5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
1CXKA 4LYQA 1JYXA 4LYRA 4QFUA 2AOSA 3PZIA 4W5ZA 3UG3A 1MVYA 1UUQA 2BFGA 4HOXA 1C8QA 3EDEA 1KXHA 1K9DA 4M81A 4TTUA 4E8DA 3UG4A 3IANA 3ZIZA 2V3EA 1E4NA 3F4VA 3ZJKA 3WDQA 5A2AA 1C7SA 1JAKA 4B15A 1MQRA 4PUDA 4FLRA 3FHAA 1EOKA 1UZ1A 5A6SA 2X0YA 1Q6CA 8A3HA 2VR5A 2ZX6A 4W88A 3UR8A 1GOOA 2DPEA 1Q6DA 5E9AA 2WLZA 3A4WA 2WMGA 3AXHA 3K4AA 1B31A 4U31A 1CGYA 1MW1A 2XM2A 1QNRA 4Z2IA 4AIEA 1D7FA 1XHGA 1CLXA 4DM1A 2VZUA 4JKLA 4ACZB 4UQDA 3EBVA 1I75A 1XSKA 4PMYA 1XYFA 2JALA 4B9YA 1LL7A 1EXPA 1ITCA 3ARUA 3BCDA 2VX4A 4CD8A 2VNCA 4CD7A 5LYRA 2V5CA 4PYSA 1WZMA 1RP8A 3AISA 1W1YA 1UD2A 4Z2GA 3W29A 4PN2A 5FKYA 1J10A 1QW8A 4HZ6A 2EPMX 1HT6A 4OKDA 1GQKA 2ZUVA 1R8LA 4JCMA 5A94A 1K9FA 3CMJA 3BGAA 4HZ7A 1UHVA 2F8QA 1UWSA 4QDMA 2W92A 1NM9A 2VZSA 5A8MA 4D6FA 2VRQA 2PBOA 2NSXA 1BQCA 5C70A 2WC7A 1WP6A 4H7VA 1EDQA 3VX1A 5CLTA 2E9LA 1GQJA 4GIAA 5M5DA 2W61A 1G0CA 3PZVA 4P8UA 1E6RA 3APGA 3WSUA 2GVYA 3PHAA 4URIA 4W7UA 4EKJA 1UQZA 3OA5A 2VRKA 4U33A 5D9OA 3FAWA 2QPUA 3WF3A 3VVGA 1R85A 5CQ1A 4PMDA 4DM2A 5EB8A 2YL5A 3CUFA 2XTKA 5E6ZA 3BAWA 2WVSA 4MTVA 3AHXA 3TTYA 2BS9A 2O9PA 4IUGA 1EA9C 1UOKA 5I3DA 3EDDA 4YPJA 3ARXA 1AQHA 1NARA 1Q6GA 4HA3A 5D9PA 3SCQA 2OWCA 2VOTA 2G4FA 3W26A 4KWUA 2O9RA 5DT7A 5BXSA 4UOZA 4J27A 4WLCA 4YHEA 1MFVA 4AIOA 1DWJM 2W5FA 2ZX7A 4QLJA 3M7SA 5A8PA 1WNOA 1XH1A 5BWFA 3QOMA 8CGTA 3ARVA 3N15A 2TAAA 3ZOAA 2C7FA 3GBEA 2VMFA 4PTXA 3N13A 5LA1A 1WAWA 1R7AA 2UY3A 7TAAA 7CGTA 4ATDA 1CXFA 2J4GA 3EDFA 5CLWA 2C0HA 3PZUA 3GTNA 3CHFA 3PZQA 3VIMA 3WNLA 2DIJA 4PCSA 4PMZA 2WMIA 2WZIA 1OM0A 3WH8A 3WUEA 1FA2A 2E3ZA 4DUWA 1I1XA 1LWHA 3CBWA 5M3WA 2WVUA 2OYLA 3SUWA 1WZAA 2XHYA 3AI0A 1HJUA 1AMYA 3MV01 4GXPA 1Z32X 1ODZA 1SFSA 1HKJA 4J7RA 5BROA 2OWWA 3CHDA 3OGRA 3W38A 4BS0A 4AD4A 2CBJA 3OG2A 1ZU8A 1GHRA 2ZUWA 3ARQA 1ESWA 1M7XA 1W2PA 4B3KA 1VF8A 1V08A 3LPGA 1ZL1A 1KXQA 4Y7EA 1OGGA 3T2QA 1VEOA 3WQ8A 1DWIM 4Z2JA 1UD3A 1J0IA 2A3BA 4CCDA 4JAWA 1E6XM 3RILA 2D2OA 2DDXA 3AZTA 5TD4A 1H49A 2NT1A 3WUFA 1YHTA 1GPFA 5I23A 5LA2A 2CHNA 4QAWA 1ZS2A 3RJYA 2CYGA 4PEEA 3QGVA 3K8LA 3OZPA 2ZIDA 5CGTA 2CKRA 1VFMA 1VFUA 3BLPX 1HIZA 4LX4A 4UZSA 5GPRA 1J11A 5BCAA 5CPSA 4WK9A 4QCEA 4WSKA 4QP0A 4CVUA 1NH6A 3N11A 3ALGA 1QPKA 4MB1A 4W7VA 2E9MA 2GDVA 2XWDA 3ARTA 4W5UA 4BQ4A 4W7WA 2DT2A 3LMYA 3VD5A 5A6BD 1JZ4A 1UKPA 1K9EA 1OBAA 1U30A 1V6XA 2VQTA 4P7LA 3CTTA 4OIFA 2Y24A 4B16A 1IV8A 1B30A 1PZ2A 6A3HA 1JZ3A 5JUVA 1WCGA 1GORA 3WY1A 2XSBA 2WMKA 2ZXQA 1V6WA 4UFMA 4AZCA 4ZE4A 3WKZA 1FFQA 5JBDA 1UKTA 2PI6A 2E40A 5ABGA 1VFFA 3ZQ9A 2DT3A 3CLWA 4DUXA 2WW5A 1GCYA 3WD0A 3O6AA 3N17A 1OT1A 3ARRA 4FF5A 2YA0A 1E43A 3TTOA 4HA4A 4AW7A 3LPOA 3FNDA 1PIGA 1MWOA 2IXVA 3WDPP 1KGUA 5FL0A 1ZJAA 3VDHA 2J8FA 4X0NA 3CZEA 1QI4A 4IPNB 3AS2A 4GI6A 1D3CA 3QR3A 3UR7A 4M82A 1HX0A 2CESA 1WPCA 4DWSA 4CD6A 4C7DA 4F9DA 2XM1A 1OB0A 1GQLA 4EAMA 4NI3A 4Z2LA 2EJ1A 2CERA 4M56A 2DH3A 2DSUA 1JZ6A 4RL3A 4JHOA 2FHBA 1HKIA 1EH9A 4UQBA 3CZGA 2WM0A 4B3LA 2MANA 5KEZA 3UEQA 1UD5A 1B9ZA 4CN6A 3DC0A 2ZWYA 1KWKA 1WZLA 3VOCA 1QI5A 4MAVA 1US3A 3DHPA 1W9UA 4PMNA 2XFYA 3NSNA 4JFUA 3DYOA 5A2BA 1GOIA 2CITA 1W9XA 3AHZA 3WF2A 1EDGA 4NSBA 1GOMA 3VO0A 3KEHA 1EQPA 1BYAA 1VJZA 4KH2A 1VEPA 1BSIA 2A3EA 4WKFA 3W53A 2YA1A 4OUEA 3WUBA 1HP4A 3BXWA 1H0IA 3FY1A 2Y8KA 4KGJA 5HPOA 3WQVA 1FHDA 1RD6A 4F79A 4LGXA 2C8NA 2BHZA 3CZJA 5A6KA 4U2ZA 2VCAA 2F61A 3T0AA 4P7OA 1ISVA 1PJ9A 2WMJA 5IDIA 4IPLA 4UQCA 1B3XA 2WBGA 4UOQA 4F66A 5JIWA 3OGVA 5ABFA 1PIFA 1OCQA 4D6IA 2CEQA 3MUIA 3HJEA 3VILA 4CGTA 3TP4A 1ISXA 1HVQA 5DEZA 1HL9A 1BYDA 3EYPA 2BV9A 2J7FA 3K46A 3ARZA 2EBNA 3VGBA 5A6JA 3AHTA 4CU6A 5A6BA 4JFVA 1TR1A 1KR0A 1FP9A 3WQ6A 3A6OA 1NWTA 1L8NA 4TVDA 3B9DA 1ODUA 3THDA 2J78A 4TVCA 1MXGA 4ACYA 2BHUA 5EBAA 3AIQA 3VDCA 4F9JA 1DWGM 3NSMA 4JFWA 3SEPA 1JD9A 4KGLA 3RIKA 4B9ZA 5IFPA 1QHZA 3AQUA 3UG5A 1EO5A 1J0JA 1GONA 4A3HA 2J7DA 3AJ7A 2GK1B 1HXJA 4H8UA 3VGEA 2ZXAA 4FLSA 3VIKA 2A3HA 3D3AA 1TA3A 1KBKA 1U33A 2WMFA 1UR9A 5D9MA 3K4DA 4PTMA 2WPGA 1C93A 4UOJA 2X05A 2VX6A 1CLVA 1MQPA 3WF0A 1BVZA 1E70M 1ISWA 1S46A 1EDTA 2WHJA 3AHVA 5D8WA 1C3FA 4UR9A 5CPQA 5F7UA 1HKKA 3QOKA 3TTSA 3M07A 1CGTA 1TUXA 4BF7A 3SUUA 2OWXA 4EK7A 3W81A 4JFTA 4YHGA 3MSGA 4HU0A 3T2OA 1ITXA 1GHSA 1XSIA 3WQ4A 1W1VA 1W91A 2PWGA 4RE2A 3SURA 2WSKA 3O9NA 5DF0A 2RGMA 4D6CA 1G5AA 1UWTA 2DSZA 1CGUA 1JXKA 2ZE0A 4MNKA 1UR2A 1X1NA 4IM4A 4E8CA 4XV0A 3SCWA 1CGVA 3U5YA 1TG7A 1W3KA 3GXMA 1QI0A 2CBVA 4U5KA 2YA2A 2D1ZA 4DUVA 5A3HA 5GNXA 2CXGA 5BRQA 3GNPA 4KRTA 1ZBKA 1BG9A 2OYKA 3WD4A 3D5HA 1NOWA 4TX6A 1G94A 3MU7A 4UQEA 2G3JA 5JBEA 5I77A 1YQ2A 1EO7A 4AC1X 1OINA 3QHOA 4MNJA 2PWDA 4D6DA 2ZX8A 3AMDA 4AD5A 2D20A 4E4PA 5A6AA 1XC6A 3HN3A 3KL0A 3BAXA 4TVUA 4GZEA 3TTQA 1TE1A 1XCXA 1V6VA 2VTFA 4W8LA 5M17A 3BAKA 2WC3A 1C7TA 1CXHA 1WKYA 3BAIA 5FIPA 2FH8A 3WD1A 3G6LA 1UD4A 3WN6A 3CZ8A 2FHFA 1R86A 3OGSA 1BLIA 3SCRA 4HOZA 2OSXA 2CPUA 1J9YA 2J25A 3AIEA 4MNMA 5I6SA 2DEPA 3VGGA 5FOOA 1LF1A 1ZBCA 1HJWA 2XGIA 2BHYA 3RO8A 1E4MM 1UQYA 1K6AA 1WDPA 2V5DA 2VVSA 1W9DM 