5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
b'NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
1ZBCA 4GZIA 3RM8A 3SCRA 4JCMA 3VIFA 1VEPA 3WUEA 1XYFA 2JF6A 3BAXA 1CGTA 3EDEA 4ZEPA 3VIPA 4DM2A 4WKHA 1KWKA 3SIMA 5D9MA 2DT3A 3RILA 2YA2A 4J3SA 2VUYA 1VIWA 1YQ2A 1AQ0A 1L0PA 1O6IA 2D0FA 4BCEA 3U5UA 1BF2A 2CBIA 1UKSA 3AMGA 3CMJA 4U5KA 5D8ZA 3UETA 1IZJA 5ABFA 1HNYA 3EDKA 4HZ6A 5DFAA 4AY1A 4EKJA 4P8VA 4ZXLA 2Y8VA 2A3AA 1LQ0A 3BMWA 1KBKA 2O9OA 1GQLA 2YA1A 3N12A 1GOOA 3APGA 4N0RA 1B3ZA 3OA5A 1V0LA 2AMGA 3GNRA 4XZBA 1CZ1A 4MNMA 3A4XA 5DT5A 5EBAA 4IPNB 4KGJA 1BYBA 3F5LA 1CENA 2UY4A 2JEQA 4MADA 2WSKA 3PTKA 4BF7A 1WCGA 3PZTA 1DHKA 4P7OA 2VVNA 1XD1A 4W7UA 1NOFA 2WW5A 3AMLA 3THDA 1MXDA 4AD1A 1EDQA 1VB9A 1HKJA 1X6NA 5FKYA 2XIIA 2V38A 4H8VA 5TD4A 2V3DA 4L4PA 1UA7A 3OB8A 4E8DA 1UWIA 2XFFA 2XFYA 3BCDA 3ARWA 1LL7A 1V6YA 1BGGA 3CPUA 4GO9A 1CGYA 1SMAA 3QGVA 2EEXA 1TA3B 5CG0A 3WQ5A 4D6JA 5A8OA 1E5JA 3SCVA 2QF8A 2DDXA 3WD3A 9CGTA 2WKGA 2J4GA 2VI0A 2WMKA 4AC1X 3W29A 2J77A 5I24A 4A3HA 3GNOA 3WDJA 3A4WA 3EDDA 3MANA 5GQBA 2EPKX 4B16A 4NF7A 3N13A 1UWRA 5CGMA 2ZUTA 3NJ3A 2DPEA 1GOMA 3BSHA 4WF7A 2CITA 4HMDA 2C0HA 1S46A 4LYRA 3W82A 2BVTA 1UWSA 1G1YA 4H8UA 5C8BB 3EDJA 2VMFA 1R87A 3HJEA 4BQ3A 1H11A 1JDAA 1MXGA 2BY2A 2XVPA 4QLJA 3B9DA 3KEHA 4KGLA 4PTXA 3W26A 1GOIA 4W89A 1C92A 5M3WA 4PN2A 5HOSA 1TMQA 1G94A 1CPUA 1JNDA 4XB3A 4HP5A 3GXMA 4CN1A 4ATDA 3N18A 1MVYA 3W0KA 3WH5A 1OWQA 1GZJA 5DO8A 4ZE4A 2EPMX 2DSZA 4JFSA 3VIIA 1BFNA 4ZENA 1XYZA 4P7NA 1E40A 1L8NA 3U7VA 3SCQA 4JFTA 4M80A 2WC3A 4M56A 4U3AA 4UTFA 4P7QA 4HMEA 2A3HA 3AI0A 5AYBA 3NIYA 5A6BA 2YIHA 1JIBA 3POHA 1I75A 4E2OA 5A6MA 4TTUA 4QCEA 1CXFA 4LQ1A 2WHLA 4B3KA 1UKOA 3VGBA 1JD9A 2GFTA 4CGTA 2CHOA 2WCAA 4UCFA 2VZVA 2W67A 2GDVA 4D1JA 3ZT6A 3IJ9A 5D9NA 1M04A 1CWYA 1VFMA 5I0DA 3WELA 3NSXA 2NT1A 3U57A 3PBGA 3MV01 1EGZA 3II1A 1WE5A 2JALA 2V3FA 1E6NA 3QOKA 4P8WA 2JIWA 1EXPA 1V6XA 3SCNA 1PIFA 3F4VA 4XV0A 4BA0A 3N15A 4OUEA 3VUPA 2PWFA 2CERA 5I77A 5ABGA 1UQYA 4AD5A 1V0MA 1C7SA 2WHKA 3WD4A 8A3HA 4D6HA 4DUXA 5CSUA 1W32A 5CJ5A 1KWGA 3ZJ7A 4H8HA 2WVVA 1C8QA 1UR4A 2BY3A 3G6MA 3WNOA 4S3KA 4OBSA 2CESA 3W28A 5IHRA 1VJSA 4EE9A 2F8QA 3K46A 3CO4A 3VMPA 4BZYA 4LPCA 1E1FA 5BXSA 3BH4A 3M7SA 5EB8A 4D72A 2WMHA 1UD5A 3WMSA 1PJ9A 4KRUA 4OIFA 3T2OA 2X0HA 1K9EA 1VAHA 3OZOA 4JL2A 3MKKA 4J3TA 3AHVA 2DSKA 1CGVA 2YA0A 3ZJKA 4AZCB 3QHOA 3WL0A 1F4HA 1W1VA 1NH6A 1QHPA 4B3LA 4PCSA 4DUWA 2FHBA 3WMBA 4W8AA 4F79A 1HJSA 5HPCA 4R5EA 4QLLA 4Z2LA 1JYVA 1R85A 4H7VA 2WVSA 1G9HA 3WEOA 3VIMA 1VF8A 1E70M 3GNPA 4PMNA 5CZKA 1QW8A 1B31A 1DEDA 3SCSA 4M29A 2DIEA 1UQZA 5CPQA 3WH6A 3BAIA 1HVXA 1HJXA 