5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
2E9MA 3W38A 5I78A 3AXIA 1G1YA 4MNLA 2J7EA 7CGTA 5ABEA 1H3GA 3OLGA 1HKMA 4UFLA 1XSKA 3OGSA 5A1AA 3PZGA 2BHYA 2VOTA 3TONA 3U7BA 3B9EA 5A6KA 2NW0A 1OD0A 4EKJA 2UY2A 1MYRA 3QOKA 3DYPA 2D3LA 1VENA 2V3FA 1V0NA 1Q6GA 5A8PA 4V28A 2WLYA 4MDPA 2WVSA 4Z2GA 2HISA 3SCRA 3AIBA 4W88A 1UKQA 3AZTA 4F9DA 1UR2A 3VD9A 1V02A 1IZKA 3WQ5A 1JD9A 3IAPA 1WZMA 4XB3A 1ESWA 3ARQA 4QCEA 4W8LA 4NRSA 1VEPA 1CGTA 1UR1A 3WY1A 1E3ZA 1UR9A 1V3IA 2VZUA 4RE3A 3SCNA 1AQMA 4C7GA 5FD0A 5BRPA 3OB8A 2E9LA 3N17A 1RH9A 5M03A 5D8ZA 3ZSSA 5A6SA 3O2LA 1UYQA 1UWUA 3SCSA 1CWYA 1D7FA 1PX8A 5KEZA 1VFOA 2WNWA 1JI2A 4QLJA 5C71A 3KZSA 4P7QA 1G9HA 3WD3A 4U5IA 3ZR6A 2EPMX 1ZBWA 2DQXA 5JIWA 3FAWA 2GJRA 2ZIDA 2GDVA 4D1JA 1VEOA 4E8DA 2J7FA 1M7XA 1R7AA 3L4XA 4HZ8A 4YN5A 1E73M 1XSJA 4HU0A 1GHSA 1NH6A 3I3DA 4YHGA 3AIWA 4UQAA 3VIPA 1K9TA 1JXJA 3VX1A 1BFNA 1CNVA 1KQYA 3SCOA 3WMBA 4LX4A 3GXDA 3AMCA 2OWCA 5CLTA 2VRKA 3AIQA 4QLLA 1UKPA 5I2UA 3MSGA 1WCGA 2VQTA 4KH2A 4P8UA 5GPRA 3HN3A 5EFFA 3BAJA 2PI6A 1PAMA 2XWEA 4EANA 4M56A 4WSKA 3PTKA 4PMQA 4XZBA 1BYDA 1B90A 4AZ6A 3TOPA 4JAWA 3CZLA 1OCQA 1GQIA 2J7DA 1W3LA 1GCYA 2JIWA 5LA2A 3QHMA 4ZFMA 1BGAA 2WXDM 4NI3A 1VFMA 1KQZA 5HOSA 3L4WA 1UZ1A 3CZEA 2VMFA 1MW0A 4FK9A 5AYIA 1EXPA 3M7SA 3W4RA 4W5ZA 2DSVA 3L4TA 3GBEA 4B3LA 3WDPP 1R87A 2GSJA 3TA9A 1B0IA 1PX3A 4BQ4A 4CD7A 2DSUA 5IDIA 4DWSC 3PHAA 4W8BA 3TTQA 3AHZA 4P8WA 2VI0A 5C70A 1BYBA 3WD1A 2XFYA 4QDMA 1QNRA 3LMYA 4JFSA 2EPKX 1U33A 1KXTA 1C8XA 5GNXA 4JIEA 2C7FA 2ZXQA 2J25A 1E55A 1GORA 4F66A 3N12A 3AIRA 1J0ZA 2WMJA 5CLWA 2D20A 2GK1A 2XSAA 3AI0A 1PPIA 1FFQA 2F2HA 2BHZA 2XUCA 4H41A 5HBFA 1WE5A 4L4OA 5JBFA 3WNMA 2Q8XA 1PIGA 1PZ2A 3UR8A 1MW2A 3NSXA 1UD8A 1QNPA 4HA4A 5M3WA 1U2YA 4AEEA 1CBGA 1KCKA 4AD4A 3VGEA 2X2YA 5IHSA 2EPLX 2OSYA 2W61A 1AVAA 3CUIA 4UQ9A 1PEZA 1JF6A 1ISWA 2D0FA 2IUZA 4U2ZA 1GQLA 5A2CA 3BLPX 4FLSA 1BYAA 1FH9A 4MAZA 3ZO9A 2VZTA 1JNEA 2CITA 1QI3A 3PZ9A 2DEPA 2O92A 4PN2A 4CVWA 5I0DA 1I75A 5CSUA 1J0JA 3AS3A 3UESA 2V5CA 2XGIA 3W25A 1FA2A 1OSEA 2C8NA 5A8NA 1ZU8A 3PN8A 3AHVA 2ZICA 1QNSA 4PUEA 3B9DA 1CIUA 2BXZA 1C91A 4PMDA 3CO4A 5BCAA 4Z2JA 3EMQA 4KWUA 2XVNA 5A6LA 2RGLA 2XHYA 2DPEA 1WO2A 1V0MA 3PZQA 3VDCA 4M81A 3VMNA 2Y4SA 3VU2A 3U7VA 3NSMA 3RMEA 4IPLA 4P7LA 1CGWA 1V6YA 4DWSB 3WUFA 1G01A 4BCEA 1JZ7A 1VAHA 2WLZA 1JAEA 4MB1A 2OWXA 4WK9A 3DC0A 1DWAM 1GQJA 2YL9A 1QW8A 2A3BA 4WJXA 3ZJ6A 2JEQA 5HXMA 2VRQA 4TVUA 3WN6A 4ACZA 1V02E 2WMIA 2XWDA 1J0IA 1XSIA 4LYQA 2WKLA 1CGUA 1E3XA 4PMNA 4HP5A 3KL0A 2QPUA 4JHZA 3ZT5A 2Y2WA 4XX6A 2JE8A 3N04A 3VGBA 1X6NA 3OG2A 5D9NA 1UZ4A 3NJ3A 1BSIA 1J18A 4MDOA 3RIKA 2BFGA 3VPLA 4W7WA 3WH9A 2ZUNA 4MNMA 1SFSA 4W5UA 4NF7A 3WBAA 4UZSA 1HKIA 4IISA 1UA7A 1E6XM 3RILA 1JYNA 4LXFA 1LQ0A 4ZE5A 3VDHA 2WVVB 1GOWA 4J3XA 1UD2A 4MAVA 2YL8A 3PTQA 2YL5A 2JEPA 2WMIB 2VQUA 4FMVA 2ZX6A 3PZTA 1V6VA 3VKKA 1E5JA 1KBKA 4S3JA 2WMFA 1E6RA 3WNNA 2VRJA 4LQ1A 1TVPA 2BHUA 4PMZA 5A6BD 1CXKA 2PBOA 4CD6A 4E4PA 1E4IA 4MADA 1OB0A 1OT2A 1V08A 1EO7A 2J7GA 2WWDA 3WDJA 1KBBA 3BSHA 4M80A 4R27A 3W26A 3GM8A 3VIKA 4W89A 4KMQA 4MJ2A 1C92A 4XZWA 2A3CA 1GHRA 2D2OA 3MSDA 2QLYA 1UHVA 5M17A 2CBVA 1ZBCA 3AOFA 1XD0A 3ALFA 1W91A 2ZUWA 4OOUA 2VJXA 1W3JA 2PF0A 2WVUA 2XM2A 2DT3A 2FHCA 1JYWA 1PBGA 4JKKA 2YDSA 5E09A 2VX7A 5D8WA 3B8SA 5EB8A 1EQPA 3AIUA 1J0KA 4UOQA 2D0GA 2ZX8A 5IXEA 1EDGA 1NWUA 3QGVA 4FLRA 2IXUA 2WMGA 2BVYA 4AZ7A 1TG7A 1WZKA 2G3NA 4D6JA 3DHPA 1TR1A 2D0HA 4J3WA 5A2AA 1W32A 3VINA 1E0VA 5E6ZA 1E40A 1VBRA 2CKSA 3TTOA 3VIIA 4TXEA 2X0YA 2OSWA 3MUY1 3APGA 2XG9A 4PMVA 5BXRA 1UD3A 1LLOA 3PZNA 3SCVA 1ITCA 2J78A 4N0RA 2VURA 4ATDA 1K9DA 4AZBA 1W9PA 3AISA 4CU8A 2E8ZA 3G6MA 3HMCA 2G3MA 5C8BB 1W9BM 3W37A 1TVNA 3OZPA 1UKSA 1O6IA 3MKKA 4HPHA 1DWIM 4WKFA 1JZ2A 2CCRA 4MTVA 3ZMRA 4H7VA 1VRXA 1B3YA 1WKYA 5JBEA 3T0AA 2XM1A 2YBUA 5LA1A 4CCCA 4AIOA 1C8QA 1B30A 1NOFA 1Q6FA 1YQ2A 5AYBA 1U30A 3UG4A 2W67A 1UD4A 4M24A 3BGAA 3UEQA 3UG3A 4PCSA 3WD4A 4TX8A 5ABHA 3GDBA 4EK7A 1SR0A 3POCA 4PMUA 2DSWA 2Z1KA 3T0DA 1A47A 2QMJA 3GH4A 4QAWA 3T08A 3VIFA 3BLKA 1OIMA 3GNRA 3N15A 4URIA 1ZBVA 2VO5A 4IPNB 1A3HA 1VFFA 1G94A 3HU7A 3ARPA 2GJXA 1WZAA 3WFLA 1QHPA 4GO8A 4CUCA 4CVUA 1BVNP 4PUDA 1B3ZA 4PRWA 1CXFA 3KWXA 4JFWA 4N42A 1QBBA 4GI8A 5GNZA 1XC6A 5BRQA 4V2XA 4QP0A 1W1VA 4TOQA 1X1NA 4MNJA 3CBWA 5I24A 1EGZA 3OLIA 4UFHA 1UUQA 3AS2A 4JL1A 1UWTA 1XRVA 2VC9A 3CUFA 3ARZA 1E71M 1M01A 4HZ7A 4PTXA 2X05A 5EBAA 3WSUA 4D6CA 3OBAA 4MB3A 3PTMA 2UWFA 2DDXA 1JD7A 4AD0A 3WF1A 1P6WA 4AW7A 3MV01 3AHTA 1F4AA 2WVVA 2ZX7A 1EIBA 1GPFA 5BXTA 4J3SA 3VD7A 3IK2A 2OSXA 2WC3A 1JGIA 4GZJA 2J7HA 1W9UA 4LPCA 3VMOA 2VL4A 4WKAA 4ACYA 4ZE4A 1WAWA 3DYMA 3BMWA 1KGUA 4D1IA 1FP8A 1L0PA 2X1IA 3EDFA 1HX0A 3WF0A 3T2OA 3AIVA 2YA1A 5CXPA 1FFRA 3K4AA 3FY1A 3MUZ1 1WZLA 4CGTA 1ISYA 4P7NA 3GBDA 4CU6A 1V6UA 4OBSA 5IFPA 4MB4A 2EXOA 1HIZA 4YPJA 1LL6A 2OYKA 2FH8A 4CN6A 3MV11 3NDZA 3CHCA 4TX6A 1E5NA 4AD2A 3WELA 3AMKA 1JNDA 2WZHA 4PMXA 3SCQA 1CXHA 3FN9A 1GOOA 1E56A 1QVBA 1KCLA 4CD4A 3PZVA 3A4WA 1NM9A 4HA3A 5A8MA 