3E1F1 4L4OA 2J77A 2UY2A 3GNRA 1E6NA 4XX6A 2DT0A 4OBRA 1QNSA 3ECQA 1M04A 4ZFMA 2ESCA 1W9PA 3VGHA 2QMJA 5A69A 1EHAA 2VJXA 2WC4A 1J12A 2PB1A 1H4PA 4AZBA 2VZOA 1H11A 2WHMA 3BCFA 4AZHA 2WWCA 3AIBA 2CETA 1QNQA 2E8YA 2XIBA 1E9LA 2NT0A 2XVNA 1V02E 4M80A 2J7GA 1OT2A 2WSPA 2OYMA 1AQ0A 2XYLA 1W32A 1E72M 4KMQA 1PX8A 1DWHM 2XVPA 1C92A 4HMDA 4TUFA 3VD7A 1JG9A 1ISZA 4AD1A 2DT1A 4CD5A 3UCQA 4GPNA 1VRXA 1UA7A 3CPUA 4UTFA 2HISA 2WCAA 2A3CA 1GOQA 4V2XA 2RGLA 2A3AA 5A2CA 3U7VA 2WVTA 2WCSA 2PF0A 4HOWA 5CXPA 1D2KA 2ZUMA 3GZAA 3L2LA 1BPLB 3U7BA 2DGAA 3POCA 2Z1SA 1H41A 2PBGA 3FXYA 2YKKA 3W82A 1XH2A 3TA9A 3ZSSA 1NOFA 5FD0A 3SCTA 3ZJ6A 1HF6A 2FHCA 4JHZA 3BSHA 1U2YA 4W84A 1VJSA 3VUPA 4AY1A 1MW2A 1ISYA 2EPLX 3WENA 2GK1A 1QHPA 4QLKA 4P8VA 3HU7A 3L4UA 1JDDA 5DFAA 5E0FA 3BLKA 1M53A 3PZOA 3NYDA 3G6MA 3L4ZA 5IFTA 4J3WA 5E6YA 5EMYA 4CD4A 3AIWA 4ACZA 1UH4A 2XVLA 4JL1A 2G41A 2ZUTA 1CXIA 1V0KA 3RDKA 3W6MA 4R5EA 4D6HA 3W4RA 1E1EA 2G3IA 2GUYA 2WBKA 2WKGA 3ZO9A 5AYIA 4D72A 1IZJA 1BG4A 2BY0A 1V6UA 2YJQA 2AMGA 1HKMA 3WF4A 1EIBA 4PCTA 2XVKA 4OOZA 3WUGA 1E5JA 3VIHA 1OSEA 2BVDA 2YDSA 3WDRA 1C8YA 4UFJA 3WDIA 3FW6A 3IJ7A 1QI3A 1LG2A 4OJYA 4J3SA 2ZXDA 2J47A 2JE8A 2WVVB 3N12A 2WAGA 1B0IA 1NOUA 1WZKA 2W66A 2YIHA 1UR0A 1XRVA 2FGZA 4TXEA 4HPHA 3AIVA 3N18A 1H0GA 4V28A 5GQBA 3WH9A 3AFBA 3UERA 3W24A 4CCCA 2VC9A 2XUCA 3IJ9A 1BFNA 3GH7A 3T09A 3DYMA 3WD2A 1MYRA 2VZTA 2JF7A 4AZIA 1G01A 1E5NA 1A47A 3MO4A 4LXFA 3VIGA 1HL8A 4JKMA 3WBEA 1Q4NX 1G1YA 4W86A 5BXTA 1Q6EA 2FH6A 2YL6A 4LYPA 3WNKA 1HJVA 3SIMA 3GYCA 2VZVA 3WNOA 1DP0A 3BAYA 2FGLA 3IAPA 4EANA 2IXUA 1UWIA 1OWQA 2J7HA 4A3YA 1I1WA 5AC4A 1BAGA 3SUTA 4TX8A 3NJ3A 1B3WA 1CYGA 1DEDA 2X1IA 2QHAA 1BF2A 5D4YA 2GJXA 3MS8A 1GUVA 2J7BA 3W37A 2ZUSA 1JF5A 3GDBA 1MFUA 2XVGA 4UQAA 4ZXLA 2JEQA 2J7CA 3SCUA 1JYVA 1NQ6A 1F4HA 1NWSA 4PMVA 3WIJA 2W63A 4KRUA 3UETA 4ATLA 4HA1A 1GJWA 2O92A 2PC8A 5FCZA 1H09A 2YDQA 5A95A 2VT0A 1ZJBA 2WHLA 5A1AA 3T0DA 4PTVA 4JCLA 4CCEA 1O7AA 3BMWA 3WEMA 3A4AA 1K9TA 3OLEA 1OIMA 2ZX9A 4U3AA 4CUCA 5IHRA 4BQ3A 3VIJA 2J7EA 1PX4A 1MQQA 4NRRA 1JDAA 4DWSB 1HJSA 1TVNA 3THCA 1JYWA 1TA3B 2CIPA 1VFOA 3WMBA 3I3EA 5GNYA 5DT5A 2WK2A 1WB0A 3CHCA 2QLYA 3CIVA 3ARSA 5JBFA 5D8ZA 1JI2A 2WHKA 1J0ZA 1RP9A 3WL0A 4X9YA 3B8SA 4NF7A 2UY5A 4D6GA 1QOXA 4JZ5A 1UKSA 3CMGA 4WKAA 2F2HA 2VX5A 1J18A 5HNNA 2YOCA 4M8UA 4AZ5A 6TAAA 2FDMA 5ABEA 1OD0A 2VI0A 1E0XA 3NDYA 3OLGA 3A3HA 4D71A 1JYNA 2WKLA 2VO5A 1UWQA 4MADA 4P7NA 3SCVA 3ZT7A 1WDRA 3AZSA 3ARPA 2CHOA 3WMCA 2QV4A 2JFEX 1GOWA 3SUVA 3L4VA 4H04A 5HDRA 3AMGA 2G3MA 1H3GA 2HVMA 1GOKA 2J79A 4AD3A 5I79A 1R87A 1V0LA 3WDJA 3NDZA 4BCEA 4BQ2A 1BYBA 3ZT5A 4UFHA 1VIWA 3GM8A 1MW0A 4D1JA 1FOBA 5BXPA 1WDQA 3VD3A 5DO8A 3VM7A 5EFDA 3DHUA 2VR4A 2GJPA 2WCGA 3AICA 3W27A 2YBTA 1JI1A 4ML4A 1GJUA 4ZE5A 2D3NA 1BGGA 1HVXA 3UESA 1OD8A 1E6PA 5C8BB 3WD3A 3OZOA 1J0YA 2ZOXA 3MV11 2E9BA 2BXZA 1LQ0A 1XYZA 4JIEA 4HU8A 3SCOA 2WYSA 7A3HA 1BVNP 2BVYA 3KL3A 2W4XA 4H8HA 9CGTA 2YLLA 2J75A 2V3FA 4LQ1A 1J0KA 4C7FA 4PBGA 2Y4SA 4FLOA 1JFXA 3ARWA 1UKQA 1E73M 2CBUA 2QF8A 2WMHA 1E6ZA 4P8WA 1Q6FA 1JNDA 3AMKA 3MSDA 1SMDA 1CZ1A 1OGSA 4U5IA 1B3YA 2J62A 2Y2WA 3PTMA 3T2PA 5ECUA 4BA0A 1GQIA 4FK9A 4AXNA 2ZXBA 1CEOA 2W91A 2XGBA 1CGWA 1LWJA 5I0DA 1DWFM 1XD0A 5ABHA 2DQXA 2XPKA 4RE3A 1V3KA 2XWEA 4M24A 4BZYA 4PMOA 3GNOA 1J01A 2X09A 3K1DA 2Y5EA 4AISA 1KGWA 3HMCA 2Q8XA 3OIHA 5M03A 1US2A 4PMQA 3S6TA 3CUGA 3SCNA 2X0HA 2OSYA 3PTKA 5DMYA 5HOSA 3WF1A 1KFWA 3RJXA 1WO2A 3N9KA 1QW9A 1E0WA 3AHYA 1JIBA 3BH4A 3QHMA 1JD7A 3WNPA 1QNPA 4MB4A 3RM9A 3CUIA 2VQUA 4HMEA 2X8RA 4S3KA 1UH3A 3U5UA 1PAMA 3BAJA 4W93A 3AXXA 1JZ5A 2WXDM 1JGIA 5E0CA 1DTUA 2PWFA 3VD9A 3T0BA 3QHNA 4M1RA 5IXEA 4N42A 3EDKA 3BC9A 3B9EA 3KWXA 1M01A 4PSPA 1LL6A 4AEEA 4TOQA 4MPKA 4RE4A 4Q7NA 2JIWA 3MUAA 3ZR6A 1HJXA 1P6WA 4NZCA 3WMSA 1V0MA 3VX0A 1UR8A 4CVWA 4OBSA 3PZNA 4UNIA 2GSJA 3WNNA 1CXEA 1UR1A 1E6QM 5CPTA 4AYSA 5A8NA 2NW0A 1HN1A 2ZWZA 4HMCA 5CJ5A 1XH0A 1XD1A 4GZJA 1VB9A 4EE9A 4AZ6A 5C71A 5I24A 1FH8A 3F5KA 1DWAM 1JF6A 1FH9A 3VKKA 3MANA 1PX3A 3POHA 1WDSA 2WB5A 3MMWA 1W1PA 1E6SM 4AZGA 3DECA 4XB3A 3IK2A 3L4YA 2UY4A 3CZLA 2V38A 1KBBA 4H8VA 4LPCA 1VEMA 2BVTA 1J0HA 1TMQA 1V3IA 4QCFA 2EPNA 1QHOA 2W67A 3VD4A 3WNMA 1XV8A 3AROA 5I78A 3WH5A 2EXOA 3IJ8A 3N04A 3MUZ1 2ZICA 4UQ9A 4Z2HA 2QPSA 5HPCA 1CTNA 1PZ3A 4JKKA 4W8AA 3RM8A 2WMIB 2VRJA 5IHSA 2DSVA 1AQMA 3M6DA 1ZBVA 5FL1A 4YN5A 2D0GA 1QNOA 4XUYA 1N82A 1FH7A 5AYBA 2VX7A 1KQZA 3VTRA 4S3JA 3WQ5A 3RMEA 3WFLA 3KZSA 1DHKA 2J74A 3L4WA 3ZSTA 3VDBA 3L4XA 1CWYA 1JZ2A 4J3XA 2D23A 3GH4A 1UWRA 3F5JA 4A4AA 4F8XA 6CGTA 1HJQA 4J3VA 3SUSA 1MXDA 5BXRA 3LPPA 4WF7A 3PBGA 4TTGA 3NCOA 2G3NA 4HPGA 5AY7A 1HNYA 1TZ7A 1W3LA 3NSXA 4JFSA 3J7HA 1KGXA 1E3XA 3AXIA 1ECEA 3JUGA 4Q22A 3A47A 5A8OA 1BHGA 4CKQA 2WNWA 5CG0A 4P7QA 1LG1A 4E2OA 3FAXA 3CUHA 4ZENA 2DH2A 1B1YA 1R7OA 4MAZA 1SYTA 1RPKA 2CBIA 3I3DA 4W87A 3ALFA 3AIRA 4CU7A 3WL1A 4DWSD 1IZKA 1GVIA 3AYSA 3AOFA 2D0FA 3VDAA 4MDOA 1CBGA 5KZ6A 1V3MA 4CU8A 3AMLA 3EMQA 1E40A 4UFKA 1KWGA 2XFRA 4PUEA 3WQWA 5E70A 1JDCA 