1PX3A 4QP0A 3AS3A 2EJ1A 3VM5A 2YLAA 1QI2A 3CUHA 2CBUA 3CHEA 4AZIA 1CGWA 1IT0A 2ZXBA 5GNYA 3WQWA 5EFDA 1LG2A 3ZOAA 1JZ2A 3CBWA 3CZ8A 1J01A 3K1DA 4GI9A 2J79A 3ALFA 2VCBA 5FOOA 3WF3A 4M1RA 4AIOA 4CCCA 3AXHA 1IZKA 3FHQA 4WK9A 3OLIA 3ARQA 4JAWA 5EFFA 4JFWA 3AIUA 3GYCA 4JFVA 5CQ1A 2D24A 5A95A 2WB5A 4IM4A 1B0IA 2J8GA 2WSPA 3BCFA 3KL3A 4TVDA 4V2XA 3SUVA 3M07A 5FCZA 2QMJA 1C93A 1NWUA 3NSNA 5AYIA 3MMUA 2BS9A 1HP4A 3W6LA 4HA4A 2CKRA 3WUGA 1BVZA 4CU6A 3VDHA 1JXJA 4W93A 5I3DA 1R7OA 2BY1A 1GOKA 3CH9A 2VOTA 4PTMA 3BGAA 3THCA 1W2VA 5E0CA 3NYDA 4D6IA 5A2CA 2QLYA 1R7AA 3WNPA 2RGLA 3AISA 2WMGA 3EMCA 1P6WA 1H41A 5CLWA 1XH0A 4UNIA 1GVYA 2VZTA 3W38A 4PMOA 4MJ2A 4QAWA 1XH2A 3W4RA 3PZGA 2XSBA 2WCGA 3LPOA 4GI8A 5IFTA 1QBAA 1XC6A 2BHZA 3WH9A 1Z32X 1E3ZA 3ARXA 1V3HA 2BXYA 1BVNP 1V0KA 4LYQA 4M81A 5KEZA 1FFRA 3OGRA 3VU2A 4IPLA 1HJUA 2D20A 3I3DA 4MDOA 5EMYA 1B1YA 1KXQA 5D8WA 4PSPA 1JZ5A 2VZOA 3KE0A 3D5HA 3TTQA 1E0VA 6CGTA 3WMCA 4HMCA 2G3NA 3I3EA 1V3MA 2ZX7A 1ISZA 2W62A 3OIHA 1J0ZA 3GH7A 1XGZA 5A6LA 1LJYA 5IFPA 1AMYA 3EYPA 3PZQA 4FF5A 1WB0A 3MO4A 5CGTA 1QI4A 3K8KA 1W2PA 5FIPA 1WDPA 1R86A 2F61A 3VD5A 1WKYA 2J7BA 1B3YA 4DWSB 4LYPA 4U2YA 1JL8A 4F8XA 3L4ZA 1WZLA 2V3GA 1ZJAA 4HOWA 4PMYA 1HKKA 3SUTA 5LA0A 3TTSA 5D9OA 3ZR6A 1NARA 3U5YA 1UHVA 5BYWA 1CNVA 1QI5A 4ACYA 2WZEA 4B9ZA 4AZ6A 1BAGA 3L2MA 4W8LA 2UY2A 3WUBA 2VZSA 1CEOA 2UWFA 2GK1A 2FGLA 4W87A 4UFIA 4Q7NA 2Z1SA 2YLLA 4V27A 3SUSA 3FNDA 1MW2A 1JFXA 2IXVA 4HOZA 2EPNA 3O2LA 2G3IA 3LPPA 1MW0A 2W4XA 3WQ4A 3RDKA 1FHLA 1EOKA 1D7FA 5M03A 1UR1A 3VPLA 2E0PA 1UZ1A 1Q6DA 4TX6A 1UD8A 2XGBA 4J3VA 2VO5A 2Z1KA 3WQVA 1E15A 2WNWA 4ML4A 4HPGA 2GSJA 3L4TA 2OLHA 3AIRA 4CU8A 1M7XA 4B15A 1CGXA 1EHNA 2AOSA 3ZIZA 3MUY1 1CGUA 4PTVA 3MV11 3BXWA 4H04A 1FOBA 2OSYA 3PZNA 4JL1A 2CKSA 4YHEA 1JYXA 1MQQA 3AS2A 3PTMA 5A6JA 3KL5A 4CCEA 3KZSA 1HJVA 1ODUA 1HL8A 2VX5A 4PMZA 1H3GA 5DF0A 3AZSA 1MYRA 1UD2A 1TR1A 5AC5A 2FGZA 3VX1A 2XSAA 3GH5A 5BWFA 3WENA 4MB4A 1VFOA 1SMDA 3A4AA 3VIJA 4J27A 2VVSA 2DH2A 5A8MA 4PMDA 4KWUA 4FLRA 2PWDA 2CIPA 3BLPX 2CCRA 1BYCA 3K4AA 1FA2A 1E4NA 1K9TA 1C3FA 4UFMA 4MJ4A 2OYKA 2G3JA 1VEMA 2VX4A 3FXYA 2QV4A 6A3HA 1FH9A 1VFFA 3POCA 3PTQA 1W9VA 2WVVB 1MFVA 4PTWA 1OT1A 1UKTA 4CUCA 5BCAA 7A3HA 3L2LA 5A94A 4AIUA 5M5DA 3WEMA 2WK2A 2UY5A 1JXKA 2WWDA 1NWSA 3GXIA 3GBEA 3ARUA 2VNCA 5A6KA 2XM2A 1US3A 3AXIA 4FLOA 3CUGA 2EXOA 2VQUA 3DYOA 2A3BA 1KCKA 4CCDA 2WANA 3VGHA 3ARRA 2ZUSA 3IAPA 4P8UA 1EQPA 3LPFA 3PZOA 1PX4A 2BY0A 4HZ7A 3U7BA 4P8XA 3ZJ8A 4E8CA 1BTCA 1J0KA 4YN5A 2GJXB 3VDBA 4PRWA 1W91A 3VGGA 1XV8A 3RMEA 1KGUA 2NSXA 3AQUA 2VURA 1A47A 5M17A 1W1PA 1B9ZA 1QHOA 1GNXA 4FMVA 4NI3A 4QDMA 2ZWYA 