OHYA 3QACA 5C70A 1HB4A 4AHWA 2X8KA 3PU8A 2VZQA 2ZKNA 3ORJA 2BWAA 1W03A 3KD4A 1DZRA 2HBUA 2ARCA 3APBA 1OKOA 4Y20A 1H6XA 3ZFFB 4E9KA 3B9CA 4XW3A 1ZZ9A 3VKMA 3SEEA 1UY1A 3WG1A 2CU5A 3ZIWA 5FDBA 4IEQA 5I8YA 5FZAA 2PAEA 2UWAA 2WFF2 2Z79A 2GC1A 5FJKA 2VTXJ 3O0WA 2HKXA 4GKXA 2XHKA 3D5OA 1CAWA 4HPKA 4CEWA 1QOOA 1COV1 3OEAA 1G9FA 2GNDA 1YJKA 2JICA 3POWA 4TXWA 5FKBA 3LA3A 3W9AA 1OF4A 2X53S 4YZ1A 3B5LB 4LMFA 1QHDA 2KA3A 1GNHA 4N8MA 4YG0A 1OD3A 1RUF1 1SHWB 1W2NA 2J7MA 5F5CA 3RRDA 1TNRA 1MS1A 2BGCA 3VBRA 1UPIA 1M4WA 4PF1A 1HB1A 1PX4A 1ND3C 1PK6C 4TN7A 3KQ4B 2G19A 4ZS3A 2ARXA 4AYUA 4YSFA 3THPA 4YZ3A 4LULA 3SLIA 1X9PA 1ZZBA 3PUAA 4D7TA 4BE3A 2P37A 1JZ4A 4K1YA 4NO4A 4EWAA 2D44A 3VBFB 1J1TA 1K5MB 4LHNA 1GANA 1POV1 4QX3A 5JSPA 4MGSA 3VDDC 1MEC1 2RDNA 4L8QA 2AACA 3TN91 3ZR6A 4CP1A 2JDZA 3GJBA 3URFA 4RS5C 4R4ZA 2X05A 1IQAA 1WMEA 4M3CF 1DZTA 1RUI3 4GXLA 4YVSC 3O1RA 4PJYA 2CAUA 4GWMA 4YARA 1RUD2 1W3VA 3LPGA 4FPGA 5FCCA 1LGCA 2EAKA 5JZGB 1DYKA 1FOD1 1PGW2 4ATFA 5A7WA 3MI8A 2RS11 1V6NA 4Q4X3 5T52A 4CPBD 2QCSB 2R041 1GQHA 3N7LA 1LOEA 1WCKA 3VBSC 4E2GA 3WINE 1QGLA 1D2SA 1LOGA 3K3NA 4CRQA 3JBG1 5FBJA 2VMEA 1BHGA 2ZBJA 3I97A 5BXXA 3PDQA 4PIXA 1GQPA 5F3GA 1RUOA 4A45A 2NP0A 1AR93 2VO5A 4XDPA 2P6CA 4AI9A 1XYNA 4P14A 1BJQA 3M1HA 4Q2FA 2FDGA 5LWBA 1YQ5A 3VZKA 4EQVA 1ZRDA 5HV0A 3HR9A 1VRH2 4FPJA 2E51A 3H0OA 1XU2A 4NIGA 3B02A 4HN0A 1QQP2 2B9UA 3ZM8A 4IL7A 1PGL1 4OFGA 1H30A 3UL2A 1S2EA 5BY5A 4WVVA 2GNTA 3O1TA 1D4M1 3B9IA 3CKHA 5DZFA 4IUGA 1BKZA 3BGAA 4YVWA 1ND3A 1EV13 1V6KA 4NHXA 1OH4A 4LBKA 2ZGOA 3VBUA 2NPIA 1B35A 4R9AA 3NMBA 2ZPXA 4AXOA 4QAWA 1UPSA 2AENA 4E4HA 4PI0A 3LE0A 2BPA2 4U2AA 5DUXA 4F7ZA 2Z2SB 1SLIA 4FPFA 4QX0A 3PURA 4DINB 4DXSA 3IZOA 1JXNA 1F4AA 3PUQA 4XTPA 2YY1A 4H7MA 4CE8A 4MG2A 1TMF1 1ZYBA 3I54A 3LA2A 4Y1VA 3N36A 2OYZA 2FDFA 2ZHKA 3BODA 3IBMA 3MUZ1 5AFBA 3DXTA 4OHZA 4WM8A 4YW3A 1RVF1 2EA7A 1W2OA 2OZ6A 3P3PA 4FCAA 1HV1A 1NCRB 3H8XA 3C7OA 1WWYA 4DEVA 1IS4A 2CHHA 1LEMA 3WCRA 4GD4A 4UI9L 4GMP3 5FPVA 2VVFA 1OI6A 1KS5A 2WLQA 4BOWA 1WKYA 2WAAA 3I2HA 5C33A 1GZWA 1JZ8A 4MGIE 1WW6A 4KBBA 3WNMA 2RHPA 3MPBA 1H0BA 2DUOA 2W91A 4ORFA 1JZ7A 1UYPA 1ZRCA 1LHNA 1MZEA 2VMGA 4OI2A 1R1ZA 1TG7A 2D6MA 3LEKA 1ULCA 2D5HA 3Q8EA 4Y4YA 3UETA 5C71A 4N9IA 3DYPA 3UKTA 2Z4FA 5LB6A 4N90A 4L99A 1OBNA 4N7IA 4WVMA 2VOWA 4XUTA 3VHPA 3DXUA 1S0JA 2ERFA 4IE7A 4GALA 4EN8B 1O3TA 2DYCA 4Q8LA 3M3OA 5DAQA 4QDSA 3FUOA 3AZZA 3WDYA 4UBHA 3I59A 5LATA 3POYA 2V5YA 5FZ9A 3D0SA 2X29A 1DQ6A 2ZEYA 4FAHA 5IAXA 2ZA9A 2B42B 4MXVA 3ZXGA 2ZGQA 5C3QA 2BNOA 2QJVA 3L2YA 3FUQA 3B7MA 2AYHA 3KVBA 4N7UA 5JOXA 4RGAA 1JOJA 1UKRA 4CYDA 2A75A 1QJX2 1UW8A 2BEOA 5DZEA 2J1AA 5FYIA 1QJFA 2VZTA 4LE4A 4LBQA 3KHCA 5C4WA 1AHSA 2P17A 3M2MA 3CDZB 2ENRA 3WP6A 1Y9MA 2DCYA 5LK7B 3OGRA 2LROA 4CUCA 1AYN3 4AQ6A 1FNYA 3FMGA 3RZLA 1ND2B 2WYFA 1QOSA 1C8NA 2VTFA 3HWJA 5ACA3 1YFYA 3B00A 3NJZA 2G4IA 2WT2A 3JD72 1W04A 1WA6X 4WVZA 4YG3A 2XKPA 1NAEA 2R6QA 2A71A 1CIYA 1D7PM 1VBE2 3A0NA 3SXWA 4DUWA 2OPWA 5DUWA 3VBOA 1WLCA 4QXCA 1PIV1 3SNMA 1XE0A 3AX4A 4RN5A 1RUI1 4AAPA 3V0BB 4JQTA 5FUIA 3AYEA 1BYHA 4LLOA 1W28A 1FT9A 2YXSA 2OVUA 1YQ2A 2VAUA 3WF4A 4A3XA 1ZBA2 2BOJA 5FYZA 1HRV1 2VOTA 5CFDC 1DLCA 2HWE2 1JH5A 3W21A 1OOPA 3WHTA 4P9XA 3RI9A 4JX0A 4RQPC 2O1QA 3PMSA 1W8WA 2ARAA 4C0BA 2R30A 1ASJ3 1J1LA 1GP4A 4XXPA 5LBFA 2A3XA 3MV01 4BQ4A 3V56A 2QQKA 1SZBA 1UY4A 1W9TA 2D3RA 3AMQA 4L11A 1NXMA 1R1A1 1WCUA 3MLKA 4BQXA 4LLFA 3CJXA 1AZDA 2VMFA 1O4TA 1HLCA 2C4XA 2GAUA 3N35A 4DXZA 2TNFA 4LE3A 5CKMA 5IJRA 5EPAA 4O7XA 5A1AA 2DVAA 5A3WA 1DGLA 1CVNA 4V1PA 1VBB3 1FV3A 1HXS2 5D1IA 1XNAA 1DFQA 3AMPA 1LOAA 5KHIA 5CAZA 3SITA 2Q8CA 3PUIA 4QPWA 2RDQA 3OBRA 2PHWA 4I0BA 4QX2A 1X33A 2WQ8A 4LA2A 4A7KA 4R9DA 3M4FA 1W39A 1MS3A 4CVUA 1SPPA 1BBT2 3NW4A 4ES9A 3PMEA 3HQUA 4OMCA 3S7EA 4QU2A 2UURA 3CHXA 3H1YA 5FPBA 3MIBA 1KDMA 1TQ5A 4KG8A 2W3JA 5BNNB 5JMOA 2JG8A 3B93A 3WQ7A 4C8DA 3GNEA 4JHTA 1AL23 5F1RA 1ALYA 5FREA 1JYVA 1LECA 1EAH2 1YQCA 4OUMA 3U75A 4CEYB 2ZS6B 1KQRA 3VBHC 4FPCA 1R082 3RYRA 4PCRA 4D94A 4N9HA 1S55A 1C8M2 4LHLA 4LO6B 5GLWA 3E6CC 5JOZA 1DGRA 4ISQA 4BLJA 3PVEA 4GMP1 2YC4A 3NV1A 5IWFA 4CDXB 5A3MA 1YXWA 4Z82A 1UCXA 3OGSA 3SCHA 2RDSA 4A2UA 4QGNA 2Y6HA 4NRPA 5FQ0B 4UWDA 4XUPA 3VKNA 1HW5A 2R072 1S0IA
chains in the Genus database with same CATH topology
5A7WA 4QX7A 2XMLA 5A7QA 5FPUA 5IVBA 3U78A 3LDBA 5FP4A 5FP8A 5FUNA 4CCOA 5A3PA 2YU2A 5FZOB 5FYTA 3K3NA 5A80A 3N9PA 5FBJA 4GAZA 5FXZA 3PDQA 5A3NA 5F3GA 5FP3A 5E6HA 1VRBA 4D6SA 2W2IA 5A7PA 5A1LA 4LIUA 3KV6A 3AVRA 3PU3A 4XDPA 4UF0A 4AI9A 5IVEA 3RVHA 4V2VA 5IVFA 5IVCA 5F3IA 5FZMA 5LWBA 4D6QA 4EZHA 4LITA 5K4LA 5ISLA 4EYUA 3AL6A 4QXCA 3N9NA 5FPAA 3KV9A 5CEHA 2OS2A 4AAPA 5IVJA 2OQ7A 5FZ7A 4XDOA 2YBPA 3N9MA 3LD8A 5FYVA 5FV3A 4QXHA 5FZ4A 3PTRB 5FYZA 5FUPA 4ASKA 3ZPOA 4BISA 5FYMA 5FXXA 2GP5A 5FYSA 5F32A 5A7SA 3K3OA 5FZ1A 5IW0A 4HONA 5FZ6A 4CCNA 5FZGA 5A7OA 4BXFA 4E4HA 5F2SA 2Q8DA 3NJYA 2YU1A 4Y33A 3PURA 4IGPA 3PU8A 5A7WB 4URAA 3PUQA 2OT7A 4QU1A 3KVAA 4QWNA 5FXVA 5FZCA 5FWJA 2PXJA 2XXZA 5FJHA 5FY5A 2YBSA 5FZEA 4DO0A 3OPTA 3DXTA 4Y4RA 5FYUA 5FY1A 5FP7A 5FY9A 5LY1A 4CSWA 5F3CA 5FZAA 2WWUA 2YBKA 3PUSA 4UF0B 2YPDA 4QX8A 4Y3OA 5FJKA 5F5AA 4GD4A 5FZDA 4CCKA 5FPVA 5FZOA 5A3WA 3UYJA 4HOOA 5FZLA 2P5BA 5LW9A 4GJYA 3KV5A 5ANQA 2Q8CA 5F37A 5F5CA 3OPWA 5FXWA 2XDVA 4IGOA 2VD7A 3AL5A 5A1FA 3AVSA 4TN7A 4DIQA 4QXBA 2WWJA 5FYYA 4CUGA 3ZLIA 2Q8EA 3DXUA 5FPBA 3KV4A 3PUAA 4IGQA 5FWEA 5FZIA 5KR7A 5A7NA 5LY2A 5F3EA 4C8DA 4CCLA 2GP3A 5F39A 4LIVA 3K2OA 5FZ9A 5FZ3A 5FY7A 5FY4A 5FYBA 3N9OA 5FZHA 2OX0A 3N9LA 4D6RA 5FZ0A 4V2WA 2XUEA 3KVBA 5FZKA 5FZ8A 2OQ6A 4CCJA 5IVVA 5FYHA 4LXLA 5F5IA 5FYCA 5A3TA 4CCMA 5FZBA 5IWFA 4GJZA 4NUBA 3N9QA 5FPLA 5FY0A 5FYIA 5F2WA 5IVYA 3U4SA 4BU2A 4EZ4A 5FZFA 5FY8A 5FP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7W A;  4QX7 A;  2XML A;  5A7Q A;  5FPU A;  5IVB A;  3U78 A;  3LDB A;  5FP4 A;  5FP8 A;  5FUN A;  4CCO A;  5A3P A;  2YU2 A;  5FZO B;  5FYT A;  3K3N A;  5A80 A;  3N9P A;  5FBJ A;  4GAZ A;  5FXZ A;  3PDQ A;  5A3N A;  5F3G A;  5FP3 A;  5E6H A;  1VRB A;  4D6S A;  2W2I A;  5A7P A;  5A1L A;  4LIU A;  3KV6 A;  3AVR A;  3PU3 A;  4XDP A;  4UF0 A;  4AI9 A;  5IVE A;  3RVH A;  4V2V