1W2VA 2G41A 1Q6DA 3VMPA 1E70M 3SCTA 4GPNA 2ZOXA 1EO5A 1TA3A 4PMYA 3VM5A 3VIGA 3VILA 3SUWA 3AHYA 2YJQA 3AMGA 1V0KA 1V3KA 4HZ6A 4H8UA 3MU7A 1NWTA 1JZ4A 4PEEA 3OGVA 1MQRA 3WNKA 1MW1A 1PJ9A 2JALA 7A3HA 1JL8A 3VGFA 3WUGA 3RJYA 2ZXDA 1IZJA 1NARA 3DYOA 3MMWA 5GNYA 4QFUA 3RM9A 5JBDA 3EDDA 1VJSA 4LYRA 1WB0A 1CZ1A 4GI9A 4KGJA 1UR4A 1PZ3A 5A6BA 1K9FA 4M1RA 3U5UA 1EHAA 3BMVA 2W62A 2QF8A 5EFDA 4J28A 1V0LA 2BNJA 2E0PA 5LA0A 4Z2LA 3O9NA 3CZ8A 3NUKA 8A3HA 2WANA 1SMAA 1GOKA 3CMJA 1DWGM 2FGLA 4PYSA 4UZUA 1EDQA 2WB5A 4F8XA 5AC4A 3DECA 5DT7A 2J4GA 3L4YA 1NP2A 2YBTA 1W1TA 2PWGA 2BY0A 1GUVA 1W9XA 1O7AA 2PC8A 5FIPA 4W85A 2Y24A 1OGGA 1E6PA 3W29A 4TVCA 4Z2KA 4AWEA 3W82A 2W92A 4B15A 4W7UA 1ZB5A 2GK1B 1HL8A 5ECUA 3SUUA 1RP9A 3W6LA 3WF2A 2BVTA 3FNDA 3THDA 1E72M 1MVYA 3FHQA 1BF2A 2FGZA 3FAXA 4JKLA 3ZM8A 1LWHA 1Q6CA 4HMDA 1J12A 4H04A 3SCWA 2GJXB 2VVSA 3BXWA 3QHOA 2ZUMA 1H1NA 4P8VA 2G8ZA 4RE4A 2BY2A 4UFKA 2CNCA 1GVIA 2WSPA 1MQPA 3RM8A 2F61A 1E4MM 4AEFA 3KE0A 2ZX5A 3WH8A 4HTYA 4H2CA 3WQWA 2ZUVA 3GH5A 1NOUA 1NP0A 3MMDA 3AMDA 5BROA 3WENA 3UETA 2ESCA 1JYVA 1ISVA 2Z1SA 4P7OA 1E0WA 2HVMA 1QW9A 3GYCA 1HKJA 4FF5A 1OIFA 4BQ3A 2UY4A 3PZUA 1K9EA 4KRTA 4CN4A 8CGTA 2BS9A 3T2QA 1LWJA 3WH7A 5E0CA 3MS8A 3EDJA 4QCFA 5DFAA 3CH9A 2XVPA 1HF6A 3L4ZA 3EYPA 4IM4A 4JFVA 1JYXA 3AYSA 2W5FA 1J0HA 2G3JA 2WMKA 2IXVA 1OGSA 3W24A 4AD3A 1B3VA 2A3AA 4L4PA 3WMSA 2V5DA 1HJXA 5A3HA 3VD4A 1ZBKA 1CGVA 1MFVA 4JKMA 1E1FA 4ATLA 2QV4A 5A69A 3OIHA 3J7HA 3AHXA 5I23A 1KGXA 1GVYA 4LYPA 1LL7A 2ZXAA 4UNIA 3WIJA 3WKZA 3O6AA 1E1EA 2E40A 1V6WA 5FOOA 4DUXA 2A3HA 2CYGA 4C7FA 1BTCA 3THCA 5CG0A 1JZ6A 2XIIA 4NSBA 2VR5A 1C8YA 1ZJBA 3MO4A 4Z2HA 4E2OA 5FL1A 4TTGA 2V38A 3N11A 1B3XA 1ISXA 2VVNA 2WW5A 3AS1A 2J77A 1JFXA 4D6IA 2YDRA 1BLIA 4K68A 4ZXOA 3W53A 1H41A 3CGTA 1LG1A 1R86A 3VVGA 1XH0A 2DSZA 3F5KA 3UERA 3WQ4A 3N13A 2EQDA 4HMCA 2G4FA 1JDAA 2O9TA 3K8KA 1ODZA 1GOQA 1BHGA 3AQUA 1XV8A 4H8HA 1WPCA 3T0BA 3JUGA 3SCUA 4D72A 2DIEA 1ZJAA 2ZWYA 3WUEA 4HOZA 1BG4A 5E6YA 4D6EA 1KXVA 3WH5A 4IUGA 1V3JA 1DHKA 2RGMA 4D6HA 3WF4A 1MXGA 2WBGA 1W1YA 2OLHA 4E8CA 4AMCA 2PBGA 3ARRA 2VX6A 1OM0A 1KXHA 2W66A 1I1XA 1MQQA 1D2KA 1E6SM 3LPGA 1H49A 6TAAA 4V27A 1H4PA 4CD5A 3BH4A 3MANA 1HT6A 3AZSA 3BAXA 1CLXA 1GQKA 4AZHA 5F7UA 1H2JA 1TMQA 4U2YA 5DF0A 5A2BA 3WNPA 3BC9A 1ODUA 3N9KA 4W86A 2J8FA 4PSRA 5CZKA 1X6LA 4D6FA 1ZL1A 1OWQA 4B3KA 1MFUA 2DT0A 3WDRA 5KZ6A 4S3KA 4HOXA 1R7OA 2D23A 1KB3A 2XFFA 2WCGA 4NRRA 4M82A 4YHEA 1W2PA 4MNKA 3LPOA 3KEHA 4UFJA 1JIBA 2BV9A 3WMCA 3FW6A 2VZSA 1DWJM 1UD5A 3VIJA 1TCMA 2WK2A 1H0IA 2W4XA 4J27A 4U5KA 3LPFA 3AIEA 1QI4A 3WD0A 1ZS2A 1QI0A 1XH1A 1E6NA 3WQ6A 3ECQA 4A4AA 1UR8A 3MUIA 2X8RA 4ML4A 1VJZA 1UR0A 3ZJ7A 2NT0A 4D71A 2CBIA 3G6LA 4JCLA 2WC7A 4GQRA 5AC5A 5D9MA 4PTMA 5ABFB 2DH3A 2WHKA 3VGDA 4AISA 4X0VA 4BA0A 3A47A 4PMRA 3W28A 1AQ0A 2FH6A 1R8LA 5CJ5A 4ZENA 3ARTA 3AROA 3WDQA 4PSPA 1KXQA 2WBKA 3ZIZA 6A3HA 2D22A 4M29A 1B2YA 3RM4A 1ISZA 1CENA 4UFMA 3EDKA 5GQBA 1NWSA 3L4UA 5CSYA 2WSKA 3N18A 3NDYA 2O9RA 4UQEA 2VNCA 2D24A 1XCWA 3BCFA 4RE2A 1QHOA 2OWWA 3S2CA 3ARWA 2DT2A 4JL2A 4CCDA 3GH7A 3SURA 3AICA 4UQDA 3SUSA 1ECEA 2WWCA 2NT1A 1EHNA 1N82A 4GIAA 1DEDA 1TFVA 1EQCA 3BSGA 1RP8A 3SUTA 1OBAA 3AJ7A 3K8MA 5CGMA 3AZRA 3VDBA 3QHNA 1XH2A 1J0YA 1HVXA 1CGYA 3U5YA 2NSXA 2VX5A 3GTNA 3OGRA 4QLKA 3CUJA 1FH7A 4MPKA 5FKYA 3K8LA 2J62A 2V3DA 2EJ1A 4Y7EA 4UR9A 2YA0A 2JIEA 4ZXLA 4W87A 4MB5A 4J7RA 1F4HA 6CGTA 2CETA 3WDHA 1UH2A 4CN1A 1HJSA 1OGBA 1LF1A 4AYSA 2JFEX 2Y5EA 2YL6A 3PZMA 3VTRA 4DUWA 3SCPA 4BF7A 1E6ZA 1VF8A 3K4DA 1CEOA 3WF3A 4X0NA 1CTNA 4AD1A 1V3HA 1FHLA 3T2PA 2MANA 1HN1A 4GZIA 3KL3A 2BY1A 1Q4NX 3BAIA 2WAGA 4B9YA 4WLCA 3VGHA 1GOMA 1FP9A 4AXNA 1B1YA 5HDRA 5CQ1A 1W9DM 4AIEA 2WYSA 3B9AA 5I79A 5HPCA 4OKDA 4R5EA 3WH6A 3A4AA 3BAYA 3WUBA 4Q7NA 3T09A 4JFUA 3A6OA 3AFBA 1W1PA 3QR3A 4HA1A 1R85A 4OIFA 5DMYA 2EO7A 1QHZA 2JF7A 1KGWA 4TVDA 1UH4A 3SEPA 4D6GA 3CHFA 4XV0A 3VDAA 1XGZA 3IAQA 4PTWA 3KL5A 1E43A 1LJYA 2XJ7A 2EEXA 1MW3A 1D3CA 4ACZB 4HPGA 1J11A 3A3HA 1HJQA 5DO8A 3W27A 4PMOA 2CHNA 4CD8A 2VR4A 1JXKA 1G5AA 3VOCA 1E0XA 2GFTA 2VT0A 3MUAA 3CHEA 3VD3A 5HPOA 3WEOA 3WDIA 2PWFA 4BQ2A 2WHMA 4C7DA 4WF7A 3W81A 1JG9A 4OZOA 3ARSA 1CPUA 1SMDA 4UOZA 4GO9A 5E0FA 3CZJA 5M5DA 2PB1A 2DT1A 2XTKA 4MJ4A 2E8YA 7TAAA 3QOMA 5AY7A 3CLWA 3NYDA 4LGXA 1HJVA 3L2MA 4J3UA 2WHJA 4H8VA 2YDQA 3VUPA 1LL4A 2CKRA 2WCAA 4ATWA 1CLVA 3SUVA 2VCAA 1GNXA 1CYGA 1FHDA 1M04A 3VGGA 1BVZA 3F5LA 4WKHA 1KWKA 3NCOA 3IJ9A 3PZOA 1NQ6A 3VIHA 4KGLA 1ITXA 3WEMA 1TZ7A 2XVKA 2B31A 1JZ3A 3GXMA 1IT0A 3WL0A 2XVLA 2E9BA 3IANA 3M6DA 1CECA 1B9ZA 1CXIA 1E15A 1KFWA 3BCDA 2BXYA 1HNYA 4CKQA 4XUYA 2PWEA 3NSNA 1BG9A 1HKKA 1VEMA 4Z2IA 3OA5A 2OYMA 4UQCA 1UA3A 1HXJA 1QNQA 3IJ8A 3RDKA 3M07A 2W91A 4DM1A 3S6TA 4AZ5A 3ARXA 5D9OA 3HJEA 1QBAA 1PX4A 5CGTA 2C0HA 3TTYA 3LPPA 3WQ8A 3I3EA 4RL3A 3CPUA 1B3WA 4FLOA 1EOKA 4TUFA 1FH8A 2EPNA 1Y7VA 1TA3B 1TE1A 2O9PA 9CGTA 1H11A 4FLQA 1CXEA 3ARVA 2XFRA 1IV8A 1DWFM 4U3AA 4U3CA 1XD1A 2YOCA 2PWDA 3EMZA 2YLLA 1EDTA 2WZIA 1C3FA 1WP6A 2WC4A 4J3TA 