2XTKA 3ZSSA 1KCLA 3WSUA 1UWUA 3PZMA 1VBUA 3CTTA 4X0VA 3CHCA 1C91A 1UR9A 2YKKA 1OBAA 1XCWA 1E6RA 3W27A 2WKLA 2VRQA 2GDUA 2ZIDA 4M82A 3OGSA 1BGAA 4UQDA 1QVBA 5CXPA 1Q6CA 4NRSA 4RL3A 3ECQA 4LX4A 3AIEA 1NP0A 3AIWA 1CECA 3ZMRA 5BXPA 1UH4A 5E6ZA 4HPHA 1NOWA 1PAMA 4AEFA 1OGBA 4PMQA 4WIWA 2J7GA 3DYPA 1EIBA 4RE3A 2XPKA 3F5KA 3UERA 1WDQA 2ZXAA 1ZBKA 4DWSC 1EQCA 4FLSA 4AD0A 2OWWA 3AYSA 1QI3A 3VD3A 4CD6A 2XVGA 3NCOA 2WVTA 7CGTA 1MFUA 4MB1A 3ZJ6A 5A6AA 2W92A 1J9YA 4TTGA 1HN1A 3AHZA 1UWQA 3VD7A 3O6AA 3S2CA 4AISA 2DT1A 1C7TA 5ABHA 4AZGA 4C7GA 4AW7A 5FL0A 1FP9A 2DEPA 5A8PA 2ZX5A 2J78A 1QI0A 3AIVA 1TG7A 4D71A 3GBDA 2DSUA 3VIKA 4L4OA 1K6AA 3A3HA 1AVAA 2NT0A 1HIZA 3AIBA 4J28A 1V6WA 3DYMA 2ZX9A 3VGEA 3PZIA 1WAWA 3MUZ1 2Y5EA 1QNOA 4CD8A 3UEQA 1WZKA 3WQ6A 5DMYA 1GOQA 4ATLA 3N11A 3F5JA 2E40A 1EOMA 2X05A 1EDTA 1E4MM 1U2YA 1CXHA 3UG5A 4OJYA 1V02A 3FN9A 2ZUUA 2EBNA 4IISA 3WY1A 2ZXDA 4WSJA 4PUEA 1YHTA 2DH3A 2OWXA 1FHDA 4TX8A 1DWHM 5CLTA 1JGIA 1QOXA 1JI2A 3WD2A 1JF5A 4NSBA 1E0XA 1V03A 3RM4A 1E72M 3IJ7A 4ACZA 4PYSA 1Y7VA 1BSIA 3VMOA 3GDBA 3CMGA 1G01A 3E1F1 1CDGA 1FP8A 1V6VA 1J10A 1KFWA 1N82A 1VFUA 1B3WA 1EO5A 1W1TA 2DQXA 3CGTA 1JYWA 5LA2A 2HVMA 2A3EA 5A2AA 5JBFA 2XIBA 1W1YA 3VMNA 2XVNA 1RD6A 1V08A 2FH8A 1SFSA 4JKKA 3CHFA 3W53A 4PMUA 2WYSA 2YBTA 2JF7A 1V02E 4FK9A 5I2UA 3WNNA 2D2OA 3WDRA 1ESWA 1WNOA 1QNRA 3UCQA 2WLZA 4BS0A 3UG4A 2VX6A 4QFUA 2G41A 4IUGA 1HJQA 2XVLA 3PZUA 1MWOA 4CN6A 4AD3A 1AQMA 3A47A 5HXMA 2YL9A 1H1NA 4UQCA 3RO8A 4WSKA 3ALGA 3QHMA 5A69A 1J18A 2J74A 4D6CA 1EA9C 1BG9A 5E70A 3LPGA 1OSEA 4A3YA 4GQRA 4AEEA 1MW1A 4J3XA 3CUFA 5BXRA 1VRXA 1BLIA 1CLXA 2G4FA 3QOMA 1UR8A 1XD0A 1CXLA 4W5ZA 2WHJA 1H0IA 2XYLA 1JDCA 3K8LA 3ARYA 1TVPA 5LA1A 3W24A 3WDHA 2BHYA 1JZ7A 1C90A 3A6OA 2ZUMA 4GZJA 1J11A 3WDIA 2EQDA 3BAYA 3TTYA 1H2JA 1R8LA 1PBGA 4CVWA 3VD9A 2BFGA 1G5AA 2QMKA 3PZ9A 5D4YA 2W63A 1K9DA 4JKMA 2EPLX 4AIEA 1VBRA 1NWRA 3WL1A 5ABFB 4UQ9A 1H5VA 2ZICA 5A1AA 3QHNA 4WJXA 4MNLA 3SCOA 3T0AA 4UOJA 2FHCA 1NQ6A 2WVUA 4MB5A 1UOKA 1E6SM 1ISVA 2BVYA 2DIJA 4AYSA 2CEQA 3W81A 2XFRA 3PN8A 2XVKA 1DWGM 6TAAA 4W84A 4OKDA 2ZX8A 2J62A 2WXDM 5GNXA 4GO8A 2J47A 1JAKA 1E9LA 2JIEA 3UG3A 1OCQA 3UR7A 3ARVA 5JBDA 2O9RA 1KXVA 2PWHA 4GPNA 4ATWA 1B2YA 1GHSA 5A3HA 3CLWA 5IXEA 1FH7A 2OYMA 3T09A 2YL8A 2E8YA 1QW9A 1RP8A 2X2YA 1DWIM 1GUVA 1E55A 3AMKA 4BQ4A 1V3IA 3WQ8A 1E3XA 2VZUA 2WMIA 4M24A 5I5RA 3CHDA 1GQIA 3N1AA 4QCFA 2ZUVA 1UWTA 3NUKA 1OGGA 1JD7A 4CN4A 3WH8A 1OIFA 3EMQA 4HA3A 3W25A 4J3UA 1CXIA 1SYTA 4CD7A 1V3JA 4UFLA 1CXEA 4D6DA 1EO7A 2XWDA 2PC8A 3VNZA 2PWGA 2Q8XA 3AOFA 2BHUA 1ZJBA 1CTNA 4CD4A 2EPOA 1UD3A 4PSRA 1B30A 1E6PA 1GVIA 4BQ5A 4JKLA 