5LZLA

Pyrobaculum calidifontis 5-aminolaevulinic acid dehydratase
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
336
structure length
336
Chain Sequence
MRVQFPTTRPRRLRASKIIRDAVAETQIDAGDFIYPLFVKPGGEREPIGPMPGIYRWPVGRELINHVEEALSLGINKFILFGVLPDELKNPEGTGGYDPEGVVPRAIRLIKEIFGDRVLVFADVCLCEYTDHGHCGVVKEKRDRWYVDNDETIKLYAKEAVVYAEAGADFVAPSGMMDGQVREIRRALDAHGFEEVGIMAYSAKYASAFYGPFRVAAASAPKFGDRRTYQMDPRNAYEALKEVAMDLEEGADIVMVKPALAYLDVIRLVKQHFPWVPLAAYNVSGEYSLVKAAATAGYVDERTITLEILTAIKRAGADLILTYHALEAAKWIKEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Delta-aminolevulinic acid dehydratase
publication title Structural studies of substrate and product complexes of 5-aminolaevulinic acid dehydratase from humans, Escherichia coli and the hyperthermophile Pyrobaculum calidifontis.
pubmed doi rcsb
source organism Pyrobaculum calidifontis (strain jcm 11548 / va1)
molecule tags Lyase
total genus 85
structure length 336
sequence length 336
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 2016-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5lzlA00
2FQIA 3LCFA 1KFEA 4N4QA 3RU6A 3W72A 1RQHA 1AMKA 1YDVA 1TMHA 4K37A 2G97A 4QM1A 3KX6A 4A29A 4FIQA 2ZFAA 3LRKA 3E12A 3L0GA 3EXTA 1OFEA 4S2CA 1XDLA 3W2UA 1X8FA 4PEKA 3DFSA 1WX0A 2DZSA 5GVJA 5I3JA 4OU1A 1TJRA 1W54A 2QCGA 2ZZ6A 1H62A 3P7YA 2E6AA 3QYQA 3FA5A 2EPHA 4AF0A 3W1XA 4WOQA 3KVMA 3BVJA 2CW6A 2ZZ1A 3ZWSA 3LCXA 1B9BA 1L6SA 5HWMA 1OF6A 2V5LA 4LU0A 3EXSA 4PTNA 3GK0A 4GUHA 4FX8A 3TC7A 3QM3A 4EF9A 1DORA 2O7SA 3S8HA 3RNDA 2FB2A 1Q6RA 1TTQA 4OHQA 4S1FA 2A6NA 3PS7A 2QJHA 2QCEA 1TV8A 3DZ1A 4ZZ9A 4Y8FA 1I4NA 2CLOA 3QMRA 3HQ1A 2BX7A 1LZOA 1NAL1 1TO3A 1Q45A 1P0KA 4JX4A 3W1UA 2QDGA 2A2IA 3ABQA 3PG9A 4WY0F 4UFIA 3UWWA 2Y63A 4HSOA 1YDOA 4GBUA 4IPIA 1K7EA 3TUUA 2A6LA 3GNNA 4A22A 1M7PA 1T99A 2ZZ5A 4NZFA 3B03A 3VI2A 1ZHAA 3F1QA 4OBTA 5ABTA 3HB9A 2V82A 3KOFA 3W87A 1N55A 4Q4KA 3ABOA 3LI0A 3QJAA 4TO8A 3LBMA 3HJZA 2VFHA 5HINA 3QSTA 3KHJA 4NNBA 2F84A 3BW2A 1OX4A 2E5CA 4RXFA 4YCOA 4UTWA 5E93A 1H1YA 2OX1A 4AH7A 2FPVA 5AYXA 4JTEA 3CC1A 3NQ7A 3S0CA 3V75A 3NQ2A 3A21A 5LHFA 1U5JA 3TSDA 3RF9A 2GVLA 3VE9A 1SW7A 1K3UA 4RJEA 3A22A 1RV8A 3AJXA 3PG8A 5C2XA 4O4WA 4YCPA 2BXVA 1JUBA 1KBJA 3IIXA 1K8XA 2CZ5A 1O4UA 4FO4A 3LTSA 1TSIA 1ZY9A 3UQNA 3GDKA 1ICSA 3DI0A 1EUAA 1XL9A 4NT0A 4H6KA 4O0ZA 3W7EA 4PODA 5EKYA 1GVFA 4IMDA 3RLUA 1L6YA 3MI2A 4A3UA 2NX9A 5K9DA 5LSMA 3MUXA 3A9IA 3EKZA 3W1TA 2EAWA 4UNLA 4LOCA 1I45A 2JK2A 4CQ9A 3LBCA 4J9JA 3SJ3A 1A50A 3S1XA 3HBLA 1I2OA 2ZRXA 4NJIA 3B0VC 3BK0A 3MP4A 1LM1A 4CQ8A 1LORA 3LCGA 4MZ8A 3LXCA 2V30A 5EMUA 3NM3A 4JTIA 4N6EA 4MY8A 5G4EA 3IIPA 1H5YA 3BO9A 1G7VA 4KFNA 2ZA2A 1XBZA 1Q6LA 3FYOA 5EA9A 4Z0SA 2QDHA 3PB0A 1O5KA 4N6FA 3NQ8A 3B0UX 1EIXA 3E0IA 2DJXA 4WXYA 3I7QA 3CWNA 2BTMA 1RQEA 5G2HA 1VLIA 2ZDRA 4HNVA 5T26A 1WQ5A 1EPXA 3TQ0A 1QPQA 3N2MA 1K02A 2KZHA 2BLEA 2EHHA 4Z1BA 3G8EA 1M5WA 2DZPA 3TROA 1TPWA 5J5DA 4BFAA 4O13A 4AVFA 1I2QA 2C6QA 3M5VA 4NU7A 3W7NA 3GX9A 1SW3A 1W37A 5EL1A 1GWJA 3L66A 2C14A 3LERA 2YPIA 4LS2A 1HUVA 1OABA 5KITA 4FIRA 1SZEA 2J6XA 3GR7A 2YDAA 1W3TA 2B0MA 2H3BA 3G1FA 1YTKA 4LVGA 1UUMA 1C9DA 2NX3A 1AK5A 3FYPA 4ZQCA 4GRSA 1PHQA 3KXQA 3T4CA 5HR7A 1OF8A 1DJQA 3TIMA 4R34A 3MP5A 5LGZA 1KTNA 2YW3A 1XBYA 1A5AA 3W7JA 4XZ9A 1VYRA 3B4UA 4X9SA 5FF0A 1GZGA 4UMCA 5I3IA 5K9XA 2QEZA 2GOUA 1NF7A 1QOQA 1ME8A 4OT7A 3NDOA 4G1KA 1EWDA 1FXPA 5FEZA 1OFBA 4DO6A 3W71A 1MSSA 1EP3A 3QC3A 3M5ZA 1FCQA 4ALDA 4LRTA 1TRDA 2Q3RA 5IBXC 3UNDA 1FDYA 4JYDA 3NQGA 2E68A 1VYSX 2OT1A 4P2VA 4Y96A 3LCHA 1X6UA 3EEGA 4UR8A 3TQVA 3S5YA 3RFAA 1KV5A 1PL9A 4YWIA 4UC5A 3TR2A 1H7NA 2W0UA 1K7FA 2WSYA 3P74A 3FS2A 4CNPA 1UCWA 3L2IA 3NPVA 3GAYA 2C0AA 2D73A 3PAJA 1FUYA 3F4WA 3SSJA 1SQ7A 4UCGA 4H3DA 5AB3A 3LI1A 1ADOA 4HT3A 4O10A 2FIQA 1JCXA 3S9YA 2GJNA 1AG1O 1ZAIA 3P60A 4LY8A 1Q3NA 3WJSA 1IIHA 4KFPA 4IGHA 3NVTA 2FB3A 1FXQA 3PUDA 5G1TA 3YPIA 1FCUA 3TJXA 3EKLA 2ZRZA 1ZALA 4M7SA 3L65A 1EP2A 3G1SA 1F6PA 5EBUA 4JTFA 4D2JA 3C2OA 5E1QA 2YFNA 3W1RA 4FEZA 2Z1BA 4WXZA 3W7LA 2ZYFA 4GFSA 2YYTA 1EEPA 3L0NA 4AWSA 4FF7A 2WSRA 2PCQA 3OHIA 5CPOA 3EXRA 2VELA 5D2XA 2GQ9A 4E2DA 3G24A 4OGZA 2ZRUA 2JGYA 3RK8A 5HR6A 3IIOA 3Q37A 5BW6A 2XFWA 1GT8A 1EB3A 2CZDA 1H51A 3F4NA 3LRMA 1KFLA 2YXGA 5G2WA 3T7VA 4RCXA 1LBFA 1I8JA 1GVQA 2ZA3A 2P0OA 5FEXA 2XN2A 4O28A 1KFBA 2QCHA 3FOKA 5CGQA 4DF1A 2X2GA 4WOZA 3MHGA 1SZGA 1QMLA 3WK0A 4RR4A 3FJLA 3FIGA 4I9AA 1ONRA 3W85A 2NZLA 4I7VA 4LC6A 3TAKA 3UWYA 3UD6A 4OV4A 2ZZ4A 4ADTA 1LRQA 1Z44A 2GQ8A 5CPNA 4ICNA 3QW3A 5AC6A 2CLMA 1YXDA 2J9XA 1BEUA 1VLWA 2HMCA 3C4UA 3VNDA 5D38A 3QH2A 4LWWA 3LHTA 5LGXA 4GXMA 2V9DA 3W70A 1QAPA 4MYXA 3DHDA 2FPTA 4O50A 2Y62A 1W5OA 3IEBA 1KM1A 1OK4A 2I9EA 1OVDA 5BMWA 4MVAA 3HGSA 4JIQA 4AHOA 3R12A 1JULA 5LNUA 4DO5A 4O0KA 3BPWA 3NL5A 4JTGA 3NAVA 3IVTA 4HNNA 4AB4A 2OJPA 3BG5A 3DFQA 4LV9A 3SI9A 3Q94A 3BW4A 2ALDA 1LOQA 3SR7A 1QDSA 1IGSA 1ZAHA 2ZTJA 1W3IA 5D2TA 3LV5A 4AF0B 4MFDA 5LNVA 4O54A 5I3KA 2Q3OA 1GG1A 5KZDA 3S1VA 3W1QA 1NFBA 3G0SA 5AOUA 3G22A 2DZVA 1KA9F 2CZFA 2NUXA 4RZ4A 1H1ZA 4DEFA 3ZS4A 1L9WA 3TKFA 1IXOA 2A7PA 3O15A 1GVSA 5G5IA 5L9FA 1NSJA 3S1UA 1H61A 1OJXA 5BMXA 4LC8A 