5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
molecule keywords Glycosyl hydrolase family 71
molecule tags Hydrolase
source organism Bacteroides xylanisolvens xb1a
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
5AC4A 5GNYA 2EPOA 2DIEA 4XZWA 4UFLA 1CDGA 3ARXA 1EGZA 1J0HA 1JDAA 3VGBA 2QMJA 2Y8KA 4KRTA 3FAWA 1E6RA 4OBSA 1LG1A 4U3AA 4ATWA 1UQYA 4GKLA 2D23A 4AEFA 4HOXA 3AZTA 1WAWA 1EIBA 1CGTA 3MMUA 2X2YA 2WKGA 3PZOA 4CCEA 2VRKA 1E71M 4R5EA 1W1YA 1PEZA 4B3LA 2XYLA 3VIOA 1UA7A 1W3JA 2WC7A 4QDMA 2Y24A 2NW0A 4M82A 1CYGA 1BYCA 2YDQA 1V3MA 3RCNA 1MYRA 3W28A 1JD9A 3GXIA 4HP5A 1EOKA 3WQVA 4HOWA 2PWEA 1JD7A 1HT6A 5IHRA 1HKMA 3UG3A 2OSYA 2CETA 2DSVA 3NSXA 2D1ZA 4GI6A 4MJ4A 4QP0A 4WK9A 3MUIA 5A6SA 3AMLA 2WHKA 3AIUA 1W9BM 1HP5A 3DYOA 3KL3A 1UA3A 1CXHA 1R85A 3F5KA 1BGAA 1Q6FA 3ARPA 2AMGA 1E72M 4GZEA 3SUUA 3W53A 3OZPA 4BQ3A 1BG4A 3MSGA 4OOUA 4M8UA 5A3HA 4OOZA 3F5JA 5D8ZA 1LWJA 1UD3A 1US2A 1V03A 2CHOA 3SCWA 3A6OA 5A94A 4U5IA 3UG5A 1EQCA 1J0IA 3AYRA 4CU7A 3L4YA 4JFSA 1LG2A 3B9EA 2JALA 2E4TA 4HMEA 2O9RA 4U33A 3LPPA 3RM8A 3U5YA 2XSAA 3U57A 3ARRA 4L4PA 1TA3A 3BCFA 5EFFA 1EA9C 1A3HA 3OLEA 1I1XA 3CUHA 1HJXA 5ABFA 3EDDA 3ZM8A 3KL0A 4J3XA 3GM8A 1QNQA 2JEQA 2A3EA 1OIFA 3W0KA 5I78A 3WDIA 1CXLA 1BLIA 2E9MA 3BAYA 5FCZA 3TTQA 1YHTA 2W66A 1E1EA 2XIIA 4GPNA 3TTSA 1PX8A 2VRQA 1V3JA 1QOXA 4JFUA 1C8XA 4AZBA 4PMUA 1QI5A 2ZXAA 3WH9A 3FHQA 2X0HA 1UH2A 2V3FA 1XD0A 1NWRA 2J47A 2YIHA 4D71A 3NSNA 2WLZA 4Z2LA 4H04A 1ZB5A 4XZBA 4PUDA 1GNXA 4JAWA 1J18A 4CU6A 3ZSTA 2WC3A 1TZ7A 3WY1A 4UZSA 1M01A 1JIBA 3SURA 1J0KA 3WQ8A 1W3LA 4F66A 5HNNA 1WDSA 3PBGA 3ZSSA 1GW1A 1XCWA 5C71A 4HZ6A 4P7QA 4MTVA 4UCFA 1KQZA 2WWCA 3ZIZA 2GDUA 1MFVA 5EBAA 5KZ6A 4WJXA 1V3HA 2WC4A 5E70A 1QBBA 4E8DA 1KGUA 3MUZ1 2QMKA 1C3FA 4IPLA 2DSKA 4JKKA 1UH3A 5A1AA 3FY1A 2E9BA 3HJEA 2Y2WA 1KXVA 4V27A 3GXFA 2VZUA 2GSJA 1ISWA 1CPUA 1MFUA 1K9DA 1XSJA 1OBAA 1J11A 5M03A 1JZ3A 4HOZA 2DT1A 4YHEA 2G8ZA 2J8FA 2PWDA 4PSRA 5C70A 2GFTA 1HJVA 3SCOA 3VGGA 1M53A 1CXEA 3OIHA 2J8GA 2BHZA 1JZ7A 4P8VA 2HISA 2VT0A 4M80A 3VGDA 1C93A 3GXDA 2GJXB 4UOQA 1J0JA 3GH5A 1TR1A 1PAMA 2QF8A 3DECA 1NM9A 1UZ1A 1E4IA 2V5CA 2DDXA 2O9OA 1NOWA 2J77A 2JFEX 1BPLB 4HPHA 1OGBA 1GOQA 2XM1A 1A47A 1Y7VA 3GH4A 1ODZA 1UR4A 4A4AA 5CQ1A 3ZO9A 3WSUA 5LA1A 2XSBA 4CN4A 4CD7A 1HJQA 3B8SA 2ZUMA 1CBGA 2VJXA 1B3YA 2CBJA 2CKSA 1NOFA 3WMCA 3DYPA 2VZSA 3NUKA 1VBUA 3OLIA 2W4XA 4F8XA 2YL6A 1PX4A 2CESA 3N13A 4HMCA 3AIEA 1FP9A 4PSPA 1BSIA 4M56A 3VX0A 2BVDA 2J62A 4R27A 1V0NA 1UWUA 1OCQA 1ITCA 4Q22A 3AFBA 2ZE0A 1FH9A 3L4VA 1DWFM 1ZBCA 5E6ZA 3WNOA 4V2XA 4JIEA 2VCBA 4XUYA 3WL1A 1HVQA 5AC5A 3PN8A 1E4LA 2W67A 1HL8A 4W8LA 1FH8A 6A3HA 4EKJA 4TVUA 5CGMA 1QNSA 2CBVA 1G9HA 2YL5A 1KGXA 2O9TA 4PEEA 3WMSA 5M17A 2GJRA 1VBRA 4MDPA 1ESWA 1AQHA 2V3EA 3SCTA 1QNOA 2JEPA 3VIFA 1GORA 4WIWA 3VD7A 1E3XA 2EO7A 1XSKA 1J12A 2UY4A 5D9MA 2D0HA 2VZVA 2X05A 5I24A 2J79A 5CXPA 2EBNA 3HU7A 3IAPA 2O92A 1GCYA 4AY1A 3CZLA 2ZUNA 3KEHA 3WENA 1KGWA 1I1WA 1TFVA 3UR8A 5HOSA 2IUZA 1GQJA 4U2YA 1OGGA 3N17A 3W38A 1LL4A 3BAIA 1JYXA 3AMDA 4S3JA 3AICA 3WQ4A 1GUVA 5CLWA 1PIFA 4NRSA 1QNRA 2ZUVA 3UETA 4WF7A 2VUYA 4LYPA 1MQQA 3VMNA 1M04A 3LPGA 1BQCA 1KR0A 3ARVA 2WLYA 1FHDA 4YHGA 1GJWA 3WDJA 1ZJAA 1BVNP 1NWSA 1GOOA 1QW8A 3AMGA 5D8WA 3T0DA 4ZE5A 1UG6A 2C8NA 2WMFA 1OM0A 3BC9A 1W9XA 2GK1A 3AOFA 1RP9A 3WQ5A 1WNOA 4KMQA 3PZGA 4D6JA 2CBIA 3QR3A 3NJ3A 1RP8A 3K8MA 4H7VA 1B3ZA 4M1RA 1OIMA 4CN1A 3WMBA 1UWTA 1PZ3A 2VRJA 2C0HA 5LA2A 4UQEA 2J4GA 4JHOA 4E4PA 3BGAA 3QHOA 1JYWA 2VTFA 4E8CA 1OWQA 2FHCA 3I3DA 3SCPA 4BQ2A 4MPKA 2XGIA 1WDPA 2BNJA 3UESA 1V02E 2WCAA 5FIPA 3B9AA 1ZL1A 2WK2A 4W87A 1IT0A 2ZOXA 4GI9A 2DSZA 1JZ5A 1V0MA 4C7FA 3F5LA 4Z2HA 2VI0A 3VIPA 2Q8XA 3EDFA 2WHJA 1XC6A 2BFGA 1GHRA 2VOTA 3CBWA 3WH5A 2Y8VA 1N82A 3MMWA 3ZR5A 1R8LA 1JG9A 3POHA 4AIOA 3ARQA 1GHSA 1E6ZA 2EPNA 4FK9A 3GBEA 1VENA 1VF8A 3CUGA 1KQYA 4BF7A 1LL7A 3OA5A 1JNEA 1E4NA 2YLLA 1E5NA 3WUGA 1OINA 2CXGA 4OJYA 1XSIA 3NSMA 3ARTA 3WF0A 4W89A 1ISVA 4DWSC 1GOKA 2XJ7A 1WKYA 1XGZA 3T2QA 4AIEA 3GXMA 5A69A 1SFSA 2V38A 2ZXDA 4P7OA 4ATLA 2RGLA 5DT7A 1V0KA 3RIKA 4QCEA 3MSDA 4HA1A 3K4DA 2J78A 2WMIA 4AC1X 1E6PA 1XV8A 5D4YA 3SCUA 5FL1A 1H09A 1KB3A 1G1YA 2FGZA 1ISYA 4C7DA 4BZYA 2IXVA 3K1DA 4DUXA 5DFAA 1UWRA 4JKMA 4CU8A 1JXJA 1XHGA 4F9DA 4ZXLA 3SCNA 1JGIA 2WVVB 2Z1KA 5EB8A 3VIKA 4WKFA 3PZQA 4UFIA 1B2YA 2VQTA 3SCVA 3VTRA 3KL5A 5IFTA 1BYDA 2YOCA 2JF6A 1XH1A 3T09A 4UFJA 2VR4A 4HZ8A 3WDRA 3VU2A 5JUVA 3CHDA 3SUTA 1BTCA 3N9KA 4MB4A 2BHUA 4AD2A 2UWFA 5BYWA 1OGSA 2FGLA 5AY7A 1GZJA 1CZ1A 1JDCA 2A3HA 4PRWA 1J10A 1X6LA 1WZMA 5CG0A 2BY1A 4D72A 5A6MA 3L2LA 1H11A 4JZ5A 2F61A 1W9UA 5IFPA 1J0ZA 1QHZA 1KXQA 4J7RA 5FKYA 2BY3A 3CGTA 1LL6A 7CGTA 3BCDA 1HL9A 3PTQA 3RDKA 1E0VA 2G41A 4CGTA 1WO2A 1E40A 4OBRA 1Q6DA 4PMYA 5E6YA 3VILA 1DHKA 3O2LA 2FHFA 4ACZB 2VL4A 4B3KA 2CIPA 5DT5A 3WFZA 1VFMA 2X1IA 3NIYA 3J7HA 1EDGA 5DO8A 1KFWA 3ARYA 3WNLA 4MB3A 4EAMA 4W86A 4N42A 3GNRA 4IISA 4U31A 2BY2A 2D0GA 5A2CA 4CVUA 3AIVA 2YL8A 1R87A 5I3DA 2WMJA 3CZ8A 4IPNB 3AROA 1E1FA 5BXPA 3CHCA 