4OOZA 1GPFA 1OINA 4JHOA 1W3HA 3VIOA 3ZT5A 2F2HA 1NP2A 3VDCA 1O7AA 5E0FA 5AC4A 5C71A 1ZU8A 3GM8A 4QLKA 4AZBA 1PX8A 4AMCA 3JUGA 2GVYA 1VENA 4MDPA 3VVGA 1K9FA 1MW3A 2IXUA 3IK2A 1NWTA 4DUVA 2YBUA 3WBEA 5HPOA 1TVNA 1HVQA 1E6QM 2Y8KA 2X8RA 5E9AA 1FH8A 1OIMA 3EDFA 5JIPA 4U5IA 2YJQA 1W9DM 2X09A 2OSWA 3WIJA 5IHSA 3DC0A 5GNZA 4ZFMA 3WUFA 1Q4NX 1DWFM 1I1XA 2DT0A 1HKIA 3O9NA 2OWCA 4C7DA 1CLVA 4EAMA 3AS1A 4UQEA 2PB1A 5JUVA 2E8ZA 1UG6A 3OLEA 1QNSA 3VDAA 3NDYA 3SUUA 2CBJA 3WFLA 1H09A 2A3CA 4D6GA 3DECA 4Z2HA 2WWCA 4JFUA 3VIHA 4UZUA 4D6EA 3ZM8A 1E6XM 1TUXA 2YDRA 1HF6A 5ECUA 1E5NA 4PCTA 3FHAA 2WC7A 1VJZA 2ZUWA 3RPMA 4S3JA 7TAAA 1GORA 2C8NA 3RJXA 1XCXA 1ODZA 4P7RA 1BG4A 1PIGA 2W61A 1CYGA 1NOUA 1DWJM 2QPSA 2ZXQA 2ESCA 1TZ7A 3FY1A 2JFEX 1W3JA 5HDRA 3CUIA 4J7RA 3B9AA 4W7WA 1W9UA 3HN3A 1W3KA 4N42A 3SCUA 1M53A 2CPUA 3HMCA 1I1WA 4NZCA 2J8FA 2VJXA 1RP9A 4ZE5A 1M01A 1WO2A 3GXDA 2CETA 3AMDA 2ZX6A 4RE4A 2W5FA 1ZB5A 1JDDA 1X1NA 3SCWA 2BVDA 2IUZA 2QHAA 3DHUA 4EK7A 3WH7A 1BHGA 4MNKA 1A3HA 1MQPA 3WEZA 3D3AA 3WF2A 3TA9A 1OD8A 5JIWA 4ACZB 3ZO9A 5LYRA 1GJWA 4EANA 2WZIA 2J75A 1UZ4A 4XZWA 2BXZA 4UOQA 2DSWA 2NW0A 5BRPA 1U30A 3MU7A 1B3VA 3AHYA 4HTYA 1W9BM 1NM9A 3WNKA 3UESA 2Y24A 5HNNA 4AXNA 1ITCA 3MUAA 2WBKA 4PUDA 2EO7A 1B3XA 2XG9A 1ZL1A 2ZOXA 3DHPA 5FD0A 1D3CA 5E6YA 4UR9A 2O9PA 3T0BA 2E9MA 3BAKA 3VNYA 3B9EA 4YPJA 4DWSA 1KR1A 4TVCA 4OOUA 1D2KA 4D6FA 1J0YA 3MS8A 5CPSA 1UYQA 2FH6A 4WLCA 4JHZA 1LL4A 5BXTA 2E9LA 4U33A 2ZWZA 2J7HA 3OBAA 3VO0A 1US2A 3ZSTA 1KQZA 2D0GA 3T08A 5IDIA 1HXJA 2WBGA 3ARZA 3OLDA 2J7DA 1E73M 1HL9A 3B8SA 5KZ6A 5HBFA 1UR2A 1HKMA 2PI6A 4PMVA 1DTUA 1BYDA 3BC9A 4W88A 1LG1A 3ZR5A 4MNJA 3PZVA 2HISA 4AD4A 2B31A 4TUFA 1JI1A 1G0CA 3MMWA 2V5CA 1OGSA 2Y2WA 1J0HA 3L4WA 1LWJA 4F66A 3AJ7A 5DEZA 2O92A 5BROA 3WNLA 1GW1A 3VINA 4TXEA 1IV8A 4CVUA 4GINA 5A8NA 1KB3A 2WLYA 3WKZA 3LMYA 3L4YA 1LWHA 1GJUA 4Q22A 4F9JA 3WDQA 1XRVA 1OB0A 4MAVA 1V6UA 4TVUA 4K68A 3OG2A 4F9DA 1M03A 1E4LA 2X1IA 5I23A 2BV9A 2YL6A 2V5DA 3NSMA 3AHXA 3WD1A 5A2BA 4W7VA 4Z2KA 3SURA 5C70A 5CSYA 4HOXA 1Q6EA 4DWSD 4PMRA 1E71M 4Z2JA 2J7FA 2D1ZA 2YL5A 3MSGA 2G3MA 3UR8A 4W8BA 1DWAM 1W9PA 1UD6A 2JEPA 1LL6A 1PZ2A 4HU8A 4CKQA 4OZOA 2TAAA 2WM0A 1E56A 3TTOA 4MAZA 4UOZA 3J7HA 2Y4SA 4KRTA 3K8MA 3CZGA 3FAXA 3IJ8A 5DT7A 4E4PA 3QR3A 1KQYA 2VT0A 2XM1A 1JZ6A 3T0DA 3CZLA 2PWEA 2WMJA 3CIVA 3VTRA 3ZT7A 4ZXOA 1J0JA 1OM0A 1E6ZA 2YDSA 3N9KA 1UA3A 3WD0A 1JYNA 1U33A 3BMVA 2W91A 3OZPA 4UZSA 3CZEA 5JBEA 1TE1A 4AZ5A 4W5UA 3WFZA 4HA1A 2WMIB 2E4TA 3IANA 4MPKA 5I6SA 1UKPA 3W6MA 2WAGA 1XSJA 3W37A 1ZBVA 3VILA 4PMXA 2VCCA 2MANA 4FLQA 4MTVA 4MB3A 1TA3A 3HU7A 5A6BD 1UKQA 1WDRA 1ZBWA 1BQCA 