2CZEA 1XKYA 1W5PA 3QW4B 4JGDA 2C3ZA 5KZEA 1MEIA 4JX6A 3W73A 2VXNA 4GUGA 1PCKA 3LM7A 3RMJA 3C52A 3NR0A 3EWWA 3O1NA 1KM4A 3LCWA 2WSQA 1W31A 5D33A 3QF0A 1C29A 1R2TA 3GNDA 2ZRYA 2QR6A 1JCNA 4XQ6A 4IXXA 4FNTA 3R8RA 2AQWA 4ZL1A 4AHQA 3SGUA 3UZ5A 1R2RA 2HS6A 1TPH1 2Q8ZA 1T8XA 3C2VA 1OX4B 3C6CA 3W7KA 5HUOA 3NQVA 3TH6A 3G18A 3TX9A 2Y70A 5AYYA 2Z6JA 2IQTA 1KW1A 3ELFA 1R30A 2HSAA 3NQMA 3L67A 4ZQRA 1PIIA 5F2LA 1GVRA 3O6CA 4N9CA 3IGSA 3ATYA 4TU1A 3L5MA 3MYOA 4UR7A 2Y89A 2H90A 1VRDA 5K4ZA 2H6RA 3C61A 1FWNA 4PA8A 1IIGA 2X1RA 4FNUA 3WJXA 7TIMA 4ONVA 1M7OA 1S5TA 2GPTA 5HUPA 2VEKA 4JTUA 3BV4A 3R89A 4YXGA 1JUKA 4FX6M 4K7VA 4XUGA 2NWSA 1DQWA 3SW6A 4NJHA 3OVRA 4QNWA 4RV8A 3V1PA 4NJGA 4UTTA 1AW2A 3MP3A 3G1XA 5HQEA 1DV7A 3O16A 4BK9A 5DBTA 4N9EA 3INPA 4WY0B 2TYSA 4FHAA 4PH6A 3VFLA 4RZ5A 4NX5A 4N2YA 3C56A 2JBMA 4JY9A 5F4WA 4OWGA 4ZVJA 3O63A 3WJZA 1OG0A 5DXXA 5D2YA 1JJKA 3N34A 4HIBA 4O1BA 3R13A 1VS1A 2GVGA 1AL7A 2NXIA 3IRDA 3LDVA 1FBAA 5EPDA 3P84A 4LT9A 3TSMA 5DXYA 4ZQMA 3M0ZA 5AFDA 1GJPA 3GDRA 4RLIA 1BWKA 2WJZA 4ORMA 3NQAA 1JCJA 1H63A 1HG3A 5D2WA 1GEQA 2E5BA 4TMBA 2V2DA 2VEPA 1G4TA 3CEPA 1SW0A 4CLMA 5HMSA 2Y85A 4UFKA 4I7UA 3DKJA 3MWAA 3W7DA 3B04A 5D32A 3NYZA 3NG3A 3P61A 3W07A 3KVJA 1A5BA 3TXZA 3G1VA 1FDJA 1WA3A 1TTPA 1EX5A 4EVZA 1AW1A 4EF8A 2QAFA 4DELA 2TPSA 1QWGA 1SPQA 3KFTA 3MI6A 3LGEA 1ML1A 5LHEA 2J9ZA 5D05A 4JTLA 5K4XA 2A1YA 1ZAJA 2R14A 3DHFA 5KSWA 2WO5A 1SR9A 3W84A 5K2ZA 1BTMA 2ABAA 4JIPA 4AAJA 4CQAA 3PF3A 2CLKA 1JQXA 3GXNA 3VKJA 1HO4A 3NPWA 3STFA 1IXNA 3N3MA 2RDWA 2NV1A 1FQ0A 3GDTA 4PL2A 3LHZA 1ICQA 4IX2A 5K3VA 2ZTKA 4IQLA 4MIMA 1K8ZA 1WDWA 1F74A 1DJNA 1DL3A 4JD4A 4WY0A 2I14A 3W1LA 5BNKA 4UMAA 3NEVA 1D9EA 4O18A 2A4AA 1AL8A 1HTIA 4L4MA 1Z41A 4IX0A 1JRCA 3C2EA 3KRZA 2QJIA 3S1WA 3P81A 3Q58A 5FEWA 3EX3A 3N14A 3VCRA 3TW7A 4DQWA 3PBYA 4R33A 2ABBA 3NPXA 3N19B 5KTLA 2CFFA 3FFSA 4ADUA 1YXCA 3PWAA 4MYAA 1MXSA 3MBFA 4O16A 1QR7A 1X7FA 4MLJA 4UFJA 1YPFA 4MFEA 5J5RA 2B7PA 4POCA 4DF2A 5D02A 5F1UA 4MOZA 1TPC1 3LRLA 2BSLA 3HG2A 4XTDA 2DP3A 4K7YA 2DJLA 4JR5A 2ISWA 2AGKA 4HPXA 1MEHA 1QPNA 5HJLA 3EWUA 5CPLA 5D30A 1WAUA 4O17A 4FXRA 3ANYA 4ML9A 5BRBA 3PB2A 1J4EA 3A5VA 3B05A 3LOTA 2ZZ2A 1OYAA 3NL3A 5KINA 4MY1A 1A5CA 1F05A 3EX2A 1H7XA 2J27A 3PULA 5D09A 4JX5A 4LS1A 3W7MA 1OFPA 3NGJA 3TU9A 2RFGA 1I2RA 2JKPA 5F1VA 1DOSA 1Z48A 5FEPA 3L5LA 5BOOA 3TAOA 1WBHA 4GC4A 1VCGA 2RHGA 1LLWA 4IJBA 4XBKA 4Y9AA 2E1DA 4M6QA 5CG7A 1TPB1 3L5AA 3LHWA 3LLFA 5C54A 5IM51 4MLRA 1G4EA 3JRKA 5HULA 3BGGA 1SU5A 1G7UA 1KBIA 2E77A 2ZZ7A 4XBSA 3IV3A 1FDZA 2QCMA 1WBJA 5I3FA 2Y7DA 3C3NA 1O60A 3WJWA 1JCMP 3P80A 2PE4A 3JS3A 3G3DA 2CLHA 3M9YA 4JDBA 2DORA 4QJ1A 1GYNA 2J88A 3WFAA 3OG3A 4LUIA 4Q33A 3GB6A 5CPMA 2X30A 1EWEA 1ZENA 2R94A 3S6DA 1RD5A 2E6FA 3UWZA 1FWWA 3DFNA 3EB2A 3DFPA 1TPVA 1UBSA 3HO8A 5LNSA 1LROA 3DXIA 3UY8A 4HNUA 6TIMA 3W76A 1Z42A 3O8AA 2ATSA 2QF7A 1NF0A 3C2FA 2ZCGA 5AHMA 3MYPA 1YADA 3CHVA 4MUZA 4UIOA 1P0NA 4O8RA 3EX6A 3NL6A 5C5YA 1TTJA 3TK7A 4KWVA 5CZJA 3UZJA 4JN6A 5A5WA 3STEA 1B57A 3FKKA 4N9DA 5CKSA 5DY3A 1ALDA 1VH7A 1O5XA 4NUWA 3VE7A 4GUFA 4GJ1A 1HFBA 3C2RA 2G5WA 3CQ0A 4H4IA 1UASA 1EA0A 1JCYA 1TPDA 4IWWA 1OFDA 4IUOA 3TSBA 1PS9A 1JUEA 1H7WA 1L2UA 3PSWA 3KAOA 3ABSA 1GQNA 1OFAA 2Q8LA 4HNTA 3UXDA 1LTDA 4JTKA 3HOJA 3GZ3A 4NQ1A 1ZJIA 1TV5A 5DELA 4NJKA 2YSWA 3HMJG 4Z1AA 2Z2UA 4FX7A 3BG3A 3KVKA 2OMAA 1TPEA 4EIVA 4KFOA 5DLCA 1OFQA 1B4KA 3HPXA 1N7KA 4NXKA 4A21A 1W56A 2A7NA 3LV6A 2C13A 5DY2A 2V5BA 4AWTA 2F7FA 4K38A 1S3HA 5AHNA 3TFCA 1QCWA 3U6WA 2PC4A 3N73A 4XKYB 3W23A 2WV8A 3NM1A 3D0CA 3LB0A 2R91A 3GIYA 3UWVA 4BR1A 1I2NA 3W83A 4NNAA 4UXDA 3T44A 3WK3A 3AO0A 1X1OA 3C0JA 3W74A 4CNNA 3S5NA 3STGA 2YFOA 5C55A 2E6YA 1DHPA 2C16A 1LOSA 1KTCA 4IOTA 3FKRA 2A0NA 3U2OA 4EOUA 1YTDA 3DH7A 3SFKA 1TTIA 3QQ0A 5AC8A 4DXVA 2LLEA 2H3DA 3CB8A 4O11A 3NQFA 5DCEA 1IF2A 1M6JA 3I7SA 4O4VA 1WYIA 3KVLA 1V7YA 4LS0A 3CU2A 2E5DA 2B7QA 2PRHA 3W7GA 3UXAA 4AWUA 3TFXA 3DFTA 1Q6OA 1W1ZA 2Y7GA 1D3GA 3GVGA 4IXHA 1T0OA 3NZRA 1G69A 1YTEA 4U4MA 2CLEA 3CWOX 4HHPA 2WKJA 2CWNA 4NXSA 4IPJA 5LNWA 1C8VA 3W2NA 3QMTA 1H7OA 1K7XA 2P1FA 1KFKA 1W5QA 1H7RA 3BARA 3G1AA 3PBWA 1YLVA 3UYCA 3BLEA 5FF3A 4E2BA 4UTWC 5IBXA 3H54A 3I6RA 5FI8A 1CX9A 1ME7A 2E09A 2FPYA 4JDYA 1P5BA 2V2HA 3W7QA 1OFRA 4QAIA 1XBXA 3R2GA 3I68A 4UTMA 3IGXA 3LHYA 1V5XA 1DQXA 1NVMA 4QIUA 3W1MA 1XC4A 3PUOA 3H55A 1VHCA 2VFEA 4GE8A 3NO5A 2JGQA 3W2LA 3W75A 2W6RA 1MO0A 1TPUA 1KM0A 1DVJA 1CI1A 1QFEA 3HIJA 3DENA 3DBPA 2X16A 3W6YA 3ABRA 4XKYA 3G8RA 1JQVA 2CLFA 5DCBA 2C18A 3QPZA 2GJLA 1OX6A 3E9AA 2EKCA 3NQ6A 3IVSA 3N9RA 1CW2A 1EUNA 2QKFA 2A85A 5AC7A 4R53A 3KRUA 1TRIA 2QCFA 4JEQA 4X3ZA 1VCFA 3PY2A 3W2KA 1F76A 5AHEA 4EWND 1QOPA 3ZFHA 4UUIA 1A53A 5D03A 3GDLA 1JVNA 2B7OA 4OQVA 3LCIA 1XCFA 1RZMA 5U7SA 3Q2DA 3M6YA 1PHWA 1KM6A 3LLDA 3QMSA 2NXGA 4JY8A 4IMFA 4MJMA 1WOBA 3R5EA 1RVGA 5K9CA 3M5YA 5G2IA 4YL2A 3EWYA 1R46A 3BGJA 1RPXA 3MI3A 4O15A 1E51A 5FF2A 4UMBA 3CEUA 3T78A 4TIMA 1WXJA 5E0KA 4K36A 5MHBA 5TQLA 4Q32A 1TIMA 3STCA 3RLVA 3THAA 5LKYA 2V2CA 5CZSA 3TMQA 1JRBA 1R2SA 3A5FA 5TBOA 3EWXA 4NZJA 4O52A 4TR9A 2NX1A 3WJYA 3LHUA 4LVDA 1ICPA 3W86A 3M43A 1GVOA 2VENA 3FLUA 3N9SA 1D3HA 