1H1NA 5E0FA 3E1F1 4JL2A 3BMVA 1D3CA 1UUQA 2ZUTA 5BRPA 4AZ6A 1S46A 3SCSA 3PZUA 4HU8A 1QHOA 5A95A 1IZJA 1UHVA 1EO7A 3L4WA 1VIWA 3DHPA 2BHYA 1LJYA 2XIBA 4DM2A 4GIAA 4HU0A 5DEZA 2BS9A 1OD0A 1WZAA 2VO5A 6CGTA 5A6KA 3OG2A 3AZRA 3WDHA 4BCEA 4DM1A 2GVYA 2F2HA 3I3BA 3VMPA 3QOKA 1EOMA 1GVIA 2G3NA 5JIPA 4MB1A 4OZOA 3WD4A 2EQDA 5HXMA 2XTKA 4P8XA 4UQ9A 3SCQA 4J3WA 3WFLA 3M7SA 3VINA 1E6NA 4KRUA 4CD5A 1CLXA 3KWXA 4AZ5A 1H4PA 4JFVA 3UERA 1ZBVA 3M07A 5A6JA 1P6WA 4PN2A 3PZMA 3TTYA 4UZUA 2A3CA 1UQZA 3GNPA 3VVGA 2UY5A 1B30A 5A6BA 1JZ6A 4YPJA 3SIMA 1IZKA 2VX6A 2E8YA 2ZUWA 1CXKA 4WSKA 1YQ2A 1QNPA 3WN6A 3BXWA 3AHYA 1E55A 1VRXA 5ABEA 1U33A 4W7WA 3OZOA 3MO4A 1PPIA 1UKSA 3II1A 1KXHA 1RPKA 4UQCA 3AYSA 2WZIA 1C7SA 1SMDA 1EQPA 2XUCA 2QV4A 2G4FA 2OWCA 3BAXA 2OSWA 1VEOA 3OB8A 3MKKA 2W92A 1F4HA 1H0IA 4W93A 3CMJA 1DTUA 3W6LA 2Y5EA 4AZGA 4PTXA 2JIEA 3S6TA 4PBGA 3ZMRA 1JYVA 4UOZA 2GDVA 1ZS2A 2YLAA 4B16A 1DWJM 2J7GA 3KE0A 1EHAA 2YBUA 5DMYA 5GNZA 3MMDA 1EHNA 5A6BD 3SUSA 4FLOA 4EANA 3EBVA 2NSXA 4MNKA 4IM4A 1UKTA 1W2PA 1VJSA 1V6YA 1CIUA 3GYCA 4D6HA 2AOSA 4OUEA 3LPFA 3VGEA 4JFWA 4CCDA 1XCXA 2V5DA 3L4UA 1AQ0A 2E40A 4JCMA 1QI4A 3AXIA 4W8AA 3ARZA 1E3ZA 1EXPA 5A8MA 1CWYA 4HZ7A 1KBBA 3OGRA 3THCA 5M3WA 4W7VA 2W62A 1CGWA 4TTGA 2BVTA 3ALGA 1WDRA 3WQWA 1SYTA 1UZ4A 3WH6A 5I2UA 2Z1SA 2CBUA 2XM2A 3TP4A 1E6XM 1DP0A 4M24A 4AW7A 1PX3A 1FH7A 1UD6A 2GJXA 2DH2A 2CERA 3PZVA 2WHMA 5CPTA 4FLSA 4GO8A 3EDEA 3BSGA 1JFHA 2UY3A 3ALFA 2PWGA 1JXKA 4W7UA 1ZU8A 1MVYA 4B15A 1BAGA 1NWTA 3PZ9A 2D2OA 4NF7A 3LPOA 3QGVA 3CTTA 4WLCA 4CCCA 2YBTA 4CVWA 1UD5A 3U7BA 1J01A 4LYRA 3AMCA 4DWSB 3CZEA 1M03A 4D1IA 3QHNA 3MV01 2PI6A 1KXTA 3PZNA 1E70M 3WD3A 3M46A 3WUFA 4S3KA 1I75A 4PMNA 4P7LA 3W26A 2X8RA 3AHVA 1C7TA 4D6CA 2QLYA 2WCGA 1OT2A 4BA0A 3WF2A 1BVZA 1O6IA 5HDRA 2IXUA 4PMZA 1JDDA 1JF6A 4MADA 4QCFA 5IXEA 3N04A 4D6FA 5JBDA 3RM4A 2CEQA 3NYDA 2W61A 4WKHA 3FXYA 4GQQA 4AD0A 4YN5A 2X0YA 3WD2A 2WNWA 4DWSA 4GQRA 4W88A 4QFUA 2XVGA 3WL0A 3BSHA 4D6DA 1Q6EA 4XV0A 1L8NA 1QW9A 3CUIA 4AZ7A 1E5JA 1HF6A 4PYSA 1E0WA 7A3HA 1CENA 4J3SA 4NZCA 3VMOA 4GZIA 5I79A 2XHYA 2BXZA 3IJ9A 1B3VA 1W9DM 4J28A 3BAKA 3WEOA 4M81A 2RGMA 2VQUA 4J3UA 4UR9A 4Z2GA 3EDKA 3FAXA 1LWHA 4U3CA 1R7OA 1MQPA 4JHZA 3N1AA 2DH3A 3CUFA 2BVYA 3T0BA 5EMYA 1W3HA 3GNOA 2BXYA 2WAGA 4A3HA 2CNCA 3OBAA 5TD4A 1EH9A 1E15A 5E0CA 1MW3A 1WCGA 1E73M 3IANA 2BV9A 2CCRA 1FHLA 3BAJA 1Z32X 3K46A 2WSPA 2E0PA 3NCOA 1J9YA 5BWFA 7TAAA 1ISZA 4GO9A 3PTKA 4PMXA 1GQKA 4KGJA 2J7BA 1XRVA 3WBEA 1TMQA 1Q6GA 5BXTA 4DWSD 1UR0A 2WM0A 1VFOA 2ZUUA 4J3VA 1QPKA 3W37A 4WSJA 1LQ0A 2C7FA 3AS0A 3VM7A 2EPMX 2VNCA 4FF5A 4DUWA 4TVCA 1QI3A 3VUPA 1C8YA 4UFMA 2FHBA 4Z2JA 4JKLA 1XYFA 1X1NA 4V28A 2YKKA 3GBDA 1Q6CA 4UQDA 4CD8A 4HA4A 2VX7A 5ABGA 3GTNA 4GZJA 4Z2KA 2EPKX 4MAZA 2D3NA 2WBKA 2XFRA 1JAEA 3WF3A 4BQ4A 3W6MA 4U2ZA 1Q4NX 1MW1A 5FD0A 1B1YA 3ZJ7A 3UCQA 3K4AA 4PUEA 4QLJA 2DT3A 1C8QA 2WVSA 1VB9A 2PBOA 2NT0A 2Y4SA 3K8KA 1JYNA 4IUGA 3AJ7A 5E9AA 4RL3A 1CGVA 1H2JA 1E56A 4AZCB 5IHSA 1UR2A 2YL9A 4FLRA 4ZENA 5I5RA 1RH9A 4TX8A 1EDQA 5CJ5A 3EYPA 1QVBA 2O9PA 3A3HA 1MW2A 4QLKA 3EMQA 2VCAA 1DWHM 2JIWA 4MJ2A 1G5AA 1FOBA 1OD8A 3DYMA 5D9OA 1JNDA 3AXHA 1AVAA 5BXSA 1D2KA 1GOWA 5CSUA 1RD6A 1UR1A 2VVSA 1EDTA 3WD1A 1B3XA 2CITA 5I23A 1NQ6A 4B9YA 4H8UA 1VJZA 3AIBA 1XD1A 1GONA 3QOMA 5ECUA 1V0LA 1D7FA 3OGVA 3VOCA 1QI2A 2WMGA 4CD4A 1B0IA 3RILA 3CZKA 1JI2A 2FH8A 4LPCA 4AZCA 4A3YA 5A8NA 1WZKA 4PMRA 2G3MA 4ZE4A 5A2AA 1VEMA 3AQUA 1BHGA 4AWEA 2PBGA 1UKPA 4PMDA 1K9TA 3I3EA 2WW5A 1H49A 4HMDA 3WUEA 4N0RA 3AHZA 1JAKA 3A4WA 2W5FA 3FNDA 5A2BA 5GPRA 1BFNA 5BROA 5F7UA 1HJWA 1US3A 3IJ8A 3TA9A 2G3IA 2VZTA 4URIA 3APGA 4PTVA 2VX4A 4J3TA 2CKRA 4W5UA 3UG4A 2WVUA 2OYKA 2WMHA 3W27A 3AXXA 2EJ1A 1KBKA 3WF1A 3U7VA 3HMCA 3WEMA 2DGAA 8CGTA 1FFRA 5A6LA 2WVVA 4M29A 1ECEA 3GZAA 4PCSA 1DWGM 2WBGA 2OLHA 1UKOA 2J7DA 1JF5A 1XH2A 1E4MM 4AD4A 1W1VA 4MDOA 2WB5A 1HVXA 1KR1A 5LA0A 3MV11 4LQ1A 1TA3B 3AIRA 5M5DA 5ABFB 4X9YA 1BF2A 1NH6A 4TVDA 5HPCA 1HP4A 3WKZA 1UOKA 4KWUA 2D3LA 2QPSA 4MNJA 5GNXA 1B31A 1XYZA 2J7EA 3CIVA 3MUAA 1JZ2A 1E9LA 3TONA 3W29A 2ZIDA 3AISA 1IV8A 3N11A 4EK7A 1PIGA 4MAVA 4TUFA 4PMVA 3EDJA 5GQBA 1VEPA 3MANA 3BMWA 1XH0A 4ACZA 1PJ9A 1KCLA 1BYBA 3CHFA 1W9VA 4H8HA 3G6LA 3M6DA 1B3WA 3VDHA 3AS3A 1C91A 3U5UA 3CUJA 1NARA 1CNVA 4GXPA 1V08A 4U5KA 5JIWA 1V02A 1G94A 4X0VA 4CKQA 4XB3A 2VMFA 1JFXA 2D24A 4P7RA 3DC0A 3ARSA 1E43A 2VC9A 1WP6A 5E09A 3RJYA 4BQ5A 1L0PA 4JCLA 3WDQA 5JBEA 2WZHA 4CN6A 2J25A 3VIHA 2CPUA 1OT1A 4P7NA 2XFYA 4ACYA 3FHAA 1KWKA 2XWDA 4E2OA 4LXFA 3F4VA 1VFUA 1WZLA 2D20A 3ZT6A 1HN1A 3SCRA 2J7CA 2UY2A 4MB5A 2YA0A 2XVKA 5EFDA 1HKJA 1HIZA 1ITXA 2WZEA 4H2CA 1ZBWA 3HN3A 1WPCA 3NDZA 3AS1A 3PZTA 5I0DA 1UYQA 2ZXBA 3WNPA 2PC8A 4AYSA 1JL8A 2XVLA 3OLGA 3CHEA 2PWHA 2ZX9A 4TOQA 3RM9A 5A8QA 3VKKA 2W91A 1UR8A 5DF0A 2WANA 3RJXA 2DT2A 4D1JA 2XVNA 3VIIA 2TAAA 3IK2A 3D5HA 3LMYA 4LGXA 1BGGA 1NWUA 4C7GA 3QHMA 2VZOA 2XGBA 2ZWZA 2OSXA 1VFFA 4AD1A 2VX5A 3L4XA 1G01A 4OKDA 3EMCA 2MANA 3MU7A 3WDPP 5D9NA 3RPMA 8A3HA 4TTUA 4UFKA 3WUBA 4HTYA 2ESCA 