A;  5IVF A;  5IVC A;  5F3I A;  5FZM A;  5LWB A;  4D6Q A;  4EZH A;  4LIT A;  5K4L A;  5ISL A;  4EYU A;  3AL6 A;  4QXC A;  3N9N A;  5FPA A;  3KV9 A;  5CEH A;  2OS2 A;  4AAP A;  5IVJ A;  2OQ7 A;  5FZ7 A;  4XDO A;  2YBP A;  3N9M A;  3LD8 A;  5FYV A;  5FV3 A;  4QXH A;  5FZ4 A;  3PTR B;  5FYZ A;  5FUP A;  4ASK A;  3ZPO A;  4BIS A;  5FYM A;  5FXX A;  2GP5 A;  5FYS A;  5F32 A;  5A7S A;  3K3O A;  5FZ1 A;  5IW0 A;  4HON A;  5FZ6 A;  4CCN A;  5FZG A;  5A7O A;  4BXF A;  4E4H A;  5F2S A;  2Q8D A;  3NJY A;  2YU1 A;  4Y33 A;  3PUR A;  4IGP A;  3PU8 A;  5A7W B;  4URA A;  3PUQ A;  2OT7 A;  4QU1 A;  3KVA A;  4QWN A;  5FXV A;  5FZC A;  5FWJ A;  2PXJ A;  2XXZ A;  5FJH A;  5FY5 A;  2YBS A;  5FZE A;  4DO0 A;  3OPT A;  3DXT A;  4Y4R A;  5FYU A;  5FY1 A;  5FP7 A;  5FY9 A;  5LY1 A;  4CSW A;  5F3C A;  5FZA A;  2WWU A;  2YBK A;  3PUS A;  4UF0 B;  2YPD A;  4QX8 A;  4Y3O A;  5FJK A;  5F5A A;  4GD4 A;  5FZD A;  4CCK A;  5FPV A;  5FZO A;  5A3W A;  3UYJ A;  4HOO A;  5FZL A;  2P5B A;  5LW9 A;  4GJY A;  3KV5 A;  5ANQ A;  2Q8C A;  5F37 A;  5F5C A;  3OPW A;  5FXW A;  2XDV A;  4IGO A;  2VD7 A;  3AL5 A;  5A1F A;  3AVS A;  4TN7 A;  4DIQ A;  4QXB A;  2WWJ A;  5FYY A;  4CUG A;  3ZLI A;  2Q8E A;  3DXU A;  5FPB A;  3KV4 A;  3PUA A;  4IGQ A;  5FWE A;  5FZI A;  5KR7 A;  5A7N A;  5LY2 A;  5F3E A;  4C8D A;  4CCL A;  2GP3 A;  5F39 A;  4LIV A;  3K2O A;  5FZ9 A;  5FZ3 A;  5FY7 A;  5FY4 A;  5FYB A;  3N9O A;  5FZH A;  2OX0 A;  3N9L A;  4D6R A;  5FZ0 A;  4V2W A;  2XUE A;  3KVB A;  5FZK A;  5FZ8 A;  2OQ6 A;  4CCJ A;  5IVV A;  5FYH A;  4LXL A;  5F5I A;  5FYC A;  5A3T A;  4CCM A;  5FZB A;  5IWF A;  4GJZ A;  4NUB A;  3N9Q A;  5FPL A;  5FY0 A;  5FYI A;  5F2W A;  5IVY A;  3U4S A;  4BU2 A;  4EZ4 A;  5FZF A;  5FY8 A;  5FP9 A; 
#chains in the Genus database with same CATH topology
 4AHZ A;  3NNL A;  2R06 3;  3AP5 A;  4DRR A;  4XQD A;  3HN3 A;  2HWC 3;  5A3P A;  2YU2 A;  4ZHN A;  5GM0 A;  2XWJ B;  2ZTN A;  4RFR B;  5DAX A;  1CPN A;  3AKS A;  4G3Y C;  2H6C A;  5HCB A;  1K12 A;  1PO2 1;  3S6P A;  5E6H A;  1AUY A;  4ASM B;  2ZAB A;  3RMY A;  2VZP A;  3NQH A;  4XOG A;  1STM A;  4UF0 A;  1JU4 A;  2X5I B;  4XF3 A;  1DQ5 A;  1GZ9 A;  5E16 A;  2RMU 1;  5D8A C;  2GNM A;  3KLS A;  3LIH A;  1BXH A;  4QPI C;  4K8F A;  4YW1 A;  1OA2 A;  2EXJ A;  2P3Y A;  4DZG A;  3B94 A;  3LFM A;  5I0T A;  2WZ8 A;  2B4K A;  3FFZ A;  4JV4 A;  5ISL A;  1GP6 A;  3TEW A;  5EYX A;  4CP9 B;  3KCX A;  4PBP A;  4FQ4 A;  5T5O A;  1MQT A;  3BU7 A;  5H9P A;  2D7F A;  2QQV A;  2Y6J A;  3B3Q E;  2JEN A;  3B01 A;  1UX6 A;  4MLO A;  1DQ1 A;  2JDN A;  3IMM A;  3N7M A;  1O59 A;  3J4U H;  1HRI 2;  4KBZ A;  5FYM A;  3DEC A;  4XZP A;  4A42 A;  1IKQ A;  3AZX A;  5IW0 A;  3HBK A;  5CKQ A;  2W94 A;  2ZGP A;  2MEV 1;  3ZFG B;  4FFG A;  2ID4 A;  1U0A A;  3FHI B;  4HK8 A;  5ACA 1;  1UMH A;  3POB A;  4S2H A;  5FPZ A;  4I09 A;  1PK6 B;  3CJI C;  1U5Y A;  1GUI A;  2YBS A;  3E5U A;  1NKG A;  4KWL A;  4DO0 A;  5J7M A;  1P8J A;  5CFC A;  1ZM1 A;  1DF0 A;  5JMC A;  2W1S A;  4LR4 A;  5AC9 1;  3MW4 A;  2V4A A;  3MLL A;  1V6M A;  3FHQ A;  1UZY A;  1WMX A;  3PUS A;  1DCS A;  2E7A A;  2VM9 A;  5F5A A;  4XHX A;  4BPZ A;  1UF2 C;  1UU5 A;  2A6Z A;  4QGL A;  3UYJ A;  2BGO A;  2BZD A;  1UY3 A;  1RUE 3;  2AUY A;  4EJR A;  3LEG A;  3GBG A;  1AYM 3;  2FHR A;  2YGL A;  1KIT A;  3J8F 1;  4QKB A;  4RS5 B;  3GCW A;  3MF6 A;  4H2A A;  1YEW A;  4BLI A;  4IND A;  1GYK A;  2D97 A;  1VBC 2;  4FTS A;  1CAU B;  3OGJ A;  2IZW A;  3GZA A;  4XJU A;  4YG6 A;  3S7I A;  4YVS B;  2JIJ A;  1ASJ 1;  3CQO A;  3O1U A;  2FD8 A;  4ONU A;  1OH3 A;  3T3Y A;  4GQ7 A;  1WLD A;  2CL2 A;  3WP4 A;  4D69 A;  2VH9 A;  4QPY A;  4LBM A;  5C5U A;  3CMG A;  1VAL A;  2D3S A;  3DN7 A;  4Y22 B;  5F39 A;  1ULD A;  3UGG A;  2WNU C;  3QCW A;  3VBS B;  1JOB A;  1EPZ A;  3I3B A;  4AVT A;  2JDP A;  4HZF A;  3VD7 A;  2J1R A;  2VW0 A;  2I74 A;  5FYB A;  4LOR A;  1EYB A;  5C5T A;  3MW2 A;  2PAM A;  3KT4 A;  4FXK B;  5JI9 A;  3MIF A;  3MEP A;  4E8D A;  3O7O A;  5C8C A;  1VBB 1;  3H7J A;  3WW4 A;  5M0T A;  3RPQ A;  2W52 A;  2WN2 A;  5FY0 A;  5JR2 A;  3W5N A;  1ULG A;  2XBO 3;  5G04 L;  2WQ4 A;  4TWT A;  4CCE A;  5F9T A;  3U78 A;  5HCA A;  5FP4 A;  4CCO A;  4S2F A;  3WDV A;  4CDU C;  1IQD C;  1JUI A;  2VPV A;  3DYO A;  2VZ1 A;  4QT6 A;  3VBF A;  4PI2 A;  1RB8 G;  2G9G A;  1AL2 1;  1Z0H A;  4MGQ A;  5BYN A;  4DB5 A;  4ISR A;  4FFH A;  3ST7 A;  2QQW A;  3T09 A;  3ZYG A;  2VJX A;  4COY A;  2OPK A;  2BV4 A;  4FBF A;  4GB3 3;  1ZZC A;  2EAL A;  4I3P A;  1NLS A;  4UFJ A;  1VJ2 A;  2FDI A;  2QQJ A;  3KV9 A;  3RZJ A;  1US3 A;  2B45 X;  4ZXE A;  4A41 A;  1I5P A;  1Q8S A;  1OHF A;  4YM1 A;  1W6P A;  4AI3 A;  4DUX A;  5FZ4 A;  1YC6 1;  1BEV 2;  1ZRI A;  4OUE A;  3S5A A;  4Q4Y 2;  2XR4 A;  1VBD 1;  3EO6 A;  1VMJ A;  4RGK A;  2HWF 3;  2LAL A;  3TAY A;  1NCQ C;  3ZYJ B;  4G9S B;  1AR8 2;  2HWC 1;  4HON A;  4MYE A;  5FZG A;  1GMM A;  5B4X A;  4NOT A;  4QPG C;  4N53 C;  1UU4 A;  3ZFE A;  4IGP A;  2NN8 A;  2A6Y A;  1PNF A;  3JCI A;  4LHK A;  5E88 A;  1I1E A;  5GAL A;  3I2J A;  4K6B A;  5T50 A;  5BNN C;  5FY5 A;  4FPK A;  4QQP A;  4XE9 A;  4L97 A;  2JE9 A;  3OPT A;  1GOG A;  1BZW A;  2EF6 A;  5FYU A;  2OA2 A;  3PUH A;  2BOI A;  1RUC 1;  1YIF A;  3OD0 A;  3HNM A;  1H9P A;  3NNG A;  4NRO A;  1RJ7 A;  4QB2 A;  3ZYI B;  3O1S A;  1UIK A;  1NXD 1;  4P00 B;  2QFE A;  1PO1 3;  4B1M A;  2Y64 A;  5KC5 A;  1UO9 A;  3H7Y A;  1LOD A;  1VR3 A;  4QKF A;  5GLZ A;  3SH4 A;  3V0A B;  4Y5T A;  4ZU4 A;  1RUF 3;  2CY6 A;  3NRU A;  4QD2 A;  4OQ9 A;  1FNZ A;  3HQR A;  4MET A;  1FMD 2;  3JXS A;  3C7H A;  3PJQ A;  4LBO A;  4AFA A;  5GKA C;  3CU7 A;  1JS9 A;  4IGO A;  5EP9 A;  3MPP G;  3WQ1 A;  2UYB A;  4JGZ A;  2PHR A;  4FP3 A;  4QDQ A;  4AAX A;  3SKV A;  4XAE A;  4PQ9 A;  2WZE A;  3R4U A;  1QQP 3;  4OUS A;  3AK0 A;  1UZW A;  2JX9 A;  4QKD A;  5CA6 A;  3LOB A;  1VBA 2;  2Y26 A;  2F4L A;  1L7L A;  3TN9 3;  4QGM A;  4OI0 A;  2YFU A;  4AVV A;  5LA0 A;  2GH2 A;  3MFA A;  4UFI A;  5IUQ A;  2DDU A;  1QEX A;  2R1D A;  2CSG A;  4PDW C;  4UW5 A;  4B4P A;  3E5X A;  1UOB A;  2BJS A;  2HWB 3;  2OQ6 A;  