4LGXA 2QPUA 4UFJA 1GOWA 3WF0A 1TCMA 1J12A 3TP4A 2G8ZA 2V3EA 1OT2A 2FHFA 2WHMA 2WPGA 4UQAA 3BLKA 3GXFA 3G6LA 4CU7A 1KGXA 2GJXA 3CZKA 3S6TA 5GPRA 2UY3A 2XUCA 1V3KA 2DGAA 1KXTA 3N04A 4KH2A 4Y7EA 5CPTA 3NDZA 1LF1A 1HT6A 5D9PA 2J25A 3BAJA 1PPIA 3RJYA 2CNCA 2VTFA 3T2QA 4A4AA 1FFQA 1WZAA 5ABEA 2O9TA 1UH2A 2D22A 2GK1B 2D0HA 1E1EA 1AQHA 3SCPA 3MMDA 1PEZA 1SR0A 3WN6A 5A8QA 3WBAA 2YDQA 1JZ3A 1WP6A 4Z2IA 1KBBA 3L4XA 4H2CA 3CUJA 1EHAA 4RE2A 4B9YA 1E43A 4PEEA 4W85A 3MUIA 3WF4A 3M46A 3SUWA 1C8XA 1HP5A 4AWEA 4GXPA 3VGDA 4WKAA 1E4IA 5AY7A 4CD5A 3AYRA 2XHYA 3GZAA 1UH3A 2J7CA 1UD4A 2CHNA 3AROA 4YHGA 1ISWA 3EBVA 1JG9A 1JF6A 1JNEA 3AZTA 3TOPA 1QHZA 3AIQA 1RH9A 3OLGA 1XHGA 4U31A 2DT2A 3T2PA 2D3LA 3VM7A 2WCSA 2CBVA 4HZ8A 3RCNA 5BRQA 2JE8A 1BYAA 4W86A 1GONA 4LXFA 3GH4A 2VX7A 4URIA 4PBGA 3K4DA 1TFVA 3RIKA 3WDPP 1MQRA 4XX6A 4UFHA 2XWEA 4GZEA 4WKFA 1KGWA 3AHTA 1JZ8A 4U3CA 1Q6FA 4HU0A 3VIGA 1CBGA 1ISXA 4NRRA 2ZUNA 1V0NA 2E9BA 2AAAA 4UFKA 1GHRA 2PBGA 4DM1A 4M8UA 4AD2A 3FAWA 3ARTA 5FL1A 1UR0A 1HJWA 4X9YA 2WMFA 1C8YA 1GQJA 1B90A 4KMQA 1GQKA 4JIEA 4AZ7A 1QPKA 3N17A 1KR0A 4D1IA 3VX0A 4GIAA 1F4AA 2YOCA 4J3WA 1H4PA 2XJ7A 4U2ZA 2DSVA 2PF0A 2E3ZA 5E09A 5A6SA 4P7LA 2C7FA 3I3BA 3ZQ9A 3L4VA 4C7FA 3ARPA 2XGIA 1UUQA 3VOCA 1GCYA 4TOQA 1J0IA 3KL0A 4AZCA 4X0NA 2D23A 1ITXA 4UQBA 1DP0A 2BNJA 1PZ3A 2FDMA 2GJRA 2CXGA 2OSXA 2OYLA 2D3NA 3RM9A 4OBRA 2VCAA 8CGTA 1QBBA 3AFBA 4JZ5A 3L4UA 4BQ2A 3VKKA 1QNQA 1XH1A 1Q6GA 4R27A 1WZMA 1LLOA 2VRJA 4GI6A 4JCLA 2VQTA 2VC9A 1WDSA 2WZHA 2PBOA 1QNPA 2WC4A 1ECEA 1W9XA 1WPCA 2X0YA 3BSGA 2W66A 4H41A 3AICA 4XUYA 2VL4A 4GQQA 3VD4A 1EH9A 5F7UA 3KWXA 3VGFA 1JFHA 2ZE0A 1EDGA 2RGMA 3IAQA 1XSIA 3ARSA 3WF1A 5I79A 3SCTA 3AMCA 1XSKA 4AZHA 3AZRA 2GUYA 1OD0A 1X6LA 4GKLA 4Z2GA 2CYGA 3WNMA 1JAEA 3BAWA 3OGVA 5I78A 1RPKA 3EMZA 1HX0A 1CIUA 1CXKA 3AS0A 2VRKA 1JZ4A 3M6DA 4V28A 2J7EA 1W3LA 2GJPA 1ZS2A 1E0WA 3CZJA 1V3LA 3AXXA 3TONA 3PHAA 1BPLB 1KXHA 1ISYA 1VEOA 3SEPA 1H49A 2VR4A 2VR5A 3FW6A 3GTNA 3MSDA 1H0GA
chains in the Genus database with same CATH superfamily
4GZIA 4H6KA 4MJZA 4DN1A 1VEPA 4ICNA 1ENUA 3EDEA 1KFEA 1IIGA 4XZIA 3WLQA 1JEZA 2DW7A 4YVVA 4PE8A 1KWKA 3WLLA 1DJQA 3MVTA 4FXSA 3E5BA 5D9MA 4J3ZA 2VUYA 2GL5A 1YQ2A 2WV8A 1H51A 5U4NA 1SJDA 4A29A 4NASA 4LAMA 1UKSA 4JTRA 1A5UA 2Y5SA 2QS8A 3EDKA 2HBXA 3TOYA 4B5NA 4CQCA 3DBPA 3M0JA 3OTRA 4G8TA 3QTPA 4MKVA 1K4HA 3QEZA 1EPVA 3N12A 4HD5A 1B3ZA 3HGRA 1J5SA 1RVKA 2QULA 4IQEA 4IPNB 4ZSUA 2W79A 2Y7GA 1P0BA 2XFWA 3IACA 3F5LA 5KITA 4BF7A 3C8FA 4C5YA 2A7PA 1NOFA 2NQHA 4PRRA 3THDA 5KMYA 2V2HA 1X6NA 5FKYA 3TJLA 3VAVA 2XIIA 3CWOX 2ZA2A 4L4PA 4FXFA 2YPIA 4C1LA 1B9BA 3TJIA 