3BH4A 3GH7A 3A4XA 3CMGA 3WELA 5KEZA 2YA1A 2X09A 1W1TA 1H0GA 1TG7A 3CH9A 1E6SM 3RMEA 4B9ZA 1FA2A 1OB0A 5I77A 1UWQA 2J7FA 2WPGA 3SUVA 5CZKA 2VURA 3WBAA 2F8QA 3VGFA 3TTOA 1TUXA 1UR9A 1TCMA 2QPUA 3N15A 4FMVA 4KGLA 5IDIA 2FH6A 4F9JA 1MXDA 4KH2A 3WEZA 4J27A 4RE4A 1GQLA 4P8WA 1CGYA 3WNMA 1K9EA 2ZX8A 1DWIM 4NRRA 1FFQA 3WF4A 4QAWA 1GOMA 5CPSA 4UTFA 1KWGA 1M7XA 1R86A 1NP2A 1CXIA 4OIFA 2OYMA 1WE5A 3VD4A 2ZWYA 4PCTA 3WNNA 3OGSA 3L4ZA 3ZQ9A 4NI3A 3WH7A 1V6VA 1WB0A 2WWDA 3WQ6A 3CZJA 4BS0A 5A8PA 2V3DA 3MS8A 5CPQA 2XFFA 3ZOAA 4RE3A 2E8ZA 2ZXQA 1O7AA 4DUVA 1KCKA 1MW0A 3AS2A 2JE8A 1W1PA 2QHAA 1X6NA 2DSUA 4K68A 3VD9A 4UOJA 2XPKA 2PB1A 2WCSA 3IJ7A 3ZJ8A 3A4AA 4HA3A 3CPUA 3UR7A 1OSEA 3JUGA 3TOPA 1V3KA 2XG9A 2ZICA 4MNMA 1FP8A 3VD3A 1CTNA 1UWSA 3AMKA 2E3ZA 4AEEA 3VPLA 2DEPA 1W2VA 5HBFA 2YA2A 4AISA 5FL0A 5CLTA 3ZT7A 9CGTA 4ML4A 4CUCA 1CECA 3L4TA 3K8LA 3PHAA 3DHUA 5JBFA 3WNKA 2WSKA 4AXNA 4FLQA 2XVPA 1NP0A 2WYSA 3BLKA 2WVTA 3BLPX 1CGXA 1ODUA 1HKKA 5FOOA 4P8UA 4XX6A 5A6AA 4D6GA 1H41A 2B31A 1U2YA 2J75A 4AZHA 1HX0A 4TX6A 5CGTA 4PTMA 1DEDA 3AIWA 4L4OA 3VD5A 3SEPA 3W25A 2GJPA 4CD6A 2PF0A 1CXFA 3L2MA 3W4RA 4PMOA 2E9LA 2DT0A 2DIJA 1C90A 4D6IA 3NDYA 3PZIA 5CSYA 2DQXA 2PWFA 3THDA 4TXEA 2WKLA 4UQBA 1GVYA 4Z2IA 1TVPA 3WIJA 5LYRA 3POCA 3AZSA 3ZT5A 3SUWA 3T2OA 3AHXA 2GK1B 1LLOA 2YDRA 4GI8A 3ZR6A 4F79A 1QI0A 1PBGA 1PZ2A 4PTWA 1J0YA 1AMYA 5I6SA 4ATDA 3FN9A 3ZJ6A 4JL1A 1W3KA 1V3LA 2GUYA 4PMQA 1HJUA 3VX1A 1VAHA 5BXRA 3O6AA 1E6QM 3AHTA 1TE1A 2WXDM 3AI0A 3N18A 3WH8A 5A8OA 3CO4A 3ARWA 3S2CA 2ZX7A 4GINA 3VDBA 3T0AA 4W8BA 2JF7A 4Y7EA 4WKAA 1B90A 3BAWA 3W24A 4H8VA 4JFTA 4RE2A 5D9PA 4UFHA 1HJSA 2FDMA 4D6EA 4X0NA 2D0FA 1V6WA 1ZBKA 3O9NA 4W5ZA 2DSWA 2J74A 2D22A 5ABHA 4NSBA 2VR5A 4ZFMA 4AZIA 1R7AA 1HKIA 1CLVA 3VO0A 4W84A 2HVMA 1QHPA 4EE9A 1ZJBA 1WDQA 1AQMA 2BY0A 3ARUA 3GDBA 1W91A 3N12A 1BYAA 4LX4A 3IAQA 2YJQA 1W9PA 2OWXA 3W82A 3WD0A 3VM5A 2VVNA 4AMCA 1H3GA 3OLDA 1JI1A 4LYQA 3T2PA 2EXOA 1SMAA 6TAAA 3VDAA 1HNYA 1G0CA 1K9FA 2DPEA 2ZX6A 1QBAA 2G3JA 4AD3A 1UD2A 2XWEA 5AYIA 3VIMA 3VIJA 4W85A 1DWAM 1UD4A 1C92A 4UNIA 3T08A 3W81A 5AYBA 1EO5A 1NOUA 1UD8A 4MNLA 2CHNA 3D3AA 1MQRA 1MWOA 1V3IA 4UQAA 1V6XA 2OWWA 4Q7NA 1B9ZA 4QLLA 2WMIB 4H41A 4AIUA 3UEQA 2ZX5A 3A47A 1ISXA 1F4AA 2OYLA 2A3BA 1BG9A 1SR0A 4HPGA 3RO8A 4ZEPA 2ZUSA 1MXGA 1U30A 4AD5A 1LF1A 3VGHA 1CGUA 2EPLX 1JZ8A 3AIQA 1TVNA 5BCAA 5HPOA 2EEXA 2WHLA 1GQIA 1GOIA 2NT1A 2VCCA 1W32A 3VIGA 3FW6A 3VDCA 3KZSA 2CYGA 3CZGA 3ZJKA 2W63A 3EMZA 1CEOA 1JZ4A 4ZXOA 1V6UA 2YDSA 3VNYA 3PTMA 1UKQA 5C8BB 2J7HA 3B9DA 3MUY1 1UWIA 3CLWA 5BRQA 2AAAA 1UH4A 1H5VA 1GJUA 3G6MA 2V3GA 1K6AA 2WMKA 1GPFA 3VNZA 3ECQA 2A3AA 1E0XA 1HXJA
chains in the Genus database with same CATH superfamily
5AC4A 3UXDA 1WKFA 4KWOA 4UFLA 2QCDA 5FF7A 3ARXA 4KT2A 3UGVA 3VGBA 4KRTA 1ADSA 2P1FA 4HOXA 1U1JA 2X2YA 2BVWA 1H7XA 2WKGA 4CCEA 1E71M 3LSBA 3NG3A 3TWAA 1W1YA 2E5DA 2E5CA 1UA7A 4O1BA 1WV2A 2Y24A 2NW0A 1FCUA 1H62A 6ALDA 2FYMA 3W3OA 1V3MA 3DHDA 4LUSB 3PK7A 3W28A 1JD9A 1IT7A 4HP5A 1EOKA 1D7KA 2PWEA 3SJNA 5LGXA 1HKMA 3T40A 4HU3A 4XKMA 4QP0A 4WK9A 4LRTA 5CPNA 1OYBA 3PPGA 5E5CA 3KL3A 1XIGA 1HTIA 1UA3A 2HCVA 4MWAE 2Z7GA 2IKHA 3QPEA 4Q8NA 4MKSA 2AMGA 1J79A 3GHUA 4JTUA 2VD8A 3NZ1A 3GUWA 2I16A 4OOZA 5EMUA 1V03A 1EQCA 2QIIA 2CHRA 1VPXA 2PDHA 4LUSA 1BWVA 2VC7A 5AHEA 3OP2A 1XWYA 4I3GA 3RM8A 3S83A 1H7PA 6XIAA 2HNEA 4NZ3A 2RKXA 1TKKA 5XIMA 4J2MA 2AKZA 4BI6A 5ABFA 2SFPA 3EDDA 1WAUA 4HJFA 2PDIA 3ZM8A 4LUJA 3IK4A 4QJ1A 2REQA 3MHUA 1QNQA 2VDHA 4JHMA 3MB9A 2EG8A 1ECQA 3T4WA 8XIMA 2XZ9A 4RLIA 1V93A 1YHTA 2W66A 2ZQ0A 3B9NA 4LAOA 3W84A 1XLHA 5AHLA 3TDFA 1QI5A 1YW1A 3APYA 3NPXA 2VEIA 2YIHA 4MYXA 1KM1A 2WLZA 4JDBA 3P0XA 4C6MA 2YYUA 4GZ7A 3B0YA 4NUWA 1XBYA 2X2GA 2E67A 3EPMA 4PUDA 3AU6A 1S2CA 2GDQA 3ZSTA 1KCXA 4FPSA 3UXIA 1M01A 3SURA 4A3UA 4TR9A 1J0KA 1W3LA 5HNNA 5A8GA 4LNYA 4QM1A 3H2CA 4HZ6A 4O28A 4Q8VA 4XAFA 4UCFA 2PZNA 1EBGA 2FVKA 2GDUA 4GUFA 1K4HA 1NDYA 1OCJA 4RDYA 1MFVA 1J8VA 4Y8EA 5KZ6A 4WJXA 2WQPA 4YTUA 1QBBA 4E8DA 2PTDA 3LYEA 4QE5A 1TPWA 3MUZ1 5LNUA 1C3FA 4KIEA 2B7OA 2DSKA 4O1AA 3G1YA 4O13A 4H6RA 3S1VA 4E2BA 2VDGA 4IMGA 4G5DA 5CJMA 2HXUA 2VZUA 3UA3A 2GSJA 4H9XA 3C2VA 5F2MA 4HOZA 5H8MA 2ZA2A 2ZRYA 1A5CA 4PSRA 3H53A 1YXCA 1X7FA 5DELA 3H7RA 5AYXA 3HQ1A 3VOHA 3SCOA 3LCHA 1M53A 4LUTA 3UYCA 4H6KA 3N2BA 4M80A 3VGDA 3GXDA 2GJXB 3GR4A 2GVEA 2Z24A 3CWNA 2V5CA 5F1UA 3QW4B 4H9ZA 1Q2RA 2PPGA 3KOZA 1BPLB 1EIXA 1XYLA 2H9AB 1XBVA 1A47A 4RZ4A 1NAL1 4PRTA 2OKOA 2CLOA 4DO7A 4CN4A 4AQLA 2VJXA 2ZUMA 4O4WA 1B3YA 1XIEA 4JTJA 2CKSA 3WLPA 3C8NA 4IMFA 3SY5A 1XFCA 1AQFA 2I9EA 4QTGA 3EB2A 3MT1A 1KC7A 5FF2A 1F9CA 2CESA 2RJHA 2ZRVA 4O1EA 2BVDA 3I10A 4KEMA 5JQ9A 1IGSA 3QLLA 1GKPA 1V0NA 1UWUA 3A5FA 3G0UA 3AFBA 1FH9A 2AQOA 4GUJA 1QWKA 1DWFM 1ZBCA 1NDVA 4YJ5A 1E4LA 4IQDA 2ZZ5A 4HB7A 2DVTA 4EKJA 4Z17A 2C71A 4KERA 3A9IA 2CBVA 1G9HA 4GYFA 3REQB 3PBVA 1F05A 4PEEA 1F3EA 5M17A 1VBRA 4H4IA 5DLCA 4R88A 3SCTA 3BARA 1S1RA 2JEPA 4GVFA 3VIFA 1RQEA 3BW4A 3VD7A 1TYGA 1HKWA 2EO7A 4CQ8A 2V2HA 1M7JA 2X05A 2PRHA 1O95A 3EWYA 