2V09 A;  5A3T A;  2RS5 2;  4QQO A;  1RUE 1;  4GJZ A;  1PM4 A;  3LKJ A;  4M00 A;  4XF1 A;  5DMY A;  1SCS A;  2JG9 A;  4K21 A;  4MHU A;  1HB3 A;  1XJA A;  3KGZ A;  4LJH A;  2WSV A;  3ENR A;  5EWS A;  4X8N A;  4EN9 B;  5FPU A;  5FUN A;  1OF3 A;  1RUH 2;  1W8Z A;  4OYU A;  1UY2 A;  2PHF A;  1O6U A;  2YPJ A;  4JGY C;  4GIQ A;  5CFD B;  1CD3 G;  1GV9 A;  2RR1 1;  1EY2 A;  1W8U A;  5FXZ A;  5F7U A;  3EYP A;  2DVG A;  5GLT A;  2ZXQ A;  2HJI A;  2GDF A;  4UBG A;  5DDJ 3;  1GWM A;  5FLJ A;  1AX0 A;  5L7O C;  1Y9Q A;  3AJY A;  3HNB M;  4OI4 A;  3ZR5 A;  3A0K A;  4RQP B;  5IVE A;  2NMN A;  1L7R A;  4RR3 A;  5F3I A;  2XL7 A;  1RUJ 2;  1WCS A;  1HDK A;  3V65 A;  3ZYR A;  1RHI 2;  5JXI A;  3E97 A;  3WNO A;  5K9Y A;  2VVD A;  1LGB A;  2ZZQ A;  3AM2 A;  1ZA7 A;  4JTO A;  1XE8 A;  4XF9 A;  3N9N A;  5FPA A;  3J9S A;  4JVA A;  3THT A;  2J1T A;  2YC2 A;  3VDB A;  5DAW A;  2OS2 A;  2BQP A;  2P34 A;  4I2O A;  1D4M 3;  1UMI A;  4CEW C;  2E32 A;  1MR5 A;  4QXH A;  1L3J A;  3PTR B;  1VB4 A;  1QJU 3;  3NNF A;  1D0H A;  2OXB A;  3K4D A;  2R49 A;  3ZPO A;  2AR6 A;  1VAM A;  3AKR A;  1JYI A;  2J1S A;  4DFS A;  4NIA A;  1C3H A;  3BN6 A;  1WBF A;  3ZN4 A;  1CZS A;  2D6N A;  5C9A A;  2WT0 A;  4M3C A;  4R8H A;  4QMA A;  2O0O A;  2VW1 A;  3VBR C;  5DXD A;  1LOB A;  4HFS A;  1S1A A;  4XFB A;  3VKL A;  1ND2 A;  2WFF 1;  2EIG A;  1W6O B;  1RED A;  1IG3 A;  2ZX1 A;  3HNY M;  4QQL A;  4QKN A;  1I5Z A;  5BNO A;  1TMF 3;  3O0X A;  4Q4W 2;  4XPV A;  1RUG 3;  4J6G A;  5LEJ A;  4JCK A;  4AI8 A;  4AHX A;  2OT7 A;  2Y6G A;  3U11 A;  3WW3 A;  4BHP A;  3ILN A;  1AX2 A;  4QXK A;  4WZF A;  2Y34 A;  4Q0V A;  5FWJ A;  4DQA A;  1RVF 3;  1WBL A;  1WA4 A;  3K75 B;  4YPJ A;  1V00 A;  3OEB A;  1LOC A;  4YZ2 A;  4E4Z A;  5J09 A;  4J1W A;  2QQN A;  1U5I A;  3T1M A;  1OFS A;  5FY1 A;  3FX3 A;  3AYA A;  2UY8 A;  3MLJ A;  4H3W A;  3EQE A;  3JUU A;  1KGY A;  4CSW A;  3V0B A;  2IVJ A;  5GLV A;  1IPJ A;  1NUK A;  4UYB A;  4IEX A;  5GZF A;  2R7E B;  1Q8P A;  3S5Q A;  4XCA A;  5FZL A;  4NWW A;  4BK4 A;  1KJR A;  3FFQ A;  1UU6 A;  2OW4 A;  1W8H A;  4IV1 A;  1UWW A;  1XSQ A;  2Y0O A;  2IFW A;  3NAP A;  4HKL A;  3PTY A;  4LEJ A;  2YFZ A;  3KWV A;  3AXD A;  1FAY A;  5L7O A;  1DGW X;  2QBX A;  1KFU L;  5B4N A;  4YM2 A;  2WWJ A;  1HN0 A;  1KS4 A;  2UY9 A;  3GGL A;  3ZYP A;  4XFC A;  2E26 A;  1SG3 A;  1UYX A;  1S2B A;  1DQ4 A;  1YHF A;  2J1V A;  3LIG A;  2DVF A;  4IE6 A;  5A7N A;  5LY2 A;  2FMD A;  3FL7 A;  4LIV A;  2YDE A;  1PGW 1;  3AZW A;  3DF0 A;  1PZ7 A;  2LM3 A;  1BQP A;  1NY7 2;  2ADD A;  4HVO A;  3OBT A;  2GSY A;  3WG2 A;  2YZ4 A;  5GZC A;  3IDA A;  1PO1 1;  1IKP A;  2CDP A;  4ES8 A;  3QH6 A;  4BIF A;  1A3K A;  5FZB A;  3KGL A;  1OLQ A;  4QPI B;  4XF0 A;  2NYY A;  5F5Q A;  1AR6 2;  1D4V B;  2W47 A;  4K40 A;  4D8M A;  1AX1 A;  3RQ0 A;  5LCW L;  1ZBE 2;  1AR7 2;  1G9D A;  3U0Z A;  1C5I A;  1RGS A;  1PVC 2;  2PEL A;  3A23 A;  3PNA A;  4P5Y A;  4Q1R A;  4QQ2 A;  4YVW C;  1V0A A;  1GWL A;  2AC1 A;  3DPR A;  1XNT A;  2DCJ A;  2PHU A;  3VBU C;  1VRH 1;  1B35 C;  2VQU A;  1T6B X;  3X29 B;  1QQP 1;  3I2D A;  2VVE A;  4FOV A;  3RWK X;  1QJZ A;  1VRB A;  3LEI A;  2PLV 3;  4IXL A;  4H7L A;  5LA2 A;  1HXS 3;  4AEJ A;  4SBV A;  1YCI A;  3RVH A;  4CEY A;  3DUI A;  2VZV A;  1SDW A;  2A1X A;  5FIX A;  5FLH A;  1HQL A;  1PIV 3;  2OUH A;  2WSU A;  4NHM A;  5C6C A;  4CCC A;  2ZOE B;  3OGG A;  2WO7 A;  3OYW A;  4RD7 A;  1H4G A;  1C57 A;  1W8O A;  2Z42 A;  4WM8 C;  2HWB 1;  4NMI A;  3BI3 A;  2VCM A;  3I3D A;  4Q0U A;  3ZSE A;  1LR5 A;  5BNP A;  2D43 A;  4NII A;  1HRV 3;  4B7E A;  1W2A X;  2XL9 A;  1YFW A;  2DTY A;  2XKO A;  3LGR A;  3CJI B;  3LFI A;  4NPM A;  4AVB A;  5CYY A;  3ZYH A;  1OUX A;  1HJG A;  5T5P A;  5DPN A;  3K3O A;  4FQZ A;  5EV7 A;  2ES3 A;  3AZY A;  2XQX A;  2VU9 A;  3K4A A;  1SBE A;  5FZ6 A;  3WOG A;  2P3I A;  3POF A;  1W9Y A;  2ORZ A;  2VUD A;  2WS9 2;  2KXL A;  2XUM A;  5I93 A;  1W6N A;  2EID A;  5KBF A;  4DOU A;  4YZ4 A;  4IDZ A;  5DDJ 1;  3T2P A;  3VN4 A;  2XJR A;  2WZR 2;  1R1A 3;  1G8W A;  1LNS A;  4Q1P A;  3A21 A;  3MIG A;  2FZ2 A;  2NMO A;  2ARE A;  3ATG A;  3C7G A;  5FMC A;  2JKX A;  5DUU A;  2VR4 A;  1COV 2;  4TYS A;  2Y60 A;  3M3I A;  2ET1 A;  3I2F A;  4FFI A;  2LS6 A;  3ZOI A;  4XFF A;  4EN0 A;  2WWU A;  2RS3 2;  2RDR A;  1W2U A;  2WAO A;  1QJU 1;  1W90 A;  1W99 A;  3HVD A;  1J3R A;  3AYC A;  5FZO A;  1QMJ A;  2VL4 A;  4HOO A;  2ZMK A;  4YW7 A;  1FPN 3;  1R09 3;  2UU8 A;  5C4W C;  2CAV A;  4MX3 A;  2PA7 A;  2VNG A;  3Q8F A;  5CNA A;  4O9G A;  2BU9 A;  3HN1 A;  4D0Q A;  1G86 A;  4RHV 3;  4UOJ A;  2G9F A;  1V9U 2;  1J83 A;  3AL5 A;  3WXP A;  4L9B A;  4DIQ A;  3AMH A;  4UFH A;  1CPM A;  1RUG 1;  4M01 A;  4YW4 A;  1GIC A;  1Y7B A;  2B46 X;  1QJX 1;  5FZI A;  3RYK A;  5CVR A;  5CU1 A;  1S0B A;  4COU A;  4ZS2 A;  1DZQ A;  3I2I A;  3BOP A;  4WBB A;  1HRI 3;  3AKP A;  2EXK A;  1RMU 2;  5CB7 A;  4CDU B;  4FPL A;  1S0G A;  3T30 A;  4XET A;  3O1V A;  4XJ9 A;  5FLI A;  3VBO C;  3PIG A;  3QD6 A;  4KQ7 A;  3KHB A;  4LUM A;  2NZ9 A;  4HMZ A;  4HAN A;  3I3Q A;  4XEZ A;  1FOD 2;  3CF6 E;  4NHL A;  2WDB A;  2QDR A;  2RS1 2;  1IHM A;  2R04 2;  4NUB A;  3JD7 1;  1QDO A;  4FT8 A;  5EQU A;  3WCS A;  1UXX X;  3JBG 2;  1O4Z A;  2JIG A;  3E1F 1;  1OOP C;  1VBE 1;  5IVB A;  1WD3 A;  5KHJ A;  4XBL A;  4IE5 A;  1PO2 3;  5FYT A;  1YLL A;  3J7H A;  1REE A;  4MAD A;  3SEP A;  2XJS A;  4Y22 A;  4AI0 A;  5FMB A;  2XPJ A;  5A3N A;  1ULO A;  2RG4 A;  3Q8C A;  4LKE A;  2RMU 3;  3OOX A;  4NE9 A;  1NCQ B;  1ZBA 1;  4IV3 A;  3CBN A;  1NQJ A;  2HWE 1;  4IE4 A;  2WO3 A;  5JR7 B;  2GC2 A;  1H6Y A;  5IVF A;  1W05 A;  5FZM A;  3ZN6 A;  4FOQ A;  3MID A;  4URT A;  5K0U A;  1J3Q A;  4GMP 0;  5K7P A;  4LKS A;  2B39 A;  3BUC A;  5HXM A;  1XE7 A;  5FPX A;  3ETP A;  2OQ7 A;  2ADE A;  5A32 B;  1IPS A;  2F4P A;  4HT1 T;  3LD8 A;  4JKL A;  4XDO A;  5G05 L;  1Q8Q A;  5LBC A;  4RYD A;  5EJ3 A;  3N7K A;  1ONA A;  4XUQ A;  3P5B A;  3CEW A;  4Y26 A;  3MZH A;  5F32 A;  3ZN5 A;  1WCD J;  1N3Q A;  1Q43 A;  2MEV 3;  5A7S A;  3WF2 A;  3VZJ A;  3AMM A;  2WUH A;  4HSJ A;  3O1O A;  4CDW B;  2O14 