2XIQA 3DFPA 3CUXA 1BGGA 3CPUA 3BOFA 3BZGA 2YCLB 1DBTA 3VOGA 2Y61A 1TZZA 4LJ3A 3TXZA 2O7SA 3TC3A 3F7JA 1E5JA 4HCDA 1UMLA 4MY8A 3HGJA 2E25A 3PK7A 5I09A 4BFAA 3WO8A 3WDJA 4RZ6A 3A4WA 3D0CA 4A8RA 4ZR8A 4XISA 4B16A 3NO5A 3N13A 3R5EA 2Z2AA 2XDFA 3I7SA 5K9CA 1NFBA 4UTHA 3GTIA 4Q4KA 1ONWA 3KP0A 2CITA 3W71A 3M5ZA 1ZTVA 1H1ZA 3N3TA 4HMDA 1OFQA 2VD8A 2BVTA 3B8TA 1G1YA 3SFKA 5C8BB 5EA9A 2VMFA 4AVFA 1KBLA 2OGYA 1AW1A 3HJEA 4BQ3A 1H11A 1MXGA 2P0OA 4QLJA 3USBA 4P61A 3B9DA 4LOCA 4KGLA 4PTXA 1C92A 5CCZA 5E5CA 4IP4A 5G1TA 3DX5A 4CN1A 3QC3A 1GW9A 1BFNA 3WLIA 3INPA 3W1LA 4ZENA 4DY1A 1XYZA 2E28A 2R1NA 1DIEA 4D8LA 1PB0A 2WC3A 4DJDC 2R6OA 4U3AA 2PWVA 5AYBA 3AI0A 5HQEA 1IIHA 4O1FA 3VXGA 3QBUA 4DJFD 1J4EA 1JIBA 3GAKA 1I75A 4HK6A 5A6MA 5AKQA 4AVOA 2WHLA 1Q6LA 1WOAA 2QKFA 3VGBA 3MBFA 1JD9A 4WXZA 4JX4A 3A22A 4FSAA 1QNVA 2GDVA 1QK0A 3IJ9A 4XBSA 3LCGA 3GDKA 5I0DA 3WELA 1TWZA 1XUUA 2C1GA 3U57A 3MV01 3TLLA 3II1A 3ENLA 4AB4A 2V3FA 1Q63A 3QOKA 1F73A 1RQBA 1EXPA 3FIGA 4OUEA 3NO1A 1UP3A 5ABGA 5I77A 2EAWA 1GT8A 2E6YA 1DJYA 5MKGA 3E0IA 3EKGA 5FJJA 3WLHA 1WXJA 3DHFA 2A7NA 5CJ5A 3ZJ7A 1YKWA 3GTFA 3PVFA 1C8QA 1UR4A 1WUEA 4HSHA 2E09A 2CESA 4RX0A 4K7YA 4ML9A 2QCEA 3K46A 2X30A 2CZ5A 3CO4A 3GE7A 4BZYA 3QFEA 1U22A 3EOOA 3BW3A 5CAKA 2CXEA 3MDUA 3WMSA 1PJ9A 4KRUA 3T2OA 3SW6A 4JL2A 3LK6A 2E5CA 3P8IA 1CGVA 3C61A 4AZCB 4GOAA 4IF2A 5F4SA 1QK2A 3T44A 2OT1A 2PLMA 4W8AA 4N2YA 1VKFA 4XKYA 1JYVA 2WVSA 1G9HA 3LGDA 3M5XA 1E70M 1IEQA 5CZKA 2KAUC 3MHUA 1QW8A 1B31A 3SCSA 4XVEA 2INZA 1UQZA 3NR0A 1HVXA 1UZDA 5HATA 4XVDA 1YRRA 1ZAHA 2V68A 4PB3A 4R7WA 3V5OA 5FA5A 3VNIA 3CUHA 2IPWA 5CZ0A 4AZIA 2DVTA 1IT0A 2ZXBA 4I5RA 5EFDA 1A49A 4Z17A 3EWUA 3WQDA 3PWAA 3ALFA 2DZPA 2PP1A 4JTQA 4CCCA 1OFOA 1IZKA 3OLIA 3UZYA 1UIPA 2PDMA 1EWDA 3TQVA 1W6TA 4A8LA 3TVAA 5A95A 4ZQNA 3MZNA 4TVDA 3FYYA 4JN8A 5G5IA 2GSEA 3HJZA 4TX9A 1ZFJA 2PPGA 2QMJA 3QF0A 4JNYA 3HPFA 2VEIA 3P61A 3IV3A 1K7EA 3WUGA 4DVOA 4X60A 1FXQA 1E9IA 2PDWA 4OV4A 3UD6A 1EJ7L 3R25A 1GOKA 4RNHA 2VOTA 1Z41A 3GK0A 1W2VA 2NXIA 1XLKA 5A2CA 1R7AA 2WJEA 3WNPA 2RGLA 3UFYA 3AISA 4JOMA 2QGHA 3EMCA 1WBHA 4BI5A 1YBQA 4INFA 3OPSA 1AJZA 2VZTA 4PMOA 2WQPA 3EA3A 3MCNA 2XSBA 3W7HA 3N6QA 1ME9A 1XPYA 2BHZA 3IVTA 4K3ZA 3WH9A 1A5LC 1BVNP 1V0KA 5CG7A 4NILA 3KBMA 4M81A 4KIRA 1GGOA 4WR3A 5KEZA 1QUMA 3R0UA 4MWAE 3VU2A 1HJUA 3C2OA 4MDOA 4Z1BA 2AKMA 4WDXA 4O1CA 4Q8MA 4LUSB 1B1YA 1HGWA 3VC5A 3O0KA 4PSPA 1JZ5A 4ROPA 3ID7A 2Z25A 2X1SA 2Y1HA 5HMEA 3GIPA 4HMCA 2BGQA 2G3NA 2QDEA 3TNOA 2W62A 3DIPA 1S2AA 1J0ZA 4NJIA 4NJKA 5IFPA 3RITA 3PZQA 3EYPA 2RDTA 1QI4A 1IXOA 1WKEA 2Z24A 3NM1A 3W1MA 3AUOA 4AYGA 3Q37A 3RLVA 2C71A 3JZEA 4LYPA 3JVAA 