1G67A 1VFSA 3W22A 2EBNA 2E09A 5TQLA 1ZJIA 3IAPA 1OG0A 2ZUNA 3CZLA 5TBOA 4AFYA 4GIEA 5H2ZA 3KEHA 3ZWTA 2DQWA 1U1UA 4REQA 5FEZA 1P5BA 3HM7A 2IUZA 1DE5A 4U2YA 3HFTA 1OGGA 4BFAA 1MI3A 4PCPA 2X1UA 4QDWA 2Q71A 3HQPA 2V81A 1PIFA 3UJSA 1PKYA 2NXIA 1NU5A 1M04A 2GSHA 3LPGA 4B90A 2NWRA 1H1ZA 2HK1A 3NDOA 1VGAA 3KBSA 4PZVA 3WDJA 2JKEA 1BVNP 1A5LC 3AMGA 2OX4A 5D8WA 4ZE5A 3T1GA 2HTMA 1XIDA 4HKPA 1WUEA 4ZGYA 1J93A 3UZJA 3I6EA 4NNCA 1WNOA 4KMQA 1V77A 1EX5A 3PZGA 4XZIA 4D6JA 4FX7A 3V16A 3BQ6A 4KS0A 3K8MA 1EJSC 3QV6A 3L65A 4LVBA 3WMBA 1UWTA 2P8BA 1P6CA 3GDKA 1VD6A 4JHOA 3QZAA 2VTFA 3IV8A 1PYFA 1RR2A 4E8CA 1OWQA 3TAKA 4PB5A 3SCPA 4BQ2A 4MPKA 2J8TA 4ICMA 3V75A 1TV4A 3MQTA 4XBSA 2Q01A 4AVOA 3B9AA 2FB2A 3IIXA 4LWWA 1IT0A 4NJJA 2E7FA 4ENLA 4Z2HA 2I5IA 3ORWA 2QGYA 2WHJA 1GHRA 3SGGA 5HMSA 4C1KA 3MP5A 3ZR5A 3KP1A 2YW3A 1VPYA 3POHA 1G6CA 3WLKX 1SW0A 5MKGB 3CUXA 2IPJA 1T7LA 1YEYA 1NIUA 2INFA 1VENA 4WDXA 3CUGA 4UR7A 4IWWA 3NQ6A 1V8EA 1UJQA 3ZLHA 1ZP4A 3WUGA 1P4CA 4C6NA 2Y7FA 1FXPA 1XRFA 1P1XA 3ARTA 1IWAA 3TN5A 2BGNE 3P67A 1WKYA 3BG9A 4AIEA 4LC8A 3HFYA 3N2XA 1AJZA 2V38A 2O4QA 3DG3A 2RGLA 4CCZA 5DT7A 4IFKB 1MZRA 3MSDA 4MM1A 4CNOA 4AC1X 1E6PA 4MOZA 1BF6A 1LWIA 3PJUA 1TQJA 4RW5A 5MKGA 1JEZA 3NEHA 1WDDA 1AD4A 2IXVA 1QASA 4A21A 4GYJA 4KWSA 4KCTA 4ZXLA 2VFGA 4ICCX 3SCNA 3H6OA 2Z1KA 4LB3A 3TV8A 3WLQA 5EB8A 4JTRA 3M4HA 3NXFA 1BYDA 3HPZA 5IM51 2JF6A 1XH1A 4IFKA 3WDRA 1BTCA 4Y9PA 1SUXA 2BHUA 1UW9A 3E12A 3PWAA 1ZZMA 3KTCA 2FGLA 4CQ9A 5CKSA 3H7UA 1CZ1A 1X96A 1JDCA 2ZE3A 4M5PA 5CG0A 1JPMA 4D72A 1GPWA 5A6MA 2FZDA 2ACSA 2F6UA 1LROA 5IFPA 1J0ZA 4I5XA 2RDTA 5CBIA 1KXQA 2FJKA 3USBA 1FRBA 3MSYA 3PTQA 4I5UA 3RDKA 1E0VA 5LXXA 4N2YA 1AD1A 4Q32A 3BJSA 5E6YA 3UD6A 1DHKA 3VILA 2FHFA 1OFDA 4ACZB 1VFMA 3T6CA 1GZGA 4C6KA 3C86A 1XG4A 1EKOA 1K7XA 1TTJA 2PTZA 1A4LA 3R10A 4IMDA 3APTA 5A2CA 5M1TA 1VCVA 1RZMA 4DO4A 4MMWA 3AROA 2EGZA 3KS6A 3CHCA 1XLCA 1LUCA 2PP1A 5E0FA 5HQLA 3LK6A 3BMVA 2JGQA 3E2SA 1FCBA 4KETA 3TCEA 4AZ6A 3SCSA 2IQDA 3OYZA 4HMNA 5I3KA 3QTPA 4HHMA 1UPPA 1VIWA 2XINA 2BHYA 4GY7A 1XPYA 4HHPA 4L56A 4DM2A 4Q4SA 4GIAA 4Z1CA 1UC4A 5DEZA 2C79A 4INFA 1WZAA 1YPXA 6CGTA 4IIDA 2GGIA 2E6YA 4YVXA 3WDHA 4BCEA 4DM1A 4POCA 2ZA1A 1EOMA 3E0IA 4H9TA 3CXOA 2C1GA 4UQ9A 3L21A 5BOOA 3PP7A 5JU6A 4KRUA 4RDZA 1CLXA 3KWXA 1YMYA 2AL2A 1TMLA 2AAMA 3PZMA 3WYZA 2A3CA 1KD0A 3VVGA 5KZMA 2UY5A 1TTIA 3G0XA 2VX6A 1CXKA 3WBYA 3TSBA 1AMKA 2I5GA 3CV6A 1DJNA 3GG8A 3LBMA 1E55A 4YCOA 5LHFA 1U33A 4W7WA 3S2NA 3MO4A 1PPIA 3BLFA 1UKSA 2OLSA 4Q8MA 2O7QA 1KXHA 1RPKA 4UQCA 1F3XA 1CW2A 1SMDA 3LBCA 1EQPA 1EJWC 4J2PA 2G4FA 3BAXA 3C2RA 4F0MA 3NGJA 3VOFA 3WLMA 3PJWA 3MKKA 2XISA 4F40A 4JBRA 1H0IA 2JKAA 4OUIA 1OHLA 5XINA 2ZYFA 4CNPA 3TLLA 1EZ2A 1FDYA 2O55A 1SO5A 3ZMRA 1QK0A 4UOZA 2ABBA 3WBWA 4B16A 2J7GA 1MSSA 4IX2A 1T40A 4WDTA 2Q8ZA 1W1ZA 2HS6A 4HT3A 4R53A 3DFNA 3L2IA 1VCFA 1VJSA 2EG6A 2A7NA 2CZVA 1Z7AA 3CYJA 4OUEA 2OT1A 4CCDA 2ALDA 1YNYA 4JDYA 4JCMA 2BBFA 3AXIA 3QPZA 4W8AA 4LVGA 3LU2A 4CQDA 3E9AA 4LW7A 2RFGA 3NZGA 3R4IA 4PTNA 4JY9A 3QBUA 1QPOA 2VFIA 1QR7A 1EFZA 3RITA 3OGRA 3TXZA 4W7VA 3COTA 1XYMA 2CWXA 3FKKA 1CGWA 3ALGA 4DQWA 1SYTA 3W23A 2XM2A 3TP4A 1DP0A 4AW7A 1PX3A 4LS1A 2OOGA 3KLKA 2DH2A 1S1PA 4XUGA 1ITQA 3OODA 1RUSA 2UY3A 4W7UA 3IVTA 1ZU8A 3DBPA 3NOYA 1VC4A 3NL3A 6REQB 7ENLA 2D2OA 4NF7A 1A53A 3MPGA 3N2TA 2VFHA 3CTTA 4L6OA 2B7NA 2YBTA 1UD5A 1BRLA 4LYRA 3RHGA 4RNHA 2H6RA 4QSFA 4XD3A 4S3KA 3F7JA 1U5JA 2PUZA 1I75A 3R94A 1C7TA 2NUWA 3W7IA 5DANA 3LCIA 5F1VA 1OT2A 3BE7A 4MWAD 1SQ7A 1OK4A 1JDDA 1IEIA 5KETA 2BMBA 3V1HA 4D6FA 4BKNA 5A6TC 3RM4A 3ABOA 2NZLA 3KBJA 5D09A 4DIAA 2W61A 3FXYA 1UZDA 4GQQA 1NDZA 4I7VA 1RBOB 3FYOA 1X8FA 1G7VA 3SZ8A 4QIUA 5ENLA 3WX7A 2XVGA 1TREA 4DRSA 1IXPA 1L8NA 4DF1A 1E5JA 4PYSA 1TIMA 4J3SA 4HD5A 4LJ3A 2XHYA 3M0IA 2BXZA 2CZDA 1OX4A 3PJXA 2VQUA 4LBSA 4J3UA 2PLKA 4IL2A 5H8UA 3UA4A 4O11A 4JQ4A 1R7OA 1OFRA 4MVAA 4JHZA 3MSRA 2VUNA 3N1AA 2BVYA 2WM1A 3H4XA 1XISA 4A2SA 3TA6A 1FVPA 1EH9A 4LOCA 1TSIA 1WCGA 4UTLA 4DVOA 1PE1A 4QXIA 3NCOA 4ZQNA 5BWFA 1CT5A 2QVNA 3HO8A 3AYTA 2FMOA 3SIZA 4JN6A 1S39A 4PMXA 4XVDA 1GQKA 4JEJA 1XRVA 2FPTA 1Q6GA 4O17A 5BXTA 1UR0A 3W2KA 2ZUUA 5LIXX 3LXBA 4J3VA 5REQA 2FMNA 3W37A 4IZGA 4DUWA 3TYZA 3IIVA 1QI3A 3RMJA 1GQNA 4NG3A 1KFCA 1XBZA 2A2IA 1X1NA 2ZA3A 1FKXA 4H6QA 1JCTA 4UQDA 4CD8A 4HA4A 4QGCA 3GTNA 1FWHC 4GZJA 2EPKX 1UP2A 1S5TA 3PUOA 3C2OA 1P0NA 1Q4NX 5HQMA 1E1CA 2PDUA 3TMLA 1S2WA 3WJXA 5FA5A 3UCQA 4D8AA 1SZRA 2XH7A 3TJIA 1VB9A 3E96A 3NM1A 3LMZA 3P62A 5E9AA 4RL3A 2Q3OA 1CGVA 3U4FA 4AZCB 4FLRA 3IGSA 1GKQA 5I5RA 1RH9A 1THFD 4W4QA 1WA3A 3A3HA 2EPHA 1YADA 2PDPA 4DYKA 1VYSX 5E0KA 3DX5A 4NAFB 1YDNA 4HK5A 4JGDA 3MA8A 2QDEA 1OD8A 2E77A 1JNDA 4I8YA 4GC3A 2VVSA 3WLHA 3WD1A 2CITA 3EWWA 5LIUX 4EAYA 4H8UA 3NQFA 3B4YA 1V0LA 1D7FA 2TSYA 1QI2A 1Y65A 4AZCA 4KESA 3VZZA 1WZKA 2OGJA 4PMRA 1VEMA 2C18A 3GTIA 4AWEA 1UKPA 1IR1A 1Z89A 4LVFA 1K9TA 3AAMA 2WW5A 1H49A 4AWUA 4EIVA 4HMDA 3WUEA 4N0RA 2W3ZA 3AHZA 4YWIA 1R5YA 4H2HA 3H2EA 4RXFA 4ZMGA 5I02A 5A2BA 1QOPA 3CQKA 5GPRA 5HWMA 1H63A 