2BVDA 4AZCB 3AYRA 1UQYA 2D3NA 1E4LA 2O9OA 5LYRA 3AMLA 1GJWA 4HOWA 1J01A 1K6AA 2CEQA 2WKGA 4UTFA 1OT1A 5BYWA 5I6SA 4GQQA 5JIPA 1XYZA 1JDCA 5DEZA 4UQBA 3CUGA 1BQCA 1QOXA 2WMHA 1VIWA 3VX0A 4AZGA 3ZR5A 2JF6A 4AY1A 2XVGA 1V03A 3VM7A 2XPKA 2VZVA 5JUVA 1EOMA 5TD4A 1Q6EA 5ABFA 1V3MA 4CCEA 2CERA 3NIYA 1Z32X 1JF5A 2X0HA 1US3A 1I1WA 2Y8VA 3GXIA 1QI5A 1QPKA 3VIMA 4BS0A 1RPKA 2E4TA 5FL0A 2TAAA 4JZ5A 2GVYA 3OLEA 3F4VA 5I3DA 1W3HA 1LG2A 2QMKA 3RJXA 2YLAA 3ARYA 2XSBA 3ZJ8A 1UWIA 2XGBA 4UCFA 1BPLB 1HVQA 3CHDA 3PZIA 5A6MA 1V6XA 4U31A 1BYCA 1WNOA 4D6DA 4NZCA 1H5VA 5E9AA 4DWSA 1YHTA 3L2LA 3II1A 1UKTA 4OUEA 1PIFA 1HP5A 4M8UA 2F8QA 2VCCA 1UWQA 1NOWA 4AD5A 2VX4A 1B31A 2FHBA 4W93A 2WPGA 4GKLA 2J7BA 1UWRA 1UH3A 3WEZA 2GJPA 2CHOA 2CESA 2EPOA 5I5RA 2DSKA 4B16A 2QPSA 3ALGA 5HNNA 3WNLA 4OJYA 1J9YA 2YA2A 1CGXA 1OINA 2WM0A 2ZXBA 3E1F1 2A3EA 1RD6A 3VO0A 4U33A 2ZUUA 5FCZA 2CIPA 1HL9A 1BAGA 3UCQA 4BZYA 3GNOA 4JHOA 1E9LA 4EAMA 2XIBA 3EBVA 1QNOA 1JDDA 4KRUA 1UKOA 3TP4A 1EA9C 5ABGA 2UY5A 1GOIA 3L4VA 1CXLA 4CU7A 3DHUA 2ZX9A 1XYFA 4J3VA 5A6JA 2BY3A 1KWGA 3D5HA 1M03A 3U57A 1G0CA 1UWSA 1JZ8A 4AC1X 2VTFA 4TTUA 1S46A 2EBNA 4X9YA 2CBUA 3AXXA 2OYLA 1US2A 1H0GA 4OBRA 1JZ5A 3WD2A 1BGGA 3AXHA 3RCNA 4F9JA 1QI2A 3F5JA 4W7VA 1XCXA 3UG5A 1AQHA 3CUHA 2CXGA 4P8XA 2YKKA 5A95A 2W63A 2ZWZA 2J8GA 5I77A 4OOZA 1W3KA 3CTTA 3ZSTA 4PCTA 5D9PA 1JFHA 2G3IA 2XYLA 3BAKA 1CDGA 4HMEA 5D4YA 3N1AA 2WZEA 3WBEA 3ZOAA 4JFTA 1WDSA 1VBUA 3EDEA 1C93A 4UOJA 2GUYA 2GDUA 2PWHA 1HP4A 1AMYA 3GZAA 1DTUA 1J10A 1VFUA 2AOSA 3GNPA 4BQ5A 5A94A 1W9VA 1VB9A 4W8AA 4A3HA 1H09A 2ZUSA 1KR1A 1GW1A 2FDMA 3CZKA 3I3BA 1OD8A 4DWSD 2WVTA 5E70A 3RO8A 1FOBA 1MWOA 4HU8A 2ZUTA 1MXDA 2UY3A 3MMUA 2CBJA 4DUVA 1GONA 3AS0A 3W6MA 1EH9A 1UOKA 3PBGA 4WSJA 4UFIA 1DWHM 2J74A 2Y8KA 3ZT6A 3SIMA 1UD6A 1C7SA 1V3LA 1UG6A 3VNYA 2VUYA 3FXYA 1JI1A 2WCSA 1C90A 3WFZA 5IHRA 3FHAA 5CPSA 4AZIA 3CZGA 3OZOA 2V3EA 2V3GA 4F79A 1WDPA 3VD5A 4GI6A 1WDRA 5BXSA 1NWRA 2VCBA 3CMGA 4GZEA 2FHFA 5A8QA 1WDQA 2VZOA 4B9ZA 5BXPA 3IJ7A 4WIWA 3UR7A 3ARUA 3W0KA 1TUXA 3VIOA 2ZE0A 2DIJA 3CIVA 1C7TA 3ZQ9A 3VNZA 1UQZA 1SYTA 1HJUA 3GXFA 5A8OA 3D3AA 2J7CA 4W84A 2AAAA 2DH2A 5EMYA 1KR0A 2QHAA 1DP0A 1GZJA 4PBGA 3OLDA 4AZCA 1HJWA 4DM2A 1M53A 3A4XA 3K1DA 4GXPA 5A6AA 3RPMA 2E3ZA 4AIUA 4PTVA 5CPTA 4GINA 2J79A 1E4NA 2J47A 2D1ZA 2DGAA 3TTSA 1XHGA 4P7RA 2CPUA 4JCMA 3M46A 5CPQA 3ZJKA 1JAKA 2WHLA 3WQVA 3POHA 4A3YA 3ZT7A 1E6QM 2YIHA 1L8NA 3BAWA 3WL1A 4ZEPA 3K46A 2X09A 1GJUA 3EMCA 5BWFA 2AMGA 4Q22A 3WNOA 2J75A 5DT5A 4EE9A 5IFTA
chains in the Genus database with same CATH superfamily
3TCSA 1OYBA 3LN3A 3NDOA 3SRDA 4PB4A 1G1YA 2Q8ZA 5K9DA 4HTBA 1H3GA 1HKMA 2R1NA 4Q4OA 1XSKA 2OQLA 3OGSA 1UR3M 3QR1A 3BTNA 4HSOA 3UPBA 1O1HA 3H7RA 4XZIA 2IKJA 2FB3A 1FXPA 4DNMA 1BSLA 2OO0A 3FJ4A 3GHUA 3DYPA 4F0KA 4DJFD 2WOQA 1VENA 3R94A 2WVSA 3AIBA 1VCGA 4F9DA 4IF2A 2PD5A 1TUFA 4DWDA 1IZKA 4XB3A 4QCEA 1EWEA 3WY1A 5LIKX 2XZ9A 3PULA 1IIHA 1IR1A 3TSMA 1SZRA 2VZUA 3QXBA 1GQNA 5BRPA 5CPNA 1VZWA 2PDMA 1PX8A 1UIPA 4YTTA 3CC1A 3W22A 1QO5A 1XPYA 1M5WA 2VDHA 3BARA 4QLJA 3QYQA 3HB9A 3KZSA 4JQAA 3QY8A 4P7QA 1G9HA 3GWQA 4QE4A 3VNMA 1S3TC 3VCRA 4U5IA 3UZYA 3GIPA 4H2HA 2VELA 4ES4A 3B9NA 1ZBWA 2DQXA 3HPFA 1FCBA 3MW7A 1GYLA 3L4XA 1CT5A 4HZ8A 4YN5A 4HU0A 4ZGYA 4PRTA 3UPWA 3OG3A 1Q45A 2TSYA 4UQAA 2NVDA 3BG5A 3VIPA 3IPWA 3DH7A 1C9DA 3WMBA 4LX4A 3GXDA 2OWCA 5CLTA 3AIQA 5I2UA 1WCGA 3C3NA 3IVUA 5IBXA 5GPRA 4KH2A 3F03K 4C6CA 2PI6A 2XWEA 4EANA 4M56A 3BOXA 4WSKA 3W1RA 1QU4A 4PMQA 3LSBA 4G8TA 1GVSA 3WQOA 4XZBA 5EMKA 1SW7A 1SU5A 4XD3A 4AVOA 4Q33A 4YYCA 1B90A 4JAWA 1OCQA 1GQIA 1H1YA 2J7DA 4JX4A 4GYPC 2JIWA 4WJ8A 1BGAA 2WXDM 4NI3A 1VFMA 5HOSA 1UZ1A 1YADA 3M0KA 1FWSA 2HXTA 3FSTA 3I65A 1K6WA 4FK9A 4NG3A 4B5TA 5LXEA 3W4RA 3THQA 1Q66A 3WK0A 4XKYB 3OYZA 1BQGA 1PX3A 4BQ4A 2DSUA 3OQEA 4PB5A 3VOFA 4ADSA 2BVWA 1OG0A 3PHAA 3TTQA 4ERGA 4MSSA 3C56A 4POCA 2PDCA 2H8ZA 2VI0A 3WD1A 5FEXA 3IV8A 1U33A 5GNXA 4HHPA 2J25A 2GGEA 2WMJA 3RRXA 4H41A 1XLEA 5HBFA 5AOUA 1PIGA 3GUGA 3UR8A 3NSXA 2V9DA 4EACA 1UD8A 9XIAA 4C6IA 2G97A 1HGYA 3WBXA 1AVAA 3TYAA 4UQ9A 1KM0A 3TK7A 2OCZA 4U2ZA 4AF0A 5A2CA 3BLPX 4FLSA 1BYAA 3KBJA 4MY9A 3DZ1A 4MAZA 3LZ5A 3SJ3A 3ZO9A 3MQTA 3LLDA 4YJ5A 2QGHA 2CITA 4IFKB 5CSSA 3AU2A 1S2WA 2V30A 4UMCA 2V5CA 3AYVA 2AGTA 3OZMA 3HURA 2ZICA 3P3BA 3N6HA 1KA9F 2BXZA 4JQ3A 1C91A 4PMDA 3CO4A 1ITQA 5BCAA 1XKYA 2VUNA 3EMQA 2A3LA 2XVNA 3NQDA 2DU2A 9RUBA 4MFDA 4JR5A 2DPEA 3FSUA 4FI4A 3PZQA 2WSQA 3UZJA 4O11A 3VDCA 4M81A 2QUUA 3VE7A 3TUUA 2Z4GA 2Y4SA 1W5PA 1K8CA 3NSMA 1VLIA 2JBMA 2QR6A 4MKSA 4BCEA 3V36A 3EA2A 2QCCA 3MMTA 2WLZA 1JAEA 3N9RA 1X97A 3DC0A 5I3FA 2TRSA 1RBAA 3QJAA 1EEXA 4GI4A 1R46A 2GUUA 1I0BA 1VRDA 4G5DA 4ACZA 2DY3A 3QQ0A 2VFFA 4MWAD 2ABBA 1BXCA 2RUSA 3VKDA 4QGCA 3NVDA 2GSEA 1J0IA 3UWQA 4ASTA 2TMDA 1A50A 1XIJA 2QPUA 4JHZA 1KM2A 2P10A 4GG9A 3OG2A 1UZ4A 3LCGA 4E2VA 2BFGA 4W7WA 1K8YA 3RR1A 4UZSA 1XIMA 3ERPA 2PMQA 3E0WA 4PUMA 3OO2A 1JYNA 4DZIA 2DZSA 1RZMA 3UZXA 3PUOA 3ITTA 3B0YA 3BDKA 1W5MA 4Q32A 3STCA 2YL5A 