3LPFA 3RCNA 3MMDA 3O2LA 3EMZA 2W62A 2JIEA 3PZGA 1H5VA 1WE5A 1E1FA 1CIUA 3K8KA 2GJRA 1JZ8A 3VIPA 3MKKA 3VMOA 5GNZA 4ATWA 3VINA 2DIEA 1VAHA 2V3DA 1W2VA 3WDHA 4UFLA 1NP2A 5JIPA 4AZCB 4JL2A 2CNCA 1F4AA 2O9OA 2BY2A 3I3BA 1KR1A 1VBRA 3GBDA 3ZT6A 4U2YA 4NRSA 3BSGA 4PRWA 3RPMA 1BTCA 2UWFA 2YL8A 1C90A 2WWDA 1JFHA 3T08A 1V0NA 2BY1A 4K68A 2VURA 1XCWA 4PTWA 1Y7VA 4WJXA 4UCFA 3TOPA 1W9VA 2YLAA 1TVPA 4W89A 1UH2A 4GO8A 2D0HA 1W3HA 2E8ZA 4H2CA 3PZ9A 3CZKA 3VGFA 3EDJA 2DSWA 3PN8A 2EPOA 1PPIA 4PSRA 1TFVA 4CN1A 1OIFA 1UD8A 2XFFA 5HXMA 4CN4A 2X2YA 4D6JA 1E15A 3S2CA 3GXFA 1CPUA 4HP5A 1X6LA 1JNEA 2O9TA 3AIUA 1UZ4A 2WZHA 1KB3A 1HP5A 5CZKA 4BQ5A 1V3HA 4OZOA 1SMAA 5I2UA 4UZUA 3WEZA 1E56A 5EFFA 3L2MA 1QI2A 1ZBWA 3CGTA 3IAQA 3ARYA 2EO7A 4HZ8A 2PWEA 5AC5A 1VBUA 4GI9A 2Z1KA 3KE0A 3VMNA 3ZR5A 3W25A 4AEFA 2XIIA 4OOUA 4D1IA 3MMUA 2GDUA 5CSUA 1TCMA 1KQYA 4FLQA 2GFTA 3WBAA 1E71M 1V3JA 1PBGA 3K8MA 2PWHA 4X0VA 3TONA 3ZJ7A 1JZ7A 2XG9A 3W0KA 1QVBA 4QLLA 3AMCA 4MNLA 1GVYA 3VIIA 3WFZA 2CCRA 4AD2A 2WVVA 1OGBA 4J3UA 4WSJA 1CXLA 1VENA 3AS3A 1C91A 1NWRA 1W3JA 3U57A 4P8XA 3CH9A 4PMXA 3WEOA 4UFIA 4AZ7A 2VCBA 2YL9A 4J3TA 1EHNA 3VNYA 3A4XA 4N0RA 3B9AA 3KL5A 1B2YA 3VMPA 1JXJA 3PTQA 1UKOA 2D3LA 1QBAA 2G8ZA 2DSKA 3WH7A 3PZTA 3OLIA 2WZEA 3RM4A 2BNJA 1L0PA 1X6NA 5D9NA 5LA0A 4PMUA 3W6LA 1SR0A 1E3ZA 1KXTA 1W9BM 4MB5A 1C8XA 4IISA 2JF6A 3II1A 3VNZA 5HBFA 1AVAA 1KCLA 3CUJA 1LJYA 4ZEPA 1PEZA 4GO9A 1B3ZA 2EEXA 4AD0A 2OSWA 5A8QA 4L4PA 1E0VA 4Z2KA 1GNXA 2BXYA 1FFRA 1LLOA 4FMVA 4WKHA 1JAEA 3GXIA 3WELA 3CO4A 1EGZA 1V3LA 4M29A 2B31A 2EPKX 2J8GA 2XSAA 3SCPA 4W85A 2V3GA 2AAAA 2YDRA 1CNVA 4MJ4A 3AS1A 2WANA 3PZMA 1UR4A 1UWUA 1RH9A 2D24A 4XZWA 1CDGA 1M03A 4PMRA 5BYWA 4ZXOA 2WLYA 2E0PA 1V02A 4MJ2A 5A6MA 5CSYA 1UA3A 3VM5A 1UD6A 4AWEA 4AIUA 2VCCA 5A6LA 5E09A 2BY3A 4W8BA 4HTYA 1E4IA 1V6YA 2ZUUA 1ZB5A 3ZJ8A 1H1NA 1O6IA 3AYRA 2Y8VA 4MDPA 4C7GA 3EMCA 3FHQA 3F5LA 4H41A 4MB3A 2IUZA 1NWUA 1NP0A 1CENA 2ZX5A 1QBBA 1BGAA 2ZUNA 5BRPA 3AS0A 1UYQA 3WH6A 3GXDA 3OLDA 1EQCA 1EOMA 1KXVA 4J28A 2XJ7A 1W1TA 2VL4A 3AZRA 3GH5A 3W28A 3ZMRA 1CGXA 1CECA 2GJXB 2VUYA 3VIOA 4WIWA 2CKSA 3OB8A 3NUKA 4GI8A 1E4LA 3FN9A 4GZIA 3VU2A 3OBAA 1XSJA 4D6EA 5ABFB 1FHLA 1MW3A 1E55A 3VGDA 3M46A 4U3CA 1UG6A 4GQQA 5CGMA 4XZBA 2JEPA 3NIYA 3BMVA 1KCKA 2EQDA 4DWSC 3SCSA 1B90A 1V03A 2E4TA 2VVNA 3DYPA 1B3VA 1LL4A 1GZJA 3VPLA 1XGZA 5I5RA 3MUY1 1H2JA 2OLHA 4P7RA 3L4TA 4V27A 1G9HA 3ZM8A 2YBUA 1GW1A 4R27A 4AMCA 4GINA 1BYCA 3N1AA 2D22A 2QMKA 4GQRA 1A3HA 1JL8A 1IT0A 3CHEA 3VIFA 1FP8A 4GKLA
chains in the Genus database with same CATH superfamily
1CXKA 4LYRA 1E1CB 3F4CA 3VYLA 4D2JA 2WPBA 3TW7A 2GJLA 1UUQA 4O14A 2CW6A 3EDEA 4O4VA 4A29A 2Z1WA 4E8DA 1K03A 1DYSA 3IANA 4DHGA 3V3WA 3MP3A 2V3EA 1E4NA 1TPB1 4YYCA 4B15A 4PUDA 2AQVA 3JZUA 3FHAA 5AN7A 1HFBA 3BJFA 2X0YA 1ADSA 2F9RA 3ITYA 1Q6CA 8A3HA 3UNDA 1ME9A 3E0FA 2QGYA 4W88A 4PRTA 1I2QA 4K6AA 5E9AA 1XLBA 3UPMA 4U31A 5JQ9A 2XM2A 2VGFA 3HTWA 1XIDA 1NVMA 3WBWA 4FNRA 1CLXA 3DHDA 2GUBA 1EPVA 3IIPA 4PMYA 1AH0A 1XYFA 3DIPA 4MZ8A 3UJ2A 1TWIA 4RJEA 1FVPA 1R5YA 3CL7A 2VHLA 2IQTA 3MZ2A 2BBFA 4PYSA 5XIMA 1ELSA 1THFD 3GUWA 2OELA 3S9ZA 4JQ1A 3TX9A 1EZWA 3EX1A 4PN2A 5FKYA 3K4WA 4HZ6A 1YYAA 1HT6A 1QK0A 3O6CA 2PLJA 3QYSA 4MKNA 4JCMA 5DBUA 1UHVA 2F8QA 3K2GA 1SPQA 3PBMA 1GYLA 1NM9A 2E28A 2VZSA 1WDWA 4JYEA 3JW7A 3W07A 2VRQA 3ABZA 3HM7A 1XGEA 2ZTJA 3SY1A 5C70A 4Q4SA 1EB3A 4H7VA 1M1BA 1EDQA 3NM1A 4GIAA 5M5DA 1W8GA 1LT7A 3I10A 4JYDA 1EC9A 3WSUA 1T41A 3E2VA 3TA6A 3OBKA 3GKFA 3PHAA 4URIA 4EKJA 3OA5A 3LB0A 3UCDA 4G2DA 3EA2A 2VRKA 3FAWA 2QPUA 3IUDA 2Y61A 5CQ1A 2PGRA 3GNNA 3AHXA 3TTYA 1EA9C 5I3DA 3ARXA 1VHNA 5D09A 4MJMA 4O50A 4QS5A 3M0XA 4RCXA 1SU5A 2PRMA 4KWUA 2FIQA 5BOOA 4UOZA 5LIUX 1DWJM 3U4AA 1WXZA 3VUSA 4MLJA 1RAKA 4I9JA 3NQ2A 1WNOA 1XLDA 3QOMA 3N15A 3STGA 2PA6A 1AZ1A 3GBEA 3EWXA 3LM7A 4MWAB 1XDJA 4ATDA 2QULA 4L6HA 1OX6A 4OWGA 3GTNA 3C86A 4DBWA 3D3FA 3CHFA 3T6CA 1SJAA 1BVWA 1LLWA 4E3TA 3IVUA 3V5CA 4PMZA 4KCUA 2WMIA 4C6QA 5CJMA 3EA1A 1LWHA 1QT1A 3D47A 5M3WA 1XBXA 2WVUA 4IHCA 3W76A 4G8TA 3CAWA 1T6MA 4YXGA 2NWRA 3B03A 1A5BA 4FO4A 4D8ZA 3MV01 1Z32X 1XLLA 4J7RA 5AYZA 2OWWA 3HG2A 1W3TA 3OGRA 3SGZA 1UC4A 3OG2A 2ZUWA 3FEMA 3G1HA 1VF8A 3LPGA 4QJ5B 1TO3A 3G1DA 4DXVA 5F2IA 4Z2JA 5HWMA 2A3BA 4CCDA 4JAWA 3QLDA 2D2OA 1VCVA 1G6CA 2DDXA 1IEIA 1H49A 1RCXB 5T26A 3VKCA 2DW6A 2DFAA 5C7HA 5I3GA 1L6YA 4BJHA 3GR7A 5LA2A 3M6YA 3H22A 4DJFA 1ZS2A 4PEEA 3K8LA 2ZIDA 3OZPA 4FHAA 1YE4A 4AY7A 1L8PA 3W01A 1VFMA 1HIZA 2XFWA 2A7NA 4ZOCA 5BCAA 1J11A 3EX4A 5CPSA 4GKTA 5AHEA 1NH6A 1REQA 3H2NA 2XWDA 4BQ4A 3GFYA 3LCFA 4WOQA 2DT2A 4H2HA 3EOEA 3B3DA 3W6YA 1MEWA 2OZ3A 1OBAA 4OIFA 3BV4A 2Y24A 4I6VA 5CCZA 4XIAA 2NX1A 4RV8A 4B16A 1B30A 4ZQRA 3NO5A 4WSHA 3P60A 5JUVA 3VCRA 1OJXA 5EMLA 4O1EA 3T55A 1QO2A 3L7RA 3W7KA 4ZE4A 2R1MA 2BOFX 3V18A 1RJPA 5ABGA 3ZQ9A 4ENLA 2DT3A 5AOUA 2YFNA 2HNHA 4LW7A 3G8EA 5HA7A 1PXGA 2X1SA 3HPSA 2QDEA 3NA8A 3N17A 3BG3A 5LIXX 1A5CA 1CI1A 3NPWA 3RF9A 1PIGA 1H7WA 2CZDA 5FL0A 3VDHA 1ZRQA 4NAFA 3AS2A 1UW9A 