3IJ8A 4GISA 3TA9A 5G1MA 4MJMA 1OVDA 1GVOA 3M0YA 3C61A 2G5WA 3UG4A 4DO5A 3W27A 1KBKA 3WF1A 4UB9A 3HMCA 3G1RA 5A6LA 3W7QA 4M29A 2WNNA 3GZAA 4JYDA 1K6WA 3BOLA 2C3ZA 1UCWA 4UTMA 2JKPA 5HJLA 1QO5A 3MP4A 3B40A 1W1VA 1DKWA 5CAKA 3ZVHB 4QISA 5M5DA 5AC7A 1HP4A 1X1OA 3NYZA 3M9YA 3IV3A 4B5WA 3LZ5A 2HSAA 4FSAA 1B31A 1FBAA 3VUSA 4Q3MA 1TX0A 2HBVA 1G4PA 4AG0A 5XIAA 3N6QA 1PHQA 3ANVA 3TNOA 4ZO6A 1OFAA 4X9SA 1VEPA 1W5NA 3GR7A 3BMWA 3CQIA 1PJ9A 4B5SA 1V51A 1W9VA 6PTDA 3VDHA 4DNHA 1C91A 5DXXA 4Q4QA 1NARA 2X1TA 1CNVA 4FIRA 4U5KA 4GUGA 3HPSA 1V02A 1CX9A 3CHVA 3CH0A 2D24A 1XQLA 3TJXA 2PURA 4P2VA 3KDNA 5JBEA 4MUZA 4PMJA 2J25A 2DP3A 4OBTA 2GQ9A 3G1SA 1Q6RA 1OT1A 1C9WA 3UVIA 1Z6KA 3PTDA 3CV7A 2Z27A 2XWDA 1B9BA 4LXFA 5AYZA 5IBXA 1Z48A 2HPIA 3MJMA 4R3UA 1FUYA 3XINA 2J7CA 4Y9NA 2XVKA 4H2CA 3CPGA 5HMEA 3SSZA 3R25A 2PTXA 4IGMA 3NDZA 5FESA 2D2JA 1U1HA 1UYQA 1PWMA 2E6AA 4AYSA 2XVLA 5BW6A 3TC7A 5CH9A 3O0KA 3NTYA 1G7UA 2PWHA 2O4MA 4FXFA 3RM9A 3VKKA 4YTSA 1UR8A 3GO2A 2ZADA 3A12A 4J35A 1DPMA 4PTDA 1X7IA 3SM0A 4KWVA 2XVNA 3D5HA 1W37A 4CLMA 4WVXA 1QPNA 2VZOA 1A5UA 3NPVA 4CQAA 4AD1A 3L4XA 3B8VA 5HWNA 4OKDA 3WDPP 4TTUA 4UFKA 1JUBA 4HTYA 3FSTA 2Z6JA 3BH4A 3GH7A 3A4XA 1ZTVA 3B8DA 4NAEB 3GDMA 1TG7A 3NQDA 4B9ZA 4F0HA 2OG9A 1EC7A 3P60A 3EB4A 2VURA 2V5LA 3WBAA 1PV8A 4Q33A 3S42A 4OV4A 4O53A 2FH6A 4F9JA 3WEZA 1PO9A 4J27A 4JD4A 4JR5A 3WNMA 2QZRA 1DWIM 2VGGA 3LQLA 4QAWA 1GOMA 1XCFA 4OIFA 2OYMA 1A5MC 3WNNA 3OGSA 4QAIA 2PWVA 4JEQA 1V6VA 2WWDA 5A8PA 4WJEA 4D2JA 4CQCA 1KBJA 2P53A 3ZOAA 1LYXA 2Y88A 1ME9A 3HGOA 3AS2A 4V33A 1MNSA 3IS4A 2QHAA 1BWLA 1X6NA 4K68A 3VD9A 3E3HA 1J96A 1FWDC 4XD6A 3O06A 3SAZA 4FO4A 4M7SA 3TOPA 1KM6A 4PE8A 2XG9A 2ZICA 4L9XA 3VD3A 3H70A 1PVNA 3QGKC 4AF0A 3VPLA 4MZYA 4AISA 4OWGA 1LLWA 4X2RA 3CQJA 5CLTA 4CUCA 3GU2A 2GGGA 3AUOA 2Y7EA 2VEFA 1S5MA 2YXOA 5FJPA 1B3OA 5AZ0A 1RK6A 4S3GA 4XX6A 3PUDA 1H41A 1U2YA 2J75A 4AZHA 3IIOA 3LCWA 2H3DA 4PTMA 3AIWA 3BK0A 2I57A 3R89A 2QQ6A 4KEZA 3W25A 4CD6A 3VKBA 3L2MA 3QFWA 2INZA 1EC8A 3MBFA 4PMOA 1ONXA 4Q4MA 1ADOA 3PZIA 4BI5A 5CSYA 3LN3A 4MY1A 4UQBA 5HJYA 4Z2IA 3POCA 1MUWA 1OYCA 3GHRA 2YDRA 4F79A 3FLUA 4PTWA 1J0YA 2OTDA 1AMYA 4WZHA 4BK9A 4ATDA 5HNUA 3FN9A 3ZJ6A 4DJFC 1W3KA 2GUYA 3UPWA 3OVGA 1QXLA 1D8CA 4K7YA 1MRQA 4DUOA 3NGFA 3MVTA 1DVJA 5G2WA 4JN7A 1RY8A 1J2BA 4W8BA 3C0LA 1Q8AA 4WKAA 1JVNA 4Z1AA 1ZY9A 4EACA 3W24A 4Z0JA 2FLIA 2V82A 1XL9A 4ROQA 3WLIA 2HMCA 4X0NA 2D0FA 1Y8BA 3O9NA 4W5ZA 4GY1A 2GSEA 4KEUA 1HGWA 3EX2A 1R7AA 1HKIA 4MWAC 1CLVA 2GLKA 4LEFA 2HVMA 3HG5A 4DEFA 4R33A 4EE9A 4F0LA 4ES4A 4WQ6A 3ARUA 5ABTA 1W91A 1BYAA 3LB0A 3W6YA 5CZJA 3IAQA 4HPNA 2YJQA 1TJ0A 3P61A 4XAYA 3PB0A 3WQEA 2G95A 1H3GA 2Z1BA 3WQGA 4JTHA 6TAAA 4UTIA 4N6EA 1TPB1 3OVQA 5TNVA 3BURA 2G3JA 2PDLA 4AD3A 4IGNA 2R1MA 1Q7QA 4K37A 1C92A 1WX0A 3T08A 2WSQA 1O5KA 1ZAHA 5G4WA 3AJXA 2CHNA 3O15A 1V3IA 1I0BA 1JPIA 3UWUA 4LF2A 4Q8TA 3EA2A 3L0GA 3MYOA 4AIUA 4G7EA 2W9MA 1ISXA 3C6CA 3BLDA 4IUOA 4E38A 1KA9F 2PD5A 3R8RA 4DY1A 3RO8A 2ZUSA 3HPAA 4QJ4B 4ZB0A 1U30A 4AD5A 4IL0A 5K2ZA 4I9MA 2EPLX 4FP1A 1K8XA 3AIQA 5BCAA 2PLJA 4NJKA 4NVTA 1GOIA 4LH8A 3EPOA 4GIRA 1UBSA 3TZFA 3GZ3A 5C6MA 1EZWA 2VGFA 2CYGA 4GLEA 3EMZA 2WO5A 1YE6A 1V6UA 2YDSA 3VNYA 3PTMA 3U8GA 5C8BB 2IPWA 2OLAA 7PTDA 3MY9A 1KRBC 4HA0A 3T7VA 1TIWA 4MYAA 3DGBA 2V3GA 1XLJA 1FWSA 1GPFA 3W02A 2PDMA 1XLBA 3GB6A 2ZRXA 5K9CA 2E1DA 2DIEA 1KRMA 2HROA 2QMJA 4PULA 2OVLA 4O1DA 1LG1A 3NZPA 3A3WA 5BU6A 3OTRA 3AZTA 2B0MA 1EIBA 2R24A 3A24A 5AECA 2ZZ1A 1EJTC 1MDRA 3DBNA 4EXBA 1PEZA 4B3LA 3VIOA 2BDQA 1KM3A 1BEUA 4QDMA 3A5VA 3TWBA 2FZBA 1CYGA 1BYCA 2YDQA 3MMTA 3CPRA 3USZA 3JZUA 4OGZA 1W3IA 1MYRA 2PODA 3S9ZA 3KDOA 4GC4A 4HOWA 3W1LA 1HT6A 4US5D 3JU2A 4LTSA 4DBUA 4DZ5A 4L1XA 3WK0A 4X63A 3F4NA 4NU7A 5MHBA 4PA8A 3MUIA 3AMLA 4RPQA 4RKAA 4F0SA 1OC6A 2OZ8A 2HK0A 1ZENA 3MO7A 1Q6FA 3ARPA 1E72M 3P7YA 5BNKA 4BQ3A 3FA5A 4OOUA 1VR6A 5A3HA 4A8LA 3B0PA 5LNWA 5D8ZA 2CHOA 3CQ0A 3UG5A 5CC6A 2A3LA 4ZOCA 3AYRA 4CU7A 1JCLA 3B9EA 5C9RA 3TTEA 1XRTA 2E4TA 4GX8A 3STEA 2O9RA 4JIRA 2NVCA 4U33A 3U57A 4L4PA 1TA3A 5EFFA 1Z69A 4RW3A 3OLEA 1H7RA 1I1XA 4ZODA 1R3YA 4F48A 1P6BA 1SJDA 3GM8A 1TCDA 2Z1VA 3G3MA 1P48A 2OCZA 3WDIA 1CXLA 3DENA 3PNUA 5CC7A 3E49A 2HPMA 1BLIA 5FJIA 3CQHA 3N34A 2AGTA 2PDGA 3TTQA 4R7WA 1E1EA 1AZ1A 3LHUA 3TTSA 4NXKA 1PX8A 3HA1A 2VRQA 3EAUA 1V3JA 2DZXA 4JFUA 2CU0A 2CZFA 1IR2A 1P7TB 4YVPA 1UH2A 3NQVA 4RV8A 2ZDSA 4K2SA 4PL2A 1XM3A 2O0TA 2VWTA 4XZBA 1ZB5A 4KCVA 3MDWA 3UXLA 3TLQA 1Q6LA 3MVIA 4QX4A 2WC3A 3WY1A 3CC1A 4YXGA 5I00A 3PBGA 3ZSSA 1GW1A 5C71A 3HV8A 4P7QA 1XQKA 4GABA 2QCFA 2WWCA 1NVMA 7REQA 4JYFA 4DPPA 5EBAA 2WC4A 3NQMA 3QQ0A 2FPVA 1CB2A 3EWCA 1KGUA 4WHBA 4QDPA 1WBJA 3O8AA 4H01A 3ITCA 4JKKA 4GIYA 5A1AA 3CB3A 3IGXA 4LCSA 2BODX 3HF3A 2IKGA 1R3VA 1KXVA 4V27A 4DJDC 4ZSTA 2QJGA 1K9DA 1XSJA 1TPEA 1PTDA 5T9BG 1OFOA 1JZ3A 3ZS4A 4KBXA 1JQVA 4C1NA 5C70A 3SADA 5D38A 4MWAB 5FJRA 3UWVA 3P81A 3G2GA 3E2VA 1FWJC 1R9XA 4P8VA 4TMCA 2HISA 1DTNA 1UP0A 1TR1A 3W86A 4DJFA 2QF8A 2Y5JA 3UZYA 1UZ1A 2OMAA 4R7JA 1NJJA 4C6QA 1OCBA 1NOWA 2JFEX 1AH3A 