4WCJA 2ZDRA 3HQNA 3PZTA 1V6VA 1V5XA 1TTQA 2Q09A 4YLWA 1E6RA 2ZYFA 4LQ1A 3ABSA 1TVPA 2PZ0A 1S39A 3NO5A 4PMZA 2E1WA 2PBOA 4CD6A 1LM1A 3S2NA 2I1OA 2HV5A 5CPLA 1ZCOA 3EWWA 4WDUA 1KBBA 4M80A 3W26A 4I7UA 4KMQA 4MJ2A 4XZWA 2Z1VA 4DXKA 3EX4A 3C2OA 1OHLA 2XDFA 1H50A 2YXXA 1ZBCA 4TO8A 5EY5A 3S5ZA 2ZUWA 5DXXA 2C0AA 2PF0A 1MEWA 4ZCWA 2XM2A 2FHCA 3HGSA 1JYWA 2QCDA 4ZTXA 2YDSA 4IG2A 4WDTA 2EG8A 4L61A 2VXNA 5EB8A 5D8WA 1EQPA 7ENLA 1GJPA 4JDBA 2GOKA 2ZX8A 2IXUA 2KZHA 1GWJA 1A5BA 1JCNA 2D0HA 4TIMA 5A2AA 4BF5A 1KNWA 1PSCA 1E40A 3QGKC 2WZTA 3TTOA 5A6TC 3VIIA 4TXEA 5T26A 3H53A 3W7LA 4JN7A 3APGA 2XG9A 4ZODA 4QG6A 1LLOA 5K2ZA 3P81A 3SCVA 1ITCA 5L9FA 4N0RA 4AZBA 1QATA 4TU1A 4QS5A 3PPGA 1RQEA 3G6MA 1LROA 3HMCA 2G3MA 1TVNA 3OZPA 1UKSA 4IFRA 2CCRA 4Q4PA 2ISSA 3ZMRA 3ZYZA 4EIVA 4LNYA 2AQVA 1NFPA 3XIMA 3S2LA 1MUCA 5JBEA 4O53A 1A5LC 4AIOA 3K13A 1C8QA 1NOFA 4ZO6A 1Q6FA 1TJ2A 3H2MA 3M44A 5AYBA 3UG4A 2W67A 4M24A 3UEQA 2D2HA 4XISA 4FR1A 1DXFA 1YXDA 5CJNA 3LM7A 3UU0A 4CNUA 4GCXA 4HQVA 3N15A 1UMLA 1PKYA 2E25A 1ZBVA 3H2CA 1R9YA 5K4ZA 1P0NA 1UB3A 3HU7A 5MF5A 1XDJA 1QHPA 4GO8A 2PDPA 5T9BG 4PUDA 1B3ZA 4PRWA 1EX1A 1YLVA 3GAYA 4JFWA 3KDNA 1QBBA 3E2SA 4QP0A 5J5RA 4TOQA 2FDSA 3CBWA 2QYGA 2YCLA 2QVHA 1UUQA 1XLFA 4JL1A 3CUFA 4HZ7A 3UNDA 4PTXA 3GU9A 2RJHA 1F2JA 1RR2A 4RV3A 4M51A 2E77A 1JD7A 4AD0A 1P6WA 4AW7A 3AHTA 2ZX7A 4C6JA 3P62A 4N9BA 3UZWA 4GQBA 2I7GA 4DBEA 1E0UA 1QPOA 1I60A 2WC3A 4GZJA 4ZB0A 2VL4A 5FJRA 3WQPA 1VHCA 1WAWA 3DYMA 3BMWA 1KGUA 4D1IA 5T91A 2JKEA 3H7VA 5C9XA 3GB6A 2PCEA 3WF0A 5FJTA 1BWLA 3T2OA 3AIVA 3NQ6A 3QZEA 2YA1A 5CXPA 5D02A 1FFRA 4QBXA 3MUZ1 4CGTA 1SJDA 3UR5A 5FF2A 2Y7EA 3UNTA 3KCJA 1H7PA 2EXOA 3QVQA 1LL6A 3MV11 3NDZA 4JY8A 3U6WA 1E5NA 4NP7A 4FB7A 3AMKA 1VYPX 2DFAA 1MDLA 3SCQA 4IQLA 1OX5A 2E1DA 2DZUA 2Y5JA 3PZVA 3LHYA 4QAIA 1NM9A 3CT2A 3UXDA 4S2BA 3E12A 1AK5A 1U5JA 4Q8VA 1E70M 4KERA 3SCTA 5F2MA 3VIGA 3VILA 2VD8A 3AHYA 4E5TA 1V0KA 3CXOA 3LSCA 1V3KA 2V82A 4HZ6A 3B4YA 3DHDA 2V2DA 3MU7A 4R9XA 1JZ4A 1TV5A 3FV9A 3LQLA 3OGVA 5D2TA 2CLLA 3BCJA 3MP5A 1X6UA 1BXBA 3ZVIA 1H62A 2W0UA 4IIFA 2ZXDA 3ENLA 3QGAC 1IZJA 3MMWA 3RM9A 4AG0A 1UJPA 4KGJA 2PLCA 3TX9A 2B7PA 4O1BA 1J79A 4HJWA 4QTGA 2BGSA 4PBFA 1XG3A 1EHAA 3U5UA 1XIDA 2QZRA 3BMVA 3VAVA 1RCQA 1IXQA 4DJDA 2PPGA 1AMKA 1V0LA 3APYA 5LA0A 1T0OA 4CQCA 1S2UA 2PDUA 2QCDB 4RNFA 4O4VA 3TZFA 1AW1A 1OFOA 3JZEA 4F8XA 3Q58A 4MZYA 5AC4A 1W56A 3PNZA 2J4GA 2PDWA 4GFIA 4DO7A 3LQGA 3SIZA 4HN8A 1W1TA 5MKGA 5I09A 1GUVA 4L5ZA 1Q6OA 1W9XA 4XD6A 3FKKA 4JTCA 4F2UA 3FKRA 3LRKA 2PC8A 4W85A 3KUMA 4WHBA 1VFSA 3GDKA 4EOUA 4RUBA 4AWEA 2H90A 1WQ5A 2W92A 4B15A 4W7UA 4FS9A 3RMJA 5AFDA 3ITVA 2WJFA 3V0UA 2ISVA 3HPAA 5ECUA 4GKTA 4KIRA 5HUOA 3DC8A 3R10A 3THDA 4OVXA 3FHQA 1BF2A 4TV6A 3P0WA 3ZM8A 4LCQA 1PZ0A 2HTMA 4HMDA 4H04A 2GJXB 3KBMA 1AL7A 4RE4A 4KWVA 2J9YA 2CNCA 1GVIA 2A6NA 2WSPA 3T81A 3RXZA 2F61A 3BUVA 3NQBA 4AEFA 1TPFA 5D38A 3MI2A 3MJMA 3NPXA 5DY3A 1EGMA 2UBPC 5G5IA 1NP0A 3LNMA 3MMDA 4IP4A 3AMDA 4UXDA 3ZLHA 2ESCA 3H12A 3FA4A 1TR9A 4FF5A 4KW2A 4IFOA 2UY4A 1F8IA 3TH6A 1VYSX 4CN4A 2ALRA 4HPNA 2J8TA 3QEZA 3VNKA 4KFNA 1KC7A 5E0CA 1ENUA 3NZPA 3CHVA 3PPCA 4E3TA 1J0HA 4DYJA 1PCKA 2WMKA 1R9ZA 2IXVA 1OGSA 4ERIA 3GFXA 2BOGX 1B57A 4ZQMA 4PR4A 5FA5A 4ENLA 1WX0A 1B3VA 4KETA 4L4PA 3M41A 4Y8FA 1HJXA 3W71A 4JKMA 1E1FA 2NXIA 4NJKA 3N2TA 3FJLA 3J7HA 4A29A 2ZXAA 3WIJA 2BASA 4UCGA 3O6AA 4WEVX 3NQ2A 1O1ZA 3LI1A 5FF7A 5K3VA 2CYGA 3THCA 2A79A 3R7MA 4J5NA 5BU9A 1T41A 3MKCA 2AAMA 4R9OA 1F3TA 3ABZA 4OFCA 1HL2A 1RXOB 1DKWA 4IJCA 2NZLA 4TTGA 3NOEA 2XGZA 4DX3A 1B3XA 1J2BA 2WW5A 3W7GA 4LVFA 1E9ZB 3HM7A 3SDOA 2DVUA 1DJWA 4LH8A 3BJSA 1OF6A 1SGJA 3BURA 1MEHA 3M0VA 2ANUA 3CGTA 5AYZA 3HG2A 2G0WA 5TNVA 3WQ4A 3N13A 2EQDA 1P6CA 3K8KA 3MT1A 1I6NA 1BHGA 2OTDA 4H8HA 1KKRA 3WCZA 4D6EA 3WH5A 2J9XA 3G1DA 3LYEA 1V3JA 1F3WA 4KCUA 1DHKA 2RGMA 1OABA 1F76A 3R58A 3QMRA 1JCTA 1W1YA 2W6RA 4AMCA 3QFWA 3G1SA 3M47A 1MQQA 3ONCA 2CW6A 1D2KA 3TYBA 1E6SM 3MYPA 2ZVRA 2OB3A 3BAXA 1XYAA 3GFZA 1Y5XA 3WNPA 1RAKA 4B5UA 1DQXA 1ODUA 2PP0A 5IDZA 5HJLA 5CZKA 5U7SA 4A22A 1EPVA 1ZL1A 1AZ2A 1OWQA 2Y7GA 1KRCC 1TWWA 4L7ZA 5H8UA 1MFUA 2DT0A 1FCUA 3ORWA 2ACRA 4S3KA 4HOXA 5I00A 1SUXA 5LIUX 4AH7A 1KB3A 2VEKA 1VS1A 1X96A 5EPDA 3T05A 1AW5A 2QVNA 2XFFA 4L80A 3S6DA 4EX4A 3UVIA 2PWVA 1W2PA 4A6GA 1J93A 4LVDA 3KEHA 2OLSA 1O5QA 3DGRA 4RXFA 1UD5A 4C91A 3VIJA 2YBVA 3IRSA 1TCMA 2OFJA 2PGEA 3WD0A 4ML9A 1UC4A 3ZXWA 1XH1A 2YB1A 3WQ6A 3ECQA 1UR8A 4Z1AA 5C7HA 2CBIA 2V8ZA 4TMCA 1BEUA 2H9AA 4PTMA 5D9MA 4OQVA 2Y70A 3GO2A 2GWNA 1M7JA 2QQ6A 4RW3A 3NTYA 4GX9A 4PMRA 2XIJA 3W28A 4W9TA 1DJIA 1AQ0A 3CIWA 4YTSA 1M7OA 4YVVA 3ZIZA 3HV8A 2P8BA 4UTWA 2D22A 4OU1A 4L56A 2FTWA 1LP6A 5TAOA 1I2QA 3LDVA 3NDYA 4UQEA 4RE2A 3VI2A 4DPPA 2Y1HA 5DMLA 3C0LA 3GH7A 4CCDA 3AICA 1LQ2A 3NZGA 4JDYA 1ZENA 3LU2A 5CBIA 3TIMA 4GIAA 3G77A 2E6YA 1E1CA 4OV4A 1DIKA 5FF3A 3LNPA 3TYCA 4RDYA 5CGMA 3LCHA 3S8HA 3N4FA 3UXIA 1J0YA 1X39A 3OJGA 1G7VA 3VFLA 4EWND 3OGRA 4QLKA 2ZA1A 2W27A 4ZO8A 3W7KA 5FKYA 1SO4A 1RHCA 3QQWA 2J62A 1REQB 