5E1QA 4BK9A 1ICPA 1WZLA 4UTWA 3QZEA 4HOWA 1M65A 4E3VA 3SUTA 3TTSA 5D9OA 3K2GA 3MCMA 4YYCA 4W4QA 3G1XA 3L2MA 3UZ5A 5HK4A 1K02A 1KTBA 5LXEA 1CEOA 3QVQA 2AQVA 4PBFA 5K9XA 2GGIA 6ENLA 3ITYA 3NQFA 1J6PA 5BU9A 4IT1A 3FNDA 1MW2A 1JFXA 2VGBA 1EJWC 4FA3A 2GYIA 2P8CA 2G3IA 1J96A 1MW0A 3WQ4A 1EOKA 4C6QA 3VPLA 1XINA 1UD8A 3P6LA 4J3VA 2WNWA 5CSSA 2JKAA 1EHNA 2AOSA 3LLXA 4NU7A 2Z1WA 4PB4A 4PTVA 3VKDA 4GY0A 3S1VA 4YHEA 4L1XA 4PUWA 5T91A 2GQAA 1NAL1 2FVLA 3UF9A 3PSVA 1PIIA 1PKNA 3PTMA 2OLSA 3W73A 2TRSA 2OPJA 3LHVA 1ODUA 3FJ6A 2CLIA 3BDKA 3R43A 3QYQA 5DF0A 1UD2A 1TR1A 4KFOA 1TIMA 1SMDA 3VIJA 5JQ9A 1XRFA 1EJUC 1H62A 1OX4B 3IGXA 2NWRA 1DJGA 5AZ0A 2CCRA 2HNEA 3K4AA 1R2RA 1DL3A 4XAZA 3U2OA 4MJ4A 4KWOA 1VEMA 3FXYA 1R2SA 4MSSA 3PTQA 1W9VA 3DKLA 3M4HA 1OT1A 1UKTA 3C2VA 4YCPA 3KOYA 3ANYA 4UMAA 4KWWA 5AHMA 2VEFA 3IEBA 4F0MA 3L2LA 5A94A 2JKPA 2Z28A 5K4ZA 4C60A 3GXIA 3RMJA 5M2FX 4M7TA 3ARUA 3AU6A 2VNCA 5A6KA 4ASTA 3TMLA 1YTDA 3P3BA 2EXOA 3DYOA 2A3BA 3BJSA 2BTMA 2DVXA 4O50A 1DKWA 3ABZA 3IAPA 4KCUA 4WDUA 3GYEA 4KFPA 2BY0A 3SBFA 5LHFA 3UZXA 2CLHA 4P8XA 3XINA 3N2XA 2ZA1A 4YN5A 2FGBA 1KGUA 3LENA 3AQUA 2VURA 4H9MA 2V5KA 3NEHA 3AALA 5REQB 2X1TA 4ADTA 4NI3A 4JX5A 1EX5A 3ZSSA 3WSUA 1UWUA 1UR9A 4L65A 1MRAA 1OBAA 1XCWA 3LCFA 2BXVA 2WKLA 1VFHA 3EB3A 3P0WA 4PGLA 1QATA 4RL3A 1NP0A 1UH4A 1NOWA 5CPLA 4PMQA 2A7RA 4L9ZA 4B5XA 1EIBA 4RE3A 3VFCA 3RLGA 1K7XA 5LNVA 1NF0A 4G1NA 1XXXA 1LOSA 3OBEA 4DWSC 2OELA 1A0CA 3VKAA 3UZZA 2J6VA 4DELA 1QASA 4ERAA 1SFTA 2XVGA 2WVTA 7CGTA 1VGAA 4XZ9A 1BXBA 1MFUA 3RU6A 3UWVA 2VXNA 3BO9A 3B40A 3WLTA 2OCZA 4HT3A 3VD7A 3O6AA 5EMLA 5ABHA 4AZGA 3RK8A 4AW7A 5FL0A 3LM7A 3IGSA 2YDAA 1TG7A 1WKFA 2I7GA 3L21A 4L9XA 3AJXA 4GVHA 4L4OA 1AVAA 1ZAJA 1KFJA 4DJDD 3UCDA 1EP1A 2FMOA 1SU5A 3MUZ1 1TCDA 4QS5A 5AB3A 3MWAA 4ATLA 4Y8EA 3KRBA 3G8EA 2X05A 1EDTA 4JX6A 4J35A 3KHDA 4RDWA 2QNEA 1R3WA 3OW1A 4CEXC 2ZXDA 3ME3A 1KA9F 4GK8A 1K4GA 2V2CA 3OQEA 3PM6A 2YCIX 3VOFA 2OWXA 1FHDA 2H9AA 1QOXA 2ANUA 4MUPA 3WD2A 3T6CA 1E0XA 3MVIA 3RM4A 1E72M 4YWSA 3QYSA 3WBWA 1SFJA 3W84A 1E1CB 1G01A 6ALDA 4AUBA 1KFWA 1N82A 3W01A 1B3WA 1N8FA 1I45A 2DQXA 1KFLA 1GTHA 2HVMA 2A3EA 3N3MA 5JBFA 5FJPA 3AC0A 5K4XA 1SFSA 5AN7A 3L65A 8XIMA 1XIHA 3BJTA 2PDLA 3OVQA 3CXOA 4A05A 4FK9A 2INEA 5I2UA 3WDRA 3U9IA 1ESWA 1TO3A 1KRBC 1QNRA 3M41A 3W7LA 3OODA 3UG4A 3GW3A 2V67A 1DE5A 1YPXA 3PZUA 4RNJA 1MWOA 3H55A 3ONBA 4AD3A 4G5DA 3DGRA 3UR5A 4HSNA 4DXVA 3PFRA 1XBZA 2J74A 4LF1A 1AL7A 1EA9C 1BG9A 5E70A 2VC6A 3CQJA 1VFSA 4TU1A 3JW7A 2OG9A 4AEEA 1MW1A 3EX1A 4J3XA 3CUFA 1VRXA 3GKAA 1QPQA 2QUUA 2G4FA 2A4AA 3QOMA 1PO9A 5CAHA 3LD5A 2YFNA 3ANVA 2I57A 4HK7A 2EKCA 1Y8BA 4IL2A 