3U4AA 3BV7A 4HPHA 2XM1A 1O1HA 1Y7VA 3GH4A 3S4TA 3WQCA 1ODZA 1UR4A 3OPSA 4A4AA 1ZAIA 3ZO9A 3I7SA 3WSUA 1NF7A 4MLRA 1HJQA 1VFTA 4BI7A 1RD5A 1SPQA 1OADA 5CSRA 4QITA 3NUKA 3LY0A 1VBUA 4EX4A 4XTDA 5LHEA 1EJ7L 4F8XA 3NPWA 5C9XA 1PX4A 3L68A 4GH3A 4HMCA 3AIEA 1FP9A 4IQLA 4LF1A 1ITUA 3VX0A 1PDZA 4R27A 4YLWA 3DUGA 3KBMA 4Q22A 3VA8A 2E28A 2CLMA 3P6LA 2ZE0A 3TOYA 1PS9A 4O57A 4UBPC 5DXYA 4V2XA 4JIEA 2VCBA 4XUYA 3TK7A 3WL1A 4ZO8A 3ZFHA 5HJXA 4W8LA 6A3HA 3TFCA 3AU2A 1KM4A 3R0DA 1RSCA 1Z8AA 1KGXA 2O9TA 3VE7A 4NT0A 2A6NA 1ESWA 1AQHA 2V3EA 3NVDA 3W2NA 1AJ2A 2BGSA 3T05A 6XIMA 1F5ZA 2UY4A 3MUCA 3GIQA 4HK7A 3EOLA 4PUWA 1R30A 5I24A 3EA1A 1LOQA 1GCYA 3BDKA 5BRBA 5D33A 4WRHA 4RJEA 3S5OA 3EOOA 1MEIA 1RVKA 3GD6A 1OZQA 3PY2A 4CNTA 5HOSA 3W7EA 1O12A 1X6UA 2HRWA 3W38A 4UMBA 4NP7A 1JYXA 2ZTJA 3UYIA 3NQBA 5F2LA 3AMDA 3RF9A 5CLWA 1QNRA 4OVXA 1MQQA 1SO4A 1SO6A 3UWWA 3VMNA 3GVWA 3NR0A 1KR0A 3DAQA 2DVUA 3K2GA 3ARVA 3W2MA 1WXJA 1FHDA 2B7PA 4D8ZA 4H8NA 1UUMA 1ZJHA 2QJJA 2VFDA 3PSWA 3H24A 1EP3A 1LORA 5FI8A 1XKJA 3LI1A 1DXIA 2XIJA 2IKIA 2WMFA 1W9XA 2YDAA 3EKZA 1RP9A 4Q8OA 1S5NA 2UZ9A 3QR3A 2DJXA 5E93A 2ACUA 5AVHA 4ADTA 3D6NA 4S38A 1P1MA 5EKYA 3R0KA 3PM6A 3TYUA 1WOBA 4GFIA 1QPQA 2VRJA 3EKLA 2J4GA 1A49A 3S5SA 1TX2A 2OT0A 2DZWA 3ITYA 4PUUA 1QCWA 2FHCA 1GWJA 1DE6A 4FNPA 3MI6A 5I3HA 1V02E 1A0CA 1ZL1A 4B2DA 2NLIA 4W87A 4WGXA 3MKCA 4RX0A 4LFYA 3VIPA 5EMKA 4ZBCA 2Z0IA 3MMWA 3LEPA 4AIOA 4F0KA 4ZQRA 1N2VA 4FEZA 3TROA 2EPNA 1RHCA 5GJMA 3WLNA 4BF7A 1KQYA 5TIMA 3W7NA 1E4NA 2YCLB 1XICA 2BX7A 3C3NA 1OINA 3GKFA 4JOMA 3IIPA 3OG3A 3RXZA 1XSIA 1RK5A 4F0RA 3QV9A 4W89A 1ISVA 4DWSC 1RCOB 3ONCA 3CASA 3PAJA 1AZ2A 2ZXDA 3B4UA 3LRKA 4ATLA 4LV9A 1GGOA 4JTTA 3SDOA 3S9IA 1XFBA 1V0KA 3E5BA 4QCEA 4MFDA 2J78A 2WMIA 2NV1A 5KTLA 1IF2A 3KBWA 4GGHA 1XV8A 3OA3A 5D4YA 4GX9A 4Q4PA 3SCUA 1ENUA 5FL1A 4JIPA 4JTDA 1G1YA 2FGZA 1EEXA 1VH7A 4C7DA 2ACQA 4MUPA 2YPIA 5F4SA 3A22A 4JKMA 1JCYA 4WR3A 2OKTA 4PRRA 2ONEA 3VK5A 2AQWA 4L65A 3ID7A 4ZR8A 3VIKA 5HNRA 3PZQA 1B2YA 3SCVA 3E0FA 4XAGA 1LTDA 5IFTA 2YOCA 3O6CA 1MEWA 3T09A 2VR4A 4HZ8A 3VU2A 5JUVA 3SUTA 4IG2B 5BYWA 3CMFA 4IIGA 2FDSA 3QLDA 3C2FA 2A3HA 2VEKA 4PRWA 1X6LA 1WZMA 2XDFA 4JZ5A 3R5EA 5FKYA 1LL6A 3PUGA 7CGTA 4UNKA 1HL9A 1WO2A 3GX9A 1E40A 4OBRA 4AAJA 1Q6DA 4PMYA 3R12A 4BJHA 3A9BA 3O16A 5EGRA 3B3DA 4ZA0A 3O6YX 2CIPA 3C4UA 3J7HA 1EDGA 1K4GA 1DJZA 3W88A 5FJOA 4YYFA 2Y0FA 3EX3A 1TTPA 1AL7A 2OB3A 4H1ZA 1REQA 4CVUA 1K02A 3JS3A 4DF2A 5I3DA 2WMJA 3CZ8A 3GVRA 4IPNB 3TQ0A 3N25A 3LLXA 2Q3RA 4IXXA 4B4FA 1H1NA 4LANA 4DJEA 3W7GA 5AN7A 4DJDA 4YMZA 4H19A 4OU1A 9XIMA 3PZUA 4HU8A 1QHOA 1IZJA 4FHAA 1KKRA 1EO7A 5EL1A 3W07A 3JZEA 5LZLA 1LJYA 3QZ6A 4B5NA 1F2JA 2IQTA 4GCXA 2QAFA 5IOBA 3E0VA 2I9UA 1FTXA 5A6KA 1N7KA 4NNAA 3I3BA 5BMWA 2PGFA 3O3RA 1XUUA 3GDTA 3W1NA 2RUSA 4DB7A 4ZL1A 3WFLA 5D03A 5BU9A 3M0KA 3VINA 1LRNA 3KVJA 3ICJA 1IE7C 3L7RA 3RU8X 2VR2A 4O4VA 1P6WA 4PN2A 1ZHAA 5AC6A 3TTYA 1K77A 4LAMA 3SIMA 3RFAA 4H7ZA 2ZUWA 5C2CA 1FWBC 5C54A 4GMEA 1OG6A 1KKOA 3WN6A 1VIZA 3AHYA 3PPCA 5FSEC 1DQXA 3LERA 3UBPC 5FEPA 1WKDA 1ZALA 3OZOA 2EAWA 4NZFA 4O10A 3U3HA 4G6CA 1C7SA 4AUBA 2XUCA 3ZLFA 1VEOA 2OO6A 4LB4A 1F4HA 3S5ZA 3SI9A 4DBDA 3IEBA 3W6LA 3LZ3A 3B97A 4IPPA 3GVQA 1W5OA 4AZGA 3FJ4A 1SSGA 1XIJA 4LALA 2OOFA 1JYVA 4GVHA 4ONVA 1Q3NA 3GHTA 3HB9A 4I7WA 3KE0A 3E38A 1JQXA 5IDZA 3F1QA 2X42A 4AC7C 3VZXA 1AH4A 7ODCA 2W6RA 1W2PA 1V6YA 3W1AA 1CIUA 3AYVA 1EGMA 3N3MA 1OY0A 2Y7DA 3DFOA 4RZ5A 3SBFA 4PUMA 3LPFA 2PMQA 1PTAA 4YIWA 1GZ1A 1W3NA 4WY0A 3ISIX 2HDJA 3EKGA 4Y8FA 3KRUA 3UP8A 4XD5A 3ARZA 1R3SA 3C0JA 1LBMA 1EUNA 2IPGA 2HS8A 4C6LA 1D3HA 1VYRA 2QXWA 1W5QA 1CWYA 3M0VA 2Z26A 5M3WA 1AA1B 3NNTA 3CEUA 2W62A 3PS7A 4ZZ9A 4TTGA 2R9RA 2EKGA 3C5QA 4YWSA 1WDRA 3QW3A 1KO0A 1F76A 2Z1SA 4YCPA 2CBUA 5C0QA 1H1YA 3LUTA 1HZYA 3MWAA 5CJNA 2WHMA 3ABQA 3PZVA 3LQGA 1AJ0A 4FLSA 5CEWA 3NZQA 4QS6A 4GO8A 3MKVA 5DQPA 5LSMA 2DW6A 3BSGA 1JFHA 2PU1A 2OXNA 1XI3A 3W1MA 2D2GA 4V15A 1RLCL 1NWTA 3BQ5A 3VXGA 3LPOA 4ORMA 3K1GA 4CCCA 2HVOA 2FKPA 1PKMA 4CVWA 4U10A 1J01A 3VNDA 4DWSB 3B0VC 5DRCA 4LAKA 1JRBA 3UVAA 2JGYA 1DV7A 2OZ0A 3BPWA 1D3GA 2V63A 3W26A 4P7LA 3TC6A 3W83A 4K36A 2WCGA 4QG8A 1BVZA 1UMLA 1O6IA 3H2AA 4QE4A 5BOFA 1JUEA 1TMHA 3DIPA 1ONEA 4C5YA 5JBDA 2CEQA 3GFYA 1PKNA 4WKHA 4AD0A 1YNPA 3GHSA 3GTXA 4E5TA 3MW7A 4YN5A 4M19A 3WD2A 3SW6A 3QM3A 4DWSA 3G22A 3WQOA 4W88A 4QFUA 3WK3A 3BSHA 3F2DA 1HF6A 3RGTA 1SW7A 2JQXA 2H8ZA 2HBXA 1W9DM 1G4TA 4Z2GA 2J6XA 2QCLA 3PJTA 1I2NA 4GGBA 4U3CA 4WUIA 2PCQA 3GDLA 1MQPA 3QY8A 3CUFA 2CLFA 4FOKA 3T42A 2ISVA 1W3HA 2FZNA 2BXYA 1YNQA 2G0WA 4C6DA 5TD4A 4JIIX 2BP1A 3VFLA 1MW3A 3BAJA 2YCJA 3K46A 2VKZG 1YTKA 3ABXA 4LSBA 1PL9A 7TAAA 2IS7A 1ISZA 2Y8UA 3QSTA 4HNLA 3A21A 5AYYA 1TMQA 3WBEA 1VFOA 4JNMA 5ECVA 1QPKA 1T99A 4I5RA 4GRSA 1LQ0A 3LRLA 2C7FA 3AS0A 2EPMX 2VNCA 4FF5A 5HQEA 1GT8A 5CG7A 4ERAA 2A0NA 3NQ2A 3H2NA 3QN3A 4V28A 3GBDA 1QPRA 3OHMB 5ABGA 4Z2KA 4I9JA 2CLEA 1MDLA 4MAZA 4QNEA 3U2ZA 3TU9A 2XFRA 3HGSA 3WF3A 4BQ4A 1EPVA 3W6MA 4TO8A 4U2ZA 4GYPC 1MW1A 4GKTA 4RDVA 4GHRA 3ZJ7A 4QLJA 3OIXA 