1W5NA 2JIEA 3G8EA 1H51A 5HNTA 4MB5A 1UPPA 4GISA 4J7RA 5EGRA 1F4HA 3CUXA 2CETA 1IGSA 3BK0A 4ZR8A 2Y5EA 1E6ZA 1FWJC 2C13A 1S3HA 2PP3A 2HSAA 4ZQRA 1FHLA 3C3UA 3N6QA 1IWBA 1WXZA 2PDNA 4B9YA 3N3MA 2A7PA 4C1NB 3VGHA 3ELFA 1ZJHA 2P5NA 1B1YA 4NL1A 5CQ1A 5LNVA 3V0TA 4R5EA 3HG3A 1YNPA 3V0SA 4GACA 2XN1A 1Z8AA 1IEQA 3B0PA 1EZWA 1VP5A 1XDLA 2C16A 4LSBA 3ITGA 2EO7A 2YCIX 1QHZA 4NQ1A 2JF7A 4TVDA 3W3OA 2XZ7A 3FA5A 3STEA 4JYEA 3U0HA 3M43A 3E2QA 1XW8A 3E6EA 3NQEA 4MYAA 1EF2A 1QK0A 4HT3A 4JGDA 4PTWA 3B0VC 2NUXA 4FZIA 1D8WA 3RG6A 1VHNA 4XKYA 3U4FA 4HPGA 5I3HA 3PBYA 3P6LA 4UTMA 4XAYA 4IZGA 3NG3A 4PMOA 1DXIA 1UJQA 2IKIA 3USBA 4CD8A 2ZZ6A 2VR4A 2C14A 3M4HA 2VT0A 3MUAA 3CHEA 1PL9A 2RH9A 1VQTA 2Y62A 3WDIA 5HPOA 5I3IA 2O0TA 4DBDA 3FS2A 1Y0EA 4QS6A 4AUBA 4REQB 2V0TA 4MZ1A 1IEIA 2WSRA 1OX4B 4DJEA 2Z27A 7TIMA 4NYYA 3QSRA 1SO5A 3QLDA 1EB3A 3KBSA 4LBUA 3AWNA 1A5MC 3F5LA 4WKHA 3PZOA 1JCLA 4KGLA 5C2CA 4GQGA 4GYKA 3WEMA 2YX0A 1FDZA 3MUXA 1AUSL 5H8MA 5I7GA 3F4NA 2YXGA 1CXIA 1B9ZA 2HK1A 1MZRA 2INEA 3H2FA 3H2EA 3NSNA 1BG9A 4ROPA 4Z2IA 5C9WA 3WJWA 3IJ8A 1SFLA 1FBAA 3ARXA 3NZQA 5CGTA 2C0HA 1LBLA 4LUTB 3S83A 4IMDA 3WQ8A 3MCOA 1F3EA 3PNUA 3LTSA 3HTWA 4FLOA 1N8WA 1QW7A 2FZMA 1EOKA 3HIJA 4TUFA 4LW7A 2OOGA 3W2NA 3LCXA 1X1OA 9CGTA 4I7VA 1H11A 2FJKA 4K37A 4JIPA 3SSZA 1IHIA 3ISIX 3GE7A 3LHVA 2YOCA 3C0QA 3U4AA 2WZIA 4J3TA 3B8TA 2BTMA 2ICSA 4MFEA 1E4LA 3O6CA 1UP2A 4OE7A 4WR3A 4D8LA 2INZA 2O9OA 3GVVA 3ANUA 5LYRA 4HOWA 3GS6A 3O16A 1K6AA 4I8YA 5I6SA 4GQQA 5JIPA 2XIMA 1TPC1 3TC6A 1JDCA 4QXIA 5DEZA 3KVJA 1BQCA 1VIWA 1ZAIA 4GMEA 1YBQA 3BJTA 3VX0A 3OHIA 3A5VA 1F3XA 4FIQA 1LYXA 3KTSA 3TN5A 2VZVA 1EOMA 1Q6EA 1R3QA 1V3MA 3MBFA 4CCEA 2CERA 1WAUA 4I9TA 1NAL1 1M7PA 3UJRA 1US3A 2Y8VA 3PPHA 3HQOA 1RK6A 1A49A 4UTTA 2E4TA 4JZ5A 3GNNA 1VIZA 3OLEA 1B4EA 5I3DA 1F6PA 4IQJA 3G3DA 3JRKA 2QMKA 3RJXA 2YLAA 1GPWA 5I03A 3ATZA 4F2TA 3CM4A 2XGBA 3VXGA 1WA3A 2OX1A 3N2MA 2VFGA 4U31A 1WNOA 4PEKA 1PKMA 1NSJA 4JY9A 1X38A 4S38A 4UMAA 4RR4A 1T7LA 3TLLA 1NOWA 1P7TA 2YCJA 5JMUA 4W93A 5F2GA 5HATA 1ONRA 5CC7A 2GDQA 2RDXA 1VH7A 2GJPA 4DEFA 1VPYA 4K3ZA 2ZRWA 1RLDA 3ALGA 3IVTA 4NNBA 3WNLA 4OJYA 4DXVA 4L6DA 4V33A 2ZXBA 3KHDA 2WJDA 3E1F1 5H1WA 3GG7A 3ZS4A 3T44A 3WQCA 2OG9A 5BOOA 3UCQA 3CAQA 4JHOA 2QF7A 2HE5A 4JHMA 1A80A 5FF4A 5HR6A 4KRUA 3LV5A 3P61A 1BWKA 1UKOA 1EA9C 2UY5A 1QPRA 1CXLA 4CU7A 2ZX9A 2Z1XA 3M16A 1KWGA 3D5HA 3U57A 3W7JA 2HE8A 2VTFA 1W3TA 2YR1A 2DJXA 1VD6A 3HPSA 1US2A 4O1EA 3KRBA 1QUMA 3BLIA 4JTTA 2W63A 2NV2A 1JUBA 2XIOA 4JTJA 3ZSTA 4PCTA 3HBLA 3AWOA 1PB0A 2OLAA 3BAKA 5D4YA 3NM3A 1X7IA 3NAVA 3EDEA 1PUDA 4XZ9A 1AMYA 3O8AA 3GZAA 1J10A 1NDZA 2GVLA 4GNJA 4A3HA 1RJPA 2ZUSA 3CH0A 1KR1A 1E1CB 2WNNA 3I3BA 3WG6A 3ZVHB 4CQBA 5E70A 3GTFA 4JN6A 3N34A 1RV8A 5BMWA 1XBZA 1EH9A 5M1TA 2PGWA 1VPQA 4WSJA 4UFIA 1POKA 5C9RA 2Y8KA 4KRZA 4CNPA 3HPXA 1UMYA 1QASA 1AJ0A 1VFTA 3OQ8A 1UG6A 2NVAA 3IWPA 1V6TA 1E51A 3TXVA 3WFZA 2YGYA 1JCJA 3CZGA 2VGFA 1WDPA 1TV8A 4GABA 5BXSA 2VCBA 3GC2A 4GZEA 2FHFA 4JXCA 4XQ6A 1K7XA 4B9ZA 5BXPA 3RGTA 4US6A 2ZA3A 1Z44A 2DZWA 3W0KA 3VIOA 3GYEA 2DIJA 3EWZA 1UQZA 4FSAA 4N4QA 3GXFA 3MWAA 5A8OA 2QCFA 2J7CA 3MC5A 3R2GA 2AAAA 2DH2A 5CSRA 3U2ZA 1FWWA 4QROA 4IX2A 4K8HA 1Q2SA 4RW5A 5HWMA 3BGJA 3CPRA 1M53A 3E0FA 4O14A 3UA3A 5CC5A 3NXLA 3DIPA 3TV8A 3D0CA 2CLFA 4GINA 5FI8A 2J79A 1E4NA 3BICA 1ZSXA 2XN2A 3BE7A 2DGAA 1XHGA 2CPUA 4JCMA 3IIOA 3M46A 3ZJKA 3WQVA 4IICA 3POHA 3ZT7A 2Z1WA 4KT2A 2YIHA 1L8NA 4G7EB 4ZEPA 4PFHA 4XSMA 2X09A 1DJNA 5G2IA 4DZAA 2J75A 3FYPA 4J1OA 5DT5A 5IFTA 3R6IA 3T8LA 5BNKA 2Q6ZA 3W38A 2GVGA 4XTIA 1DL3A 1RK5A 5I78A 4IWWA 5C9UA 4MNLA 2X30A 5ABEA 1UIOA 3E5PA 4HN4A 3LLXA 1YNYA 3E02A 2HPMA 2BHYA 1A5UA 4W4QA 3FK4A 1OD0A 3PWIA 2UY2A 4L1WA 4L9ZA 2V3FA 1V0NA 1Q6GA 3TR2A 3A21A 1QCWA 2HISA 3SCRA 1UKQA 3AZTA 1UR2A 2BG5A 3UWEA 3WQ5A 1WZMA 1ESWA 1XLDA 3RN6A 4W8LA 4NRSA 2F84A 1CGTA 2ALDA 1UR1A 3E0LA 4A8IA 1E3ZA 4JTSA 3P8IA 3BG3A 3SCNA 1AQMA 4I5UA 1KBIA 1V8EA 5RUBA 1V7YA 3IIZA 1B3OA 5M03A 4EVZA 5D8ZA 3ZSSA 3O2LA 2P1FA 3DFHA 1UYQA 2XISA 3SCSA 3EX6A 4YIWA 1D7FA 3QY7A 1VFOA 1KD0A 4F0MA 3B8DA 5AZ0A 4JQ1A 1IIGA 2OX4A 4D1JA 1SZEA 1VEOA 3BPWA 2J7FA 3U8GA 3O0FA 4AU0A 1E73M 4L64A 4KQNA 1GHSA 1NH6A 4RNIA 3ES7A 3I3DA 3AIWA 2WZMA 2PLMA 3EB2A 4IXXA 1JXJA 1X7FA 2HWGA 1I8JA 2QUTA 1BFNA 3W86A 3O7UA 2FVLA 2V81A 1ZJIA 4HNLA 2R8WA 1KQYA 5CZTA 3MSGA 1EC7A 4F0SA 2R14A 3W1NA 4LV4A 1PAMA 1UCWA 1FWGC 4IPIA 3V5FA 5E0KA 3W72A 5B7YA 3WO8A 4H00A 4HK7A 3URNA 3UVAA 1F74A 1W3LA 1NF0A 1GCYA 4L4LA 1MW0A 5KZDA 3ITOA 1UROA 1EXPA 1D7KA 2Z6IA 4XTDA 3T0TA 1YXYA 3L4TA 4K2SA 4M6UA 4M7SA 4B3LA 4H6EA 3WDPP 2GSJA 3TA9A 5BWAA 2ZZ3A 2VEMA 4KFPA 2VEFA 3NA8A 4DWSC 1V7AA 3GU2A 2POZA 4QDMA 3WK3A 4LAOA 1QNRA 4ALDA 5DRIA 2EPKX 1C8XA 3W7OA 1CB7B 2ZXQA 3JZUA 2TYSA 1HUVA 1E55A 1GORA 1J0ZA 5DANA 4OBTA 5CAKA 4ZOCA 1W1A1 3CNYA 3AI0A 1FFQA 3PJUA 3LB0A 4BWLA 2XUCA 3WNMA 1WKDA 1ZUAX 1PZ2A 1CBGA 3ITCA 1KCKA 1H61A 1A4MA 4EPBC 1SVDA 2X2YA 1W3IA 3SAZA 6TIMA 1US0A 5IHSA 2V63A 2DORA 5FJIA 4IPJA 4H19A 1LRTA 1ISWA 2IUZA 3A22A 