1LBMA 2V0TA 1VHNA 3MMTA 2A5HA 2Z0IA 3IIZA 4Y6GA 4ORIA 3A23A 2ISVA 3TE9A 1KM3A 4NVTA 4GWEA 2Z6IA 4DBDA 3IVUA 1GOXA 1H50A 1QO5A 4MJZA 1I2PA 4B5NA 1KFJA 4FB7A 4IMGA 1J5TA 1S5WA 3B8DA 3P82A 2DU2A 5EYWA 1F2JA 2C15A 2VEIA 3SY5A 2QUTA 4JICA 5AHLA 3BLIA 1SO3A 3LTYA 1GTHA 1TB3A 2H8ZA 2FLIA 1TREA 1G4PA 2RDUA 2YX0A 3A24A 2ATMA 3W2JA 4AXKA 4XWUA 3ZR4A 3IGUA 2HS8A 2ZQ0A 1FCBA 4JTHA 4RZ6A 2Y88A 4Y90A 3E96A 4O1AA 2EF9A 2A7RA 3TC6A 5DN1A 1MZHA 1G6CA 1SO5A 3UPBA 5HWNA 1W3NA 5HNRA 3NXFA 3K30A 3SECA 3LXBA 4PCFA 3B0PA 5I3GA 3HGOA 1ME9A 4FNSA 2RDTA 2UV8G 1WV2A 3C8FA 2VC6A 1L6WA 1T96A 3I7RA 1PE1A 4OV9A 3JR2A 3GAKA 5G1YA 2NUYA 3G1DA 4FNPA 2JKAA 2QUVA 1LRTA 3GXPA 4FNRA 2B7NA 2RKXA 3CT7A 3ZWTA 1HL2A 4WX2A 1SFJA 2NUWA 4AMAA 4BWLA 3OIXA 4LV4A 2Y7FA 3B06A 1A5SA 2G95A 1SUXA 3QZEA 1P4CA 1LRNA 2QJGA 4JTSA 5F2IA 4WQ6A 1KTBA 4ZQOA 1B4EA 2PRMA 3HG4A 5AHIA 3T40A 2FFCA 5TIMA 3HGJA 1MEWA 1BWLA 4XTIA 3TQKA 4K8EA 3OA3A 4O12A 3EX1A 3QFEA 3L68A 4QITA 5FESA 1O94A 5FF7A 3OBKA 2Y6ZA 4I7WA 1LOLA 2X1TA 3S5OA 1OHLA 2YCEA 2ZA1A 4MZ1A 4PFMA 4NX0A 4LTSA 1UUOA 3NA8A 3HPZA 5U4NA 1DKWA 2GUUA 3GKAA 3WK1A 3DI1A 3DGRA 1YXYA 1SSDA 1XUUA 3BLFA 1OYBA 4TX9A 4Z0JA 3LXAA 3LCLA 4MZYA 4UFLA 3W2MA 2YW4A 3TNOA 1XBVA 2GQAA 1G4SA 4X2RA 3TMLA 2TMDA 4P61A 5L6UA 3GYEA 3W22A 4BF9A 1JCLA 2A21A 3W7PA 2E6DA 4O57A 2XN1A 1VCVA 1LDCA 1YDNA 4LUJA 3NPUA 2P10A 4IMEA 4Z1DA 3O05A 3P62A 2WOQA 5KMYA 4HSNA 3WK2A 1JR1A 4O14A 2YYUA 1TQXA 3I65A 4UTHA 4BI6A 4RK8A 4GUJA 3PR2A 1KV8A 2VFIA 1FX6A 1NEYA 4LVBA 1KLZA 3MW7A 3PBVA 3LHVA 1XUZA 1TPFA 2FJKA 1TJPA 4S2BA 3W88A 3L9CA 4JYEA 2Y7EA 3P67A 3NNTA 4NNCA 5F4SA 1W5MA 2OZ0A 1OFOA 5LNRA 4AHPA 1OK6A 3MBDA 4MPQA 1TQJA 1KFCA 1EP1A 2HTMA 1SZNA 2ZZ3A 3QQ1A 4HKPA 3CIXA 4HPJA 4CNOA 2WNNA 2PURA 2DZTA 2BZNA 3M44A 2OCZA 3O06A 5A8GA 2Y61A 1H60A 2CLIA 2J24A 2OT0A 4UFHA 1XFBA 3CTLA 2DZXA 1LLZA 1F5ZA 3OVPA 2QCDB 3TXVA 5CSRA 3NQEA 2VEMA 3P8IA 2ZRVA 4MKNA 4O1CA 2QCNA 4E38A 3HGRA 4BI7A 4UTUA 2VOMA 2H8XA 2B4GA 4ZQPA 5AHFA 1YPIA 2CU0A 2WPBA 3FJ6A 3G1YA 1TYGA 3QRHA 4PC8A 3TCEA 3M16A 2ZBTA 2C19A 1F6KA 3SIZA 1X1ZA 3BG9A 4M6PA 3W3OA 1SFLA 4WD0A 4ADSA 1LCOA 1IXPA 4UTIA 3W1NA 4KKXA 2VKZG 3GLCA 2G96A 4WZHA 5HWJA 3S5ZA 3W7CA 3HF3A 3UWUA 1OX5A 3OVQA 3N2XA 1W5NA 3BW3A 4Z1CA 1VC4A 4GUIA 4TMCA 5FF4A 4M7TA 5F2GA 2X1SA 3GKFA 1O95A 4UFMA 2QAPA 3S42A 3W7RA 4GNJA 3LX9A 3O6DA 5G4WA 4JTTA 2FTPA 4LW7A 3P5ZA 1VZWA 3L0KA 5KZMA 4W9TA 1U83A 3PC0A 4LRSA 3TDFA 5CZ0A 1VGAA 2NLIA 1P1XA 3MHUA 3TW6A 4R7JA 1YYAA 3O07A 3W9ZA 1ZCOA 4MY9A 1QO2A 4M6VA 5I3HA 4HN4A 3G1HA 1G67A 1KLYA 4JNMA 4O1DA 1FY6A 2WNZA 2TSYA 4LNYA 2R8WA 1W8SA 4UTKA 4CCCA 5SWUA 1XM3A 3MO7A 5DBUA 4JTJA 2NXHA 1F7BA 1F73A 2QCLA 1GPWA 1THFD 4C1KA 4CCEA 1PVNA 4K8HA 2PRLA 3P8JA 1K8YA 4N4PA 1IXQA 2V8ZA 1GG0A 2ZRWA 3CLMA 4PL1A 3UPWA 1S5VA 3PVFA 4NJJA 4WJEA 1PV8A 4OE7A 2VFDA 1FCVA 2VFGA 3E49A 5CSSA 5EY5A 2O7QA 3FEMA 1SZFA 4O19A 1WOAA 1J2WA 1XI3A 3UWQA 2RH9A 3M47A 2VFFA 4UTTC 3U8GA 1HO1A 1PCWA 4CCDA 2QCDA 3W7OA 1FWTA 2FDSA 1OYCA 4U28A 4O53A 1KM5A 3M1ZA 1TV7A 3CM4A 4A2SA 1UB3A 4M19A 4LVAA 3PUEA 3NL2A 4N02A 4WUIA 1GTEA 4UNKA 1Q6QA 8TIMA 4AEOA 1LP6A 4YLWA 4A2RA 3O6YX 3PM6A 3EWZA 4JXCA 4UTJA 3W7HA 3P5YA 3H53A 2BWGA 3G3MA 1RR2A 3TJLA 3G0XA 3CPRA 1VR6A 4RKAA 4K39A 1QPOA 4RXGA 5H91A 5D37A 5CZTA 1BKSA 3IIVA 4ZMGA 5AYZA 2I1OA 2WNQA 1XDMA 3QPYA 1QPRA 1B3OA 1RQBA 2DZUA 2NWRA 3PBUA 2JKEA 4DF0A 4C1LA 6ALDA 2ISSA 2XN0A 3GR8A 5DCDA 3DU0A 3THQA 3ATZA 4FXSA 3DAQA 1Y0EA 3E02A 4DBEA 4LVFA 1R47A 4IMCA 3F03K 3G0UA 2TRSA 1AW5A 3KRSA 5LZLA 5AN7A 1VQTA 4JS3A 1QNVA 3DKLA 3SGZA 1FWSA 2EGZA 1H7PA 3W7IA 2J9YA 5D2VA 2YGYA 1FWRA 3L21A 3NOEA 3M7WA 1TCDA 1KM2A 3MHFA 3GXTA 2NV2A 1N8FA 2QUUA 4N9BA 4L4LA 4X22A 3USBA 3LTPA 5H2ZA 1SSGA 1VYPX 4YMZA 4JYFA 2C1HA 1ZFJA 4BI5A 2CLLA 3QSRA 1SO6A 3DFOA 1UJPA 3MJYA 4ZQNA 4QISA 4FNQA 1LYXA 2W79A 4QQ3A 4BWLC 3NQDA 5D04C 4DO4A 4UTLA 5F4XA 3T55A 1DBTA 1VJIA 3W1AA 4E0CA 4K6AA 2WQPA 3EWBX 3OEXA 1ZNNA 4RX0A 3HG5A 4KWWA 2GVJA 3W1PA 1W0MA 3GDMA 1SO4A 3EX4A 4QSHA 1VPXA 4DPQA 3UY7A 2DZWA 2QCCA 2V81A 5F2MA 3M41A 3HG3A 3HPSA 4QNEA 4DPPA 5C6MA 2YZRA 1XXXA 2X1UA 1GYLA 3NQCA 1LBLA 3SZ8A 3CIWA 3TA6A 3QEZA 4Z08A 3PSVA 2AAMA 1K03A 2YR1A 3TV8A 5K7JA 3NZ1A 4M5PA 3M5XA
chains in the Genus database with same CATH superfamily
4N4QA 1X6LA 1RQHA 2YOCA 2GJRA 1YDVA 4K37A 4K1GA 3WLRA 2C71A 2G97A 3UESA 1QK0A 4A29A 2ZFAA 3CH0A 3LRKA 1OFEA 4S2CA 3VNKA 3DFSA 4AY7A 3R4IA 1WX0A 1BLIA 4WSHA 1V3IA 5GVJA 5I3JA 1NDVA 4XAGA 2P88A 2QCGA 2ZZ6A 2ACQA 2HE8A 2E6AA 3TN5A 3I4KA 3WLMA 1XRFA 4PMYA 2OZ3A 4GI9A 4H7CA 5FJUA 3KTSA 3GK0A 5CCZA 3QM3A 3RNDA 2XM2A 1N2VA 1Q6RA 4XO7A 4OHQA 5CJNA 1XLIA 3UA4A 4S1FA 3M0KA 1CXEA 1FFQA 4HSHA 4Y8FA 2QS8A 1IZKA 2UY3A 1VEMA 4KS0A 3HQ1A 1LZOA 2PF8A 3U9IA 1Q45A 3W1UA 3PG9A 4WY0F 3ABQA 3UJ2A 3GDBA 4UFIA 1QI0A 3A13A 1ESWA 4AD0A 4ROPA 1M7PA 2ZZ5A 5D8WA 3WLNA 2VGBA 1QNSA 1J9YA 2ZUMA 3CL7A 3W87A 2F9RA 1M7JA 2VDIA 4JQ2A 2PBGA 3ABOA 5B7ZA 4TO8A 5HINA 1BTCA 2QIWA 2W27A 1MDLA 4NNBA 2F84A 3VM7A 2EG8A 3BW2A 1OX4A 2E5CA 3EA1A 4GACA 4QTGA 1CDGA 4US6A 3NQ7A 3R1ZA 2DIJA 5LHFA 4D6JA 4H8UA 4IICA 4D6HA 1SW7A 3IJIA 4RJEA 3SCVA 3E2RA 3AJXA 1UQYA 1R3SA 2CZ5A 4FO4A 