A;  5A7O A;  4BYY A;  4BXF A;  3C7E A;  4OZO A;  3W58 A;  5IK4 A;  4P9J A;  3Q8A A;  4B1L A;  4JKK A;  4ZU7 A;  5HBA A;  2PLV 1;  2RJ2 A;  4GH4 A;  4GWJ A;  3LA7 A;  4FOY A;  1RC6 A;  2VBP A;  1HXS 1;  4FPH A;  2JG8 C;  3Q9O A;  4HXC A;  1JYW A;  4YW2 A;  1CZT A;  1QY4 A;  1NA1 B;  2IC1 A;  4IE0 A;  4DXT A;  4NAO A;  5AC9 3;  5I8T A;  5JSO A;  2ZAH A;  2Q30 A;  2DF7 A;  4Q4V 2;  1CAV B;  1GU3 A;  4JC1 A;  1BBT 1;  1H8T B;  3J7L A;  1W9S A;  2MNG A;  1SFY A;  2I45 A;  4JDO A;  2ZGR A;  5C3P A;  1X8E A;  4NWV A;  3J8F 3;  3LSD A;  5IFP A;  1MS9 A;  2FDH A;  4G4F A;  4N43 A;  3IAQ A;  5J37 A;  4YRD A;  4PDW B;  2QZ2 A;  1EAH 1;  1FYU A;  2V73 A;  1W9W A;  1HQW A;  2E7T A;  4FP2 A;  5LW9 A;  4LBL A;  1O8S A;  2C24 A;  1T6G C;  2YRO A;  3OY8 A;  3ALQ A;  2VD7 A;  3AP4 A;  1C8M 1;  4XAB A;  5L9V A;  1YIP A;  3CIH A;  3FWE A;  4TTG A;  3ACL A;  3NNJ A;  1F15 A;  4I01 A;  3SHR A;  3WEZ A;  5A3O A;  5A6X A;  1NX9 A;  3I49 A;  4IEU A;  5F3E A;  1BEV 3;  4JHZ A;  3M8L A;  4Q5O A;  4ZPI A;  3RNS A;  2W1U A;  5HPO A;  4Q4Y 3;  2QQI A;  2W0X A;  4Z2W A;  4JGY B;  3R6S A;  3BIE A;  1UD1 A;  1EUU A;  2QTW B;  3BB6 A;  4YGB A;  3ZKU A;  2DU0 A;  3MYX A;  4CXW A;  2I07 B;  4LTA A;  4D7Y A;  3ELN A;  2XUE A;  2JXA A;  4BB3 A;  1LOF A;  3JZV A;  2QKD A;  2SLI A;  3CZJ A;  5F5I A;  1MQT C;  4XAC A;  2A5Z A;  4KWK A;  1QNY A;  4CU9 A;  3VZO A;  4D7S A;  3VHN A;  1CAX A;  4ZKT B;  1FPN 1;  1R09 1;  1J84 A;  3U4S A;  3LEM A;  2VUC A;  2QQM A;  4RHV 1;  4D3W A;  5IAT A;  3SKJ E;  1HN1 A;  2DCK A;  2A70 A;  4HK9 A;  1CAW B;  2G9Z A;  4HPK B;  3ZMN A;  4CEW B;  4CDQ B;  4TZD A;  3AFG A;  3ZXE A;  3GZT B;  3EMR A;  4FOW A;  4MXW A;  1JU3 A;  4ZXK A;  1QJY 3;  2UWC A;  1OLM A;  3ZDV A;  2EIC A;  3AFK A;  5A7P A;  3MW3 A;  2Q0A A;  3THD A;  3R4D B;  3VBR B;  1HRI 1;  4R4X A;  1W6M B;  2H6B A;  2E63 A;  2BP6 A;  5J36 A;  1ENQ A;  2LW8 A;  2YB7 A;  4Z07 A;  1XQN A;  2MPF A;  1N3P A;  5CFC C;  4AED A;  3RI8 A;  2ARB A;  2ZX4 A;  1UOF A;  1A34 A;  5HI0 A;  4Y1Y A;  1F5J A;  3B69 A;  4BQ5 A;  4Q4X 2;  2GAL A;  1IG0 A;  3D6E A;  4P9I A;  3UGF A;  1VBD 3;  5FR3 A;  1MS4 A;  2XLA A;  3CNA A;  3ITQ A;  3H1W A;  5FUP A;  2ILM A;  3OD4 A;  2JDU A;  3ON7 A;  5JOW A;  3EHK A;  2C9K A;  3I2G A;  2WKK A;  4ITC A;  2VEC A;  1AR9 2;  3INA A;  5JXG A;  2Y8K A;  4HKO A;  2DUQ A;  2XVL A;  4A3Z A;  3FLT A;  3J7N A;  2CGP A;  2WN3 A;  4XVH A;  5JDB A;  2WR9 A;  3NJY A;  4JDN A;  4CU7 A;  1MAC A;  4XJZ A;  4A7Y A;  3D82 A;  3WUC A;  1UNB A;  4OMD A;  5A7W B;  3FJS A;  2YG0 A;  4BZ4 A;  5FAX A;  3CZU A;  4JAA A;  3BTY A;  5FO9 B;  4HBN A;  3VUO A;  5H9Q A;  5GJ6 A;  1RUC 3;  1H1I A;  4MOA A;  1AVB A;  3POG A;  5JIA A;  5FZE A;  4XUR A;  5BPX A;  4WM7 A;  3UES A;  3FZ3 A;  5T55 A;  4AFM A;  4YLZ A;  4KNC A;  2GC3 A;  4BQ3 A;  1EV1 2;  1HKD A;  1IS6 A;  1G6N A;  2D6L X;  2YBK A;  5E89 A;  3NV3 A;  3PVB B;  3VD3 A;  3WNX A;  4CTE A;  5C8C C;  4AQT A;  3AP7 A;  5JXJ A;  4CPB A;  4UXA A;  5JPN B;  4BK5 A;  1OVP A;  2ET7 A;  2VMH A;  2EIB A;  3OUJ A;  5HV4 A;  1X82 A;  2PHD A;  4XIL A;  3KM5 A;  3VD4 A;  5A33 A;  3MBW A;  2VOV A;  5TSW A;  3GCX A;  5FXW A;  1RHI 3;  2XDV A;  1SAC A;  2WWS A;  3UGH A;  3DKW A;  5ABJ A;  3RZK A;  2W92 A;  2A6V A;  3VBF C;  4YVW B;  1ND3 B;  4A4A A;  4ERO A;  4DMI A;  2D98 A;  5KR7 A;  3VBU B;  2C6S A;  3IWZ A;  4AEK A;  3WNK A;  2RM2 3;  1B35 B;  4F3J A;  2EXH A;  4AW7 A;  2PFW A;  5KHG A;  3VKF C;  1W06 A;  1JBC A;  5FY7 A;  3VDD B;  4K7J A;  2JWP A;  5SV8 A;  4B8E A;  5FZ0 A;  5FZK A;  5JLV A;  3L2H A;  5KWR A;  4LK6 A;  4Q29 A;  2WNV A;  3C7F A;  3H1M A;  2HWD 3;  1UYZ A;  4LOS A;  1JOP A;  2JEC A;  3HD8 B;  3NKG A;  3QBQ A;  4K20 A;  4KMQ A;  3TBD A;  4WM8 B;  1ENS A;  5EHD A;  5FZF A;  2Y0I A;  5FY8 A;  4C90 A;  3ACF A;  4HKW A;  2RR1 3;  2P1B A;  3LDB A;  5FP8 A;  3ZSJ A;  3VD5 A;  1WD4 A;  1GZW B;  2ZGS A;  4BCU A;  3ZFF A;  4P9G A;  2Q8O A;  2A7A A;  2C26 A;  1DGW A;  3ZFE C;  4AVA A;  4CP2 A;  1BEV 1;  2VOX A;  2W2I A;  4M4R A;  4DNY A;  5C3S A;  2B9V A;  4UFK A;  4Q4Y 1;  1D0G A;  5C8W A;  1FXZ A;  3FLP A;  2VCA A;  4NJ4 A;  3WDW A;  4JRA A;  3IAP A;  4V2V A;  1AR8 1;  1TME 3;  3PHM A;  2A3W A;  4WVM B;  4W6Y A;  1WLW A;  4KWJ A;  1Q5O A;  4OLL A;  2RE9 A;  4B7K A;  4CP0 A;  3NO8 A;  4DY5 A;  1SQ4 A;  3ACG A;  3I59 B;  4XIK A;  2C9A A;  4PHZ A;  5FYV A;  4AL9 A;  3PLQ A;  4MGZ E;  5KXD A;  3BPZ A;  1AYN 2;  4GZ9 A;  2XVK A;  1LB2 A;  4JZR A;  3VZN A;  1K5J A;  3HIF A;  1JI6 A;  3T0D A;  3ZSL A;  3IPV B;  2XJP A;  3LCP A;  2WFF 3;  2VBB A;  3WDU A;  1LES A;  1K5M A;  3MDP A;  3UJQ A;  4JGZ C;  1Z7S 2;  2ZCW A;  1LHO A;  1QJY 1;  3III A;  4LBQ B;  4QX5 A;  2Q8D A;  5C4W B;  5A70 A;  4IES A;  4W4Z A;  4X6Q B;  2DBN A;  2WBK A;  2CGO A;  2VE1 A;  2VOK A;  3AP6 A;  4M3C E;  1WGP A;  3S30 A;  3VHR A;  4RA0 A;  1L7Q A;  2ZJC A;  5LK5 A;  3WP3 A;  1FMD 1;  3ZIX A;  1JW6 A;  1O3R A;  4QM8 A;  2JE7 A;  3LF7 A;  4Y5Z 0;  4BWO A;  3M3C A;  1W0P A;  1NCR C;  1CN1 A;  2XVG A;  2XJV A;  5FY9 A;  5JZG A;  2Z5W A;  1UOG A;  2VCC A;  4F8A A;  4AEM A;  2K9Z A;  1SBD A;  1DDL A;  3BKZ A;  1F31 A;  1F9K A;  3ASI A;  2JG9 C;  3M3Q A;  4XTM A;  1ASJ 2;  4YGE A;  2Q1F A;  2HH9 A;  3VBO B;  4E4S A;  1W9F A;  2A3Y A;  2LRP A;  2VZS A;  1WZX A;  3H3U A;  3KZ4 C;  1JHJ A;  1OSG A;  2C1F A;  3RGB A;  5I0U A;  2V5D A;  2W1W A;  4L0P A;  4XMA A;  4C0H A;  5I8S A;  3KS7 A;  4GKY A;  5FYY A;  1RUD 3;  3ZLI A;  3FBY A;  2IXK A;  4LKD A;  2BER A;  2XJQ A;  5DAB A;  1OFN A;  5CBL A;  5J3U A;  2QNK A;  1OOP B;  1RIR A;  2VZ3 A;  3HOB A;  1NZI A;  3WF1 A;  4GA9 A;  1LUL A;  2BVB A;  3AKT A;  2ZHM A;  3K2O A;  4RR3 C;  1OVS A;  3A4U A;  3UNP A;  5FY4 A;  2NLR A;  1CES A;  1VBB 2;  4NAM A;  3KMH A;  4LO8 A;  1YQ8 A;  3N9O A;  1GP5 A;  2OX0 A;  3GBW A;  1Y9G A;  4L92 A;  3WDT A;  2IXH A;  3T2Q A;  5FYC A;  2FCU A;  2F6B A;  4FSJ A;  3USU B;  3O0V A;  3N9Q A;  2WZR 3;  3NJV A;  3R0R A;  1RJ8 A;  5FPL A;  3WP5 A;  1VIW B;  1I6X A;  5IVY A;  4UFL A;  3W5M A;  5LAS A;  1VRH 3;  1CON A;  1XNB A;  1YFU A;  4J1X A;  5LA9 A;  5C3O