4X3ZA 5C2XA 1LBMA 1F05A 2VZTA 1JNEA 4S39A 3UR2A 4Q8WA 3VOJA 3PZ9A 2DEPA 2VEGA 2VFEA 5CSUA 1HW6A 1VBJA 3CO8A 1XRFA 1V4YA 2ACQA 3TN4A 1ZU8A 1OJXA 4QRNA 4PUEA 4DY1A 3B9DA 4AEOA 1KLZA 4IL2A 4Z2JA 3EXRA 4FR6A 4ICCX 4R7JA 1XUUA 3GW0A 2XHYA 1H7OA 4M3PA 1IYXA 4US5D 3W7EA 3VU2A 3IVSA 4ZTYA 3RMEA 4P7LA 4JYFA 5DXYA 2HBXA 3NVTA 2F7FA 1G01A 4ADTA 1DXEA 3LHTA 4PCNA 4MB1A 4DNHA 1EZ2A 2GQ3A 3G1RA 3QC0A 3QV6A 5HK4A 4PRRA 3E9AA 3MCMA 3GUWA 2J13A 4G9PA 2P88A 1GQJA 2YL9A 4I7WA 1ECQA 3KCOA 3KLLA 1FUYA 3ZJ6A 5HXMA 5J8LA 2OODA 1SJAA 3W84A 2E6FA 2YW4A 2R91A 3ZR4A 6XIMA 4U28A 3WN6A 3M5XA 2EG6A 2P0IA 1G7UA 5E1QA 3I7SA 4RJEA 2XWDA 4LF1A 4DF1A 1E3XA 4EPKA 2A21A 2HVOA 4AX7A 4A8NA 3VGBA 5C2GA 2Z2BA 4JPGA 1BSIA 3PWGA 3VPLA 3FGCB 2ZUNA 4MNMA 1SFSA 1XLIA 3G8RA 4IISA 4YNGA 3NPUA 7XIMA 1TKKA 3RUBL 4QITA 4Z1CA 4DQWA 1GOWA 2E6AA 2XSXA 4NJJA 1UD2A 5E5CA 1W54A 1OFPA 1WKFA 2ZQ0A 1J8VA 3SRHA 2WMIB 1T5AA 3R8HA 3KXQA 4FMVA 2ZX6A 1W1IE 3M0XA 3SW6A 2NX3A 4S3JA 3RHGA 4UB9A 2R1PA 1ICPA 1OC5A 2BHUA 1CXKA 1GZ1A 1TRDA 3AJXA 2ISWA 1EO7A 1L2QA 3TC3A 3BSHA 4LUSA 3VIKA 4W89A 1JR1A 1C92A 4MUPA 2A3CA 4H6KA 1WBJA 2D2OA 3MSDA 2QLYA 1UHVA 5M17A 1FXQA 3RLHA 2CBVA 3AOFA 3IGUA 3ALFA 1W91A 2VJXA 3IS4A 1ME7A 2Z00A 3C6CA 2WVUA 5CEWA 1FWTA 1PBGA 4JKKA 5E09A 2WM1A 2VX7A 4XUGA 4LTSA 3GXTA 2PA6A 3QY6A 4UOQA 2D0GA 2F6UA 5IXEA 4Z1DA 5CAHA 2Y63A 4FLRA 2WMGA 5TQLA 4AZ7A 1TG7A 3D3FA 2G3NA 3L0KA 1TR1A 3VINA 3DG3A 5E6ZA 1EJRC 1VBRA 1QO2A 3MUY1 4IFKA 5BXRA 4PMVA 1UD3A 3COTA 4XAGA 1W3NA 2VURA 1RBOB 4C65A 3L0GA 3UCDA 1JQXA 4HPHA 1O6IA 1XLCA 4WKFA 3QPZA 1JZ2A 4PCPA 4C6BA 4MTVA 4ZQNA 3QV9A 1U5VA 4ICNA 1B3YA 1PXGA 1EJWC 4CCCA 2CZ5A 1PV8A 1LLZA 2PAJA 1H7RA 1YQ2A 1U30A 4ZO7A 4PCSA 4TX8A 5AVHA 4M7TA 4EK7A 3DDMA 1SR0A 3CUZA 4MLRA 5XINA 3E0IA 4PMUA 2DSWA 3T0DA 1A47A 3DKJA 3T08A 1EFZA 1OIMA 1KRBC 1BXNA 4QQ3A 5D37A 4IPNB 4H9ZA 4QR6A 3I7QA 4CVUA 2REQB 3PFRA 1QOQA 1TV4A 1HTIA 4IJBA 4L9XA 3R12A 1XC6A 2ATSA 3QMTA 5BRQA 3UPMA 3Q67A 2BLEA 1R3YA 4O18A 5I24A 1EGZA 1RBLA 1UWTA 1MRQA 1M01A 5EBAA 2HS6A 4D6CA 1EL3A 2NSOA 4ZQOA 4MB3A 2UWFA 2YDAA 3JS3A 4LS1A 2ISDA 4PZVA 1F4AA 4GH3A 1AD4A 1SFJA 4Y9MA 1EIBA 3IK2A 2OSXA 4HD5A 2QS8A 1FDYA 1JGIA 4QG8A 4DO5A 1FHVA 3EEGA 2J7HA 4ACYA 3VMOA 4DYEA 1JDFA 3BL3A 3PJWA 3NGFA 1GTHA 1XLBA 1S2VA 1DTNA 4MZ8A 2ZZ5A 1HX0A 1UP3A 4GUHA 3TN3A 3CWNA 4RZ4A 3EEZA 3R0UA 2NQ9A 2QEZA 3FY1A 1OG6A 3DKLA 2OXNA 1ISYA 2B7OA 4P7NA 3GBDA 4OECA 3QM3A 2Y7DA 4WGHA 3TLQA 3N9SA 4MB4A 2OYKA 2FH8A 3DI0A 4N02A 1J6PA 4RXGA 3WELA 1CXHA 4RCXA 1GOOA 1E56A 4DZ5A 1QVBA 1KCLA 4CD4A 4HA3A 5A8MA 2G41A 2WQPA 2VC7A 4MGGA 4GPNA 3BLLA 1XBXA 1YTDA 3B8IA 2AQOA 1EP3A 3LMZA 3AMGA 4MKVA 2I17A 3PVFA 4PEEA 3WNKA 2X1RA 5DBUA 1JL8A 1WKEA 4RNJA 1VJIA 5JBDA 4QFUA 3KTXA 4GI9A 5C54A 3N25A 4LAZA 1PZ3A 5A6BA 5HNRA 4M1RA 3RITA 5ECVA 2CLHA 3T78A 1ML1A 2E0PA 3CZ8A 3NUKA 2HVNA 4HA0A 2FPTA 2FGLA 5H91A 2PU1A 4A3QA 3DECA 3WLHA 2V5KA 5DT7A 5EKYA 1N7KA 2V68A 1OFEA 3QYSA 2DZBA 3W7PA 1S38A 2PWGA 1QPQA 5HJYA 1O66A 2Z7GA 1O7AA 4GRSA 4K8EA 1A0CA 3H23A 5FIPA 3VE9A 1OX4A 4QSHA 1VCVA 1UZDA 3N2OA 3M5YA 1IWAA 3P82A 3W29A 4IMFA 4JIQA 3W82A 1ME9A 3DGBA 2PSNA 1RP9A 3NPWA 3WF2A 4WQ6A 1E72M 1MVYA 3S1WA 2CZEA 4JKLA 1Q6CA 1VYRA 2ZA2A 5EMUA 3BXWA 3BQ6A 1H7XA 3BWWA 1JVNA 4FNPA 4O52A 3QN3A 2FZBA 2O4QA 4I90A 3FLUA 3DU0A 1E4MM 3LG3A 4WXYA 4KESA 2ZX5A 4AWTA 1A5CA 4FAMA 2OU4A 2ZUVA 3PB0A 1NOUA 2ZKMX 1KM1A 1ISVA 4P7OA 2TODA 3C5QA 1E0WA 1AA1B 4FNRA 1QW9A 3GYCA 1HKJA 3WYZA 5CKSA 5JQ9A 4MYXA 3GIYA 4BQ3A 2RKXA 3PZUA 3CQJA 8CGTA 2BS9A 1L6WA 4ORMA 3T2QA 3QRHA 3WH7A 1ICSA 1XQKA 8XIAA 4DZHA 2XVPA 3UJEA 4WDXA 4A2SA 4JFVA 3AYSA 5K9XA 3TA6A 1BRLB 3OVQA 4YCOA 4GBUA 3WMSA 2VWTA 1YBQB 1ZBKA 1J2WA 3CYJA 4XBKA 4ATLA 2OMAA 1XYMA 3C8NA 5A69A 3N2BA 3AHXA 4H9MA 1KGXA 4LYPA 4TMBA 3GR7A 4QQUA 3O06A 4G7FA 5FAJA 3WKZA 4LS0A 1E1EA 1PHQA 1TELA 5FJJA 4ZOBA 4KEUA 4EPDC 4DUXA 2A3HA 2QJMA 3KP0A 5CG0A 5EYWA 2C3ZA 4AHQA 3PC0A 4NSBA 4U10A 3UQNA 4IG2B 1ZJBA 4GK8A 4Z2HA 1DIDA 2Q3OA 4E2OA 2V38A 3DOPA 2P50A 3OPSA 3UJSA 4F2BA 4L1GA 2OZ3A 4LCSA 1JCYA 3AS1A 3HA1A 4HU3A 1JFXA 1BLIA 1KFCA 1SZNA 1H41A 1LG1A 1R86A 1B4KA 4LUSB 4UTLA 3UERA 4PUKA 2PDLA 3LGEA 2I14A 4M0XA 2NUYA 1Q6QA 4GC4A 3AQUA 1XV8A 5XIMA 4DLFA 1XIGA 3SCUA 4D72A 2DIEA 2VEPA 3WUEA 4HOZA 3C0JA 5E6YA 1XYCA 1KXVA 2ZZ4A 5HWNA 2HBVA 4IUGA 3QPEA 3EX1A 3EWUA 5DCDA 1OC6A 4FIRA 4IIEA 2VX6A 2VEIA 3DFQA 3EWYA 2W66A 3CWOX 1UPMB 1I1XA 3P84A 3H54A 4AX6A 2PTYA 4V27A 4CD5A 4IIDA 1OEPA 2H9AB 2WSYA 3MANA 4AZHA 3WLSA 5F7UA 1H2JA 1WBHA 3BW2A 4J3ZA 4S3CA 5REQA 4U2YA 3V7PA 2CZVA 3N9KA 3TJLA 3DHFA 4W86A 4GXMA 3G1FA 2D73A 3BLFA 1PO9A 3I6EA 3I6TA 4B3KA 4LVBA 4PCFA 1R7OA 2Y85A 3RX4A 1M9HA 3W7CA 2V67A 4NRRA 4M82A 4YHEA 1OX6A 4MNKA 4XZHA 4UFJA 1ZAHA 1LUCA 4FO4A 1DWJM 3EPNA 2HJPA 4GIEA 1YTKA 4E38A 1EJXC 1H0IA 4J27A 1Q7QA 1DE6A 4O10A 2CLIA 1ZS2A 4B5WA 1QI0A 3V5OA 4WZHA 4A4AA 4O19A 1VJZA 1UR0A 3ANVA 5LHFA 2WC7A 4GQRA 3O0KA 2WKJA 4XAFA 5G1YA 5ABFB 2HRWA 1JUEA 1EF3A 2WHKA 2CXEA 2FFIA 1XYBA 4AISA 3EPOA 1I9CB 4BI5A 4K8GA 1YDOA 1A4LA 2QJNA 