2PDQA 1F74A 3R0UA 1GVEA 2NT0A 3LCXA 2Y4SA 3K8KA 2PF8A 2GVLA 3R13A 1JYNA 4IUGA 3DKLA 3GAKA 1ICPA 2IPFA 3FJ6A 1BVWA 4GA8A 1H2JA 1E56A 2QCDB 4AWTA 5IHSA 5K4ZA 2YL9A 3EA3A 2QKFA 1YLVA 2J13A 3W7KA 1EDQA 5CJ5A 3QMSA 2R8WA 4IICA 4PUKA 1MW2A 2D73A 3T4CA 2XFWA 4QLKA 1DWHM 5CPMA 4MJ2A 3NQ7A 1SZFA 5D9OA 4C6BA 4PUNA 1EL3A 1YE4A 1RD6A 2VOMA 4HPJA 3GDRA 1R3RA 2OR2A 4HVXA 5ECUA 4XD4A 3GVVA 3WQPA 4EPBC 1Z9AA 3VOCA 4NASA 1W8SA 1PUDA 4CD4A 4LPCA 4A3YA 1EJVC 3BW3A 5A2AA 3EZ4A 4Z1YA 3MTWA 4DI9A 2QDGA 2CZEA 1N8FA 3HJZA 4LS2A 4WEVX 1JAKA 5D2TA 3PNZA 1GYLA 2W5FA 3FNDA 5BROA 1HJWA 4G1KA 1S5WA 2A7RA 1S5VA 4PB3A 2VZTA 4WDWA 4URIA 3WLSA 2VX4A 4J3TA 2CKRA 3E74A 5LIWX 1US0A 1Q13A 3BGJA 5K3VA 1K3UA 1XGDA 2WVVA 1PYMA 4R85A 4NILA 4H9YA 1E4MM 1X39A 2NXHA 4YNGA 1HVXA 1KR1A 5LA0A 4EXAA 4CNSA 2BZNA 4UTUA 5ABFB 1NH6A 2GQAA 4TVDA 5HPCA 4PR4A 3EX1A 3WKZA 1UOKA 1SJBA 2REQB 3B8WA 3KOFA 1PIIA 4KWUA 4XSLA 4MNJA 3TQKA 4N02A 5GNXA 4AXKA 4C6PA 2J7EA 1DJIA 3CIVA 3B8TA 2Z6IA 1JZ2A 2FQIA 3LV6A 2QDDA 2ZIDA 2ZRWA 3VOIA 4XG1A 3AISA 3LNPA 4O1CA 3Q58A 2GGEA 1UUOA 3N11A 2CLIA 1PIGA 4OECA 4MAVA 3D47A 4PMVA 2PTWA 1ZCCA 1Z44A 2V2CA 5TF0A 1XH0A 2GZXA 2PTYA 3TE9A 3W76A 1BYBA 3CHFA 1F6KA 4H8HA 3SGZA 1KNWA 3S2JA 3M6DA 4HBKA 3RUBL 2L5HA 3CO8A 3CUJA 1YDOA 4X22A 3O07A 1V08A 5JIWA 3HQOA 2RDWA 1NSJA 4XB3A 6ENLA 1WP6A 3RJYA 3SN1A 1WQ5A 3WDQA 1KBIA 2EJAA 4HYRA 5KZEA 3WLLA 3VABA 4P7NA 2WSYA 1IEXA 2PDCA 1VHCA 5AHNA 3IRDA 4E2OA 2QR6A 5DRIA 1UP3A 1VFUA 3QZEA 3ZT6A 1HN1A 2UY2A 1GVFA 1LCOA 3BGGA 2DFAA 2WZEA 1ZBWA 2GUUA 1ICSA 4C65A 3HN3A 1AK5A 3PZTA 5I0DA 1S3TC 3F4DA 2Y89A 1Q5MA 3QJAA 3WNPA 3LG3A 1JL8A 2FIQA 4MJZA 5A8QA 5DF0A 2WANA 3EWUA 3VIIA 3LMYA 4LGXA 5RUBA 5HAOA 3XISA 4C7GA 5DMNA 4LUTB 2V2DA 1GEQA 4R7OA 3G24A 4HNVA 3MU7A 4ZCWA 1AG1O 1F8MA 3BLOA 3V4BA 3M64A 4DBSA 2Z25A 3CMGA 3STPA 4LRSA 5FJJA 3CH9A 3QKEA 4NZJA 1E6SM 4JTAA 5I77A 1XLKA 4O12A 5C7HA 4E3TA 5CZKA 2F8QA 1W31A 4AIBA 1TUXA 3OBEA 4R9XA 1TCMA 2QPUA 5IDIA 1KFLA 1MXDA 4A8RA 3IJQA 4ZOEA 4RE4A 4AHOA 4P8WA 1CGYA 4I6VA 2QJNA 5CPSA 3LLDA 4NY2A 1BXBA 3URQA 4A22A 4B5VA 1NP2A 1CXIA 1GEHA 2ZWYA 4PCTA 3ZQ9A 2X1SA 2HWGA 4MZ8A 4NI3A 3S47A 3WH7A 4UTTA 1UASA 2C0AA 4BWLA 3M0XA 4BS0A 3QQ1A 4IP5A 2V3DA 3MS8A 3SR7A 2XFFA 4RE3A 4F2UA 4GY0A 2DUZA 4I9TA 1O7AA 4DUVA 8XIAA 1KCKA 1OFEA 5HA7A 1AW5A 1WDWA 2X41A 4JYEA 4OE7A 3V1PA 1LRTA 4F2TA 2XPKA 3ZJ8A 3A4AA 3CPUA 4CEXC 1XG3A 1E9ZB 2BOFX 2C1HA 4BHYA 2D2HA 3SRKA 3WJSA 1P43A 1CTNA 3KBNA 2E3ZA 2YXXA 4MSSA 2ZBTA 3W7MA 1W2VA 4E8GA 2YA2A 3TYAA 3ZT7A 9CGTA 3VNMA 1GTEA 1CECA 1BTMA 5K9DA 3PHAA 5JBFA 1SVDA 1Q66A 1NP0A 3BLKA 2PC4A 2WYSA 2WVTA 3RLUA 4REQB 5BWAA 1ODUA 1EEPA 1HKKA 4P8UA 4Z1BA 4XO7A 3L23A 5A6AA 4B92A 3C52A 4EP8C 4TX6A 5CGTA 1DEDA 5G5IA 3VD5A 3IRSA 3H55A 3SEPA 3SRFA 3ITGA 2GJPA 2PF0A 1BXCA 4GACA 2E9LA 4GYPA 3OEXA 4EOUA 1PCWA 3THDA 1GW9A 3THAA 3VZYA 3U48A 2ABAA 1JPDX 4US6A 5LYRA 3T2OA 4L9ZA 4LUYA 4HN8A 5F4WA 1JULA 4IP4A 3M5YA 4NHVA 4HSOA 2P3ZA 3TMQA 1V3LA 4P5UA 4GG9A 4MG4A 3UJ2A 1VLWA 3VNJA 3I6RA 3FXGA 3O6AA 2V69A 4K1WA 3AI0A 1RVGA 5A8OA 2WJEA 3S2CA 1O94A 4IJRA 2ZX7A 1EUAA 4HNCA 1RQHA 3Q65A 3PR2A 2AKMA 4Y7EA 1B90A 2V0TA 3TW7A 3BAWA 4H8VA 2VENA 3HV9A 5AC8A 5ABHA 4AZIA 3SJ3A 4EF8A 4JX5A 4QEHA 1FX6A 1QHPA 3VNLA 1ZJBA 1WDQA 5DY3A 4M7TA 1YDVA 3FJLA 4TIMA 4WX2A 2VEMA 1XIFA 3O0FA 4IH3A 4LVAA 4UMAA 2GOUA 1TPUA 3VM5A 1XP3A 3C2EA 3EEGA 3T2PA 1JI1A 4O0KA 4DXXA 1SMAA 4OTKA 3VDAA 1HNYA 3V5CA 3DFTA 2DPEA 2OEMA 5I06A 4S2CA 2ZX6A 1QBAA 3CWHA 3TQVA 4UNLA 5AYIA 3VIJA 1UD4A 3KOWA 3W81A 3R8HA 1EO5A 1XPGA 1I2RA 1UD8A 4L9YA 2OWWA 4N6FA 4HCLA 1B4EA 4J4KA 4ERIA 3UEQA 2ZX5A 2OYLA 2J6VA 1FQ0A 4I8DA 3E5PA 1OK6A 2GOKA 3RCYA 1LF1A 1UWAA 4O1FA 1CGUA 1QUMA 2NSOA 5I09A 5HPOA 2WHLA 1GQIA 2ZZ3A 4WY0F 2QUNA 4LYKA 5C55A 3KZSA 1A4MA 1J5SA 3ZJKA 1CEOA 3A23A 3AUJA 4H83A 4ECLA 1N8WA 1TV2A 5A5WA 1T6MA 2ZC8A 2AAAA 4JX4A 3CYVA 5FAGA 4K8EA 3G77A 2QJMA 2WMKA 5BMXA 3RX3A 3ECQA 4LAZA 1Y5VA 1BWKA 4XQ6A 2B7QA 5GNYA 1A5OC 2EPOA 4XZWA 3VKAA 4UTKA 2V30A 1CDGA 1EGZA 3LHZA 5AZ1A 4D8LA 1JDAA 3VCRA 1E6RA 4OBSA 2UBPC 4U3AA 4ATWA 1O5QA 1GKRA 4K8GA 4C1LA 2D23A 4Z1DA 2WZMA 4ZO7A 4AEFA 2Q02A 3G1AA 5FJUA 3BZGA 2HV5A 4RPPA 1XS2A 5BOEA 3N9RA 1S2AA 2X7WA 1WUFA 4DNMA 4GQBA 1K8YA 2CXEA 2W0UA 3JW7A 3S1UA 3KOXA 3W87A 1J5TA 1W3JA 3EXTA 1TUFA 2WC7A 1IEWA 4B4HA 5D2WA 2NX3A 1VQTA 2DORA 3F4WA 2B81A 4IHCA 1GVSA 5HINA 3GXIA 3WQVA 1SO3A 3L0NA 3U2EA 4HIBA 1JD7A 3GXNA 1LUCB 5IHRA 2OSYA 2Y85A 3NQEA 2CETA 2CLLA 2DSVA 1PDYA 3W1TA 4GI6A 1OFPA 3STGA 3TX9A 2WHKA 1IXOA 1XIHA 3C56A 1PZ1A 3DYOA 4QROA 1R85A 2DZTA 3UNTA 2PFHA 1BGAA 4L1WA 4GZEA 3SUUA 3W53A 4MKVA 3OZPA 4MFEA 3TIMA 4BR1A 3FEQA 1F6YA 1BG4A 3MSGA 4M8UA 3F5JA 1LWJA 1UD3A 3SCWA 3A6OA 1W1IE 1J0IA 4PGLA 3HTWA 2VC6A 4AX6A 1LG2A 2JALA 5C2GA 1TWDA 2TODA 2WJZA 5CGQA 4N9DA 3LPPA 3U5YA 1XLDA 4ERGA 2PRMA 2AL2B 3U6WA 3BCFA 4UXDA 1UC5A 3KHJA 2X40A 1EA9C 1A3HA 3RRAA 1VRDA 1POKA 1HJXA 3CUHA 3LHVA 5HNTA 4XKYA 5EYWA 2WZTA 2JEQA 2A3EA 3W0KA 5I78A 4O50A 1SU5A 3BAYA 5FCZA 2OU4A 3LGGA 3LM3A 4PFHA 4JQ3A 2HNHA 4IPIA 4GPNA 4U4MA 