2QXWA 5HR7A 4HGXA 3UR7A 1S1PA 4M82A 1HX0A 3W02A 4CD6A 1GOXA 1V93A 3I6TA 2VM8A 3EX3A 4R9OA 2IMRA 2DH3A 1JZ6A 2DORA 1HKIA 1TZ9A 1FXPA 1DHPA 2WM0A 3QKEA 5TAOA 2MANA 3GIYA 1LTDA 3N6JA 2ZWYA 1JRCA 1QI5A 4MAVA 4PMNA 4FAMA 2I17A 2XFYA 3NSNA 2HQAA 4JFUA 1S5VA 4QGCA 2BVWA 3IS4A 3P5ZA 3WF2A 4MGGA 1EDGA 4GD0A 4JXCA 3KEHA 4EVZA 1YPFA 1VJZA 4WKFA 3LV6A 1BSIA 4KH2A 3W53A 4OUEA 3WUBA 5CSRA 2V5LA 2V2HA 4MY8A 5KZEA 1XISA 1RD6A 3I65A 3IEBA 3RG6A 4LGXA 2C8NA 2BHZA 5DMMA 1UZDA 3KBVA 2ZA3A 3B40A 5A6KA 3PG9A 1YLVA 3T0AA 4P7OA 1ISVA 2GVGA 1RVKA 1J79A 4IPLA 3A21A 1QOQA 5I07A 3JRKA 5G4HC 2DW7A 2DUZA 4OHQA 1LOSA 3PWAA 5TF0A 3LXBA 4FOJA 3MUIA 4L1GA 2FZDA 1Q63A 3RR4A 4XZHA 1HL9A 3GU9A 3EYPA 3K46A 3PUOA 1R3WA 3ARZA 3M16A 3O0FA 3VGBA 1TSIA 2VDIA 3AHTA 5A6BA 2OJPA 3GR4A 1KR0A 1GTHA 2AAMA 3A6OA 3O07A 1L8NA 1O60A 1ODUA 4UNLA 2PTZA 4JQ2A 1FQ0A 1MXGA 1YDNA 1QO5A 1SW3A 3UG8A 5KTLA 4GJIA 3R58A 3DFPA 1YXCA 4XAYA 4BR1A 1OVDA 1QHZA 1ZCCA 3QQ0A 1DJHA 2MUCA 4A3HA 3N4EA 2J7DA 2QPXA 4MWAD 1H61A 1HXJA 3ICJA 4R7JA 4H8UA 2OVLA 1XL9A 1UR9A 2WZTA 4NJHA 4BI6A 1MNSA 2X05A 2VX6A 1VLIA 3SSZA 3GHRA 1E70M 2POTA 2B7PA 3AHVA 3P0XA 2YDAA 3C2VA 4N6EA 5D30A 2R14A 1GKRA 4UR9A 4JNMA 2GQ3A 2I16A 2R1LA 2BZNA 2FZNA 3OU8A 3SIZA 1TUXA 4IMFA 3TN5A 1DIDA 1W5MA 1MO0A 1ITXA 1GWJA 1DE5A 2WJDA 1V5XA 1Q2RA 4S3DA 3CT7A 4YMZA 1IR1A 5DF0A 2RGMA 2ZZ5A 2DSZA 3TSMA 1ZGDA 1CGUA 2QIIA 4Q8PA 5A6TC 3EKLA 4B5TA 4IM4A 3NGFA 3FV9A 4ZTXA 4KIEA 1V8EA 1N8WA 2VELA 2ZRVA 4JIRA 4O8RA 5A3HA 1W0MA 3N34A 4C65A 3C2RA 3O06A 4KRTA 1BG9A 3QMTA 2OGJA 4QEEA 4TX6A 3TR2A 2CZFA 2G3JA 4GVHA 4DJFC 2PWUA 4MNJA 1KFJA 3AYTA 5BOEA 1R2RA 4AD5A 4E4PA 4ROQA 3H55A 2C6QA 2QT3A 3BAXA 4GZEA 1AH3A 1XCXA 2A4AA 2VEFA 4W8LA 3BAKA 1C7TA 1WKYA 4UTTA 3CZ8A 1PVNA 1R86A 5SWUA 4GMEA 4C6OA 1EWDA 1J9YA 3PNUA 3AIEA 4GABA 4MNMA 1Z9AA 2PAJA 4O8AA 1EJSC 1ZALA 2V5DA 9XIMA 2VVSA 2G97A 2UY2A 1E6NA 4HT3A 3ECQA 1M04A 2ESCA 1W9PA 3ITVA 3VGHA 3KCLA 2VJXA 1LWIA 3G1RA 4BEUA 1J12A 2PB1A 4A8NA 3N4AA 2I7GA 2WHMA 5FJOA 1HTIA 4NX5A 2QCEA 1A50A 3AIBA 1WOAA 2CETA 3H23A 3FJNA 4L61A 1AQ0A 1ZAHA 3OO2A 1IF2A 4ZOEA 4F48A 2E25A 3SRDA 5ECVA 1WXYA 2PU0A 1Q8AA 2ZZ2A 4GPNA 4L1XA 4DLMA 3LUTA 5LXXA 2YB1A 2A3CA 1GOQA 3DUGA 3GXTA 3H2CA 3I68A 2A3AA 1OCNA 2IKIA 3PTDA 3W72A 2WVTA 1JCTA 2PFHA 3QV8A 5CXPA 1D2KA 4JPGA 3S83A 1BRLB 2WNZA 3CLMA 1BPLB 3U7BA 1XDMA 2DGAA 4JX4A 2HRWA 4LAUA 2ACQA 3E5PA 1XH2A 5LXEA 3ZSSA 4Q4RA 1NOFA 1IEXA 3SCTA 4KCWA 3H8AA 4ML9A 3TCSA 1R3YA 4JTIA 4KS0A 2B4GA 3VUPA 3UZYA 3RU8X 2QCDB 2QUMA 4J2MA 4G1KA 3C8NA 3DI1A 1QHPA 4QLKA 3HU7A 2A21A 2ACUA 2QUTA 4XD3A 2IPWA 1A5KC 1TWWA 1DXFA 1TMHA 2DY3A 3W75A 1XLHA 5IFTA 3CMFA 5EMYA 4CD4A 1F6KA 3SRFA 4U4MA 2ZUTA 1Y5VA 3FXGA 1OG6A 4O28A 3P67A 4D6HA 3W4RA 2G3IA 3W85A 2C71A 4EWJA 1KD0A 2V30A 3ZO9A 4L56A 4D72A 1IZJA 2AMGA 3HJZA 3L9CA 3NQ8A 4PCTA 3NL6A 4R53A 3HG5A 4NT0A 3BE7A 3KLLA 2A1YA 1X98A 3VIHA 1XCFA 2BVDA 3V7PA 1FWRA 4QQ3A 4UFJA 3U6WA 3FW6A 3R12A 4HB7A 3IJ7A 4AMAA 4K8HA 4E4FA 4XTDA 3S1XA 4DO6A 4UR8A 2W66A 5CG7A 5HNRA 3TJ4A 2FGZA 3L65A 2ZZ3A 1IR2A 5GQBA 1TX2A 4K2SA 3UERA 1GZGA 4I6KA 1AH4A 1AL8A 4B2DD 2VD8A 1QFEA 2C1GA 4H9YA 3MO7A 1EJTC 3W3OA 4AZIA 4DYJA 1FUYA 3TYZA 3PBUA 1E5NA 3CL6A 5HATA 2J9XA 4WX2A 4JKMA 1F2JA 2OKTA 1GW9A 1G1YA 4IUOA 1ITQA 2A6LA 2D2GA 4O12A 1GVSA 3UT0A 1TPC1 3NXLA 1Q6EA 2FH6A 2YL6A 3ME3A 4EACA 3F4DA 4LYPA 1YADA 3WNKA 3UFYA 3WNOA 1DP0A 3A5FA 5C7VA 2FGLA 1IIHA 3W7GA 1EJVC 3NYZA 1OWQA 3ITTA 3T42A 1EXBA 5AHMA 2PURA 4XD6A 3MVTA 4JQ3A 4C60A 4FX6M 1Q6LA 3LLXA 5DX7A 1A53A 1CYGA 1IEQA 1DEDA 2V67A 1U5JA 4J3ZA 5D4YA 4ZMGA 1GUVA 4NU7A 3GDBA 4UWMA 1DIOA 2JEQA 3H12A 2J7CA 3MUCA 1JYVA 1NWSA 3GO2A 2INEA 3I6RA 4ATLA 4HA1A 4XAGA 2YDQA 1QNVA 4QQUA 1ONWA 5K3VA 2NVAA 2NUWA 1ZJBA 2WHLA 2X42A 4I90A 3W1PA 3G2GA 1O7AA 3COTA 4JY9A 3U3HA 4CUCA 1R6WA 3F1QA 4BQ3A 4I5RA 1NF7A 3THCA 1JYWA 3S42A 1IQ8A 3WMBA 5GNYA 2W6RA 4HA0A 2QLYA 2DVUA 1O68A 3CIVA 3QFEA 1POKA 1JI2A 3WJSA 3TYDA 3WL0A 1YDVA 3QY7A 2NQZA 3W2LA 4D6GA 4N7QA 2WNNA 4H00A 2A0NA 2VX5A 4LRSA 5HNNA 4JTRA 2YOCA 4M8UA 3A13A 4AZ5A 6TAAA 2ZDSA 2CLPA 4F0MA 3WQDA 3NDYA 5T9BG 3A3HA 1TV3A 2WKLA 4P7NA 3KHJA 3W7DA 4DPPA 1WDRA 3ARPA 3RLGA 1OG0A 3WMCA 2QV4A 1IYXA 3PJUA 3HFYA 5L9FA 4H9ZA 4B3ZA 4QS6A 2J79A 4J35A 4AD3A 5I79A 3EKZA 1KC7A 4YJ5A 3PJTA 3AALA 2YW3A 4BCEA 3WG6A 2ODOA 5JXQA 2X16A 1V51A 4F2BA 4D1JA 2FJKA 3R13A 1FOBA 1DJZA 2FVLA 4GZ7A 3RHGA 2EGZA 5DO8A 1JJKA 3KS6A 1VCFA 3LHVA 1VYSX 2XU2A 3H4WA 3EXTA 3M1ZA 4ML4A 3DKLA 1GJUA 4IT1A 3ONBA 1OD8A 4L64A 3IUHA 3BVJA 4F0LA 3W2MA 2EKCA 4C6PA 1XYAA 1DTNA 2I9EA 5HINA 3VAVA 1Z8AA 2HXUA 4EWND 4PCFA 3KHDA 3VOJA 9CGTA 4M1BA 4PBGA 2Y4SA 3WLNA 3ARWA 5D32A 2BP1A 2CWNA 1ZCOA 4JYFA 2CBUA 3T4CA 4US6A 2QF8A 4M6UA 2HV5A 3GFXA 1CX9A 1E6ZA 1AD1A 4A2RA 1Q6FA 3UYIA 1TQJA 3C6CA 3B8TA 3NPUA 3FA3A 3DFNA 3KBMA 3LM3A 1WV2A 4U5IA 1B3YA 3PTMA 3T2PA 2X40A 5ECUA 3N2CA 1PB0A 4IIBA 4Y9MA 4FK9A 4LAMA 5FF7A 3UR5A 2HS6A 1LWJA 5I0DA 4MLRA 3NAVA 3CUXA 5HWJA 5ABHA 3M0ZA 2XPKA 4RE3A 3GNOA 3HGOA 3DDMA 2A6NA 3Q45A 2HE5A 2ZZ7A 1W5OA 1Z89A 