A;  1IOA A;  1RUJ 1;  5C9A C;  4OQ8 A;  2DFC A;  4XIO A;  1RHI 1;  1UZV A;  2QQU A;  3LDK A;  4QX7 A;  1JUH A;  3BTA A;  1AL2 2;  3IDE A;  4BDV B;  1IZ3 A;  1ND2 C;  1UQX A;  3NV4 A;  4NHK A;  2E6V A;  5FMO L;  5FFO C;  2QUO A;  5BNO C;  3ZO0 B;  2JDH A;  3PL0 A;  3DKQ A;  4YM0 A;  3ES1 A;  1W6Q B;  1NCR A;  2RM2 1;  5A1L A;  3P6B A;  1QXR A;  1LCL A;  3NJX A;  4KGQ A;  4M0N A;  1SPP B;  4YWA A;  1MS0 A;  3HMY A;  3WHU A;  3BVC A;  5T5J A;  4CUA A;  1CJD A;  1JYC A;  4COV A;  1H4H A;  3IB3 A;  2R06 2;  2HWD 1;  4Q4W 1;  3RWN A;  1PMJ X;  4B3N A;  3JQW A;  1SFP A;  1RIN A;  4NPR A;  2W08 A;  4FPO B;  3DCQ A;  4W50 A;  1CX4 A;  3H8O A;  1X7N A;  4ARX A;  2GZW A;  4DS0 A;  2WQZ C;  4IV1 C;  4EN6 B;  4KU7 A;  1PVX A;  1RMU 3;  3NAP C;  5F8P A;  3ZXJ A;  1N1T A;  3KT7 A;  4LA3 A;  4CA9 A;  1POV 0;  1UIJ A;  4E2Q A;  3T08 A;  4HVQ A;  3I7D A;  3J7M A;  1LED A;  2GH8 A;  2X10 A;  2AH2 A;  4LBQ D;  2QQP A;  2JKB A;  2DU1 A;  2Z69 A;  2WJS A;  3WT3 A;  1BMV 2;  4Z8B A;  3WDX A;  4YGC A;  3PJY A;  2E31 A;  4FTE A;  3WF0 A;  2L9L A;  4NHY A;  4Q27 A;  1TME 1;  1RXF A;  3GBF A;  4W6W A;  1F8V A;  3VDA A;  2Q5T A;  2BFU L;  5GZG A;  3EJK A;  4IEO A;  4S2D A;  4BJ0 A;  2RJL A;  4OZX A;  4DEQ A;  4XJW A;  2VQ0 A;  1K3I A;  2DCZ A;  2CDO A;  3AZV A;  4MO3 M;  4FPY A;  3I2O A;  4KG0 A;  4UF0 B;  4NR1 A;  4L2N A;  1Q3E A;  2HEV F;  1SLB A;  3SMH A;  5IHR A;  2BRT A;  3ES4 A;  2KM2 A;  2WLP A;  2DV9 A;  3UT0 A;  4LBN A;  4WZC A;  2ZX3 A;  1J3P A;  2ZKL A;  1SLC A;  1YFX A;  4XQ4 A;  4PF5 A;  1NY7 1;  1N47 A;  3VV1 A;  2D6P A;  3DPR C;  4CDW A;  4Q8K A;  1E5I A;  1MQT B;  4BME A;  5I91 A;  5KC6 A;  1F5F A;  1MS8 A;  4O61 A;  1PMH X;  3THC A;  1QJX 3;  2CWM A;  4MSV A;  4CUB A;  1LAJ A;  1LHU A;  1X9T A;  2NQY A;  2WA3 A;  2D40 A;  2WC2 A;  1XB9 A;  1SBF A;  3HPN A;  1NA1 A;  1AR6 1;  1J58 A;  3BU0 A;  5T3N A;  4CCL A;  4FFF A;  1AR7 1;  1ZBE 1;  3OTF A;  1C28 A;  4CEY C;  1U5Z A;  1PVC 1;  4IW3 A;  3U07 A;  4BQ2 A;  2E53 A;  2ZAC A;  2WII B;  1A78 A;  4A44 A;  1CAV A;  2VTX A;  1H8T A;  1AYM 2;  4EWE A;  1CQ9 A;  2FDJ A;  4Q26 A;  1X36 A;  4HSL A;  4XC9 A;  4V2W A;  4XYX A;  3WNN A;  1ENX A;  3VBH B;  3JD7 3;  5BNP C;  2UYA A;  4LXL A;  2ZEZ A;  2JDA A;  2ZHL A;  2XOM A;  1ZZ8 A;  1JYN A;  2BVV A;  4X8P A;  1F35 A;  3E5Q A;  3RMX A;  5CFC B;  3LPF A;  1VBE 3;  5F2W A;  3G6J B;  3RSJ A;  4AI1 A;  4XFH A;  3WNP A;  4EE2 A;  4HN1 A;  1WMF A;  1BK1 A;  3OBZ A;  1EP0 A;  2YMZ A;  4ZON A;  3O14 A;  1ULF A;  2DFB A;  3POE A;  4XXA A;  2WO1 A;  3QOP A;  4S2G A;  1RUD 1;  2VY0 A;  3L9J T;  1W8N A;  1ZBA 3;  1B09 A;  1S4C A;  2HWE 3;  1HV0 A;  3POI A;  3CO2 A;  3OG2 A;  3BYW A;  1I9R A;  2VXJ A;  1W8T A;  2WO2 A;  1AXZ A;  1H1M A;  2SBA A;  1O8P A;  2VUA A;  2LUW A;  3HEI A;  1YQ6 A;  3KV6 A;  4Y1U A;  3AVR A;  4COZ A;  1N1V A;  4HVR A;  4Z1V A;  3O1P A;  3MIH A;  3N3H A;  2VMC A;  3FHA A;  1VMF A;  5L9B A;  3WX5 A;  2DVD A;  1O7F A;  2C0Z A;  3VHO A;  4K9S A;  5IT6 A;  5D8A B;  4LIT A;  5K4L A;  1SLA A;  3TB0 A;  4DUV A;  2XBO 2;  3E6D A;  2WS9 1;  4EV0 A;  1SLT A;  3AL6 A;  1URX A;  1XOY A;  3OJB A;  4XFA A;  5DZG A;  1G9C A;  1ZA4 A;  5GZD A;  1LTE A;  1R64 A;  2WZR 1;  2W46 A;  2WL1 A;  3IT8 A;  4AVC A;  2RVA A;  4AWD A;  1PHM A;  4NN0 A;  4PT6 A;  4FI9 A;  2DUP A;  2VMI A;  3F2Z A;  3R05 A;  4ARY A;  4YNI A;  4CDQ A;  1AJO A;  4Q0P A;  3ZFG C;  5BNN A;  3OF1 A;  1GR3 A;  5C8C B;  2J42 A;  5EJZ B;  5JUV A;  4A6O A;  1JZ6 A;  2RS3 1;  3HT1 A;  1FI2 A;  2VNR A;  4GB3 2;  5JOY A;  3J26 N;  2OUJ A;  4IEY A;  4Y33 A;  4PLO A;  3HT2 A;  5DN2 A;  4QHZ A;  3RZG A;  3OPZ A;  1W6M A;  1XPW A;  3U4X A;  3RZM A;  1HIX A;  2MHF A;  2Y38 A;  2WZP P;  3IIA A;  1ACC A;  1NLR A;  3M3E A;  3D3A A;  3O12 A;  3QH7 A;  5ERL A;  4CDX A;  1BBT 3;  5DAV A;  1W0O A;  1IS3 A;  2GMP A;  1NOV A;  1V9U 1;  4XQW A;  2Y6F A;  3ZMO A;  5FQ0 A;  1UYY A;  2HWF 2;  1QXJ A;  2YHJ A;  3S0M A;  5CZK A;  2YPD A;  1AF9 A;  5IAV A;  5EZW A;  4Q0S A;  3FN9 A;  3GXU A;  3T4H B;  4LKF A;  3BPS A;  1EAH 3;  5FK8 A;  4CCK A;  2OKX A;  4JDM A;  1GBG A;  4P9W A;  4PLN A;  1LRH A;  5CAD A;  2Q1M A;  4QHB A;  1R08 3;  4IEP A;  4GJY A;  3K46 A;  1RMU 1;  1C8M 3;  3VL8 A;  2K0G A;  4ATE A;  1PMI A;  1GFF 2;  1PGS A;  1VAK A;  3G7D A;  2W1Q A;  5F37 A;  4AFC A;  1W6P B;  2IFR A;  1OLR A;  2X5I A;  1CX1 A;  4NRQ A;  4XHB A;  1UY0 A;  5EIY B;  2ZEW A;  5C7G A;  4LK7 A;  1DU3 D;  4MGK E;  2R07 3;  3I4I A;  3BTX A;  4AFB A;  4IV3 C;  2E7Q A;  2XG3 A;  3TOJ A;  2FBE A;  5D2A A;  1E5S A;  3CL1 A;  3GZE A;  4Y1Z A;  4CP9 A;  1KEX A;  4B4Q A;  1PO1 2;  2FCT A;  4FTB A;  1SEF A;  2WNU B;  1XXN A;  2BTV C;  4WVW A;  4YYO A;  5K0U C;  5CG9 A;  3ZFE B;  3MHZ A;  1RUF 2;  3P1I A;  1BVV A;  4M4P A;  1YWK A;  3HJR A;  1CWP A;  3WW1 A;  4HET A;  2KR2 A;  1S2K A;  2VMD A;  3ZFG A;  1H9W A;  4KGG A;  3SC7 X;  4DXR A;  2XH6 A;  2Q1Z B;  1JMU B;  2HBT A;  1TZO A;  2WFP A;  5EFU A;  4FAG A;  4FVV A;  5FO8 B;  3PVN A;  5L36 A;  2C5D A;  3IKW A;  1MEC 2;  3BOW A;  1UOJ A;  1IGO A;  1SCR A;  3ZXD A;  3TN9 2;  2PHT A;  3TNP B;  5BV6 A;  2IXJ A;  2O8O A;  1E5R A;  3DV8 A;  4W65 A;  2CWS A;  4XF4 A;  1PK6 A;  2JE8 A;  2BBV A;  1DHK B;  4GH4 C;  4OHW A;  4BIO A;  4AHY A;  5FKC A;  2H0B A;  2HWB 2;  2ZZJ A;  4CCD A;  1DQ2 A;  1DYO A;  3GAL A;  4JGZ B;  3VDC A;  4DRV A;  3VDD A;  4NRM A;  4QM9 A;  3OUI A;  3H3Z A;  1F4H A;  4A7Z A;  3U37 A;  1TNF A;  1MVE A;  1OLM E;  4IER A;  3ME2 A;  3OGV A;  1QJE A;  1WLT A;  2WRA A;  4RS5 A;  4KWU A;  4RSU A;  1H1A A;  1OC1 A;  5CEH A;  5IVJ A;  2P3K A;  1CAU A;  3ZDS A;  2YBP A;  4BQW A;  3ZSK A;  3U1X A;  4YVS A;  4ET7 A;  1PZ8 A;  3WY6 A;  4N43 C;  1QWR A;  3WF3 A;  4O9E A;  5FYS A;  5H9R A;  2BGP A;  2R32 A;  1ZRE A;  2Y33 A;  1REF A;  5DDJ 2;  1QU0 A;  1JN2 P;  3BAL A;  1E57 A;  3U14 A;  3IN9 A;  3IMN A;  3O5S A;  4C1X A;  4Q4V 1;  1DIW A;  2JJ6 A;  3F95 A;  3VBS A;  1H2L A;  2JG9 B;  2ZHN A;  3UV9 A;  5LZ6 A;  4XJA A;  3MIE A;  3VGI A;  4FPE A;  4C1W A;  3ECQ A;  1PZ9 A;  4QX1 A;  1O3S A;  1PGL 2;  4QPG B;  3CLP A;  4N53 B;  2LTN