1QOXA 1DJWA 5IRPA 1AUSL 2DZUA 1F6PA 1BKHA 2INEA 3FHQA 5AHIA 2X0HA 1XD0A 3LTYA 2J47A 3LXCA 4D71A 3RPDA 3VKJA 4Z2LA 3WG6A 3Q2DA 4H04A 4A05A 5GJNA 3UW6A 3FVDA 1J18A 1XR2A 4CU6A 3VAVA 1TZ7A 3MDUA 1JIBA 3WQ8A 4F66A 2A85A 1R3QA 3BSMA 1NFGA 3NQAA 1WDSA 3G1FA 3P93A 4KWWA 2FB3A 4MTVA 1K8ZA 3GLCA 3GW0A 1KQZA 4PCNA 3QMTA 1PZ0A 3TN6A 3FX4A 3ZIZA 1VP5A 4K39A 1V3HA 5L6UA 5E70A 1Q63A 1QK2A 2NUXA 1E0TA 1NFBA 1Y5XA 4IPLA 4ZTXA 1UH3A 3QXBA 5AHMA 1OC7A 3IJLA 1XW8A 1XLFA 1ISWA 4TV5A 2FTYA 1CPUA 5KSWA 5F2GA 1MEHA 1MFUA 5AKQA 4O18A 3D0CA 1RLDA 4Q4OA 2DT1A 2J8FA 2PWDA 2GQ8A 1HJVA 3VGGA 4LBUA 4HNTA 4RUBA 3OIHA 3TYEA 3FVMA 2J8GA 4A6GA 4Q8QA 2BHZA 3P2VA 1JZ7A 3Q45A 1LRQA 2VT0A 1C93A 3BOFA 4UOQA 1J0JA 4NX0A 3PG9A 3A64A 1E4IA 3CJPA 2J77A 2ZC1A 3P0WA 3UJFA 2PDBA 1OGBA 1GOQA 2YW4A 4NZ4A 3N4AA 3R7MA 1RQBA 3O63A 4EPEC 4MY8A 4DPQA 4M1BA 1Q4WA 5LA1A 2F38A 3HMJG 1BRLB 2XSBA 3NAVA 1IT8A 3V0SA 2Y7GA 4HNNA 3DU0A 1NOFA 5IBXC 4YTQA 1L9WA 4XAZA 5T26A 1CLKA 3TN4A 2V5BA 4GJJA 3UZ5A 3EX6A 3N13A 4TX9A 4PSPA 1BSIA 4M56A 1ZGDA 1ZPTA 2F6KA 4DZHA 5CZTA 2A4AA 4QRNA 3GXTA 1OCQA 1ITCA 3KVKA 2E25A 4O54A 1A5SA 3M1ZA 3P14A 2YCEA 3L4VA 3HG3A 4HZMA 3WNOA 1HVQA 5AC5A 4IJBA 4DJFD 4IMCA 1DXFA 3BCJA 4ZQOA 4MY9A 4TVUA 5CGMA 1QNSA 3WJZA 1YDYA 4Q8UA 2YL5A 2Y6ZA 2BXVA 2GJRA 1T8QA 3S1GA 3TJLA 2ISSA 1QWGA 4DBWA 1FY6A 5LKYA 1E3XA 1XSKA 3H12A 4S3FA 2QULA 3LV5A 4NKCA 2J79A 4JS3A 1OX4B 5D02A 1IXQA 1PTGA 2F7FA 4XWUA 3QC0A 3M41A 1QFEA 2XH0A 1I1WA 3KBVA 2AL1A 1TFVA 3GXPA 1TV7A 5J8LA 3LHYA 3RK8A 3N17A 4Z0SA 2DJLA 1LL4A 3BAIA 3M0LA 3BW2A 1M6JA 4S3JA 3AICA 4NRSA 2ZUVA 3UETA 2NVAA 1ZUAX 4GVIA 1BQCA 3CAQA 4FAMA 3HGRA 4YHGA 1VCGA 3EWZA 2ASHA 4FR6A 4AHPA 4JTGA 4C90A 1TJ2A 1ZJAA 3I7QA 5REQB 1NWSA 1GOOA 3T0DA 2C8NA 1OM0A 3BC9A 3AXKA 2GK1A 3AOFA 3C2YA 2G37A 1Z42A 3WQ5A 4CNUA 3L67A 1YXYA 3IUIA 4X61A 1O4UA 4KFPA 4H7VA 5AOUA 3LTPA 4M1RA 3IJIA 3KUMA 1E1CB 2C0HA 5LA2A 4UQEA 1XIIA 4M0XA 2PAJA 3BGAA 4NL1A 1JYWA 3LENA 3OZMA 3LCLA 4S3AA 2BNJA 5AB3A 4DBEA 1BQGA 2R82A 4U28A 2DSZA 2C6QA 3MP3A 1V0MA 1YKWA 4FNUA 3RLVA 3H4WA 1TO3A 2R1PA 1JZ5A 2C1IA 3F5LA 5C5YA 2VI0A 1XC6A 2BFGA 3CBWA 3WH5A 4FNRA 4GQGA 1N82A 4QQUA 3P5ZA 1R8LA 3LA4A 1JG9A 4FB7A 4L64A 2IW0A 1GHSA 1E6ZA 3W71A 4O19A 3GBEA 4A35A 1VF8A 1JNEA 1E5NA 4JNZA 1UB3A 3HPFA 4OJYA 1O68A 3NSMA 3OHIA 4FOUA 3WF0A 1GOKA 3PPFA 3L5LA 1XGZA 1KM2A 2YCIX 3GXMA 5A69A 1DL3A 1TPVA 4Y9AA 3TSDA 5FF4A 2W79A 4Q6XA 2KZHA 3VCNA 3HPXA 3OO2A 4HA1A 3KM8A 4B2DD 1R2TA 5DBTA 3W70A 1H09A 2I5QA 2FTPA 1EF2A 2PDFA 1ISYA 2YZRA 3OQEA 2HJPA 4DUXA 5DFAA 2PDXA 4GNVA 2GYIA 1O1ZA 2CLHA 4HNOA 1JXJA 1QAPA 1XHGA 1M7OA 2Y63A 1G4SA 1B54A 3BG3A 1AFSA 3CS2A 5JMUA 1SZNA 4WKFA 3VTRA 4AHQA 1E0UA 4DZIA 4UFJA 4FNTA 1U5VA 3UCCA 3N9KA 3NXLA 4MB4A 1GYMA 5SWUA 2UWFA 4I90A 1OGSA 2G97A 1GZJA 4IGHA 3S8HA 4RE0A 1V79A 1NQKA 1YTEA 1MUMA 1XX1A 4AYGA 4GOAA 3L2LA 4Y6GA 4IPJA 3O7UA 1QHZA 1WYIA 3CGTA 4X2PA 3BCDA 3U2OA 2G41A 4CGTA 2V6AA 4ZSUA 4ZOBA 5C2XA 4LNCA 3WFZA 3NIYA 4IT1A 5DO8A 1MNZA 1KFWA 3ARYA 4MB3A 3IWPA 1FKWA 2O56A 4N42A 3GNRA 1RALA 2PZ0A 4U31A 3S5YA 4Y96A 2R6OA 3L5AA 3U9IA 4MHBA 2WJDA 1JDFA 4FXJA 1O66A 3MUXA 3WJWA 5BXPA 2PDWA 3WLJA 1D3CA 1UUQA 4B5XA 2ZUTA 1S46A 1L2QA 5A95A 5FEXA 1UHVA 1I45A 3DHPA 1S2TA 3IARA 1AL8A 1S3HA 4WDUA 4HU0A 1OCNA 1UPMB 3V0UA 1Z3NA 5EMJA 1OD0A 1DBTA 1PKLA 1VJIA 4Q4RA 1H7NA 4GFSA 2P5NA 1K8CA 1E9IA 2WQDA 3GG0A 1GVIA 3NEVA 5JIPA 4MB1A 4OZOA 2EQDA 5HXMA 2XTKA 2HEJA 4NZ1A 4P8XA 1VBJA 4J3WA 2ATSA 1IEQA 4CD5A 1H4PA 4JFVA 3UWEA 3M07A 5A6JA 3BOXA 3VKDA 2R94A 3GE7A 3B0XA 1FWWA 3GNPA 2QDHA 5A6BA 1JZ6A 4YPJA 1X1ZA 3UQNA 3M0MA 4DJED 1LBFA 4XO6A 2E8YA 2I56A 4DJDD 1QNPA 2QF7A 3BXWA 1W54A 3M16A 1FDJA 4ICNA 4G9PA 1M41A 3GTFA 1EC9A 2QCMA 2UV8G 3WCZA 3II1A 5TAOA 1DOSA 3IPWA 1KW1A 3AYSA 3BWWA 2WZIA 4IMAA 2QV4A 4HU4A 2OSWA 1O5XA 1KFKA 3OB8A 4UTWA 3W00A 3AO0A 4EPKA 1GVQA 4W93A 4XTIA 3CMJA 1DTUA 3W2LA 3FKRA 4YYCA 3BG5A 4PTXA 2JIEA 1XJBA 4L5ZA 2PDYA 4Q8WA 3KRBA 4C6CA 5J5DA 1ZS2A 1KLYA 2ZCGA 4BEQA 1DWJM 3FV9A 3T44A 1XIMA 3T07A 3DERA 1EHAA 3L66A 3R11A 2YBUA 5DMYA 4RR4A 5GNZA 3SUSA 3QEZA 4FLOA 3TSMA 3EBVA 5AFDA 4NIRA 4MNKA 5EPDA 2W27A 4RZBA 3QVQA 3GYCA 1AODA 4XBKA 4D6HA 2DUXA 2ZVIA 1ONRA 3VGEA 3NO1A 4PBFA 2V5DA 4MIMA 2HXTA 5FF0A 4HSNA 4N9CA 3UXKA 2QCGA 4AF0B 1EXPA 4OT7A 5A8MA 5L9FA 3LI0A 4DWDA 4HZ7A 3QKZA 4JTFA 1L6GA 2PGEA 2QJHA 3FFSA 1I6NA 4H9VA 2ZKMX 1GJPA 2EHHA 3T78A 4QS5A 3WQWA 1UZ4A 4DXKA 2PGWA 2ZZ6A 4IIBA 3ABZA 3QRHA 4M24A 3KXQA 2V9DA 1FH7A 4XZMX 2YB1A 2GJXA 2CERA 3FYYA 1I60A 5CPTA 3PANA 1I4NA 2TRSA 1XUZA 3L5MA 3ALFA 1JXKA 1R6WA 2H9AA 4B15A 1YPFA 3HURA 2AQVA 3MHGA 4DAIA 3QGVA 4D9PA 4WLCA 5DMMA 3U7BA 3S5NA 4GI4A 2A79A 3CZEA 3EWBX 4D1IA 2Z2UA 3QHNA 3PZNA 1E70M 3WD3A 5K7JA 3M46A 3WUFA 1Q2SA 4HGXA 2A21A 3VOGA 3V0TA 1J2WA 3PBUA 2CLKA 5D2XA 4PMNA 4ASTA 3M0ZA 3CT2A 3AHVA 4DF0A 1IIHA 3L12A 5HDRA 2IXUA 3VC6A 1JF6A 2YXGA 3SRDA 4QCFA 3N04A 3LOTA 3NYDA 1XIBA 1OABA 5I3IA 1OC5A 1T41A 3REQA 2CC0A 4GBDA 1F3TA 4XZLX 1Q6QA 1JDEA 4NQ1A 3WL0A 1M65A 2BASA 4D6DA 1Q6EA 5FF3A 3VI2A 3CAWA 1DIDA 4AZ7A 1E0WA 3K13A