2OFJA 3ATYA 3SCNA 5MKGA 4V1XA 3B0VC 2F7FA 4REQB 4H6QA 4S3FA 3ENLA 1C9WA 3AHYA 1KRMA 3LXAA 4MB4A 3CUIA 2X8RA 3U5UA 2YXXA 3S47A 3FLUA 2PLMA 2Z26A 1JGIA 1T7LA 3VD9A 1VRDA 5IXEA 1BRLA 3SFWA 1KFBA 3STPA 4GYJA 1M01A 3DCPA 1LL6A 4PSPA 4AEEA 4RE4A 3UZWA 2ATSA 4IQJA 1H7PA 2RDWA 4PFMA 3R79A 4GUGA 3IGXA 4CVWA 4M3PA 1BQGA 1CXEA 2YCKX 4LF2A 2FTPA 1E6QM 2R9RA 2GVEA 3AO0A 3CYJA 2NW0A 1U5VA 3SRKA 1XD1A 1LOLA 4ERGA 4GOAA 2VXNA 2QNEA 1K8YA 1LBLA 1EIXA 2R8WA 3LDVA 4YTQA 3TMLA 1K1DA 3W7EA 3H21A 2WJEA 2GSHA 2EAWA 3PUDA 3HV8A 1IXQA 1VEMA 2BVTA 4LPCA 3Q37A 4XO7A 1PYFA 1S2WA 1FDZA 3P93A 3VD4A 4ERAA 3AROA 2OZTA 4ROPA 3DBPA 3BDKA 5HPCA 3ANUA 3IACA 4QNEA 2EG6A 4PA8A 3WMLA 1FWBC 2VRJA 3E3HA 4K36A 1BF6A 4DO4A 3BARA 1QNOA 4JD4A 1LORA 1UR3M 3NO1A 3PPGA 1G4SA 3VTRA 4S3JA 3W83A 2NX3A 3WQ5A 3RMEA 1YNPA 3F03K 4YTSA 5JH2A 4LVAA 4AF0B 2BGSA 3S2NA 2WNQA 2XN1A 3ZLGA 2QUNA 2AQWA 3GH4A 3RU6A 4H9VA 4I8DA 1AW2A 4ZQOA 1HJQA 4J3VA 1SGJA 3C2FA 1Z41A 2JKAA 1RUSA 4RDYA 3PBGA 4JNYA 4HPGA 5AY7A 5HK4A 4P5UA 1HNYA 1TZ7A 2YB4A 3SDOA 1EBGA 3NL3A 3AXIA 1ECEA 3EOOA 2X1UA 3UJSA 1VZWA 1A5SA 4REQA 1QUMA 1UPPA 3PWIA 3S5OA 4CNUA 2PC4A 3P3BA 1B1YA 4XBJA 4MAZA 2CBIA 3LTYA 3AIRA 2WSYA 3GC5A 3FS2A 1EYEA 1V3MA 3BLDA 1GVOA 2DJLA 1KWGA 5HANA 3RCNA 3O2LA 3EMZA 2W62A 5K4XA 2Y70A 2DZWA 3NURA 1JZ8A 1YNQA 1SFJA 1UP3A 4EX4A 3GC4A 1X1OA 1AZ2A 1VAHA 3WDHA 4Q33A 3I3BA 4J5NA 1KM2A 1VBRA 4JEQA 1F8IA 1Q2SA 1S2UA 2ABAA 2YYUA 1U1HA 1UJPA 1BTCA 1YTEA 2YL8A 3AC0A 3RITA 1C90A 5G1MA 3T08A 4K68A 2VURA 4JQAA 4DYKA 3S1VA 4IQLA 1XG3A 4PTWA 4C6MA 4CLMA 3PBYA 4L4MA 4TV5A 4WJXA 2YLAA 4W89A 1FWGC 2D0HA 3FK4A 1W3HA 3TV8A 4RV3A 4MWAA 1H51A 2DSWA 3VKAA 4ZO6A 2HMCA 4ONVA 2EJAA 4CN1A 1S2VA 3QZEA 1VFLA 2RDUA 2F6UA 1GK8A 2XFFA 3BW4A 4POCA 1ZAIA 5KITA 2FZBA 1CPUA 4LEFA 1W17A 2XINA 2WZHA 2PTWA 1HP5A 1PTDA 4RKAA 4BQ5A 1V3HA 1B57A 4TR9A 1JQXA 3M0JA 2OQLA 2H3BA 1D3HA 1ZBWA 3IIOA 3U2CA 1CB7B 3GY1A 4M19A 3V5OA 4O16A 5AC5A 4BI7A 1NFPA 4UR7A 1K77A 4FS9A 3KE0A 3NZRA 2QIWA 3ZR5A 4KFPA 1R47A 3W7NA 3WK0A 3WQGA 1NSJA 3T1GA 3WBAA 4XZNX 1E71M 3HV9A 3E96A 3TONA 3TW6A 3NL5A 2XG9A 3W0KA 2VGIA 4MNLA 1B9BA 1GVYA 4E3VA 2CCRA 3B8IA 3CL8A 4EXBA 1EF3A 1W3JA 3U57A 4P8XA 4XZIA 2F2KA 3WEOA 4AZ7A 4J3TA 3A4XA 4N0RA 3B9AA 1M9HA 3VMPA 1LT8A 3EAUA 2D3LA 3QY6A 1ZHAA 2F6KA 1RBAA 1JULA 3EWDA 3W1NA 5FI8A 3PZTA 3UXAA 4CNNA 2BNJA 4KKXA 4PMUA 1KXTA 1TV4A 1W9BM 3KDOA 2TODA 4IISA 1V4YA 3AWNA 4ZEPA 3ZWSA 3DENA 1B3ZA 4FF7A 3NQCA 4O0QA 3W7PA 4M5PA 3KRBA 3OYXA 5BWAA 1LLOA 5I7GA 4QISA 1JAEA 1KM0A 3GXIA 4LEQA 3CO4A 4PTDA 1XUZA 2EPKX 2J8GA 1BKHA 3SQMA 1GKQA 4HNCA 3OBEA 6XIAA 2YDRA 5D2YA 4YTUA 3STFA 3T05A 2ZRYA 3LS9A 2D24A 3TWAA 1CDGA 3H7UA 2LLEA 5BYWA 4F0RA 2PE4A 1KW1A 3KBNA 1UD6A 1ZP3A 5DBTA 4Q8MA 2BY3A 1JDEA 4UTWA 3ZJ8A 3NTYA 4GK8A 4C7GA 3M41A 1JRBA 4PRRA 3B8DA 4F0SA 5BRPA 2AQOA 1UYQA 3CV1A 3UZXA 1KXVA 4A3QA 1P4CA 2VL4A 1OEPA 5I06A 1JCJA 4GNVA 4DJEA 1CECA 2GJXB 1S39A 3MBFA 3ABQA 1YE6A 2CZ5A 2QCCA 3KBWA 4HSOA 2CU0A 5IBXA 3GYEA 3SBFA 4GI8A 3WLKX 1E4LA 4GZIA 2B7NA 5ABFB 2MNRA 2C3ZA 1A80A 1IT8A 4U3CA 1UG6A 4XZBA 3HPZA 2VVNA 3DYPA 3BANA 3BOLA 1H62A 3KRUA 1NQKA 1LL4A 3N6HA 3FVMA 3VPLA 1H2JA 6XIMA 4P7RA 1RZMA 3L4TA 4V27A 1G9HA 3LRMA 1GW1A 1OFAA 3W7LA 1Z7AA 4GINA 2D22A 4JGDA 3SFKA 3H6OA 4QFUA 3UG3A 4I9AA 1C8QA 1TCDA 1A4LA 1K9DA 1LROA 5F2GA 1HW6A 3ZIZA 3WDQA 3D0CA 1GKPA 1LBFA 1NDZA 3RYSA 4FLRA 3FSTA 3IJIA 3N14A 3WO8A 1UZ1A 1S5TA 1RCOB 3P5YA 4YLWA 3R0DA 2DPEA 1Q6DA 3L5MA 2PU1A 2WLZA 3DFYA 1SJCA 2PRHA 1CGYA 2OPJA 4AVOA 3KTCA 4AIEA 1XHGA 4DM1A 4FIRA 1V7YA 5TIMA 4ACZB 3QF0A 1WAUA 3W7CA 4PC8A 4CNPA 1OQFA 2PWVA 1XM3A 4HPNA 5LNRA 4C6JA 1EXPA 3ARUA 2VX4A 4CD7A 2V5CA 3ZVHA 3AXMA 1RP8A 2Z1XA 1PUDA 4X2RA 3W29A 3K13A 4OKDA 1E9ZB 3E12A 2NX9A 2ZUVA 4DI8A 1EWEA 2J66A 4KBXA 4W9TA 1IZCA 1ONEA 5A94A 4UTTC 4FXFA 3G1XA 3WK1A 3B97A 2Q01A 4IGMA 3TR9A 4QDMA 1XINA 4E8GA 3LEPA 1P0BA 1BEUA 2NSXA 1YBQB 1BQCA 2G96A 4WOZA 1WP6A 4JN8A 4L7ZA 1GQJA 2XH2A 2I14A 4OECA 4P8UA 4IWWA 3B0PA 5FF0A 1UQZA 1IWBA 4DPQA 5D9OA 3WF3A 3DGRA 2C19A 4AQLA 4PMDA 4DM2A 3G0UA 2XIJA 2YL5A 3C4UA 2PS2A 4LV9A 1A0CA 5E6ZA 2E1DA 5CGQA 2BS9A 3LNMA 4IIEA 1UOKA 4KWVA 4GH1A 1W31A 1SFLA 5D2XA 1N2VA 2OWCA 2VOTA 3W26A 5EMJA 4GRSA 5DT7A 1LDCA 5BXSA 2XZ7A 1RBLA 4N9BA 4BFAA 4AIOA 4YTTA 2W5FA 2PF8A 5CZTA 2ZX7A 5C55A 3EWBX 1R38A 3M7SA 3T78A 3H7RA 1XH1A 8CGTA 3ARVA 4O13A 2V2DA 4ZO9A 4PGLA 3QLLA 3G77A 4UTJA 2UY3A 1R7AA 4XVEA 2ZQ0A 3CV6A 2J4GA 3C0LA 1KLZA 3W00A 1PZ1A 4R88A 1PKYA 3PZQA 4J2PA 3VIMA 4FXSA 4J9JA 3GIPA 5T9CE 1K7XA 3H54A 4PCSA 3MC5A 3PR2A 2XN2A 3S5YA 2WZIA 3WUEA 2O7QA 4DUWA 3CPGA 4LTSA 4R33A 3KWSA 2OYLA 2OX4A 1XI3A 4DI9A 3SUWA 2XHYA 5HMDA 4IFKB 4RNIA 3GTFA 1ZENA 3DEQA 4GXPA 1ONRA 1ODZA 1SFSA 5BROA 1RALA 2GWNA 1PHWA 4W4QA 3OHIA 5M2FX 4AD4A 1ZU8A 3ARQA 4K1WA 4BKNA 4E2VA 3EGJA 4KF1A 1V08A 4Y7EA 4RPQA 3MMTA 3TVAA 1OGGA 3T2QA 2HNEA 1WUFA 4PCPA 1X7IA 1RY0A 3TN4A 3KOXA 3O3RA 1LRQA 4B4HA 3N3MA 4I8YA 3GTIA 5TD4A 2Z6IA 1NU5A 5JMUA 1YHTA 1RSCA 2CZEA 4Z42C 3KOFA 5FESA 2I5IA 4A8LA 1GVRA 1OCBA 2VWTA 