A;  2GC0 A;  1VBC 3;  2JEM A;  2DUR A;  4QB6 A;  4QWN A;  1AJK A;  5FZC A;  5K8S A;  1D4M 2;  4OHV A;  4IEZ A;  4W8J A;  3BIW E;  4KI5 M;  5IYY A;  3VZM A;  2TEP A;  1WW4 A;  1NQD A;  3S57 A;  1QJU 2;  3WVJ A;  5I0D A;  2VNV A;  1F2N A;  1LU2 A;  2J22 A;  4Y5S A;  5FP7 A;  1OUR A;  2BYV E;  3SCG A;  5E8A A;  1LOF C;  1JZ5 A;  3TWI A;  3RZZ A;  3GDB A;  4GWN A;  4UW6 A;  1PNG A;  4KL1 A;  1OT5 A;  3H42 B;  4RR3 B;  4AG4 A;  1MPX A;  1S0F A;  2IVI B;  1EUT A;  1GNZ A;  3IPV A;  1LGN A;  1TMF 2;  2R1B A;  2ZX0 A;  3I8T A;  1RUG 2;  5JAX A;  2EIE A;  2N7G A;  5ANQ A;  4E8C A;  4K3U A;  4GUL A;  1GQG A;  1V6L A;  1JZ3 A;  2EVX A;  2W68 A;  5E1R A;  1RVF 2;  3WG3 A;  3RYP A;  2F17 A;  4QXB A;  3ZXA C;  4LHS A;  4CUG A;  4DPN A;  2CV6 A;  5F6L B;  3KB5 A;  4IET A;  1BLZ A;  2JDK A;  5C9A B;  4IGQ A;  3PVO A;  4M3C B;  5FRA A;  2VZO A;  2D93 A;  1NZC A;  2IXC A;  5B2G B;  3UKV A;  1LHV A;  4CU6 A;  4BH9 A;  3ZPY A;  3MIC A;  5L73 A;  5BUV A;  4AED C;  5BNO B;  2O8Q A;  1HJF A;  4AGV A;  3NVC A;  2R0H A;  3TEX A;  1Z7S 3;  3WQ0 A;  1CR7 A;  1AL0 G;  4PLM A;  4RGG A;  1OQD A;  1IS5 A;  1G7Y A;  1G9B A;  1R08 1;  3K77 A;  5KXB A;  4EZ4 A;  3NV2 A;  4OVE A;  4CU8 A;  1LEN A;  2PTM A;  3WZ1 A;  4WV8 A;  2W39 A;  2BW8 A;  2XLF A;  1YO8 A;  2RV9 A;  1RL3 A;  2IWG B;  4AE2 A;  4YFZ A;  1DYP A;  3NWK A;  4LPL A;  5A80 A;  3N9P A;  4GAZ A;  2FMY A;  4Q4X 1;  5L9R A;  5LBB A;  3GZU C;  2R07 1;  2GNB A;  4MZU A;  5AVA A;  2ZML A;  1VPH A;  4IV1 B;  3NAP B;  3WLU A;  1AR8 3;  1NYW A;  4ZZ8 A;  2K46 A;  4JRL A;  1MZF A;  4E2S A;  5L7O B;  3LDR A;  1OD5 A;  1GZT A;  2BNN A;  2E33 A;  1NLQ A;  1AR9 1;  2OZJ A;  3V0A A;  3AXE A;  3MFC A;  4WM7 C;  4BMB A;  2XLG A;  4OUL A;  2A6X A;  4Y20 B;  1XRU A;  5C3R A;  4MGT A;  4EYU A;  1XYP A;  1JHN A;  2ZX2 A;  4MGY E;  3USU A;  5CG8 A;  1QIQ A;  2JB8 A;  4AGR A;  1CGP A;  1I3H A;  1O4Y A;  1LHW A;  2FQP A;  4AFD A;  1QH6 A;  4ASK A;  1NE4 A;  3FE5 A;  5FXX A;  4UW3 A;  4Z92 B;  3ACH A;  1E5H A;  2VXR A;  3M70 A;  5GLU A;  2PLV 2;  3H3L A;  1GNY A;  1GOF A;  2GN7 A;  3OCP A;  5F6K A;  4CCN A;  2H0V A;  3U10 A;  1A8D A;  3VZL A;  5ABJ C;  2B8M A;  1EV1 1;  4UAP A;  3LOI A;  1PIV 2;  1RUI 2;  1W6Q A;  1BK0 A;  4XJ8 A;  5AFE A;  2P2K A;  2B5H A;  5DG2 A;  3WSO A;  1FMD 3;  1HQN A;  2HEY F;  3FBM A;  4URA A;  3DPR B;  2ZGN A;  4BXS V;  1ZX5 A;  1QKQ A;  3C3V A;  1HRV 2;  4YZ5 A;  2B7Y A;  2XXZ A;  5FJH A;  3SCF A;  3OB8 A;  2YGM A;  4JTN A;  4TLF A;  4EWD A;  4LT5 A;  1T2X A;  4OHX A;  4ZZ5 A;  3UKN A;  3PIJ A;  1QOT A;  4B29 A;  3VB9 A;  2D6K A;  4XUO A;  3JB8 A;  4XBN A;  5LY1 A;  1RXG A;  1VBA 3;  2VCB A;  2WAB A;  5JVV A;  3TEZ A;  2WNV C;  3KSC A;  4Y3O A;  4O65 A;  1IPK A;  3IDC B;  2A6W A;  1JZ2 A;  3OYW B;  4HL0 A;  2AGS A;  5CFD A;  5I0R A;  1M06 G;  4PQQ A;  4PBO A;  5AVP A;  4I30 A;  2QZ3 A;  1R1A 2;  1V70 A;  4LO5 B;  3SIS A;  5BNP B;  4XFI A;  2QQL A;  3ZSM A;  1ULP A;  3A7Q A;  3VD9 A;  1U12 A;  2R0F A;  2RS5 3;  2XGX A;  3AKQ A;  4XCB A;  4RQP A;  1OPM A;  1ZNP A;  3E6B A;  1K42 A;  2PHL A;  2ZGM A;  1K45 A;  3AVS A;  1NT0 A;  2VG9 A;  3ZFF C;  5KHH A;  4ASL A;  1SFN A;  1UAI A;  3LWC A;  4BQ1 A;  2DTW A;  1YUD A;  3KV4 A;  1Y4W A;  1VBC 1;  2VC9 A;  5FWE A;  2GP3 A;  5EXO A;  3WW2 A;  1W2T A;  1RUH 3;  2CNA A;  3NKT A;  4XDQ A;  5KXE A;  5FZ3 A;  1JYT A;  1DLL A;  3WQB A;  1UN1 A;  1W6N B;  2GN3 A;  1CJP A;  3AYD A;  1RTV A;  1FPN 2;  1R09 2;  2P6H A;  3POJ A;  5FZH A;  3VLB B;  3VKO A;  2VUL A;  4QDR A;  1KXG A;  2EAA A;  5IVV A;  4RHV 2;  4AF9 A;  1QH7 A;  1FX5 A;  4E4D X;  2EXI A;  5EYY A;  1RUJ 3;  3N7J A;  5H9S A;  4W6X A;  5FMO S;  1W6O A;  4BU2 A;  2V4V A;  1OQE A;  5T54 A;  3K51 A;  2P3J A;  2PQS A;  3D8C A;  1K5M C;  5FTT C;  5FMD A;  2DVB A;  5FZO B;  2J1U A;  3R4S A;  1N3O A;  3KCC A;  1OKQ A;  1BVP 1;  2G1M A;  2JDM A;  5KHK A;  1HX6 A;  3GF6 A;  3T2O A;  5CKN A;  2PYT A;  1H2N A;  1AYN 1;  1OA3 A;  2GME A;  4R9B A;  5A3U A;  3OBA A;  2BBA A;  3FLR A;  1CIW A;  5FK7 A;  1DBN A;  4AOC A;  5A3L A;  4UW4 A;  3RS6 A;  2DBI A;  2QVS B;  1DP0 A;  4D6Q A;  2ZGL A;  3VBH A;  4CXX A;  4Q4W 3;  5FOB B;  2VQT A;  5JZG C;  1Z7S 1;  4AK3 A;  1ST8 A;  3OUH A;  3T0A A;  3T0B A;  1LKN A;  1YI9 A;  2QE3 A;  2WT1 A;  5DUV A;  1XYO A;  2D5F A;  5DAP A;  2ZGT A;  3M7A A;  4P9Y A;  1PO2 2;  1BCX A;  4XUN A;  4IQP A;  2VW2 A;  4OI1 A;  4MV2 A;  2GU9 A;  4AGG A;  2WNE A;  2RMU 2;  3TRS B;  5JSR A;  5FZ1 A;  3EXU A;  4AQS A;  3POS A;  5A6Q A;  4YFW A;  2YUE A;  3EB7 A;  3GHM A;  3QLQ A;  1XC6 A;  3SH5 A;  3VL9 A;  4BQY A;  2VZU A;  1VLN A;  2WIN B;  1OMI A;  1N1Y A;  3MUY 1;  1ZRF A;  4PIZ A;  3T1L A;  4TLG A;  5F2S A;  3W20 A;  1G9A A;  2DCT A;  1AXK A;  3DYM A;  3GYD A;  1ODN A;  4X6R B;  2BFU S;  5SV5 A;  1H2K A;  5JI7 A;  4C91 A;  3RZH A;  2AZ5 A;  3KF3 A;  3H8U A;  2BDR A;  1WW5 A;  2HYK A;  3KVA A;  1O5U A;  1Q56 A;  1QF3 A;  4QU1 A;  5IFT A;  1TE1 B;  3H8R A;  1A6C A;  2PXJ A;  3HQX A;  5J1X A;  5D8A A;  2A73 B;  1UKG A;  2HYX A;  4QPI A;  1PX3 A;  3NST A;  3I3M A;  2K2S A;  2D3P A;  1WW7 A;  4Y4R A;  3V64 A;  1X50 A;  3SQO A;  4LO7 A;  5D21 A;  3T4V A;  2AEY A;  2IXI A;  1SMV A;  4IV3 B;  2MEV 2;  2ZAA A;  1O3Q A;  5BNQ A;  3DGT A;  4OCT A;  5IK5 A;  3ZXL A;  5ACA 2;  5FBZ A;  3C8X A;  1XBF A;  5FZD A;  1KFX L;  4AI2 A;  3ZN6 B;  3GHN A;  1N1S A;  3KT1 A;  5CIS A;  1FAT A;  1JTZ X;  1H2M A;  4IEV A;  5K0U B;  4JKM A;  4B4R A;  3WV6 A;  1TEI A;  4I02 A;  2P5B A;  1V6O A;  4XBQ A;  2XJU A;  3K4Z A;  3SH3 A;  1UMZ A;  4XFG A;  4YGD A;  1KDK A;  3EBR A;  3Q8B A;  3OPW A;  4AVS A;  1HB2 A;  5A1F A;  2W95 A;  5AC9 2;  4UT5 A;  4GWI A;  1AR6 3;  4YM3 A;  1FV2 A;  2PHX A;  4NVP A;  2ZGU A;  3ILF A;  3I2K A;  1AR7 3;  1WUV A;  1ZBE 3;  2R16 A;  1VAV A;  2VQA A;  3AC0 A;  1PVC 3;  2UWB A;  3IM0 A;  1UZZ A;  2Q8E A;  1W0N A;  1OPO A;  1W8F A;  3ZX7 A;  2ATF A;  5IK7 A;  1D2Q A;  1UZ0 A;  3JB4 C;  5HXV A;  2TBV A;  1C1F A;  1C5H A;  4P08 A;  3UJO A;  3J8F 2;  3CJI A;  4KU8 A;  4Z2A A;  4CXY A;  4GH4 B;  1MZ6 A;  1UL9 A;  3N9L A;  2ETE A;  1VBA 1;  2PN5 