1KC7A 1TSIA 1BWVA 4KERA 3H26A 5LIUX 1V6XA 2OPJA 5T91A 1IEIA 7PTDA 1EUAA 4S3KA 3T0DA 4NT0A 1GVFA 4J4KA 2WB5A 1L6YA 4A3UA 2NX9A 1EIBA 3EKZA 3CL6A 3Q67A 1XPGA 1GYMA 2EAWA 1VEPA 4K8GA 4LOCA 1I45A 4UQ9A 3LBCA 2QJNA 2VVSA 3OU8A 3AXKA 3IS4A 4HGXA 1B5TA 4NJIA 1LT8A 1CGTA 1LORA 3CUHA 4AFYA 3KW3A 1WB0A 4PTDA 4JTIA 5G4EA 2F6XA 3IIPA 2XFYA 1H5YA 3UCCA 3QHNA 3GTIA 3LPOA 5C70A 4ZEPA 1DIEA 5A8QA 1GW9A 3NQ8A 3B0UX 1AD4A 3I7QA 8XIAA 3WNMA 1VLIA 2QLYA 4IH3A 1CWYA 2ASHA 1CECA 1CGYA 4JFTA 1TVLA 5HJYA 3ARVA 4HNVA 2XIMA 2KZHA 4L1XA 4LYPA 2CWXA 1M5WA 2DZPA 4C6LA 4NG3A 2VZSA 2C6QA 4NU7A 4E4PA 3QY6A 1W37A 5EL1A 1JZ4A 2YPIA 3OJGA 3VZXA 2ZX5A 3CHFA 1W3TA 3AUJA 1PAMA 4LVGA 4FR6A 1C9DA 3N6JA 1O1ZA 2R1PA 4GRSA 2XGZA 3T4CA 2OELA 1OF8A 4PRWA 1G0CA 3A47A 4R34A 5LGZA 3WH8A 1CLVA 1A3HA 5FF0A 1XD0A 3H7UA 1TELA 2OWXA 1NF7A 1QOQA 3NDOA 2VHLA 1ISXA 1R9ZA 1FXPA 3TVAA 5BU6A 3EOEA 4Q3MA 3M5ZA 4GZJA 3WLHA 5IBXC 4JYDA 3NQGA 2E68A 1KGXA 2OSXA 1V0MA 3GFYA 4NAEB 1MZRA 3FAWA 4NHVA 1X6UA 1VFUA 3NTYA 2ICSA 3RFAA 1KV5A 1PL9A 4AU0A 4C6DA 2W0UA 4GYFA 2NVDA 3A3HA 4UCFA 3VGGA 4NILA 1J0IA 4GYPC 1J01A 3DOPA 1QW7A 2D73A 4CD4A 1YNPA 3F4WA 3OBAA 1SQ7A 1Q6CA 4GH3A 4ZFCA 3UETA 3WELA 1ADOA 2D1ZA 4HT3A 4L4OA 4HA1A 3L4VA 2FIQA 1ZAIA 3NVTA 2I9UA 3PUDA 1W1IE 2PDUA 4L1WA 4QDMA 1FCUA 1V03A 2ZRZA 1BG9A 4CCZA 1F6PA 4AZ5A 1AH4A 3WQOA 3H4WA 3T2QA 1W9VA 5E1QA 4EE9A 3MV11 2Z1BA 4YYFA 2ZYFA 2YYTA 5M1TA 5A69A 4JL1A 2ZWZA 2OZTA 1I9CB 2PCQA 4ZO6A 2VELA 5D2XA 3G24A 1OGBA 3QY7A 2ZRUA 4FA3A 3JZUA 1D2KA 1WXYA 2Z28A 3ABXA 5E0CA 2YXGA 5G2WA 5HOSA 1UKTA 5MF5A 1Q4NX 4J1OA 1KFBA 2QCHA 4LCQA 1SJDA 1R9YA 1QWKA 1ISWA 3KDOA 2ZUNA 4ENLA 4NZ5A 1SZGA 3FJLA 1PKMA 4I9JA 4I9AA 4NRSA 1BRLA 7CGTA 4PCSA 3AXXA 2ZZ4A 5T9BG 2J8FA 4TTUA 4S39A 4Z2KA 4B4HA 4GY7A 3QW3A 3AMDA 1TA3B 2BHYA 3LM3A 5C7VA 3LNPA 4QLKA 2B31A 3VNDA 3V36A 1EJ7L 1QT1A 4GXMA 1PWLA 4R3UA 4MYXA 3DHDA 4AY8A 1DJYA 3J7HA 3BAIA 4OECA 1W5OA 1KM1A 2I9EA 1CXIA 5BMWA 2C1IA 3HGSA 2PLMA 2OU4A 2P53A 5CC6A 1JULA 4WF7A 2VD9A 4PMUA 4XUYA 3NL5A 4IGMA 1UKSA 2WVSA 1KNWA 5KZ6A 4LV9A 3IAPA 4W7UA 3BW4A 2ALDA 2HQAA 1AUSL 3PJXA 1XIDA 3SR7A 1QDSA 1IGSA 3CZ8A 5D2TA 1B31A 4AF0B 5LNVA 4AX6A 3RCNA 1VIWA 3OVGA 1UR0A 3VD9A 5A2BA 4LUYA 2Y24A 4PMNA 4B2DD 2JQXA 3PAOA 4GX9A 4IIGA 4DEFA 3FK4A 1CENA 2A7PA 1VFOA 1K4GA 1OJXA 1W5PA 2C3ZA 4JX6A 3W73A 4C7DA 1PCKA 1VFFA 2EBNA 3D3AA 3ITXA 1UOZA 3BICA 1PTDA 2WSQA 4WRHA 4G7EA 5D33A 2FZBA 2VX4A 1R2TA 1UD8A 1JEZA 4UWMA 2QJMA 4ZL1A 2C79A 3T2OA 1FA2A 2C7FA 2OKTA 3KLLA 3SUWA 3WL0A 2OB3A 2HS6A 1OBAA 1PTAA 1TG7A 4X2PA 5A6LA 1EKOA 1NU5A 1OCQA 4LAKA 3DHUA 1TA3A 2VGIA 3C0SA 2Z6JA 2YA2A 3ELFA 3RU8X 3F2CA 4GCXA 1PIIA 1HX0A 4N9CA 3DIPA 3ISIX 4IIHA 3QZAA 2BFGA 1GCYA 3EB4A 3MYOA 1XD1A 4W4QA 4G7FA 2PWGA 5K4ZA 1TR9A 1TCMA 3C61A 4PA8A 4W87A 1IIGA 2X1RA 3WJXA 4ONVA 1M7OA 2PDLA 4JTQA 4K1WA 2NT1A 3GM8A 4YXGA 3KOWA 4K7VA 4LNCA 2VVNA 2NWSA 1DQWA 2MUCA 4WKFA 1XLJA 2BGSA 2HNEA 2Q01A 2BP1A 4FHAA 3CBWA 3HTWA 2R1MA 4J3SA 2HK1A 3MDUA 3RPMA 4LCRA 1J2BA 4NX5A 1BYCA 4DJDC 3H2NA 3NSXA 2XWEA 4XZHA 1TMLA 4F79A 2WCAA 4ZVJA 2VGFA 2BOFX 5D2YA 4O1BA 1MW0A 1FBAA 9CGTA 4QROA 1XINA 1NP2A 4LT9A 1QXLA 3E5PA 4ZQMA 1E72M 1PWMA 1VBGA 2YJQA 3SN4A 1B54A 1XYCA 4QCFA 3TONA 1RBLA 3CEPA 4GI8A 5A8NA 4XB3A 1C90A 5DRIA 3W7DA 3GH5A 4IPNB 3NG3A 3W07A 3KL3A 4MNJA 4M3PA 4HU3A 4Q8PA 1EX5A 2OOFA 2TPSA 4BJHA 4BEUA 1SPQA 2PP0A 3V0SA 3MI6A 3VDAA 2PDPA 3E0LA 4D1JA 4X60A 2R14A 5KSWA 4XSMA 3H2CA 2WO5A 4HK5A 2R1NA 3W84A 1ENUA 1BTMA 4NYUA 4V28A 1CYGA 4CQAA 3E0WA 2GSEA 2PTWA 5TNVA 3CT2A 3RXZA 1J6OA 4LX4A 1BYDA 4M81A 1KWGA 3LHZA 4IX2A 2D24A 5K3VA 1E6ZA 1K8ZA 3SUUA 1TZZA 3RITA 3LG3A 1DL3A 4GFIA 4JD4A 2I14A 2VJXA 1HN1A 3WO8A 3NEVA 1D9EA 1HTIA 3JU2A 3SY1A 3NURA 2RUSA 4OUIA 4B16A 3HV9A 5CSYA 7ODCA 4LH8A 3K46A 1JRCA 5FEWA 5CBIA 2W91A 3AHVA 3IJDA 2G50A 2W61A 1LLOA 4CQDA 4HPNA 4IIEA 4GIAA 4LANA 1YXCA 4C6IA 3GFZA 3PWAA 4MYAA 3MBFA 4O16A 4U2YA 4MLJA 4GG9A 5J5RA 3B3DA 4PRRA 5D02A 1RJPA 4MOZA 3QPEA 1J0ZA 2BSLA 4XTDA 2VCCA 4AD2A 1W2PA 1A0CA 3RCMA 4PN2A 5D30A 1WAUA 1GHSA 4M24A 4XD4A 5TD4A 3KBSA 2V63A 3VA8A 4E2VA 1A5CA 1F05A 1TFVA 1ZP3A 4NAFA 1HQTA 3NGJA 2X41A 2RFGA 3ZSTA 2ZADA 1UOKA 3EYPA 1OEPA 1RUSA 1WBHA 4GIEA 1NOWA 4TUFA 2WQDA 1YW1A 4AZBA 4IJBA 4M6QA 4WHBA 3SGGA 1TPB1 3LHWA 3JRKA 1GORA 1SU5A 1KBIA 4XBSA 2RJHA 2AGTA 4ROQA 2QCMA 4L4PA 2WWDA 2Y7DA 1QI5A 3C3NA 1O60A 2AKMA 3P80A 2ACSA 4V2XA 3QHOA 4JDBA 4FS9A 3OG3A 4LUIA 3GVWA 3GB6A 2R94A 1PZ2A 3S6DA 1RD5A 5A2AA 4C5YA 3A4JA 2XYLA 4F48A 1MQPA 5LNSA 1LROA 4HNUA 4AMCA 4NRRA 2ATSA 2AKZA 3CO4A 5CSUA 1AD1A 1NF0A 4REQA 2ZCGA 1TWZA 4KCTA 4D8AA 1M1BA 5DO8A 3BMWA 5CZJA 1GZ1A 3WBYA 1KCLA 3FKKA 5DY3A 1ISVA 7REQA 4B3LA 3S46A 1CT5A 2G5WA 4S3AA 4XZNX 3GTXA 2A3AA 2TODA 4WDUA 3RRXA 1TPDA 1ZBCA 5JBEA 1IWAA 2VX5A 1GQNA 2Q8LA 3UXDA 3GZ3A 4QJ5B 1J11A 3ANVA 1VIZA 4MG4A 1TV5A 2CKSA 4Q6JA 4NJKA 3R11A 2YSWA 4Z1AA 3WFLA 2OMAA 4XVDA 1OFQA 4NXKA 4BF5A 5DY2A 2WVUA 1YNYA 1I60A 2WZMA 2DSWA 4AWTA 1J0JA 4K38A 2BS9A 2VP8A 4JFWA 3TP4A 2IPJA 1IT8A 4EAYA 3W23A 4I3GA 2WV8A 3VNIA 1T7LA 2QYGA 3UWVA 3CMFA 1I2NA 3W83A 4NNAA 3T44A 3IK2A 1DJGA 3F4CA 4WSKA 1WDQA 3C0JA 3S5NA 2YFOA 2EG7A 3SUSA 3L4YA 