2VC7A 3GG1A 3QC3A 3OA3A 1E0TA 3QQWA 3LK6A 4UZSA 4QCEA 4JY8A 2PDUA 4HPXA 4UBPC 4CVUA 4LVDA 3ALGA 2E9MA 4UMCA 2QV5A 1ICPA 5A6BD 1J5TA 2REQB 1R3RA 1HGYA 1ZJIA 1U30A 1V6XA 4NILA 4H7CA 1UIOA 3SN0A 1A49A 1JZ3A 5AC7A 1WCGA 3H4GA 4DBUA 1OFRA 4HHPA 1V6WA 4AZCA 2CC0A 2WSRA 3NM3A 1FFQA 5JBDA 2TMDA 3BO9A 2E40A 1Z69A 3IIXA 3EOUA 2Y88A 3B8VA 3SI9A 1OFDA 4IFRA 2IPGA 4FF5A 4IL2A 3FSUA 1OY0A 3TTOA 1YDYA 3C3NA 4AW7A 3LPOA 3GD6A 3S1UA 2CLEA 4HK7A 1P48A 5FSEC 5IOBA 2ZVIA 3CZEA 3A24A 4HTBA 1QI4A 4IPNB 2NV9A 1GG1A 4M6PA 4JN7A 3MSRA 1D3CA 3DU0A 2A7RA 1WPCA 1EYWA 4A22A 1Z42A 4TQTA 2XM1A 1SSGA 1GQLA 3S46A 4AYGA 2CERA 4XBKA 3W7MA 4HVXA 1PCWA 4M56A 4JHMA 4B92A 3AWOA 4B3LA 4H6EA 3LX9A 3LGEA 1I2OA 1UD5A 1B9ZA 1Q66A 3VOCA 1US3A 4QITA 3DHPA 1W9UA 3G1YA 3LHZA 4RUBA 3PB0A 3SGUA 3WCZA 4PCNA 3G5EA 3AYVA 3HFTA 3QRHA 1W9XA 2CITA 1OFPA 4MHBA 3Q65A 4NSBA 1AL7A 3A22A 4NNCA 3NZPA 1HP4A 5CJNA 3BXWA 4Y96A 3TSBA 4HKPA 3PG8A 5CC5A 2GPTA 3M4HA 2QJGA 2P88A 2VCAA 3FA5A 1PJ9A 1TPFA 3W23A 2HE8A 4ZL1A 2DUXA 1Q13A 4G5DA 5B7ZA 1OF6A 1Q6RA 1OCQA 5CZJA 2CEQA 2H3DA 4NYYA 3HJEA 3TROA 1J2WA 3LLFA 4CGTA 3TP4A 1ISXA 5DEZA 3NQ7A 4QSHA 4PUUA 3SGGA 2VEGA 3UWEA 3TN3A 3Q94A 5FAGA 1LQAA 1JR1A 4CU6A 3RX4A 4NAEA 2ZZ1A 4TVDA 4FNPA 3G24A 1VS1A 2J78A 2OLAA 2BHUA 4V15A 5EBAA 3FDKA 1MUMA 3M0KA 3UYCA 3VDCA 1MMFA 3EB4A 4JFWA 4NNBA 1Q85A 3SEPA 1OABA 1QCWA 4GYKA 1WKEA 3W88A 4KGLA 1XIGA 5J04A 1L6WA 3JU2A 1J0JA 4J40A 3AJ7A 3QN3A 1O5XA 3W7OA 4O53A 2ZXAA 4FLSA 2A3HA 5AHIA 1KBKA 4DJEC 1HQTA 3GZ3A 2P0IA 3MCOA 3K4DA 3A9IA 4Y9PA 2WPGA 3EXSA 3QW3A 1V79A 1C93A 5T91A 4B5SA 1TJRA 5C2GA 3PJWA 1CT5A 1MDLA 4Q6JA 1SZGA 1ISWA 4EPBC 1S46A 3TK7A 5D8WA 1RY8A 1E9IA 3RLUA 3HG3A 1HKKA 4C6CA 3DFHA 1T99A 2J9ZA 3QOKA 1PWMA 3RFAA 3TTSA 4OFCA 4BF7A 3UXIA 5DXYA 2OWXA 3UQNA 2ASHA 3W81A 2H8XA 5LHFA 4WJEA 3MSGA 4ADSA 2EKGA 1XSIA 3WQ4A 5EPDA 4QDWA 3M0VA 5HJXA 1W91A 3A9BA 3PF3A 3SURA 3AAMA 4FX8A 2EG8A 3G1VA 4MNKA 1X1NA 2H90A 9XIAA 2ZZ4A 1K4GA 4IXXA 3R5EA 5LIWX 1QI0A 4U5KA 2D1ZA 3S5ZA 2CXGA 3GNPA 1UROA 4UNKA 1WKDA 1TPEA 3MU7A 3UY8A 1YQ2A 2HTMA 3QHOA 4HNNA 1SUXA 4D6DA 5A6AA 1XC6A 3HN3A 2C91A 4EPKA 1RJRA 3OQEA 4GUHA 1UP2A 5AECA 1DJIA 3IV8A 3LNPA 1D3GA 5M17A 2QDHA 5C9UA 2WC3A 3CB8A 3CAVA 5FIPA 3G6LA 4GNKB 4WXYA 1E9YB 1BLIA 2Y1HA 4FOUA 1DORA 4TMCA 3SCRA 4GWEA 4HOZA 2J25A 1F3EA 2DEPA 4MFDA 3VGGA 4IG2A 1W56A 4GVFA 3RO8A 3LHYA 3GHTA 1UQYA 1K6AA 5I3IA 2OZ0A 4L4OA 2J77A 2VFDA 2DT0A 1AD4A 1VGAA 1TPUA 1QNSA 3LHUA 3G8RA 3QMRA 3B9OA 4AZBA 2VZOA 3DG3A 1H11A 3B05A 4ERIA 4QJ4B 2J9YA 4JICA 4AZHA 3E2QA 2G5WA 1JVNA 2XIBA 2NT0A 3A64A 4D8AA 4QE1A 4GUJA 2ZRUA 4YVVA 1E51A 1W5PA 3HPFA 2X7WA 3HOJA 1DWHM 2XVPA 4NP7A 4O1CA 4HMDA 1K8XA 4AG0A 3TN6A 5G2WA 5E1QA 2DT1A 3GXPA 4AWSA 2YBVA 5G4EA 4UTFA 5H2ZA 2RUSA 2HISA 1DJGA 4PULA 2WCSA 4XUGA 1RJQA 2PGFA 2ZUMA 3L2LA 3POCA 3U48A 2Z1SA 1V77A 3VOGA 1FWTA 2YKKA 3TA9A 2HS8A 3UWQA 3ZJ6A 3QH2A 5CC3A 2PD9A 4JHZA 3FKKA 1U2YA 4PUJA 3L67A 4EOUA 3C0JA 3TJLA 4AY1A 1MW2A 2ZDRA 3CS2A 4I9TA 3WENA 1XFBA 1ZJHA 4P8VA 1FHVA 4N9CA 4LBRA 3M0HA 1M53A 4L5ZA 3G6MA 1XFCA 4C1NB 5E6YA 2O4MA 4ACZA 1F9CA 3E5BA 2G41A 4NJIA 3SO7A 4S2BA 4N6FA 3F7JA 3MY9A 3TJIA 3N6QA 2WBKA 1YXDA 2TPSA 4RZ6A 4C1KA 3BZGA 3OHMB 2BY0A 2YJQA 5TBOA 3GG0A 3WF4A 3C8FA 2XVKA 4OOZA 1K7EA 1E5JA 3B06A 3P2VA 1LG2A 4H19A 2JE8A 3UXKA 1B0IA 1W5NA 1WZKA 2AGKA 5J8LA 3DGBA 4HPHA 4V28A 3AFBA 3W24A 4CCCA 1ITUA 2EG7A 3WQEA 3NQVA 1ONXA 3DYMA 1G01A 4JS3A 4MVAA 3T8LA 1A47A 5B7YA 3WBEA 1GYMA 1Q4NX 1J93A 1TVLA 1ZUAX 1VYRA 2HDJA 4EXQA 1HJVA 3SIMA 2J13A 2VGBA 4K3ZA 3BAYA 4EANA 1BKSA 4IP4A 2IXUA 3MQTA 1NIUA 2OZ8A 4DBSA 3VZZA 2PDHA 4Q7BA 2O0TA 3NJ3A 2H8ZA 4BWLA 5EMKA 4JIQA 1BF2A 2GJXA 3MS8A 4B5VA 5HQLA 4ZXLA 3UCCA 1XUUA 1EEPA 3UJFA 2O7SA 2Q8LA 2Z1VA 2IS7A 4KRUA 3BZJA 4B5NA 5CKSA 1GJWA 2O92A 2PC8A 1ECQA 5FCZA 5A95A 1NTHA 4LUJA 2HXTA 2Z2AA 4XZ9A 5A1AA 1RXOB 1QR7A 1A5OC 3T0DA 4PTVA 3APTA 3WQOA 4CCEA 3T0CA 1A5LC 2VFEA 3LENA 3WEMA 3A4AA 1K9TA 2ZX9A 1S38A 1AODA 2J7EA 1PX4A 1MQQA 1JDAA 4LBUA 3AU6A 4AF0A 4HSHA 4KETA 1F07A 1O12A 2WK2A 3JS3A 5JBFA 2QUUA 4NY2A 3QKZA 1HKWA 5D8ZA 5REQB 4A8IA 2WHKA 3NL2A 1S2AA 1IE7C 4NZ1A 4PB3A 4HJWA 3UY7A 1WXJA 1OFEA 3NXFA 2E6DA 1XGDA 2FFIA 1FX6A 1CCWB 1QDSA 1A4MA 1GTEA 2NQJA 3EEZA 5ABEA 2VI0A 1E0XA 2NXIA 4WJ8A 3OLGA 4D71A 1JYNA 3SCVA 3HURA 3ZT7A 3GDRA 5GJNA 2CHOA 3BPWA 1HO4A 2JFEX 1GOWA 3GB6A 3SUVA 5FJTA 5HDRA 3KUMA 4KQNA 4CNTA 1VBHA 1UMYA 2RFGA 1GOKA 2BWGA 5M1TA 3VKJA 3FCPA 4IJRA 1AJ2A 2DZSA 3NDZA 1GYNA 4JQ4A 1M3UA 3T40A 1XLFA 3BLEA 1Q6QA 3ZT5A 4UFHA 4MUPA 3TC6A 3LY0A 5I3HA 3QM3A 1MW0A 4LAOA 5JVLA 3VD3A 1XIIA 1KBIA 3BW2A 2YBTA 3W27A 4BWLC 1JI1A 5D2VA 1TB3A 3DAQA 1OZQA 4IP5A 3GHSA 5F2MA 3KRZA 2Y89A 3CWHA 3RLHA 4KESA 5CC7A 3QYQA 4ZZ9A 1XRSA 3OZOA 1XW8A 2NUYA 1GJPA 2BXZA 5ENLA 1UPMB 1IEWA 3MI6A 3VNKA 4KRZA 3IVSA 1BVNP 2BVYA 4Q32A 4DF1A 2J75A 4LQ1A 3TQVA 1JCYA 3MJYA 1Y5XA 2PGEA 1W6TA 3CXOA 3ORWA 4O4WA 2YZRA 2ZZ6A 4ZODA 4NVTA 4BF5A 2G37A 1SMDA 4L6OA 3GAYA 2PDPA 2XH0A 4O0KA 4HCHA 4NNAA 4AXKA 1EJXC 3RUBL 1GQIA 4AXNA 2ZXBA 3QBUA 