1V79A 3EWBX 3WDQA 4XD5A 3TC7A 3ZZ1A 4M29A 5EU9A 1B2YA 5L6UA 1PIIA 3RM4A 3MSRA 1FY6A 1W31A 3N19B 4S3GA 5GQBA 5CSYA 1T40A 3L4UA 3N18A 5E93A 2O9RA 4LANA 4MPQA 3G3MA 4JL2A 3SURA 3GHTA 1XLKA 4Y9PA 2DZTA 4UQDA 2WWCA 4MF4A 1N82A 4HNNA 1SQ7A 1DV7A 3TOYA 1AZ1A 1TFVA 1X8FA 3PSWA 3CQHA 2C1IA 1RP8A 2VC6A 3SUTA 3AJ7A 2VFDA 3VFCA 5MHBA 4LU0A 3CB8A 3FEMA 3VDBA 1XH2A 1W8SA 1S2AA 2HNEA 2PGRA 4JIIX 4DI8A 4O1FA 2DZAA 3GTNA 2V2HA 3OIXA 1OVDA 3MBDA 3O6YX 1KFBA 3OZYA 3K8LA 4J9JA 2YA0A 3G5EA 7REQB 4O54A 4W87A 4LEQA 4NHVA 4BI7A 3BZJA 5C55A 3RR4A 3K1GA 1A0EA 1RUSA 1OGBA 1LF1A 4FA3A 4AYSA 2JFEX 3UXAA 4JNYA 1CEOA 2GGIA 3CJPA 4AD1A 4IGNA 1V3HA 4GFSA 3T2PA 2MANA 1HN1A 3LHZA 3DCPA 3T4WA 3S46A 1FCVA 3IJLA 3WZ0E 1G69A 4J2MA 4JTDA 4E0CA 4F48A 4AIEA 2OEMA 2WYSA 3B9AA 5HPCA 4NI8A 3A4AA 2DIKA 4Z1YA 3V3WA 4L65A 3W9ZA 4JFUA 2PDBA 2H3DA 2OEKA 3DG6A 3U9IA 3L65A 4UR7A 2QULA 1KRMA 5CC6A 3W75A 1R85A 4ZB2A 3GTHA 1I2OA 2NVCA 3CASA 2VWSA 3E2VA 1KGWA 4DJDC 1UH4A 4ILSA 5FEPA 1S5MA 4D6GA 4XV0A 3VDAA 4U4MA 5FESA 2OQHA 3T9PA 4GOAA 1TJ0A 1RJRA 3H8AA 1XBVA 1W1B1 3KL5A 3PAJA 1PKNA 2EEXA 1MW3A 4PUNA 4MY8A 4ACZB 4J35A 3A3HA 4C6EA 3JU2A 3W27A 1U1JA 1IWPA 3CEUA 4QX4A 1DPMA 2XIQA 3FCPA 1K1DA 3MP4A 3HGOA 3VD3A 3R25A 5GJMA 3WEOA 2PWFA 4BQ2A 2WHMA 3T07A 4F40A 4F4RA 4WF7A 1JG9A 5B80A 3HFYA 4OZOA 5T9CE 4QJ4B 3G1AA 1CPUA 2DVXA 5E0FA 2PB1A 3STPA 4C6QA 2E8YA 5DLCA 5AY7A 3CLWA 3T4CA 1QJWA 4LGXA 4UNLA 4J3UA 2WHJA 3W7NA 1Y8BA 3C2RA 2YDQA 2CKRA 3ID7A 1AL8A 3C52A 2DZVA 4ATWA 1CLVA 2VCAA 1KFJA 2ZRYA 1OFBA 3SY8A 3F7JA 3VGGA 2NX9A 4K39A 2C1GA 1NQ6A 3VIHA 4B4FA 1O5RA 3LUTA 4FOKA 2ABAA 4LT9A 1TTPA 3DFPA 2B31A 3L9CA 4JQ2A 4AAJA 1JZ3A 4FOJA 3GXMA 3LGDA 2E9BA 1KFWA 3BCDA 5LNSA 1HNYA 3B05A 2GVJA 3UG8A 4BJHA 1LT7A 3S5NA 1IGWA 1TWIA 2W79A 3DFOA 3M64A 1T8QA 1HXJA 3RDKA 2IQTA 1JPHA 1MXSA 5D9OA 3U2CA 2J9ZA 3TTYA 1G4PA 1B54A 1JCMP 4AVNA 3LPPA 5CZ0A 3CPUA 2OVLA 3P7YA 1B3WA 1QDSA 4H9TA 4WOZA 1TE6A 3CB3A 4P2VA 4UTKA 2EPNA 1Y7VA 3FXGA 4NASA 2R82A 3UXLA 1K7FA 2G4JA 2O9PA 4LB3A 2XFRA 3APTA 1XD1A 2GGHA 1R6WA 3KVLA 4JTLA 2QJJA 1O60A 2YLLA 3BGGA 4AZCB 3AYRA 2D3NA 5G4WA 4OV9A 1QWKA 4KCWA 4RKAA 3QTPA 1ZALA 4I5RA 3O63A 3AMLA 3M0JA 3P14A 3CQKA 3URBA 2WKGA 3SQSA 4AC7C 3KHJA 1GOXA 2ZVIA 5BYWA 1MO0A 3LCWA 2QGYA 4O57A 3WMLA 4Z08A 4JTUA 4FX6M 2WMHA 3KBNA 5AC6A 2JF6A 3SRFA 1IZCA 2XVGA 1V03A 3VM7A 5JUVA 3NIYA 1Z32X 3R1ZA 1JF5A 5HWJA 1QPKA 3GKFA 4JEJA 3NEVA 1RPKA 4R88A 1I0DA 5FL0A 2P8CA 5EA9A 2TAAA 1O94A 3GW3A 2VGIA 3F4VA 4MVAA 1ITUA 2OR2A 1LG2A 3V5CA 4HSNA 1WDWA 5I02A 2OGJA 1SFTA 1SM9A 5HULA 1V6XA 4D6DA 1H5VA 4L4MA 3WLRA 4DWSA 4DYKA 5FACA 3II1A 1UKTA 3IRDA 3W1AA 4M8UA 3NL5A 3ZVHA 1JQVA 3M0YA 2VCCA 3NXFA 2P76A 3HV9A 3OVRA 2EPHA 2FHBA 4DELA 4IIGA 1K7EA 2J7BA 1YMYA 2CC0A 1UH3A 4KEVA 1SW0A 3M9YA 3QH2A 1T6MA 4NAFB 4GH1A 2DSKA 5HNNA 3EOSA 4XKMA 1BD0A 3PF3A 2FB2A 2WM0A 2DZXA 2IQ0A 4O0QA 4PGLA 3EOEA 4U33A 4QDPA 2ZUUA 4LEFA 1D3GA 3TU9A 1XWYA 1BKSA 1MDRA 3GNOA 2AMXA 6PTDA 5AHNA 4EAMA 3Q37A 4H9YA 5DCBA 2Z26A 5BZAA 4KEZA 2R9RA 2VGGA 1ADDA 2E28A 1M03A 1OCJA 1O12A 4JTFA 1G0CA 1JZ8A 4TTUA 1S46A 4LALA 3A5FA 2Y88A 4X9YA 4AIBA 2Y7FA 3AXXA 4Y90A 4Q8MA 2ZRUA 3WD2A 3LOTA 4F9JA 2IKGA 1UUOA 2FQIA 3D46A 1ZFJA 3CUHA 1PTDA 4P8XA 2YKKA 3LV6A 2KX9A 4OOZA 4UC5A 5D9PA 3PTDA 1OFQA 5CZSA 4C5ZA 1KCZA 2G3IA 5LIWX 3CAKA 4GY1A 1CDGA 1TV3A 3N1AA 2WZEA 3WBEA 1PDYA 1DJGA 1WDSA 3KS5A 1C93A 4HYVA 4DAIA 2GDUA 2PWHA 5I07A 1AG1O 1DTUA 4KWSA 2DZPA 4BQ5A 1DJZA 4IOTA 3S42A 4E2BA 1DQWA 4HYRA 4JICA 5K9CA 5BRBA 3CZKA 1OD8A 3SN0A 1E0TA 2WVTA 1XIBA 3RO8A 1MWOA 4DN1A 1LT8A 2QCEA 1R2RA 3MMUA 2UY3A 1Q8JA 3AS0A 1TWDA 3EKLA 4G2DA 3GAKA 3ZFHA 3PBGA 4QE5A 1DWHM 1GTEA 3W1MA 4E4UA 4QE1A 3ZT6A 3SIMA 5LIYX 1V3LA 4NU7A 4AY8A 3FXYA 4NVTA 3SR7A 1JI1A 1AQFA 3H26A 5IHRA 2A2IA 3O15A 4PBEA 4AZIA 1TJRA 1YPFA 2V3EA 4F79A 2PLJA 4GI6A 1WDRA 1ZAJA 3CMGA 3F4WA 1JULA 5A8QA 1WDQA 2VZOA 3GK0A 1KM6A 3TNBA 4E4FA 1Q3NA 2E5DA 2RHGA 4A21A 3CL8A 2QDEA 4V1YA 3R11A 2WNQA 2ZE0A 4B2DA 3ZQ9A 1ZGDA 1MNSA 2IS7A 3MKVA 1M1BA 5HR7A 5AB3A 4W84A 1GW9A 3B06A 1R3VA 4MIMA 4O0ZA 4RZ6A 1YDYA 4PBGA 1PHWA 4FNUA 3C2VA 2J66A 1N8FA 2YYUA 1HJWA 4ZL1A 3A4XA 3K1DA 3S1UA 3GQYA 5A6AA 5AECA 3RPMA 2E3ZA 4AIUA 5D05A 2AL1A 4PTVA 2FMNA 5CPTA 4EAYA 3REQB 4JS3A 2J27A 3SADA 3F4DA 3TTSA 4P7RA 1X98A 1M68A 1JAKA 2HEJA 1QWGA 1XF0A 1ZPTA 1ZRQA 3GFYA 2WPBA 2XU2A 3MTWA 3BAWA 1MNZA 4JOMA 4D2JA 3CQ0A 2CWNA 1K70A 1R3RA 4YMZA 4US5A 2AMGA 5T8GA 3S5YA 5TBOA 4NUWA 1OQFA 2C91A 3WLPA 2CLPA 3A23A 1XI3A 3OLGA 5A1AA 3WQDA 3PZGA 2GJNA 2ZZ7A 3IEBA 2QV5A 3B9EA 1ZP4A 2FVMA 3BLOA 4OHQA 3NQAA 4A3RA 5DMNA 3WJXA 1MYRA 1CB2A 3QOKA 2D3LA 3IK4A 1NDWA 2HNHA 3CIXA 4MDPA 4TX9A 3VZZA 1SSDA 3E0VA 4W88A 1LLWA 3G1VA 4DIAA 3QKEA 1JD9A 3IAPA 3ZWTA 3KS6A 1VEPA 3GVQA 3N6JA 4ONVA 3L5MA 3FX4A 1V3IA 4RE3A 4C1KA 4J4KA 3OB8A 2E9LA 3N17A 4HIBA 5DQPA 1OK4A 1CWYA 4F3HA 1T8XA 2ZE3A 3GR4A 5KEZA 1JI2A 1GKPA 5C71A 1O5XA 3VC5A 3KRUA 3JVAA 3WD3A 4MM1A 5JIWA 3FAWA 2GJRA 2GDVA 4ICMA 1TV2A 3RU8X 1K77A 1R7AA 4M5PA 3N2XA 4FPSA 3F1QA 2I9UA 4IQEA 2J88A 