2JF6A 3BQ6A 4TV6A 2A0NA 4TOQA 1TTIA 3QQ0A 4UQEA 3A4AA 4L56A 2PD5A 3F7JA 1U33A 3B9OA 3OPSA 3V4BA 2LLEA 2QUMA 4B5WA 3W28A 4YTRA 2J77A 5DCEA 4JHZA 1M6JA 1QBAA 4W7VA 5FIPA 2NSXA 1O7AA 2XVPA 1MWOA 3NOYA 2DT0A 3W7GA 1W1TA 2GUBA 5BXTA 4AWUA 1Y5XA 2OGJA 4IPPA 1UWIA 1BYAA 1JDCA 4UTFA 2DFAA 1VKFA 4AZHA 3G77A 1HKKA 4M51A 1DQUA 4HHPA 2WKJA 5DT7A 1YMYA 4RDWA 3O6AA 5H1WA 2CCRA 5LNWA 1BQGA 3APTA 3W2NA 5C0QA 4OVXA 1K7XA 1W5QA 1AJ2A 3UYCA 1XC6A 2XFFA 3KL5A 4UTWC 3I6RA 1DPMA 1CX9A 4QE4A 4AYSA 3VNLA 3TYAA 2V2HA 1UZDA 2HE5A 3I68A 4UTMA 3IGXA 1TUFA 2YLAA 1V5XA 3AISA 1DQXA 3KWSA 1NVMA 4DAIA 4QIUA 1M03A 1T40A 1XC4A 1MUMA 4R9OA 2XIBA 3W53A 3VGDA 2JGQA 3W75A 4JIRA 2W6RA 3OW1A 4H9TA 1KM0A 1DVJA 2AL2A 4QSFA 3AS0A 1F4HA 4JCMA 5FJPA 2C18A 5ECVA 2GJLA 4MWAB 2VCBA 1QTWA 2WANA 2ZIDA 2PU1A 3IVSA 1QHPA 3N9RA 1EUNA 4UB9A 1DIKA 3E2SA 2QKFA 2A85A 2BV9A 4HOXA 5EMYA 3UZZA 2FZMA 1TRIA 1BKHA 4X3ZA 1PIFA 3SEPA 3B8VA 5A1AA 4Z2LA 3BLKA 3N2TA 2XG9A 1A53A 3LZ5A 3GDLA 1H49A 3LCIA 1V79A 1XCFA 1RZMA 3AWOA 3GXDA 3A6OA 3Q2DA 3M6YA 1PHWA 5AVNA 2NXGA 1ZS2A 4MJMA 4HPGA 4CVUA 4UQAA 3R5EA 4PUNA 4RW5A 4ZA0A 5G2IA 3AYRA 1R46A 3QXBA 1RPXA 4L5ZA 4HB7A 1B0IA 4O1EA 4AWEA 1E51A 4UMBA 3CEUA 3T05A 1WUEA 2QQ6A 5MHBA 3SRFA 1AA1B 4LYQA 1TIMA 2V2CA 4ZSTA 1XYFA 1R2SA 2VD8A 3C0QA 3EWXA 4O52A 3RGTA 2NX1A 3ZXWA 4LVDA 3MMDA 4H6EA 1GVOA 2OLAA 3OHMB 3S2JA 2V0TA 1IV8A 1Z9AA 3IIZA 1KKOA 3VOGA 1TV2A 4J3UA 5DF0A 2Z6IA 3N29A 4FB7A 3P82A 3GW0A 3FXYA 3N18A 1ODUA 1J18A 4HMNA 2XSBA 3ZJ6A 2XIIA 4C6BA 1GTHA 4MAVA 2FLIA 1KXQA 4F0RA 2ATMA 4ATDA 3B8IA 1GQLA 2PODA 4JIIX 3URAA 4CU6A 3E96A 2A7RA 3TC6A 3AAMA 4R5EA 1MZHA 4J40A 4HCLA 3REQB 3G5EA 1UWUA 3NXFA 5HBFA 3K30A 3ZT5A 3SECA 3KE0A 1EOKA 3M0IA 1V6YA 2UV8G 1KRAC 1D7FA 1L6WA 1EDGA 3JR2A 3FHQA 2YXOA 3G1DA 2JKAA 2QUVA 4FNRA 2B7NA 3SN0A 1HL2A 4WX2A 3BAYA 4AMAA 1OC5A 4BWLA 2J8TA 2QDDA 3OIXA 3B06A 1A5SA 4XAPA 1SUXA 1QI3A 4Y9MA 1LRNA 4YN5A 2Y2WA 1FWGC 5TIMA 1LUCB 3HURA 1P7TA 4QGCA 1W1A1 3ZVHA 3QFEA 1TE6A 1O94A 2WLZA 2E4TA 2WLYA 2VWTA 4P7RA 1R87A 4FSAA 3THCA 2X1TA 1F3EA 4R7WA 3PJWA 2ZA1A 4PFMA 4C7FA 1CGXA 2RDXA 4NX0A 4LTSA 4BS0A 5U4NA 3A3WA 3AS3A 2EPLX 3OG2A 4RNFA 4JKLA 3DGRA 1SSDA 2JE8A 5C9XA 3AIUA 2QDEA 3S9IA 3TNOA 1PEZA 2YA1A 3TN4A 4DBUA 4X2RA 5KETA 2QZRA 5IHSA 1DJWA 1F3XA 4DXKA 2XN1A 3N2BA 2DZAA 1YDNA 4QG9A 3BAJA 3NPUA 3O05A 1MQRA 1Y65A 1JR1A 2YYUA 2NLYA 4GXPA 4F9JA 4GUJA 3PR2A 3ZT7A 5EFFA 2POZA 2Y7EA 3NNTA 4PUKA 4NNCA 5F4SA 1OFOA 3IARA 1OM0A 1EJSC 4AHPA 4MPQA 1KFCA 1EP1A 3CMJA 2BXYA 4CNOA 1RK5A 1DJXA 4ZOBA 3IK4A 2DH3A 5C71A 4JTRA 3N11A 3ZT6A 4PMXA 1VFHA 2Y61A 1NFPA 2IMRA 4JCLA 1XR2A 4RZBA 8CGTA 1A3WA 2WHJA 4RE3A 2QCDB 2VEMA 1TWWA 4O1CA 2VX6A 3EOUA 4XZWA 4BI7A 4C5ZA 4UTUA 2B4GA 4ZQPA 4IPLA 4I8DA 3DC0A 2OQHA 3W82A 2WPBA 4QP0A 3M16A 2C19A 4A8IA 4C60A 3T8LA 1HP5A 2QVHA 1E0TA 3W3OA 4M6PA 3KHDA 2F38A 3QZ6A 2DSVA 1H09A 2VKZG 1PX3A 2D2HA 1XRSA 2YXXA 2QV4A 1OX5A 3N2XA 4NZ4A 1KXVA 7A3HA 4GUIA 4TMCA 3MC5A 1VBHA 4PSRA 3PJTA 4OBRA 1ZQ5A 3WX7A 5F2GA 3GKFA 2QAPA 4LB4A 2PDWA 4D72A 4GNJA 5FAJA 4IT1A 3AIWA 3MVIA 1FWHC 3L0KA 3QV6A 4DN1A 1XLDA 2Y0FA 3TDFA 4LRSA 4C6EA 2NLIA 2XJ7A 4ACYA 9XIAA 1X7IA 2X0SA 3W9ZA 4MY9A 3G1HA 3TTSA 4Y9NA 4O1DA 2WNZA 1BYBA 2TSYA 3O3RA 3QFWA 6REQB 1EF3A 4LNYA 3LENA 1W9DM 2UBPC 4UTKA 1A5KC 1G9HA 5EGRA 3DDMA 1KD0A 2NXHA 2QCLA 4C1KA 4F8XA 1J0KA 3VIMA 4MB1A 3IGHX 3BURA 3ES7A 3OZMA 1S5VA 4NJJA 3O2LA 1EX1A 2AMGA 2VFGA 4JL2A 5D4YA 3MY9A 4C90A 4DWSC 3VABA 2QULA 5EY5A 2DUZA 2FHFA 4Q8QA 3FEMA 1SZFA 2Z26A 4O19A 2D22A 4QRNA 2QCDA 4H9XA 1JPDX 3FA4A 3W7OA 2FDSA 1RAKA 4AG0A 1BXBA 2ONEA 5CJ5A 1H4PA 2WBKA 1G01A 1CPUA 1F6YA 4LQ1A 3E0FA 4AEOA 3TTOA 3EWZA 4JXCA 1EGMA 3P5YA 3H53A 1HL9A 3GU2A 2DW7A 3GHRA 3RMEA 3CPRA 1VR6A 1W9UA 1ZUAX 7XIMA 4RXGA 1OC7A 1REQB 8A3HA 2ACUA 5AYZA 3FSTA 2I1OA 1KBKA 3HN3A 3K13A 1C8QA 2DZUA 4H9YA 2NWRA 4G8TA 4HTYA 3FV9A 1BVNP 3TA9A 3I4EA 1I6NA 3KCOA 2DY3A 1KFWA 1FWDC 1Y0EA 4LUTA 4IMCA 3F03K 2FFIA 1H0GA 1VENA 3HJEA 2CERA 2J7FA 1AW5A 2QXWA 1MRAA 2PLCA 1W91A 3HPFA 3HFYA 3OLGA 2YGYA 2FH8A 3OLEA 1GOKA 2VNCA 1KM2A 3EWDA 3MHFA 2XZ9A 2X05A 1N8FA 4N9BA 1O12A 3KP1A 3USBA 1ZFJA 4GYPA 4UR9A 4B15A 3UR7A 2CLLA 2J62A 5GQBA 1PTGA 2QMKA 1LYXA 4TXEA 3AHYA 1JPHA 5D04C 4UTLA 4ACZA 2OEJA 4J28A 2VEGA 3PWIA 3ZSSA 2OG9A 3HG5A 4PBFA 4GYJA 1S1PA 3GDMA 2E8YA 1SO4A 3PTQA 2Y8UA 3ZJ7A 3I3EA 1K70A 1IEWA 1KXHA 3OLDA 1Y5WA 4RDYA 4LYKA 4QNEA 5C6MA 3M6DA 2X1UA 3MVTA 1XGDA 4DLFA 3U57A 2KX9A 3PSVA 4A3QA 2AAMA 1GW1A 3TV8A 1HKWA 2YA0A 2DUAA 2FQIA 1KFEA 3W72A 5GPRA 4QM1A 1E3XA 4HA0A 4FIQA 3E12A 4UQDA 3EXTA 1X8FA 2PDXA 3ITYA 1TJ2A 2BOEX 3T4WA 3VU2A 3CV6A 1HVQA 2VM8A 3QKZA 3KVMA 5CJMA 1XGEA 3MS8A 2CW6A 3VILA 2ZZ1A 3ZWSA 3MPGA 5HWMA 1Y7VA 1OF6A 1EXPA 4PTNA 3TC7A 1XQKA 4EF9A 1DORA 1ONXA 3S8HA 3DN5A 2DDXA 3A3XA 3TZNA 1DXEA 2A6NA 3GFXA 3LA4A 1KKRA 3DZ1A 3BMVA 2ZC1A 2O9RA 2CLOA 3AZSA 1TO3A 2HK0A 3NYDA 4JX4A 4JN7A 2XISA 3UP8A 2A2IA 2OEMA 4KEZA 1UIPA 2PDCA 4Z2GA 1B90A 1SZRA 3TUUA 3BAXA 4A22A 3T1GA 5A8OA 5HQMA 3IJ8A 4NZFA 2WKGA 3VI2A 5D9PA 1ZHAA 4WR3A 4OBTA 5ABTA 1XIEA 3RHGA 3HB9A 1LL7A 3WG6A 4Q4KA 3QJAA 1UWSA 1YNQA 4DYKA 1EQPA 3QSTA 2J4GA 1GQIA 3RN6A 3WLPA 2XH4A 1F9CA 