1CGWA 1DWFM 4A05A 3CJPA 4M24A 2QAPA 1J01A 1XYBA 2DZPA 1QRQA 3TIMA 3JZEA 1EPXA 3G18A 3HMCA 3O6DA 4PMQA 3T7VA 4ZQPA 2JGYA 2X0HA 2OSYA 3WF1A 3C2EA 4MMWA 3VFLA 1KFWA 4V33A 4PTNA 3N9KA 3NZGA 1QW9A 4DJDA 3BH4A 1RA0A 4IFOA 2VENA 2H9AB 4S39A 3VE9A 1F73A 1FBAA 4NJKA 1TWZA 2VQUA 3I4EA 2X30A 4S3KA 1PAMA 2ZC8A 1OK4A 2GGIA 4E38A 1TV5A 1OYAA 1JZ5A 2WXDM 2YW4A 2BB0A 1DTUA 4UMBA 3T0BA 3QHNA 4M1RA 2PUZA 4FALA 4LAKA 3EB3A 3KWXA 1VQTA 4CEUC 3W9ZA 4Q7NA 3N2TA 3GKAA 5FEWA 3VFCA 4NZCA 3WMSA 1V0MA 4OBSA 4UNIA 2GSJA 2VDHA 4PB5A 1XDLA 1K02A 2IPFA 2JGQA 1EZ2A 3IK4A 1DJXA 5A8NA 3ZLFA 5CJ5A 1EJWC 1DL3A 4V1YA 4CCZA 5REQA 4GZJA 4LH8A 1VB9A 2PZNA 5I24A 2VWSA 1DWAM 3BSMA 5IDZA 2W79A 3LZ3A 1FH9A 4LANA 1UC5A 3MANA 3LYEA 1K6WA 4XB3A 5EA9A 4XAZA 2UY4A 3T0TA 2V38A 4H9XA 3TKFA 3CTLA 3KVJA 1H7XA 1AW1A 4KFOA 3TEVA 5CPNA 3QGKC 1QW7A 3O15A 4GHRA 1XV8A 3REQB 4OE7A 4RDVA 2PRLA 5I78A 4JIIX 5DN1A 3IJ8A 1OHLA 2DV0A 2ZVRA 2ZICA 3N04A 1TV7A 2W0UA 1I60A 2FPVA 3M6DA 4H9MA 1ZBVA 5FL1A 1KFCA 1KQZA 4DUOA 3OW1A 1F3XA 3WFLA 3TUUA 2J74A 2YXOA 4MM1A 5FAJA 2EF9A 3PPHA 3A12A 3VDBA 3KS5A 1M7JA 1JZ2A 1TR9A 2YCIX 3LRLA 3VA8A 3B8WA 1YEYA 3D6NA 1VKFA 3F5JA 4A4AA 3TYBA 3WQFA 1I8JA 3ANVA 3SUSA 1IHIA 4WGXA 3LPPA 4WF7A 3E0IA 2PP1A 3DHFA 2G3NA 1VLWA 1T8XA 1R9ZA 3B04A 3LG3A 2X2GA 3NSXA 1RR2A 4GX8A 4JFSA 1I45A 3J7HA 1KGXA 1R46A 1WBJA 4Q22A 1FCBA 3KLKA 2CLOA 5C9RA 5CG0A 2QEZA 4P7QA 1DBTA 3W2UA 5BW6A 4OU1A 1OX5A 2P50A 2XH7A 4R7OA 1RPKA 3G1SA 1SW7A 3ALFA 2PSNA 1NJJA 3EWYA 3SN4A 2X1TA 3CWNA 3I6EA 4A6GA 4MDOA 1X1ZA 1X39A 1H5YA 3AMLA 4UFKA 1E40A 5DY3A 4LV4A 1MZRA 1R2TA 4HYWA 2XFRA 1SR9A 4RPPA 1M68A 3RAOA 5E70A 4K7YA 4ZFCA 3LPFA 3MMDA 3S6OA 4IJBA 4IP7A 4GUFA 1H50A 1WE5A 1MI3A 1F3WA 1O94A 3GU2A 3UP8A 2H6RA 3VMOA 2AL1A 1PTAA 1XYMA 1WKFA 5GNZA 4ATWA 2Y0FA 4HIBA 3ABSA 5MKGB 4HHHA 5G2HA 2CNCA 1F4AA 1L6FA 4UTHA 5FF2A 3DZ1A 4JTFA 3PWGA 3WJZA 4RDZA 2UWFA 4JR5A 4EPDC 3VE7A 4KT2A 2E5DA 2WWDA 1V0NA 1UCWA 4KW2A 4GC3A 1QPNA 4QROA 2FYMA 1AMKA 4ADUA 5LNVA 1S3HA 2PDIA 1EKOA 1B4KA 3TMQA 3C2YA 4X63A 3FGCB 3EKGA 3EOSA 4H2CA 2FGBA 3HA1A 3CZKA 3TQKA 1JPHA 1I2NA 4FXRA 4NJJA 4DX3A 1TFVA 1G7UA 1UD8A 3H53A 3R7MA 2HPIA 1E15A 3GXFA 5FJIA 3VZXA 4H3DA 4YL2A 1RQEA 4HN8A 1KB3A 4I7VA 4LUTB 3HIJA 4QG9A 5I2UA 2CLLA 3WEZA 1K8CA 2XSXA 5EFFA 2F38A 1LP6A 1QI2A 5LGXA 3CGTA 4X2PA 3HMJG 2XIMA 4NIRA 3T81A 3IAQA 4GFIA 2EO7A 4IGNA 3ZXWA 2R1NA 3QZ6A 4TO8A 1VBUA 4GI9A 2Z1KA 4ICCX 4GBDA 1VH7A 3VMNA 4S3EA 4AEFA 3WLOA 4I7UA 3HPXA 3G1AA 2PDKA 3THUA 2GFTA 1A3WA 2ZE3A 4MY9A 1PBGA 4X0VA 2SFPA 2X0SA 1JZ7A 2TSYA 3FKRA 4QLLA 3CIWA 3LU2A 3M5VA 2ISDA 4M6QA 4AD2A 4GXWA 3T8QA 3MHGA 4J3UA 4WSJA 3AS3A 1R9YA 4Q8UA 2HCVA 3CH9A 3BUVA 5DMLA 3VI2A 3HBLA 3KOWA 2YL9A 3VC6A 1EHNA 3E6EA 1UIPA 1NFGA 5C5YA 3URAA 2B7QA 4MWAE 3KL5A 4DLFA 1B2YA 3QPYA 4XKMA 2HJPA 4Q8QA 2DSKA 4FR6A 1XS2A 3MHUA 2WZEA 4JTCA 3OP2A 5LA0A 3QGAC 5CBJA 4QR6A 1C8XA 2GQ8A 3ITCA 3II1A 5HBFA 1AVAA 3CUJA 5LHEA 2BXVA 4O1DA 4IGHA 4XIMA 4L4PA 1E0VA 4Z2KA 1I2RA 3FIGA 2BXYA 3R1ZA 5FA5A 2FPYA 2WOQA 2DVTA 3E74A 3TDFA 3E0WA 3DXIA 1ML1A 4FXJA 2XGZA 4ZQMA 3WLHA 2XSAA 1R0MA 3VOHA 1XLIA 1XICA 4HZMA 4W85A 3TQPA 2V3GA 1XIJA 3B0XA 3VZYA 1CNVA 4AC7C 4UCGA 7PTDA 1LLZA 4R85A 1Q7QA 2QVHA 1UWUA 2VC5A 1M03A 2Z24A 4PMRA 1YRRA 3L68A 4HNUA 3EWZA 2WLYA 2E0PA 2W9MA 2QS8A 1V02A 4MJ2A 5A6MA 4XBSA 1P7TB 2ZRWA 3HQOA 4US5D 4AIUA 2DU2A 5A6LA 4GGBA 3GVVA 4W8BA 4HTYA 1V6YA 2PDJA 1ZB5A 1J96A 4MJZA 8XIAA 4BEQA 2V81A 4C6NA 2PDCA 4MB3A 2IUZA 3LBMA 3FYOA 2ZX5A 1FCVA 3HG4A 3HQ1A 3WH6A 1NAL1 3N3TA 3GXDA 1PTGA 4KFNA 3GH5A 4C6LA 2PTXA 1CGXA 4X61A 3N9RA 7REQB 2Z27A 2PDYA 3VIOA 4WIWA 1NY1A 3LCHA 4Q8OA 5DCDA 2R1KA 1ZY9A 3MB9A 3SADA 3MI2A 3NUKA 3SRHA 3FN9A 3OBAA 4D6EA 2DZBA 1MW3A 1Q3NA 1SW0A 5CGMA 1DOSA 4QE5A 4GQGA 4RZ4A 2VYOA 5EMMA 4IFKA 3PULA 2PDGA 2A85A 3GK0A 5I5RA 2Y8UA 1VHCA 2OLHA 1W1ZA 4TMBA 3TC7A 3USBA 4XVDA 2OG9A 4QRNA 1VD6A 2YBUA 3CIXA 3TCEA 1BYCA 3NQAA 4GQRA 4QXIA 1A3HA 3P61A 3MYPA 2QJHA 1FWEC 4GKLA 1JYXA 3UZJA 3PZIA 4W5ZA 2R1PA 4HOXA 3LV5A 3QSTA 5D05A 3NQMA 1XRFA 4M81A 2NQ5A 1W3NA 3UG4A 4Y2WA 4IX2A 3UPBA 1KM1A 3C0SA 5A2AA 2EPHA 1C7SA 1JAKA 2GL5A 5HMEA 3HO8A 3KOZA 1G4TA 4C6EA 1EOKA 3C0QA 2GQAA 4DZ5A 2ZX6A 4YWIA 3UWVA 3ZVHB 5MF5A 3A4WA 2WMGA 1C29A 5D03A 2C0AA 3UWYA 2VFGA 1JEZA 4BI5A 1D7FA 2OOFA 3W1XA 4B5WA 2VZUA 4UQDA 5H8MA 1IWAA 3QXBA 2IKHA 1G4PA 1XSKA 3HQPA 4AWUA 5DCBA 3ABRA 4HSNA 1LL7A 1GG0A 4S1FA 4X3ZA 4CD8A 2VNCA 4PB4A 3LCLA 5I02A 4EPEC 1WZMA 2Z1BA 2Y85A 1BXNA 4HJFA 3GVGA 5CSSA 3E9AA 4NL1A 5TNVA 3KCJA 1Q65A 4LUTA 1GQKA 1XLMA 3BGAA 3CQ0A 1QWGA 1QJWA 2PTYA 2W92A 1F7BA 1LYXA 1QAPA 2CZVA 2Z7GA 4D6FA 2PBOA 3G0SA 4IZGA 2NQ9A 2W61A 1G0CA 2HROA 3PZVA 5DELA 3APGA 3OG3A 3BURA 2ZBTA 3CWOX 4W7UA 3IRDA 2W3ZA 1QPOA 4O54A 1QATA 3S8HA 3RCYA 4Z08A 5HNUA 4U33A 4B91A 1VP5A 5C6MA 1R85A 4LY4A 3TZNA 2XTKA 3BAWA 4JN6A 4A3RA 2O9PA 5GVJA 1QMLA 2OKOA 2DZTA 4Y9NA 1PKLA 4LFYA 2OEKA 2E77A 1KTCA 3Q58A 1AQHA 1NARA 4HA3A 4UB9A 1EGMA 1BWLA 2BODX 5D9PA 3SCQA 1UBSA 2NV1A 3O05A 4C6DA 2O9RA 3A5VA 4S23A 1DE6A 4K38A 1UUOA 