A;  3RJ2 X;  2VZR A;  4D6R A;  2VBD A;  1GKB A;  1S0D A;  1XU1 A;  3TEY A;  3K48 A;  5GZE A;  2FDK A;  3D4K A;  1OXC A;  2RJK A;  1VE0 A;  3DL3 A;  1JOD A;  2BNM A;  2VUJ A;  3ZXK A;  1YI7 A;  4QHO A;  4K8R B;  2ZGK A;  4LUK A;  3KF5 A;  4CCM A;  4I0A A;  1QXP A;  3P3N A;  2XB6 C;  1GLH A;  2D6O X;  4COW A;  3AJZ A;  2ZMN A;  5LRS A;  2JB4 A;  5IK8 A;  2RS5 1;  1YYN A;  2XML A;  1W3X A;  4UFM A;  1LJ7 A;  2TUN A;  4Y24 A;  4RL7 A;  2CYF A;  4N43 B;  2R06 1;  4YW5 A;  1GWK A;  3H9A A;  3NNM A;  1ULE A;  1QDC A;  1V6J A;  4D6S A;  1OQ1 A;  4EN7 B;  3OY8 B;  1APN A;  4AZZ A;  1RUH 1;  3LZZ A;  3PU3 A;  4XZU G;  3BCW A;  2WNU A;  1XNC A;  2PAK A;  2XON A;  4KH9 A;  2WS9 3;  2WNO A;  3D0J A;  5IVC A;  4DY3 A;  5FOJ B;  1VP6 A;  4EZH A;  1O5L A;  3MO4 A;  1RIT A;  2XJT A;  3MGU A;  3OSD A;  3ZKY A;  3BTZ A;  2VGD A;  1C1L A;  5DQ0 A;  3I3E A;  3ZXF A;  5FZ7 A;  2JDY A;  3N9M A;  1DG6 A;  1BMV 1;  3LB9 A;  5A6Y A;  2IUW A;  4R52 A;  3TNQ A;  2FZ1 A;  3LAG A;  2YC0 A;  2YYO A;  1COV 3;  5ANN A;  4BIS A;  1Y3T A;  2QDN A;  2GP5 A;  2Q4S A;  3GM8 A;  1QJY 2;  4IEW A;  3ABZ A;  4E27 A;  5KXC A;  4CDW C;  2RS3 3;  2I2S A;  3UK9 A;  1ZVF A;  1KD7 A;  1CAX B;  4TSV A;  3IDB B;  4HG6 B;  1DQ0 A;  1JYX A;  4CDU A;  4F83 A;  3ACI A;  1S0C A;  2HLE A;  3KQR A;  5HCH A;  1H8V A;  1S0E A;  2XWB B;  3WR0 A;  1NA1 C;  4P02 B;  5J96 B;  3AMN A;  4SLI A;  3N4M A;  4QB1 A;  3LQC A;  1V9U 3;  1O91 A;  1Q8O A;  5FXV A;  2JG8 B;  1VBD 2;  1XNK A;  3GJA A;  4MVT A;  1QNW A;  1POV 3;  2WA4 A;  1U5X A;  3RDI A;  3T2T A;  4MXW B;  3A22 A;  2VNO A;  1MEC 3;  3W59 A;  2HWC 2;  3WD5 A;  1H8T C;  5A6Z A;  3RFR A;  1MZ5 A;  4NID A;  5LBE A;  1WCQ A;  2BUK A;  5F3C A;  1C4R A;  5CIR A;  5LA1 A;  2PMW B;  4QX8 A;  1MVQ A;  4Y1X A;  3AB0 A;  4RFT 0;  3O1M A;  1EPW A;  1UXZ A;  4QQH A;  5T5L A;  2BWC A;  4AED B;  4XMI A;  1POQ A;  4ZY9 A;  4CZS A;  3KV5 A;  4LBJ A;  1NE6 A;  1NCQ A;  3AP9 A;  1FOD 3;  2YV8 A;  1AYM 1;  2P4E A;  2RS1 3;  2X09 A;  5JIU A;  1Y43 B;  1ENR A;  3TYJ A;  2R04 3;  1A8M A;  1RUC 2;  1Z78 A;  5FO7 B;  4YW6 A;  4QPG A;  4N53 A;  3JBG 3;  3HBZ A;  1DGR N;  3NL1 A;  4MH0 E;  4NPL A;  1XND A;  2JD4 A;  2V72 A;  3ILR A;  5APA A;  2KD7 A;  5J98 B;  3ROU A;  4XAA A;  1ZZ6 A;  4BM8 A;  5A32 A;  2CGN A;  5JPM B;  1GZC A;  2HEW F;  3JQX A;  2JD9 A;  1NG0 A;  5I0S A;  1ZZ7 A;  4I0W B;  5JXH A;  2GMM A;  1ZRR A;  2Y6K A;  4AR2 A;  5FZ8 A;  2WYS A;  3WUD A;  4CCJ A;  4Q0Q A;  5FYH A;  2PQQ A;  4MHR A;  2J1E A;  3FC0 A;  1GSL A;  3C2U A;  1OUS A;  4PIY A;  4NIH A;  4WM7 B;  4FXG B;  1CZV A;  3JU9 A;  4JQR A;  4P9L A;  5FP9 A;  4CDQ C;  2DWR A;  2W9X A;  4I3G A;  2W87 A;  3DEM A;  1MS5 A;  1SDD B;  2Y6L A;  2XBO 1;  5A7Q A;  2NM1 A;  2RM2 2;  3HAG A;  3ZYF A;  4R9C A;  3RJR A;  2XHN A;  5LRR A;  4BA6 A;  5JCT A;  3USS A;  1LU1 A;  4LQR A;  4LNV A;  1Q8V A;  4LO4 B;  3ZYB A;  1ODM A;  5FP3 A;  3ETQ A;  5A33 B;  1SLL A;  1UX7 A;  4LIU A;  1RUE 2;  1VMH A;  1V6I A;  5J48 A;  5JWP A;  4P5H A;  4A6S A;  4J25 A;  3MF9 A;  5ABJ B;  2HWD 2;  5DG1 A;  2QQO A;  1RYY A;  3RG0 A;  3WG4 A;  4CDX C;  3LSE A;  4K1Z A;  4FO9 A;  1PM7 A;  4LOT A;  1VB2 A;  1YNA A;  2XQR A;  1KRI A;  4PDW A;  2ORX A;  2W5F A;  1YJL A;  4H55 A;  4HLT A;  4GB3 1;  4H14 A;  4M0H A;  1J59 A;  2RR1 2;  5LEK A;  1XSR A;  2CTV A;  1GOH A;  5FV3 A;  1AXY A;  4U36 A;  3ZVX A;  2OII A;  1X8M A;  5EJ1 B;  1YRZ A;  4Q4V 3;  3KCY A;  2AEZ A;  3WNL A;  1TVG A;  1US2 A;  2FCV A;  2IXL A;  2WNV B;  4MUV A;  5HCF A;  4AQ2 A;  3H50 A;  2ZEX A;  2X5I C;  4ZU5 A;  1OA4 A;  2E9Q A;  2HWF 1;  3MV1 1;  1TME 2;  4JGY A;  5L19 A;  1RUN A;  1WMD A;  2YU1 A;  1KJL A;  4OHY A;  3QAC A;  5C70 A;  1HB4 A;  4AHW A;  2X8K A;  3PU8 A;  2VZQ A;  2ZKN A;  3ORJ A;  2BWA A;  1W03 A;  3KD4 A;  1DZR A;  2HBU A;  2ARC A;  3APB A;  1OKO A;  4Y20 A;  1H6X A;  3ZFF B;  4E9K A;  3B9C A;  4XW3 A;  1ZZ9 A;  3VKM A;  3SEE A;  1UY1 A;  3WG1 A;  2CU5 A;  3ZIW A;  5FDB A;  4IEQ A;  5I8Y A;  5FZA A;  2PAE A;  2UWA A;  2WFF 2;  2Z79 A;  2GC1 A;  5FJK A;  2VTX J;  3O0W A;  2HKX A;  4GKX A;  2XHK A;  3D5O A;  1CAW A;  4HPK A;  4CEW A;  1QOO A;  1COV 1;  3OEA A;  1G9F A;  2GND A;  1YJK A;  2JIC A;  3POW A;  4TXW A;  5FKB A;  3LA3 A;  3W9A A;  1OF4 A;  2X53 S;  4YZ1 A;  3B5L B;  4LMF A;  1QHD A;  2KA3 A;  1GNH A;  4N8M A;  4YG0 A;  1OD3 A;  1RUF 1;  1SHW B;  1W2N A;  2J7M A;  5F5C A;  3RRD A;  1TNR A;  1MS1 A;  2BGC A;  3VBR A;  1UPI A;  1M4W A;  4PF1 A;  1HB1 A;  1PX4 A;  1ND3 C;  1PK6 C;  4TN7 A;  3KQ4 B;  2G19 A;  4ZS3 A;  2ARX A;  4AYU A;  4YSF A;  3THP A;  4YZ3 A;  4LUL A;  3SLI A;  1X9P A;  1ZZB A;  3PUA A;  4D7T A;  4BE3 A;  2P37 A;  1JZ4 A;  4K1Y A;  4NO4 A;  4EWA A;  2D44 A;  3VBF B;  1J1T A;  1K5M B;  4LHN A;  1GAN A;  1POV 1;  4QX3 A;  5JSP A;  4MGS A;  3VDD C;  1MEC 1;  2RDN A;  4L8Q A;  2AAC A;  3TN9 1;  3ZR6 A;  4CP1 A;  2JDZ A;  3GJB A;  3URF A;  4RS5 C;  4R4Z A;  2X05 A;  1IQA A;  1WME A;  4M3C F;  1DZT A;  1RUI 3;  4GXL A;  4YVS C;  3O1R A;  4PJY A;  2CAU A;  4GWM A;  4YAR A;  1RUD 2;  1W3V A;  3LPG A;  4FPG A;  5FCC A;  1LGC A;  2EAK A;  5JZG B;  1DYK A;  1FOD 1;  1PGW 2;  4ATF A;  5A7W A;  3MI8 A;  2RS1 1;  1V6N A;  4Q4X 3;  5T52 A;  4CPB D;  2QCS B;  2R04 1;  1GQH A;  3N7L A;  1LOE A;  1WCK A;  3VBS C;  4E2G A;  3WIN E;  1QGL A;  1D2S A;  1LOG A;  3K3N A;  4CRQ A;  3JBG 1;  5FBJ A;  2VME A;  1BHG A;  2ZBJ A;  3I97 A;  5BXX A;  3PDQ A;  4PIX A;  1GQP A;  5F3G A;  1RUO A;  4A45 A;  2NP0 A;  1AR9 3;  2VO5 A;  4XDP A;  2P6C A;  4AI9 A;  1XYN A;  4P14 A;  1BJQ A;  3M1H A;  4Q2F A;  2FDG A;  5LWB A;  1YQ5 A;  3VZK A;  4EQV A;  1ZRD A;  5HV0 A;  3HR9 A;  1VRH 2;  4FPJ A;  2E51 A;  3H0O A;  1XU2 A;  4NIG A;  3B02 A;  4HN0 A;  1QQP 2;  2B9U A;  3ZM8 A;  4IL7 A;  1PGL 1;  4OFG A;  1H30 A;  3UL2 A;  1S2E A;  5BY5 A;  4WVV A;  2GNT A;  3O1T A;  1D4M 1;  3B9I A;  3CKH A;  5DZF A;  4IUG A;  1BKZ A;  3BGA A;  4YVW A;  1ND3 A;  1EV1 3;  1V6K A;  4NHX A;  1OH4 A;  4LBK A;  2ZGO A;  3VBU A;  2NPI A;  1B35 A;  4R9A A;  3NMB A;  2ZPX A;  4AXO A;  4QAW A;  1UPS A;  2AEN A;  4E4H A;  4PI0 