5I03A 4RXFA 3MSDA 2Y5EA 5E93A 4A3HA 2OX1A 1N82A 1EBGA 3CC1A 3H7RA 3V75A 1UG6A 1U5JA 3RF9A 1UWTA 4KGLA 4DRSA 3UJRA 4DIAA 1TJ1A 4GVGA 4QG8A 2Z7GA 3TYDA 4YCPA 3NUKA 1JUBA 2VEFA 3IIXA 2WC7A 5LIYX 3VX1A 3AXMA 5AY7A 4PMDA 2PDKA 3GDKA 3DI0A 1XL9A 3R94A 1RD6A 3PNZA 1V0KA 3W7EA 5K9DA 5J8LA 1MW3A 3A9IA 4MKVA 2WVTA 4V1XA 4IHCA 3W1TA 4PSPA 1GGOA 1QNOA 4CQ9A 1UW9A 4FXJA 1ZJBA 2R82A 4J9JA 1ITCA 3ITLA 3SJ3A 1A50A 3S1XA 3KM8A 3HBLA 1B1YA 3KS5A 3MMUA 5BU9A 3QY8A 2BY1A 3BK0A 3MP4A 4E5TA 1LM1A 4CQ8A 4KT2A 3W25A 4N6EA 4MY8A 3T0AA 3AXHA 3FYOA 4Z0SA 2AMXA 3MCOA 1O5KA 1JDDA 3IUDA 3CWNA 2BTMA 1GOMA 5G2HA 2ZDRA 3Q65A 5T26A 3BE7A 4ZBCA 2NT0A 1EPXA 5FCZA 4Z1BA 1JZ6A 4EXBA 1UA7A 4E4FA 1G94A 6PTDA 4RV3A 5J5DA 1UMYA 3EDJA 4O13A 1JAEA 3LYEA 3QGVA 4P8UA 2V3GA 3W7NA 4V27A 3GX9A 4L6HA 1SW3A 4RPPA 1W9PA 2F6KA 3LERA 1U5VA 1FWJC 1P6WA 2OYKA 3TYZA 1NM9A 2BDQA 1TR1A 1POJA 3GR7A 5CBJA 2B0MA 3GC5A 5JMUA 3G1FA 1TX2A 4CU7A 1UUMA 2NX3A 1AK5A 3FYPA 1PHQA 3CYJA 3DYMA 1IR1A 4ECLA 3B8SA 3KZSA 1RPKA 1AQMA 4AISA 1A5AA 3B4UA 4UOQA 1GZGA 1JAKA 3S9ZA 3D6NA 5I3IA 2PU0A 2GOUA 1G5AA 4OT7A 4G1KA 1CB2A 3P93A 1EWDA 1VF8A 4DO6A 2O9TA 2VZOA 3UWEA 1TRDA 2Q3RA 4K2SA 2G41A 1BVWA 3I3BA 5H8MA 1IEXA 1Q6DA 3OZYA 4P2VA 2DIKA 5H8PA 2ISDA 1DE6A 2XSXA 5FD0A 2GFTA 4UC5A 3TR2A 5MKGB 4HHLA 2OXNA 2GDVA 3ALFA 3FS2A 4W5UA 4CNPA 1D3CA 1UCWA 3L2IA 4X63A 4GABA 4MDOA 3VGEA 3PAJA 4PCTA 1FUYA 5AZ0A 3ARWA 4FLOA 4H3DA 3GZAA 3LI1A 4AZCB 4O10A 5HANA 1JCXA 1EO7A 3UR5A 4LY8A 3WJSA 1UP3A 3AYTA 3K8KA 5EMMA 1IZCA 4FOKA 1V51A 3M0VA 3H7VA 2PWVA 4YHGA 1ZALA 4L9ZA 4M7SA 5EBUA 4CN6A 1JFXA 4D2JA 2BVTA 2YFNA 4FEZA 4IGNA 5BOFA 3V1HA 4GFSA 4X9YA 4IFRA 3KL0A 2WSRA 4FLSA 2GGIA 2WMFA 4P8WA 3ONBA 3CMGA 3ABZA 2REQB 4FLRA 3RK8A 3SCOA 4MNLA 1FP9A 4QDPA 5BW6A 1GT8A 4GO9A 3WQ8A 1NWUA 1KFLA 3T7VA 4RCXA 5FEXA 2ZXBA 4O28A 4ZENA 3FOKA 1PDYA 2INEA 3PPHA 3AHZA 4RR4A 3FIGA 1OWQA 1ONRA 2NZLA 4JNZA 3UWYA 1QW8A 2YBVA 4OV4A 3UERA 3VKKA 3LN3A 1Q7ZA 4GKTA 1JI2A 1YXDA 2BG5A 5D38A 4JN8A 1CXLA 5BXRA 2AL1A 1A5NC 3PZIA 3CO8A 2PZ0A 4DBWA 2FPTA 4O50A 3IEBA 1PKYA 3COTA 4JIQA 1SR0A 5GNYA 3R12A 3H70A 4O0KA 3BPWA 3TOYA 3IVTA 4HNNA 3UZWA 4AB4A 2PMQA 3BG5A 3URNA 4JIHA 3CYVA 1FH8A 1WDSA 3SI9A 1CLXA 1ZAHA 2ZTJA 2H9AB 1EYEA 4L6DA 4MFDA 1HZYA 3M0JA 4O54A 3IUHA 2Q3OA 2WZTA 3WBWA 4ES4A 2WMIA 1NFBA 2XIOA 3G22A 2DZVA 1F61A 4XAYA 1IXOA 4XD3A 1NSJA 2WWCA 1H61A 3QVQA 2CZEA 2UWFA 3RPTA 4AYGA 1XKYA 1MEIA 2VXNA 1SMAA 1W3KA 1L6FA 3C52A 5HMFA 1U1HA 4LAMA 2BB0A 3LCWA 3OGVA 3HPAA 3PBMA 4R9XA 1W31A 5CH9A 4G5DA 3QF0A 2VQTA 1A5LC 2ZRYA 2BASA 1JCNA 2YL6A 3MUY1 3V16A 2NQ5A 1PZ0A 1BSIA 3SGUA 4Q8VA 4PE8A 1TPH1 3LGDA 5IOBA 2Q8ZA 2VMFA 1OADA 2P50A 2J79A 1TX0A 3W7KA 1Q6EA 1F3WA 3T9PA 1FWEC 1QHZA 1KW1A 4MMWA 3D46A 3FEQA 3B9DA 3NQMA 3L67A 4L61A 2F8QA 4JTCA 3O6CA 4JEJA 3GE7A 3UJSA 2YCIX 1VRDA 3H4XA 3ZLHA 2EO7A 4FNUA 3V5FA 3TTYA 4GK8A 5ABFB 4D71A 2GPTA 1D8CA 4JTUA 2RJGA 3AHTA 4S23A 1S3TC 4I9MA 1JUKA 5FJOA 3QGKC 3GW3A 3SW6A 4NJHA 3LD5A 3OVRA 4QNWA 4A3RA 1UZ4A 4UTTA 1AW2A 2Z2BA 2JFEX 1IWBA 4GPNA 3O16A 3Q45A 4WY0B 3INPA 1JZ2A 2XDFA 3GVQA 2BY3A 4IP5A 4BQ3A 3WQWA 2PUZA 2VL4A 1WO2A 3SCUA 4RZ5A 4RE4A 4N2YA 3ENLA 4JY9A 4GQ0A 5F4WA 3KS6A 3PZTA 3WJZA 1OG0A 4QQUA 1K9EA 3R13A 3W01A 2GVGA 2VUNA 2DQWA 3P84A 4NF7A 1RP9A 3TSMA 1ZJAA 5I02A 1E6RA 4F2BA 3GDRA 2HVMA 4RLIA 3WNNA 4P7OA 1BWKA 1UD6A 1BD0A 5I24A 1JCJA 1H63A 1HG3A 3B8UA 1UD2A 4CD6A 2VEPA 2PC8A 2A3HA 2Y85A 1E1EA 4I7UA 3B04A 2WCGA 4GHRA 2PCEA 3APYA 4HZMA 4P8VA 4JQAA 1R38A 1A5BA 3G1VA 4Q4RA 5CQ1A 4S3CA 1AW1A 3VMPA 3ZLFA 2UZ9A 1QWGA 5I77A 5LHEA 1R86A 5C2GA 2J9ZA 4ZOEA 2GJXA 3LPPA 4KEVA 4XO6A 3OB8A 1V02A 1MYRA 4LPCA 2A3LA 4PUEA 1XSJA 2OEKA 2R24A 4JIPA 3EPNA 5I5RA 1J0YA 4AAJA 3WLTA 3PF3A 1XGZA 4PTXA 3OA5A 3VKJA 3CAKA 1HO4A 1JPMA 3WEZA 1UYQA 3PZUA 3N3MA 2RDWA 5DMNA 4DUOA 1V8EA 3DG7A 1GJUA 1ICQA 3WLLA 3BSMA 3CUJA 3BJFA 2DVTA 2QGHA 3CWHA 2CNCA 1KCZA 1US0A 4WY0A 4C6FA 1X1NA 3BOLA 4JHMA 3W1LA 4LFYA 3LMZA 4UMAA 4RE0A 4AIUA 4O18A 2A4AA 1FP8A 4IX0A 3RCYA 2BGQA 4H9MA 2HZGA 3CGTA 3Q58A 2AOSA 2PGEA 3N14A 3VIGA 5CXPA 3H6OA 3TW7A 4DQWA 4R33A 2BY2A 1XRTA 5KTLA 3FFSA 4PRTA 2WBGA 3KBJA 2CPUA 4HCHA 1BF6A 3AMKA 2VR2A 4UFJA 3URBA 4MFEA 1R3QA 4MJ4A 1S5NA 5F1UA 2CXEA 4RNHA 2FKPA 3PANA 3LRLA 4QR6A 2DP3A 2QVNA 3WDQA 4KESA 2QT3A 1OGGA 4KPLA 5C7HA 1PDZA 2D2GA 4HPXA 5CPLA 3N6QA 4LGXA 3OQ8A 5BRBA 3PB2A 1J4EA 4I5XA 4ZO7A 3TTQA 1JXKA 3B05A 3MCNA 2DVUA 1ADDA 4IL0A 3GVVA 3NL3A 5KINA 2PAJA 1EGVA 3EX2A 1H7XA 2J27A 3PULA 5LIKX 3CUZA 3CJPA 3WUGA 3CPGA 2JKPA 3WDIA 5F1VA 5DQPA 3VC6A 3L5LA 4DWSD 5I79A 4IM4A 1VCGA 1J79A 3GUGA 4XBKA 4Y9AA 3UGRA 4Q4PA 3L5AA 3LLFA 3EDKA 3VGBA 1G4EA 3G1RA 1WUFA 3BGGA 3AMCA 1GUVA 1G7UA 3BXWA 1O5QA 4C1NA 3QTPA 3IV3A 1R0MA 4PTWA 4B5SA 4J3ZA 5I3FA 3WJWA 4CNUA 3G3DA 2OTDA 4RUBA 3ID7A 3OOQA 2J88A 1CB7B 1JZ5A 3GHTA 5CPMA 1IT0A 1EWEA 1ZENA 1EOMA 5EMKA 4F2UA 3F4VA 1FWWA 3DFNA 4E8DA 4KIEA 3GNOA 5HNUA 1TPVA 1UBSA 1Z8AA 1NOFA 3H21A 6TIMA 4NZ3A 4LBUA 3JZEA 3S2LA 1AJZA 1H0IA 1WNOA 4EP8C 5A6AA 5AHMA 4MM1A 3MYPA 1NELA 3N25A 3CHVA 1P0NA 3EX6A 5C5YA 3UF9A 1TTJA 3TK7A 4KWVA 3UZJA 2P5NA 2ODOA 4PB4A 5CKSA 1RALA 2OLHA 1VH7A 1V6UA 2PWEA 2E9BA 2JEQA 