4HK6A 4J27A 2WSQA 4WLCA 4YHEA 1WX0A 4GA8A 1MFVA 4JIPA 4IMEA 3DC8A 2AKMA 3S2LA 5G2IA 3PFMA 3M43A 2Y7EA 1FCUA 1ZNNA 1S5MA 1KM4A 5BWFA 4QBXA 2TAAA 4LBSA 3ZOAA 4DF2A 1JGMA 4PTXA 4ZA0A 1YNYA 3CM4A 1KM5A 1WAWA 4LJ3A 7CGTA 5E0KA 4L9ZA 4NKCA 4NASA 2C0HA 4OUIA 5CLWA 3PZUA 3PS7A 4MWAC 4LY8A 4JTAA 3UF9A 4Z1CA 3FX4A 3WNLA 3RNDA 2NLYA 3IJDA 3M7WA 1F3TA 2E3ZA 7ODCA 4E4UA 4Y90A 1XQKA 3AI0A 1HJUA 3S3GA 1EX1A 1AMYA 1HKJA 4US5A 2ISFA 3NEVA 4WVXA 2VEPA 3W38A 4BS0A 4EP8C 4QX4A 3LOTA 4GG9A 3PANA 2Z28A 4C5ZA 2IQ0A 4GC4A 4IIFA 1GHRA 5EL1A 2OMAA 1M7XA 3N29A 4IQEA 4IXHA 1ZL1A 1KXQA 3GAKA 5DXXA 3GDLA 5H8PA 4AB4A 3WQ8A 3LLDA 3MDWA 3P0WA 3UGRA 1J0IA 3MI3A 3WLRA 1E6XM 5AZ0A 3RILA 3R8RA 1UJQA 4WZHA 2NT1A 3WUFA 4RW5A 1KO0A 2QUVA 4K7VA 4DZAA 3T9PA 1BSLA 4QAWA 2D2HA 3RJYA 1RVGA 2CYGA 3OQ8A 3UXLA 2HPMA 3WLSA 2CKRA 3V1HA 1UUMA 1VFUA 1IEVA 1TYGA 3NZ1A 5GPRA 5C54A 4HYVA 4WK9A 3PSWA 4WSKA 4K1GA 3V0UA 1MNZA 4G7FA 2J6VA 3N11A 5A5WA 4LVFA 1QPKA 4MB1A 1MZHA 2GDVA 3ARTA 5FSDC 2DJXA 2QW5A 2W27A 3F2CA 3LMYA 5AHFA 1JZ4A 4QE4A 3ZZ1A 3QPEA 1UKPA 1K9EA 3PK7A 5FACA 1IV8A 1PZ2A 6A3HA 4S3BA 2RH9A 1GORA 3CQKA 1YDOA 1G7VA 2XSBA 3CEPA 1FWNA 3SECA 1I4NA 4N9EA 4AU0A 4N9DA 2WMKA 1DIKA 4UFMA 3WLLA 3STEA 1G4EA 1D7KA 1OZMA 3MKCA 2PI6A 5C0QA 1VFFA 2YPIA 5EMUA 1LUCA 3MYOA 4P2VA 2WW5A 4HNOA 4I9MA 2V6AA 4B4FA 3L5LA 3WD0A 3WK3A 3O6AA 2GJNA 4ZSTA 1OT1A 3ARRA 4JBRA 2YA0A 5KSWA 1JUEA 4LALA 4HA4A 9RUBA 2IXVA 3WDPP 1KGUA 4FNSA 2J8FA 4X0NA 4GI6A 3W1UA 1UMLA 5HNTA 2VFIA 2CESA 5BZAA 1PWLA 4BY3A 4DIAA 4DWSA 4C7DA 2JKPA 4PUMA 1TTIA 3ES7A 1AW5A 1OB0A 4EAMA 2EJ1A 3TJXA 1YTDA 3HGJA 5EU9A 2DSUA 1EJRC 4JHOA 4UQBA 3MCMA 1Z6KA 3UEQA 1FCQA 1Q7MA 4X60A 3T44A 2E09A 3DC0A 4AHOA 1JDFA 4DJFD 1WZLA 1PS9A 6PTDA 3MSYA 5EY5A 4OBTA 1M7OA 3KX6A 2BGNE 3DYOA 3AHZA 4Q4KA 2CWXA 3SQSA 1GOMA 4XKYA 3VO0A 1TREA 3U2ZA 1EQPA 4WHBA 2VEIA 1VEPA 3P7YA 4ICNA 1FY6A 2OODA 3W1AA 4G9PA 4DO7A 2Y8KA 2QDDA 3NVDA 3WQVA 4F79A 3WFAA 1VPXA 2YR1A 1RBOB 3TQ0A 3V4BA 3F2BA 3MHFA 1UOZA 3IRSA 1XC4A 4WDTA 4UTLA 4GY7A 1KA9F 4H8NA 4U2ZA 2F61A 5T8GA 2VUNA 5FEZA 2WMJA 7TIMA 4UQCA 1B3XA 2WBGA 4F66A 2FJUB 2O55A 3IARA 2ISWA 5ABFA 1D9EA 1PIFA 4LS1A 1RQBA 3HZ3A 3EB2A 4M7TA 5HMSA 3VNLA 1TJ1A 2IQDA 2PGWA 4L1WA 4NYUA 3CV2A 2WKJA 2EBNA 4RZ5A 4JFVA 5CC6A 1FP9A 4D8LA 2V9DA 3NQGA 3LTSA 1NWTA 3B9DA 4GY1A 3VDGA 3THAA 1P5BA 2BDQA 3V0TA 3CT2A 3ITXA 4I5XA 3S6DA 2RHGA 3W2JA 3ERPA 4F9JA 1DWGM 3NSMA 4LUYA 1JD9A 5D37A 4DXKA 3RIKA 3L0KA 1OX4B 5IFPA 3V0SA 1I0DA 1FWWA 1XBZA 3AQUA 3UG5A 3RMJA 5C2CA 1GONA 4QJ3B 5C2XA 1PKNA 3IPWA 4XTIA 2E6AA 3UWZA 5GJMA 3VIKA 1IXPA 1QWKA 1TA3A 1U33A 3D3AA 2OX1A 1DV7A 2Y7FA 1KRBC 2QR6A 4PTMA 2H9AA 2DP3A 2VFFA 2WQPA 4YNGA 1BWVA 1CLVA 4YYFA 3WF0A 1BVZA 2QJNA 1TQXA 1EDTA 1I0BA 4E5TA 2WHJA 2ZADA 4C1LA 4RX0A 4HNTA 3CQIA 4NG3A 5CPQA 5IM51 5F7UA 3V5FA 3W87A 4MSSA 1FTXA 2FZ9A 2FVKA 3UJEA 3AXKA 4EK7A 4JFTA 4YHGA 1ICSA 2WZMA 1BD0A 2GGEA 2XH4A 2OT0A 2Z2UA 3W73A 1TPH1 3PPFA 1AK5A 3VNJA 4D6CA 1G5AA 1UWTA 3WBXA 4YTRA 1UR2A 3LZ5A 3MPGA 3W7IA 2EHHA 3L2IA 3U5YA 1HKVA 4PH6A 1TG7A 2G95A 4ILSA 1W3KA 3GXMA 2CBVA 4AH7A 2YA2A 3VK5A 5GNXA 1TPWA 3VCCA 2BTMA 5BRQA 4PBEA 1NOWA 5H91A 1G94A 1NDYA 4HHLA 3GTXA 3DX5A 5JBEA 5I77A 3UVAA 1OINA 4M6VA 5BNKA 2PWDA 3RPDA 3AMDA 3MCNA 2D20A 4IQDA 3EZ4A 3KL0A 3MW7A 3TTQA 3V35A 4DJDC 1TE1A 3MJMA 1VCGA 4DNMA 2AMXA 3BAIA 2FH8A 1RLCL 4IMAA 1UD4A 2FHFA 1W1A1 4Q4QA 2FTYA 1ME8A 4RE0A 2C1HA 1QK2A 5FJRA 1TUFA 1LF1A 1ZBCA 2BHYA 1SO6A 1S1RA 1W9DM 5CZ0A 4XX6A 1TJ2A 4ZFMA 2Z0IA 1Q7ZA 3SAZA 1TPDA 2P3EA 5A69A 1EHAA 2OT1A 2P76A 5FEXA 1SO4A 4U10A 4CQBA 3BCFA 2DZUA 3NPXA 4GCXA 5CPMA 1QNQA 4YVXA 1SJDA 2ALRA 3BG9A 1V02E 4M80A 2J7GA 1OT2A 2WSPA 2Q71A 2OYMA 2XYLA 1W32A 5AC6A 4KMQA 1PX8A 5I3FA 3FJLA 3ZVIA 4TUFA 2CXEA 3DFQA 1ISZA 4ZSUA 1K8ZA 4CD5A 3UCQA 5LKYA 1UA7A 3CPUA 1A5AA 5DLCA 3OYZA 2KZHA 2RGLA 4ZB2A 2Z25A 2PF0A 4C6FA 1P7TA 4ZB0A 2QCMA 3CQJA 4K8GA 5K2ZA 1V6TA 1H41A 2DQWA 2PBGA 3FXYA 1HF6A 2FHCA 3W70A 2VFHA 2Q02A 4H83A 3BSHA 2YCJA 4JTJA 4W84A 1VJSA 1H63A 4HU3A 4WDWA 4XG1A 3CPRA 4QAIA 4C6KA 2GK1A 3GDTA 1JDDA 4HNLA 1C9DA 5DFAA 5E0FA 3BLKA 4GNJA 5IBXC 3WX7A 2P0OA 4J3WA 4Q6XA 5LNSA 2P3ZA 2XVLA 4JL1A 4O17A 1CXIA 1V0KA 3W6MA 4KERA 4F0KA 1DXIA 1P0DA 5HWNA 4XSLA 5AYIA 3BQ6A 4IPJA 2ISVA 3LQGA 1XBVA 1K7FA 4ECLA 3WUGA 4NZ3A 1OSEA 3WDRA 3WDIA 1QI3A 4OJYA 4DELA 1MUCA 2IPJA 2WAGA 3NDOA 3UWWA 4Y8FA 1YX1A 3APYA 1FKXA 2YIHA 1UR0A 5C9ZA 4GUIA 4TXEA 3AIVA 1H0GA 4ADTA 3WH9A 1J8VA 4IX0A 2QJIA 2XUCA 1BFNA 4RNHA 3GH7A 3T09A 1XBYA 5TQLA 3C52A 3WD2A 1ALDA 1DJWA 2VZTA 2JF7A 3OVGA 2GZXA 3VIGA 4LXFA 1LRNA 3KRSA 4W86A 1J6PA 3KP1A 5BXTA 1GVQA 1X8FA 3IGHX 3KXQA 4IF2A 2GSEA 3GYCA 3BLLA 1EBHA 4DEFA 3ISIX 3ZS4A 2C79A 3PNZA 4O10A 4QEHA 1UWIA 2J7HA 1I1WA 1PO9A 2BLEA 4TX8A 1L6SA 4E2BA 4ALDA 1QXLA 2QHAA 1O5KA 4ASTA 4DZHA 2J7BA 2ZUSA 1JF5A 3TW9A 1MFUA 3NR0A 5BOFA 1L2QA 1NQ6A 4IMDA 4AAJA 3WIJA 1UBPC 1DQUA 2W63A 3UETA 3O1NA 2Q09A 1H09A 3U0HA 1P1MA 2VT0A 5DY2A 1U1JA 2FDSA 1T5AA 3D46A 2V5BA 1OF8A 3W7JA 3IIZA 3VIJA 3HGSA 4NRRA 1H7OA 3GVQA 1HJSA