A;  3LE0 A;  2BPA 2;  4U2A A;  5DUX A;  4F7Z A;  2Z2S B;  1SLI A;  4FPF A;  4QX0 A;  3PUR A;  4DIN B;  4DXS A;  3IZO A;  1JXN A;  1F4A A;  3PUQ A;  4XTP A;  2YY1 A;  4H7M A;  4CE8 A;  4MG2 A;  1TMF 1;  1ZYB A;  3I54 A;  3LA2 A;  4Y1V A;  3N36 A;  2OYZ A;  2FDF A;  2ZHK A;  3BOD A;  3IBM A;  3MUZ 1;  5AFB A;  3DXT A;  4OHZ A;  4WM8 A;  4YW3 A;  1RVF 1;  2EA7 A;  1W2O A;  2OZ6 A;  3P3P A;  4FCA A;  1HV1 A;  1NCR B;  3H8X A;  3C7O A;  1WWY A;  4DEV A;  1IS4 A;  2CHH A;  1LEM A;  3WCR A;  4GD4 A;  4UI9 L;  4GMP 3;  5FPV A;  2VVF A;  1OI6 A;  1KS5 A;  2WLQ A;  4BOW A;  1WKY A;  2WAA A;  3I2H A;  5C33 A;  1GZW A;  1JZ8 A;  4MGI E;  1WW6 A;  4KBB A;  3WNM A;  2RHP A;  3MPB A;  1H0B A;  2DUO A;  2W91 A;  4ORF A;  1JZ7 A;  1UYP A;  1ZRC A;  1LHN A;  1MZE A;  2VMG A;  4OI2 A;  1R1Z A;  1TG7 A;  2D6M A;  3LEK A;  1ULC A;  2D5H A;  3Q8E A;  4Y4Y A;  3UET A;  5C71 A;  4N9I A;  3DYP A;  3UKT A;  2Z4F A;  5LB6 A;  4N90 A;  4L99 A;  1OBN A;  4N7I A;  4WVM A;  2VOW A;  4XUT A;  3VHP A;  3DXU A;  1S0J A;  2ERF A;  4IE7 A;  4GAL A;  4EN8 B;  1O3T A;  2DYC A;  4Q8L A;  3M3O A;  5DAQ A;  4QDS A;  3FUO A;  3AZZ A;  3WDY A;  4UBH A;  3I59 A;  5LAT A;  3POY A;  2V5Y A;  5FZ9 A;  3D0S A;  2X29 A;  1DQ6 A;  2ZEY A;  4FAH A;  5IAX A;  2ZA9 A;  2B42 B;  4MXV A;  3ZXG A;  2ZGQ A;  5C3Q A;  2BNO A;  2QJV A;  3L2Y A;  3FUQ A;  3B7M A;  2AYH A;  3KVB A;  4N7U A;  5JOX A;  4RGA A;  1JOJ A;  1UKR A;  4CYD A;  2A75 A;  1QJX 2;  1UW8 A;  2BEO A;  5DZE A;  2J1A A;  5FYI A;  1QJF A;  2VZT A;  4LE4 A;  4LBQ A;  3KHC A;  5C4W A;  1AHS A;  2P17 A;  3M2M A;  3CDZ B;  2ENR A;  3WP6 A;  1Y9M A;  2DCY A;  5LK7 B;  3OGR A;  2LRO A;  4CUC A;  1AYN 3;  4AQ6 A;  1FNY A;  3FMG A;  3RZL A;  1ND2 B;  2WYF A;  1QOS A;  1C8N A;  2VTF A;  3HWJ A;  5ACA 3;  1YFY A;  3B00 A;  3NJZ A;  2G4I A;  2WT2 A;  3JD7 2;  1W04 A;  1WA6 X;  4WVZ A;  4YG3 A;  2XKP A;  1NAE A;  2R6Q A;  2A71 A;  1CIY A;  1D7P M;  1VBE 2;  3A0N A;  3SXW A;  4DUW A;  2OPW A;  5DUW A;  3VBO A;  1WLC A;  4QXC A;  1PIV 1;  3SNM A;  1XE0 A;  3AX4 A;  4RN5 A;  1RUI 1;  4AAP A;  3V0B B;  4JQT A;  5FUI A;  3AYE A;  1BYH A;  4LLO A;  1W28 A;  1FT9 A;  2YXS A;  2OVU A;  1YQ2 A;  2VAU A;  3WF4 A;  4A3X A;  1ZBA 2;  2BOJ A;  5FYZ A;  1HRV 1;  2VOT A;  5CFD C;  1DLC A;  2HWE 2;  1JH5 A;  3W21 A;  1OOP A;  3WHT A;  4P9X A;  3RI9 A;  4JX0 A;  4RQP C;  2O1Q A;  3PMS A;  1W8W A;  2ARA A;  4C0B A;  2R30 A;  1ASJ 3;  1J1L A;  1GP4 A;  4XXP A;  5LBF A;  2A3X A;  3MV0 1;  4BQ4 A;  3V56 A;  2QQK A;  1SZB A;  1UY4 A;  1W9T A;  2D3R A;  3AMQ A;  4L11 A;  1NXM A;  1R1A 1;  1WCU A;  3MLK A;  4BQX A;  4LLF A;  3CJX A;  1AZD A;  2VMF A;  1O4T A;  1HLC A;  2C4X A;  2GAU A;  3N35 A;  4DXZ A;  2TNF A;  4LE3 A;  5CKM A;  5IJR A;  5EPA A;  4O7X A;  5A1A A;  2DVA A;  5A3W A;  1DGL A;  1CVN A;  4V1P A;  1VBB 3;  1FV3 A;  1HXS 2;  5D1I A;  1XNA A;  1DFQ A;  3AMP A;  1LOA A;  5KHI A;  5CAZ A;  3SIT A;  2Q8C A;  3PUI A;  4QPW A;  2RDQ A;  3OBR A;  2PHW A;  4I0B A;  4QX2 A;  1X33 A;  2WQ8 A;  4LA2 A;  4A7K A;  4R9D A;  3M4F A;  1W39 A;  1MS3 A;  4CVU A;  1SPP A;  1BBT 2;  3NW4 A;  4ES9 A;  3PME A;  3HQU A;  4OMC A;  3S7E A;  4QU2 A;  2UUR A;  3CHX A;  3H1Y A;  5FPB A;  3MIB A;  1KDM A;  1TQ5 A;  4KG8 A;  2W3J A;  5BNN B;  5JMO A;  2JG8 A;  3B93 A;  3WQ7 A;  4C8D A;  3GNE A;  4JHT A;  1AL2 3;  5F1R A;  1ALY A;  5FRE A;  1JYV A;  1LEC A;  1EAH 2;  1YQC A;  4OUM A;  3U75 A;  4CEY B;  2ZS6 B;  1KQR A;  3VBH C;  4FPC A;  1R08 2;  3RYR A;  4PCR A;  4D94 A;  4N9H A;  1S55 A;  1C8M 2;  4LHL A;  4LO6 B;  5GLW A;  3E6C C;  5JOZ A;  1DGR A;  4ISQ A;  4BLJ A;  3PVE A;  4GMP 1;  2YC4 A;  3NV1 A;  5IWF A;  4CDX B;  5A3M A;  1YXW A;  4Z82 A;  1UCX A;  3OGS A;  3SCH A;  2RDS A;  4A2U A;  4QGN A;  2Y6H A;  4NRP A;  5FQ0 B;  4UWD A;  4XUP A;  3VKN A;  1HW5 A;  2R07 2;  1S0I A; 
#chains in the Genus database with same CATH homology
 5A7W A;  4QX7 A;  2XML A;  5A7Q A;  5FPU A;  5IVB A;  3U78 A;  3LDB A;  5FP4 A;  5FP8 A;  5FUN A;  4CCO A;  5A3P A;  2YU2 A;  5FZO B;  5FYT A;  3K3N A;  5A80 A;  3N9P A;  5FBJ A;  4GAZ A;  5FXZ A;  3PDQ A;  5A3N A;  5F3G A;  5FP3 A;  5E6H A;  1VRB A;  4D6S A;  2W2I A;  5A7P A;  5A1L A;  4LIU A;  3KV6 A;  3AVR A;  3PU3 A;  4XDP A;  4UF0 A;  4AI9 A;  5IVE A;  3RVH A;  4V2V A;  5IVF A;  5IVC A;  5F3I A;  5FZM A;  5LWB A;  4D6Q A;  4EZH A;  4LIT A;  5K4L A;  5ISL A;  4EYU A;  3AL6 A;  4QXC A;  3N9N A;  5FPA A;  3KV9 A;  5CEH A;  2OS2 A;  4AAP A;  5IVJ A;  2OQ7 A;  5FZ7 A;  4XDO A;  2YBP A;  3N9M A;  3LD8 A;  5FYV A;  5FV3 A;  4QXH A;  5FZ4 A;  3PTR B;  5FYZ A;  5FUP A;  4ASK A;  3ZPO A;  4BIS A;  5FYM A;  5FXX A;  2GP5 A;  5FYS A;  5F32 A;  5A7S A;  3K3O A;  5FZ1 A;  5IW0 A;  4HON A;  5FZ6 A;  4CCN A;  5FZG A;  5A7O A;  4BXF A;  4E4H A;  5F2S A;  2Q8D A;  3NJY A;  2YU1 A;  4Y33 A;  3PUR A;  4IGP A;  3PU8 A;  5A7W B;  4URA A;  3PUQ A;  2OT7 A;  4QU1 A;  3KVA A;  4QWN A;  5FXV A;  5FZC A;  5FWJ A;  2PXJ A;  2XXZ A;  5FJH A;  5FY5 A;  2YBS A;  5FZE A;  4DO0 A;  3OPT A;  3DXT A;  4Y4R A;  5FYU A;  5FY1 A;  5FP7 A;  5FY9 A;  5LY1 A;  4CSW A;  5F3C A;  5FZA A;  2WWU A;  2YBK A;  3PUS A;  4UF0 B;  2YPD A;  4QX8 A;  4Y3O A;  5FJK A;  5F5A A;  4GD4 A;  5FZD A;  4CCK A;  5FPV A;  5FZO A;  5A3W A;  3UYJ A;  4HOO A;  5FZL A;  2P5B A;  5LW9 A;  4GJY A;  3KV5 A;  5ANQ A;  2Q8C A;  5F37 A;  5F5C A;  3OPW A;  5FXW A;  2XDV A;  4IGO A;  2VD7 A;  3AL5 A;  5A1F A;  3AVS A;  4TN7 A;  4DIQ A;  4QXB A;  2WWJ A;  5FYY A;  4CUG A;  3ZLI A;  2Q8E A;  3DXU A;  5FPB A;  3KV4 A;  3PUA A;  4IGQ A;  5FWE A;  5FZI A;  5KR7 A;  5A7N A;  5LY2 A;  5F3E A;  4C8D A;  4CCL A;  2GP3 A;  5F39 A;  4LIV A;  3K2O A;  5FZ9 A;  5FZ3 A;  5FY7 A;  5FY4 A;  5FYB A;  3N9O A;  5FZH A;  2OX0 A;  3N9L A;  4D6R A;  5FZ0 A;  4V2W A;  2XUE A;  3KVB A;  5FZK A;  5FZ8 A;  2OQ6 A;  4CCJ A;  5IVV A;  5FYH A;  4LXL A;  5F5I A;  5FYC A;  5A3T A;  4CCM A;  5FZB A;  5IWF A;  4GJZ A;  4NUB A;  3N9Q A;  5FPL A;  5FY0 A;  5FYI A;  5F2W A;  5IVY A;  3U4S A;  4BU2 A;  4EZ4 A;  5FZF A;  5FY8 A;  5FP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...