2Z29A 4NUWA 3VE7A 3C2RA 4HYWA 4NY2A 4GNVA 4U10A 5LIXX 2GWNA 3ORWA 1EA0A 5C9RA 1OFDA 1CZ1A 1PS9A 1H7WA 5C9WA 1OCNA 3ABSA 1EC8A 5I09A 3IJ6A 4HNTA 1LTDA 2XVKA 3UT0A 2ZWYA 3USZA 3WCZA 1OSEA 1EJVC 5C9UA 3HMJG 3DUGA 4IL2A 3WIJA 2ZKMX 2Z2UA 3GG1A 3VD5A 4KFOA 4EXQA 1B4KA 3ITVA 4A21A 4D6FA 3LV6A 2C13A 2V5BA 5BZAA 3CS2A 4PUWA 1Q63A 2WCSA 4Q8WA 4L65A 3U6WA 1KBBA 2ZVIA 2R91A 3GIYA 3B97A 4D8ZA 4AVNA 2O55A 3NO1A 4CD5A 3WK3A 1WKEA 4KWUA 1KR0A 1X1OA 1JF6A 3W74A 3VIPA 4B9YA 4OFCA 3KEHA 3STGA 1K4HA 2C16A 1E6XM 2WK2A 3WYZA 1FH9A 5REQB 3EMZA 4EOUA 2HROA 3DH7A 4ERAA 2WMHA 3E1F1 1FWFC 5AC8A 2Y4SA 3DFYA 2B81A 3IUIA 3F4DA 3THDA 1K1DA 5LYRA 2H3DA 3CB8A 2DEPA 3I7SA 4O4VA 1WYIA 3AYSA 1V0LA 2B7QA 1JYXA 3UXAA 1UIOA 1W1ZA 1WKDA 2Y7GA 4DWSB 3GVGA 4IXHA 1G69A 1YTEA 1S2CA 4FR1A 2IKJA 2QV5A 4IP7A 3WQ6A 3CWOX 3OLIA 2CWNA 4LBSA 3FX4A 4IPJA 1C8VA 3MZNA 3QMTA 1X8CA 2X0HA 2ZE0A 3FYYA 2P1FA 5DX7A 2NQLA 1VD6A 3BLEA 3VIFA 4YHEA 5EBAA 2FPYA 4Q22A 4JDYA 1CXKA 1P5BA 3W7QA 2QUNA 4QLJA 4EKJA 3SB0A 3H2MA 3LHYA 3KBVA 2R1KA 3W1MA 3PUOA 2XVLA 3NO5A 3KRBA 3W2LA 1E1CB 1VPYA 4HBKA 3MUCA 1EL3A 1CI1A 1Q7MA 3DENA 1Q5MA 3W6YA 3ARXA 2PDFA 1GK8A 2Q71A 5FACA 1XLEA 4M82A 4DUWA 1K9TA 4YTTA 1M01A 1IZJA 2EKCA 4GCAA 1RCOB 5T9CE 3ARYA 1TE1A 5ABHA 5CPTA 5C9ZA 4A8LA 4US5D 5AC7A 3MDWA 4R53A 4H8VA 3WLIA 5REQA 3AICA 1F76A 1XIFA 4RW3A 4GJIA 5AHEA 2INFA 2CXGA 3VGHA 5D03A 1JVNA 3EOLA 1UP0A 3AIQA 3SBFA 4B5XA 4IUGA 4KGJA 1AQFA 2VUYA 4D6IA 3JUGA 3K8MA 4KEUA 4JY8A 4IMFA 3WDRA 3QR0A 1ZCCA 5BYWA 1WOBA 4IJCA 5K9CA 2BVYA 3M5YA 4YL2A 2DQXA 3BGJA 4NKCA 1C9WA 1OT1A 2I5IA 3VDGA 3UXLA 2EPNA 4TIMA 1WXJA 3RIKA 4K36A 4A35A 4AIEA 4ICCX 3SO7A 1BPLB 2PDGA 2OWCA 1UWRA 4P7NA 3RM9A 5CZSA 2HPMA 1M53A 1VP5A 4PB5A 5HATA 4A4AA 1JRBA 4AZ7A 4NZJA 4TR9A 1E4LA 3T0CA 3KLKA 2GUYA 3FLUA 2TAAA 3NO3A 1KO0A 3FDKA 3MMTA 2A5HA 4BHYA 4IJRA 3TE9A 4GISA 4GWEA 3WQPA 1GOXA 3EWCA 4MJZA 1I2PA 4NZ1A 1DJIA 2XGIA 1J5TA 3B8DA 5CAHA 1A4LA 2X7VA 3SY5A 3HQPA 4GKLA 4QFUA 4LAZA 5JIPA 2IKGA 1TKKA 1G4PA 1TREA 2BVDA 3A24A 1E0VA 4XWUA 3WNKA 3ZR4A 3B4YA 5GJPA 2ZQ0A 3K8LA 1NJJA 5B80A 4Y2WA 3VOFA 1G6CA 1Q8JA 3UPBA 5HWNA 4NZCA 4QS6A 4LSBA 4ZOCA 1V0NA 4PCFA 5H6HA 1J5SA 2CHNA 1WV2A 2QPSA 3V0UA 1XFCA 4D6EA 1XCWA 4MB5A 4HJWA 4OV9A 3NGFA 3AZRA 3GAKA 5G1YA 4FNPA 3OYXA 4CN1A 4TQTA 1HJUA 3GXPA 1PUDA 5BRPA 3K4DA 3U7BA 3ZWTA 1XLBA 1J0HA 2NUWA 2J7CA 1YKWA 2HDJA 4LV4A 4F0SA 2VOTA 1ZBKA 1MXGA 2G95A 1XYLA 2EPMX 2OGYA 3QZEA 3WMSA 2E8ZA 2DUXA 2I16A 4CEUC 1B4EA 2PB1A 2PRMA 3HG4A 2FFCA 1MEWA 1AODA 4XTIA 3TQKA 1T6MA 4K8EA 4TVCA 1RLCL 1VB9A 3L68A 1ADSA 1SJAA 4QITA 5FESA 2D69A 1FHUA 1CTNA 2Y6ZA 4UZSA 4FZIA 4Q7IA 4H2CA 4AZ6A 1W1VA 3GKAA 3WK1A 3WDJA 2ZDSA 1XUUA 3BLFA 2V38A 2QMJA 1JPIA 1K9DA 1NY1A 1G4SA 4P61A 4IFOA 2HRWA 1VFSA 4I5RA 1RH9A 1VCVA 4LUJA 4GJJA 4S3GA 3P62A 3UJEA 2W92A 2ZOXA 4Y8EA 4XV0A 1CEOA 1RHCA 4UTHA 4RK8A 1XYZA 2OX4A 1NEYA 1DWJM 4G9PA 3U0HA 3MUZ1 4WDTA 3KWXA 3R8HA 1KRMA 2VR4A 4JYEA 1GOOA 1QJWA 2NQHA 4HMCA 1WE5A 3MKCA 1OK6A 1BQCA 1OGSA 2IS7A 5IHRA 4EPKA 1DWIM 1SZNA 1A80A 4B5UA 4HKPA 1IHIA 2WNNA 3MWCA 5TF0A 3M44A 3O06A 4ZE4A 5A6KA 1XF0A 1H60A 2CLIA 2OT0A 8RUCA 4PGLA 3IJ9A 3N3TA 4H9ZA 5HPOA 2DZXA 2G3MA 4CN4A 1LLZA 4DJFA 4QE5A 5HAOA 3TXVA 1NWTA 1ITXA 1E1FA 3WBEA 1JNDA 2VOMA 1OD0A 3D5HA 2H8XA 4BA0A 1WKYA 4NASA 1S2AA 4FLQA 5AYBA 3VPLA 1XIGA 3OO2A 1E5JA 4IQJA 1YE6A 5AC4A 2YB1A 1IEQA 3K4WA 3TCEA 3S6TA 4HN8A 1X1ZA 5I7GA 2DW6A 1TMQA 3GS6A 4WD0A 1XSIA 2I17A 3WLOA 3TYCA 1IXPA 3W1NA 4KKXA 3GLCA 2G96A 4WZHA 3UWUA 1QK2A 3AHXA 1W5NA 3BW3A 3HU7A 1BXNA 1GONA 1B2YA 3SUVA 1O95A 2GSJA 3WD2A 1EJRC 4BKNA 3WEOA 1HJSA 1PKNA 5G4WA 4Y9PA 4LW7A 3P5ZA 1JGIA 1KR1A 1U83A 3PC0A 2G3IA 2IXVA 3MHUA 1C7SA 1BHGA 3TW6A 3O07A 3ZR5A 2BMBA 4HN4A 1KLYA 3AWNA 4C6KA 2JIEA 4JNMA 3WF0A 3GR4A 1XLLA 2CHOA 3BAWA 5ABEA 4GZEA 5BXSA 3UGVA 1US2A 3MO7A 2OLSA 2ISFA 2FHCA 1V02E 1DWHM 3MUIA 1EA9C 1XYAA 3P8JA 2FMNA 5C8BB 1GG0A 2L5HA 1WPCA 1LQ2A 1PV8A 4OE7A 1TWDA 3GTHA 1NH6A 3RUBL 4AZIA 3UPMA 1QASA 3M47A 1HO1A 1PCWA 1RBOB 2VRJA 1H3GA 4O53A 1KM5A 1V3LA 3M1ZA 4UZUA 1TV7A 3CM4A 1UB3A 4YTSA 5LA2A 3EDEA 4PCNA 1GTEA 1Z7AA 2V5DA 4UNKA 1Q6QA 4YLWA 4A2RA 3O6YX 3CAQA 3W7HA 2D2JA 3TJLA 1DTNA 3G0XA 4WGHA 4NAEA 2VRKA 4XD6A 3RPDA 3GRIA 3CLWA 3IJ7A 4I6VA 4B90A 2ESCA 4E3TA 2WNQA 4CEXC 1MNSA 5I78A 3M0MA 4IISA 2CC0A 5JH2A 3C86A 6ALDA 2FTWA 3TOPA 3IWPA 1XKJA 5XINA 4IIBA 3THQA 4FXSA 5IRPA 1I0DA 3FY1A 5DMLA 4A8RA 4DBEA 4LVFA 3WNPA 4AY1A 2DV0A 3L2LA 4I90A 3FGCB 2TRSA 3KRSA 5LZLA 3AJ7A 5AN7A 3VGFA 1WKFA 1FWSA 2E3ZA 2Y8VA 4J2PA 3L21A 4KEMA 1A0EA 3NOEA 4QDWA 3M7WA 2GOKA 1US3A 1XLKA 1JF5A 1OB0A 1QATA 4X22A 3LTPA 3BMXA 3T0BA 1A5MC 1Q2RA 2C1HA 2PDNA 4PULA 4BI5A 3ZJKA 3F2DA 2PPGA 4MJ2A 3QSRA 2V3DA 3DFOA 4JNYA 3MJYA 3TYBA 4FNQA 1E6PA 1R5YA 2W79A 4MSSA 3NQDA 2NQJA 2GYIA 2PGRA 4E0CA 2IXUA 3GBEA 2WQPA 4QS5A 3EWBX 1KRBC 3L4TA 3OEXA 2GVJA 3LLXA 4AC1X 4D1IA 3UCDA 3WF2A 1R6WA 3EX4A 1XHGA 2F6UA 4DPQA 2QCCA 2V81A 5F2MA 4X61A 3M41A 1QW9A 3PZMA 3AOFA 4DPPA 1UP2A 2DSUA 3A64A 4HZ8A 1CXFA 4RDZA 3CQIA 4GGBA 4H9VA 4K3ZA 1MXDA 1K03A 2YR1A 4M5PA 4C6JA 3R0DA 3M5XA 3GBDA 1UH3A 3LCFA 3VZZA 3KZPA 3I6TA 1EDTA 3PJUA 3KX6A 1UPMB 2E1WA 2E0PA 