4PTDA 2X16A 3EXTA 1K9TA 1KKOA 1ICQA 1Y65A 1EJTC 2PRLA 4A2RA 3NQCA 1CNVA 3SCOA 3AMCA 4EPEC 2PDIA 2VRKA 1EPXA 4G7EA 2OO6A 4P8UA 3HN3A 2VHLA 4XAZA 1AW2A 4Q8QA 3SRKA 3OVPA 1Q6LA 3P80A 3PTKA 1XUZA 1K02A 1BYDA 1Q63A 4B92A 2Q02A 1RQBA 5G4EA 1GZGA 3CZLA 1Q7MA 5G1TA 4ZFMA 4Q8TA 2I57A 3CZEA 4Q8OA 2VMFA 3ABRA 2RDWA 3RLGA 2NWSA 3RLUA 3R0KA 1UUMA 1R2TA 1L2UA 4X60A 2DSVA 1WOAA 3GBEA 3TSDA 3FVMA 1R87A 1B0IA 3VOHA 4KKXA 3QW4B 4W8BA 5DRCA 3AHZA 4P8WA 5C70A 1BYBA 1PTAA 4I9JA 2XFYA 4RX0A 4JFSA 2ZZ2A 4DBSA 1KXTA 1R38A 5C9ZA 3VZYA 2B7QA 3KVKA 4I3GA 3CAVA 3AIRA 4ZO9A 2D20A 2GK1A 2XSAA 5AVNA 5HUPA 4KF1A 4QISA 1A5NC 3G18A 1IT8A 3ZLGA 4YVXA 2BHZA 1NQKA 4H83A 5BOEA 2NLIA 1MW2A 2O4MA 1QNPA 4HA4A 4IMGA 3QC3A 5M3WA 3RPDA 1OYCA 3P0XA 8RUCA 4C6MA 3K30A 2OSYA 3NZ1A 3WLKX 3H22A 4Q4SA 1PEZA 2G50A 1JF6A 4EXAA 4MWAC 2D0FA 3SM0A 1KBJA 4PODA 1GQLA 2FZNA 3OP2A 3SY1A 4S3FA 1QI3A 5I0DA 2O92A 4PN2A 3AXMA 5J04A 4B5SA 1I75A 3MHGA 4GJIA 1DYSA 3AS3A 3UESA 2XGIA 3EX3A 1HG3A 1TX0A 3FJNA 3W23A 1FA2A 1MRAA 4Y96A 2C8NA 4M6QA 3AHVA 3DEQA 4OUIA 2YPIA 1Z48A 5F2LA 3WBWA 1CIUA 2AQWA 5F4XA 2ONEA 3TW9A 5BW6A 2YW3A 5A6LA 4NAEB 2RGLA 5FJPA 1BRLA 4ZZ9A 2V6AA 3VMNA 3UBPC 3U7VA 4MLJA 2JKAA 3FDGA 2MNRA 4IPLA 3CLMA 1DOSA 3VNDA 5JH2A 4GVFA 3WUFA 2BODX 5M2FX 1F6KA 1JZ7A 1OK6A 3SGUA 2DJLA 4WK9A 4RDWA 1ONXA 2QUNA 1O4UA 3HOJA 1L6YA 4WJXA 2GJLA 4HJFA 1P0DA 2JEQA 3V35A 4RK8A 5AKQA 3CV1A 4GJ1A 3H6OA 1BWVA 4B90A 1TX2A 1XFBA 1VCFA 3S0CA 4NX5A 3M0ZA 4XD4A 2WKLA 1CGUA 4PMNA 3KL0A 3ZT5A 2Y2WA 1FX6A 2C71A 2JE8A 4QHRA 4D8AA 2GUBA 2FIQA 3BLEA 3NJ3A 4MDOA 4N6EA 1DE5A 3WH9A 1XGEA 5EMMA 4WXZA 3WBAA 1EBGA 2PRHA 1UA7A 2CLMA 2IW0A 2NQHA 3HF3A 5CPMA 1IT7A 2QCHA 2VENA 4LXFA 1LQ0A 3RO6A 1LRNA 2I5GA 2WVVB 3RFAA 3C2FA 2GLKA 4ZA0A 4N9CA 4B5VA 3PTQA 1XC4A 2JEPA 4NZFA 4Q8NA 1GEQA 1SJCA 3VKKA 3IUIA 1KBKA 1GG0A 2VRJA 5BOFA 1WYIA 5A6BD 1ME8A 4E4PA 1E4IA 4QG9A 1OB0A 1OT2A 5PTDA 4IP7A 1V08A 1D8CA 5CZJA 4JX6A 3GG1A 4R85A 4DJED 1NU5A 2WWDA 3SI9A 3TYEA 1A3WA 1GHRA 4GHRA 1XD0A 3WLTA 2YZ5A 3B40A 4OOUA 4UTTC 1W5OA 4RZ5A 2PTXA 4GVIA 2Y5SA 3P8JA 3B8SA 3W2LA 5CGQA 1J6OA 2WO5A 4NAEA 3AIUA 1KV8A 3AXKA 1EDGA 1NWUA 1S5TA 3QGVA 4O8RA 4XO7A 1QTWA 2EF9A 1WZKA 4R7OA 4JTRA 3DHPA 3QV8A 1ADOA 1L8PA 1W32A 1E0VA 1FWBC 2CKSA 2OSWA 5LIXX 2B81A 3QKZA 3PZNA 3SN4A 2NWRA 3PBWA 3QTGA 3E5BA 3AISA 2E8ZA 3G1HA 3MKKA 2HZGA 3FFSA 3H55A 4C5YA 2QT3A 2UV8G 4QNEA 4H7VA 1VRXA 3P74A 1FRBA 3TVAA 2PGFA 2XM1A 1W0MA 4DJDD 1JPDX 1L9WA 3B4UA 2OGYA 4N9DA 4V1XA 1UD4A 5H8PA 3BGAA 3WD4A 4MKNA 3GDBA 5LXXA 2R6OA 1EUAA 3IIVA 3POCA 2QMJA 3BLKA 1VPXA 4URIA 4YTRA 3RU6A 3S9YA 3ARPA 2C18A 2GJXA 4HNCA 1WZAA 3EOLA 3URAA 4HGXA 1XLAA 1BVNP 3KAOA 3KWXA 4KCVA 4O8AA 4RZBA 4LJ3A 4GI8A 3TMQA 5GNZA 5A8GA 4V2XA 4BR1A 4DJFA 1SO3A 1W1VA 3PUGA 1X1NA 4MNJA 3V4BA 3TMLA 1YIXA 3AS2A 1XRVA 3GG8A 3W88A 3ARZA 2X05A 1I45A 4HHLA 1A3XA 3OBAA 4FNSA 3VYLA 3W85A 2DDXA 3QF0A 3T0CA 2WVVA 1GPFA 1XICA 1VBHA 3NNTA 4J3SA 5BXTA 3TQ0A 1W9UA 4LPCA 4ZE4A 4MWAE 5AHEA 4E3VA 1FP8A 3AYTA 5D30A 3UYCA 4HK6A 2E6DA 4G1KA 2HK0A 1UC5A 1IQ8A 3K4AA 1WZLA 2GL5A 3KOZA 1YPIA 4EF9A 4CU6A 3LHUA 2PDGA 2O7SA 2RFGA 1HIZA 4C6FA 2CZFA 3SO7A 1H5YA 3T7VA 3MY9A 4CN6A 4LAUA 5C0QA 3CHCA 1JNDA 4XWUA 3R8RA 2Y0FA 3H4WA 3KM8A 2BXVA 3FN9A 3ITXA 1C8VA 1W2VA 1XFCA 4QEHA 2A5HA 1Q6DA 1RCXB 2ZOXA 1EO5A 1TA3A 3CU2A 4PMYA 3VM5A 5JXQA 3H21A 3CTLA 3MDWA 3W1LA 4LY8A 1NWTA 1MQRA 1Q7ZA 4RPQA 1NTHA 2EKCA 3IV3A 1MW1A 1PJ9A 7A3HA 4GZ7A 1MUMA 1YTEA 3MVTA 3IIXA 3TKFA 3WUGA 3RJYA 5IRPA 1NARA 3DYOA 5GNYA 1FKXA 3INPA 3DERA 1VJSA 3EDDA 1CZ1A 3EA3A 1P5BA 4UNKA 2YCKX 2G96A 2INFA 3C86A 3F2BA 4LUJA 2GPTA 3UWWA 2NV9A 3UZ5A 4XIAA 4M1BA 4J28A 3TJIA 5U4NA 4Z2LA 4PUWA 4G56A 3MYOA 3O9NA 1GVQA 3URQA 1SMAA 1GOKA 4OWGA 1E9IA 1DWGM 4PYSA 4C1LA 4UZUA 4L9YA 8TIMA 3UWUA 2YBTA 3V18A 3R0DA 1TO3A 2BY0A 3HZ3A 4NXKA 1XIHA 2FTPA 4LF2A 3TW6A 4DO6A 4PULA 1NFGA 2Y24A 3HJZA 4MUZA 2ZADA 1LUCB 1NEYA 1KW1A 4AXKA 3KWSA 1ZB5A 4UTIA 4Q8UA 1DBTA 3W6LA 1TVLA 3S6OA 3FNDA 3DFYA 4IUOA 4MY1A 3WQFA 4PH6A 3REQA 4C90A 4L6HA 3G0UA 3DN5A 2ON3A 1LZOA 3FAXA 1GVOA 1LWHA 3MHUA 1RCOB 2F9RA 4A35A 5K7JA 4FXRA 3T55A 3CQIA 3SCWA 2VVSA 4P8VA 1H1NA 3VK5A 3BV7A 1EBHA 3LTYA 2BY2A 1MQPA 1ZCCA 1VKFA 3RM8A 4LYKA 3WH8A 2P3EA 1DJYA 2IQDA 4KS0A 4ZQCA 3W2MA 3F4CA 5HMDA 3UETA 1JRCA 4MJMA 3DBPA 2JK2A 2HVMA 1TWSA 1DJQA 1OFAA 1VFLA 1WDDA 2JQXA 5F4SA 1OIFA 1AH3A 3A4JA 4H8NA 1OC7A 3ABXA 4KRTA 2RDUA 3MS8A 4LBSA 1QAPA 3CH9A 1HF6A 3L4ZA 1M3UA 4IM4A 1PS9A 1JYXA 2W5FA 3M0LA 3S2JA 5I3GA 2G3JA 5EMLA 3LGGA 3EB3A 1L6FA 4AD3A 2QKFA 1LOLA 3GG0A 2PTWA 2A3AA 3HQPA 3B97A 1CGVA 1MFVA 1GVYA 3ABOA 2E40A 1FWFC 3RCYA 1V6WA 4IL0A 4GUIA 4JTHA 1Z69A 4C7FA 1UOZA 1RY8A 2VR2A 1LQAA 3PSVA 2VR5A 3BZGA 4BY3A 2EHHA 3EKZA 3E96A 1NDYA 5JH1A 5FL1A 4Y9AA 3W7HA 4WDWA 3N11A 4H9XA 2PU0A 1QK2A 1M41A 1TYGA 3L12A 2J77A 2J6XA 2R1MA 2PTDA 3ITYA 3TWBA 4K68A 4ZXOA 3TFCA 3W53A 4JIRA 3VKJA 4Q6XA 2G4FA 3MO7A 1MI3A 2BGQA 4FHAA 1GOQA 3VNLA 4XK2A 4FX8A 2Q71A 2L5HA 4FXFA 3F2CA 4C6PA 4REQA 4A05A 2VDGA 2ZWYA 1QR7A 1XX1A 3A64A 1BG4A