3L0GA 1XDLA 3N12A 4AUBA 4PEKA 2Z1WA 3VOJA 2DZSA 3MV01 3GXMA 1TVNA 1W54A 1UD3A 5DMYA 1H62A 2QIIA 3P7YA 3SN1A 1ZTVA 4AF0A 3U4AA 1I75A 4H2HA 3BVJA 4AD3A 3LCXA 2XSAA 4INFA 4LU0A 4FX8A 2GK1B 2O7SA 1GPFA 2FB2A 4S3JA 2PDMA 1TTQA 2HJPA 3WMLA 2A79A 4N42A 3PS7A 3E5BA 4JIEA 4QG6A 2QCEA 1TV8A 1I4NA 4LEQA 2ZUVA 2BX7A 1NAL1 1UWAA 4UQCA 1P0KA 4GD0A 3RG6A 2QDGA 3RM4A 3AMLA 3UWWA 4HSOA 4DJEA 4IPIA 4GBUA 3GNNA 3T8QA 3UG5A 1UH4A 1T99A 4EPBC 3PPCA 3G6LA 4ZGYA 2POTA 3NSNA 3B03A 1GNXA 1O1HA 1EH9A 3RR1A 4QAWA 2CLPA 1E0XA 2SFPA 3PZQA 3KOFA 1IR2A 3O9NA 1F4AA 3NSMA 4PMVA 2VFHA 2Z00A 4HCDA 2XTKA 4TX6A 2X7WA 3H2OA 4YCOA 3OP2A 3E74A 5IXEA 4MHBA 4AH7A 4PUDA 2FPVA 5AYXA 4JTEA 1HJWA 2EKGA 4C7GA 1V93A 2AAAA 4ZR8A 3TSDA 1E15A 5FL0A 1XG4A 2YDQA 1K3UA 1XLMA 6CGTA 2VO5A 2J25A 3A22A 1RV8A 3GVRA 3VIIA 3GH7A 4O4WA 4J5NA 2P76A 3U48A 4OKDA 1KBJA 1K8XA 2GVYA 1ZY9A 3LBOA 4NYYA 3UQNA 3BJSA 1FHDA 1N8WA 1XCXA 4JKKA 3DYPA 4O0ZA 2PS2A 3MI2A 1S38A 4OIFA 3FVMA 5LSMA 3F5JA 4DNMA 5CLTA 3SFWA 1HP4A 3SADA 3PZVA 1SFSA 4H1ZA 4LALA 5HA7A 2ZRXA 4IG2B 3W4RA 3B0VC 3B9EA 3QN3A 1V3JA 4GQRA 4MF4A 2GZXA 2NVCA 5AVHA 1E9ZB 4L7ZA 1J6PA 2ZA2A 3NDZA 3V35A 2QDHA 4B5TA 4QXIA 4KRUA 1PXGA 2DJXA 5E09A 4GIRA 1RQEA 3BAKA 3S83A 1VPQA 2IW0A 2VC9A 1WQ5A 3TQ0A 1QPQA 3N2MA 1CXHA 2BLEA 4JHOA 5KEZA 2DGAA 3CHEA 2PP1A 3TROA 1TPWA 1ISYA 3D47A 4BFAA 1PSCA 2HCVA 1JXJA 2Z27A 1GWJA 6TAAA 5M5DA 3BSHA 3KBWA 5I3DA 4FIRA 2J6XA 3MKVA 2HBVA 1V6TA 3PFRA 1KRCC 3POHA 1L8PA 4BQ2A 1UMLA 4ZQCA 4CD7A 1P0DA 5HR7A 1DJQA 4KWOA 4M1BA 1ZL1A 3MP5A 2YW3A 1XBYA 4X9SA 4PR4A 1HIZA 2BXZA 4RE2A 5K9XA 1OG6A 1TV3A 2WXDM 5FEZA 1OFBA 3W71A 1ZZMA 4DZ5A 3QC3A 1CIUA 4GXWA 4XIAA 3S1GA 1FCQA 4ALDA 3RX2A 3UNDA 1FDYA 1XPYA 2O9OA 1JD9A 3E0VA 1AQ0A 3PNUA 4N7QA 2BODX 2PA6A 1KWKA 2P0IA 2OT1A 4Y96A 3LCHA 1VFMA 3EEGA 3TC3A 3TQVA 3XINA 1UJQA 2UY5A 3S5YA 4YWIA 8XIMA 1HF6A 1H7NA 3P74A 4DI8A 1QI4A 1W3HA 3FAXA 1R3YA 3LPFA 1S1RA 2C0AA 4JQ3A 5IFTA 3APGA 1P1MA 1ODZA 4UCGA 2VGGA 3CV1A 5AB3A 1BXCA 4CKQA 2WMGA 3S9YA 1AG1O 1IIHA 1VAHA 4IGHA 2FB3A 2WJEA 4I8YA 2XIQA 3TJXA 2IQDA 3TWBA 3EKLA 4DLMA 1EP2A 3HQOA 3G1SA 1PX8A 4JTFA 4F0KA 1RA0A 3XIMA 4PTMA 3W1RA 2Z4GA 1JIBA 1DXIA 4WXZA 1GKRA 4J3XA 3OGRA 1V6WA 1IGWA 2YCLB 1EEPA 4AWSA 4HK7A 5DT5A 3WKZA 5ECUA 4DX3A 2HPIA 3V18A 4D6GA 2RGLA 4OGZA 1Q6FA 2JGYA 2ADAA 3GO2A 3WD1A 2WSPA 4H83A 3IIOA 3Q37A 2XFWA 2CZDA 3II1A 1H51A 3LRMA 4C6OA 2YZ5A 1LBFA 3HFTA 1GVQA 4R85A 2P0OA 3KP0A 2XN2A 3LEPA 5CGQA 2X2GA 4WOZA 2EJAA 3W85A 4I7VA 4LC6A 3TAKA 2GL5A 3UD6A 1RVKA 1Z44A 5AC6A 2CLMA 4EPDC 3WBXA 4IFKB 1VLWA 4K68A 4W5ZA 3C4UA 4M8UA 2D2OA 4LWWA 3TQPA 4MGGA 3DG6A 1JI1A 4BEQA 4B9ZA 4F3HA 3DBNA 2Y62A 4XISA 2D0FA 2C1GA 1OK4A 4RL3A 1JGMA 1VJSA 2XHYA 2FZ8A 3N13A 4DO5A 4JTGA 1BFNA 2OJPA 1PPIA 1FWIC 1UD4A 3MO4A 3DFQA 3SQMA 1NWSA 1U22A 3Q94A 1M68A 1LOQA 5HQLA 3VDHA 1W3IA 1V3HA 3GC4A 5JH1A 6XIMA 1SYTA 3K2GA 3SRHA 5I3KA 2PDBA 1GG1A 5KZDA 3LPGA 4JQ1A 5JIWA 5HNNA 3G0SA 2CIPA 1KA9F 2NUXA 4PMOA 4RZ4A 1H1ZA 3N9KA 3VMOA 2PTYA 3O15A 5L9FA 3WLKX 2BY0A 5BMXA 4LC8A 4JFSA 4JGDA 5A6JA 3EPMA 1W17A 4GUGA 3RMJA 2J7EA 4QJ3B 3EWWA 2WM0A 3O1NA 1KM4A 3WQGA 2VQUA 4U5KA 1C29A 3GNDA 2QR6A 3DERA 3M0LA 1ZGDA 1I1XA 5CPQA 4DBSA 4AHQA 1VFLA 3M07A 1R2RA 3UZ5A 5JVLA 3VZYA 4U3AA 3C2VA 3P3BA 1OX4B 3MA8A 4FOUA 4U5IA 3C6CA 1S5MA 3NCOA 3QBUA 4IFKA 3G18A 3WF4A 2Y70A 5AYYA 2IQTA 3W81A 2R1LA 1JDEA 4NL1A 5FJJA 1S2WA 2V67A 1GVRA 3TZFA 3ATYA 3L5MA 4UR7A 5J04A 2Y89A 1C8XA 1XS2A 5EFDA 3SQLA 5EU9A 3RRAA 1FWNA 2XUCA 1S46A 7TIMA 1YEYA 1TWIA 1EBHA 1XQLA 1P0BA 1S5TA 3VC5A 4YVXA 3R89A 4JZ5A 3GYCA 2F2HA 3CXOA 3N04A 1OD8A 4FX6M 1QUMA 4RNIA 1J10A 2PWDA 3S2CA 4V33A 3V1PA 4NJGA 3G1XA 1D7KA 5HQEA 1DV7A 4XVEA 4AC7C 1PIGA 2VWSA 3W26A 1EHAA 2TYSA 1FFRA 2QNEA 5A3HA 3CZJA 3VFLA 2PI6A 3O7UA 3C56A 2XWDA 3B8TA 3L4UA 2NQ9A 3LUTA 1Q85A 3O63A 5JUVA 1KB3A 1XLHA 2OOGA 5DXXA 5LXXA 4ZTYA 4N0RA 1VS1A 3BC9A 2CITA 2G3FA 4Q8NA 5AFDA 3M0ZA 2PBOA 5GNXA 5E6YA 2WJZA 2OQYA 3FHAA 5D2WA 1LL6A 1VJZA 2V2DA 1IQ8A 1G4TA 3QQWA 1EJWC 5HMSA 4PMRA 5CPSA 1LWHA 4F0HA 4UFKA 3DKJA 3MWAA 5D32A 3TJIA 2RAGA 3BH4A 3B40A 3NYZA 3P61A 4MWAA 3KVJA 3TXZA 3M0XA 3WH9A 1ZB5A 1FDJA 3JVAA 4EF8A 2QAFA 4DELA 3H4GA 1ZPTA 3LGEA 1L6GA 4YVVA 1XIBA 5D05A 2Q02A 5K4XA 1X98A 2A1YA 1XYBA 1R3VA 2KAUC 1HKVA 2ABAA 1E0UA 3W00A 1RY0A 1B9ZA 3EAUA 5TAOA 2YB4A 3STFA 1IXNA 3XISA 1FQ0A 1UHVA 3GDTA 3T6CA 4IQLA 4MIMA 1XP3A 1W1PA 4ZO9A 3SCPA 1WDWA 1YRRA 4M0XA 4J3TA 1DJNA 1XISA 3IJQA 4PEEA 1PB0A 3PPFA 4P7LA 4FK9A 1XX1A 4L4MA 2XM1A 2YKKA 1Z41A 3VNZA 3KRZA 3S1WA 2PDHA 4GX8A 4FMVA 3PBYA 3EMCA 1RK6A 2ABBA 3NPXA 2Y1HA 2FZNA 2CFFA 3GHSA 3UZXA 1DIOA 3TCSA 4EXAA 4S3BA 1YPFA 2B7PA 4POCA 4KF1A 2WMKA 1YE4A 1ECEA 3HG2A 3MANA 2ZUSA 3FNDA 2DJLA 2ISWA 1MEHA 3EWUA 4NI8A 1UC4A 3WQ4A 3RO6A 2NVAA 5PTDA 4FXRA 1W32A 3LOTA 2ZZ2A 5G1MA 1OYAA 3REQA 4JX5A 1VBJA 4PZVA 3W7MA 3LMYA 1AZ2A 3TU9A 2CHRA 1I2RA 1RLDA 1Z48A 4H6RA 5BOOA 1CGUA 1CBGA 4RDVA 4GC4A 2RHGA 2E1DA 4B5VA 4ZE5A 5CG7A 4X0VA 3ME3A 3NFUA 4B4FA 1W3LA 4MLRA 5F7UA 5HULA 2YLLA 2JEPA 4AXNA 2XVGA 1BRLB 1FDZA 5IFPA 3OTRA 3RLHA 1JCMP 1MVYA 2CLHA 5GNZA 2BGNE 4GIYA 2DORA 4QJ1A 1R8LA 4BQ5A 1GYNA 1E6QM 3WFAA 1LUCA 5A6BA 2X30A 1JYN