1DV7A 3M0HA 2BHYA 4LVGA 3ABOA 1C90A 5T9CE 1XLEA 1AJ0A 1R8LA 5EMJA 3RU8X 1T6MA 2ZCGA 3KBWA 3GS6A 1J2BA 2TPSA 4JKMA 1VBRA 4HKPA 5FJTA 2G37A 1R47A 1O94A 2ZZ6A 3C86A 3IUIA 3FSTA 5A1AA 1S39A 3WK1A 3PR2A 2FHCA 3R12A 1BWVA 1FWGC 1UOKA 5FAJA 1ISVA 1TPDA 3HO8A 4JR5A 4AYSA 1EJVC 3S5YA 4GD0A 2XN1A 3VOHA 3HFYA 5I02A 2XFRA 3PN8A 3SN0A 2OGJA 4OKDA 2JIEA 3TROA 3H6OA 2I1OA 4O14A 3QY6A 2O9RA 1KXVA 3G0XA 3T7VA 5JBDA 4GPNA 1B2YA 1UBSA 5IXEA 1OABA 2YL8A 3N4FA 1RP8A 5AHIA 4O0ZA 3KBJA 1I0DA 3AMKA 4M24A 1XC4A 1GQIA 1Q85A 2G96A 4ERIA 3WQEA 5G2WA 1OGGA 1KO0A 3TLQA 1IEVA 1LRQA 2OR2A 2WJDA 3S9IA 2DQWA 1EC7A 1FHVA 1V3JA 4KERA 4I9JA 1F61A 1EO7A 5HINA 3PJWA 1CTNA 4PSRA 3GO2A 3KUMA 4PUUA 4RNFA 1GK8A 4N4QA 3P62A 4BQ5A 3PUEA 4QX4A 1Q45A 2R1KA 4UTJA 3E02A 3NL6A 3ZT5A 3N14A 5F2IA 5AC4A 2PTZA 1OFRA 4A3UA 4ZOBA 4E3TA 4HNOA 3GHSA 3HM7A 4KT2A 1PX8A 3H4XA 4MDPA 3VVGA 4LB3A 3IK2A 4U10A 1JRCA 4DUVA 3TFXA 5H91A 2IKIA 4FI4A 3WBEA 5HPOA 2V63A 2Y8KA 4U28A 2P50A 5GJMA 2OSWA 3WK2A 4HB7A 3DC0A 4ZFMA 3RR1A 4A21A 4JS3A 1Q4NX 1SJBA 2WM1A 2OWCA 2VFIA 5G4WA 1EGVA 3FVDA 3A21A 3LXAA 1CB7B 1TJRA 1V79A 4O4WA 3NDYA 3WFLA 4JTTA 4YWIA 2A3CA 4GXWA 2X16A 1N7KA 3S4TA 3R94A 1R3QA 2VEPA 2C1IA 4Z2HA 4H6RA 4WHBA 3ZM8A 3RGTA 3K13A 3GR7A 3TSMA 5ECUA 4ZB2A 2J9ZA 3STGA 3PWGA 2R24A 2WC7A 2ZUWA 3ICJA 7TAAA 2C8NA 1H7XA 1W1IE 3I4KA 4P7RA 3FEMA 3TIMA 1CYGA 2ESCA 5IM51 4GC4A 3HBLA 2Y6ZA 1XQKA 4DYKA 1OK6A 4W7WA 4NZ5A 3SGZA 5I3KA 2CPUA 3QZAA 4NZCA 1RK5A 3D6NA 4ZE5A 1M01A 1WO2A 4P5UA 2CETA 4RE4A 1TR9A 4AHQA 5FSDC 1JDDA 3W76A 1QRQA 4DZAA 2OLAA 2BGNE 1A3HA 3WEZA 3D3AA 5D2XA 3GC2A 4HYWA 3CQHA 1OD8A 4LUSA 1JJKA 2NQZA 4ACZB 4KPLA 3H2OA 4EANA 4C6IA 1LDCA 1UZ4A 2D2GA 2QCMA 4UOQA 2NW0A 1L6YA 4EPEC 4PTNA 3DDMA 2V6AA 2I5IA 1W9BM 2WPBA 5B80A 1KC7A 2EKGA 3OJGA 2Y24A 1Z8AA 2W6RA 1ITCA 4PUDA 1D7KA 3PBMA 3EA2A 1TPC1 3OBKA 1O4UA 3CC1A 2E9MA 5EU9A 4L56A 4YPJA 1PKLA 3EPOA 4ZCWA 3V0SA 3IJLA 2E9LA 3T07A 5D30A 1US2A 2D0GA 4XZLX 5HWJA 3NQCA 2FZMA 5FF7A 3LTPA 3OLDA 4ORIA 5C9ZA 1HL9A 3B8SA 1UR2A 2GZXA 4R7JA 4R34A 1DTUA 1BYDA 2PLCA 3ZR5A 5G2IA 2B31A 4LVAA 7REQB 1OGSA 4LUIA 4V1YA 4H3DA 4Q7BA 2OX1A 2X7WA 1KB3A 1RXOB 2H3DA 5AZ1A 4FR1A 5D2TA 4WX2A 2F6XA 1EEPA 1LWHA 2QVHA 3R2GA 4LS2A 1XRVA 3W2KA 3TC7A 3MWCA 2CC0A 3LY0A 4RV3A 1Z42A 4ADUA 4F9DA 2NWSA 1M03A 1LOLA 5I23A 2BV9A 2YL6A 4ERGA 4J1OA 4MWAB 2NX3A 1XGEA 1XLCA 1T40A 4O54A 4XAPA 5C70A 4PC8A 3TA6A 4DWSD 3W7OA 4Z2JA 2J7FA 4QHRA 1KM4A 4PODA 3HTWA 2W27A 1V6TA 3E96A 3U6WA 5HMFA 4CLMA 4O8AA 4FIRA 4AC7C 2TAAA 2WM0A 1E56A 1EWEA 3J7HA 4NAEB 2Y4SA 1FWWA 4KRTA 3K8MA 1T7LA 3MB9A 2IKHA 3QR3A 1KQYA 3CZLA 2WMJA 1MXSA 3T81A 3N9KA 1DJXA 3WD0A 1JYNA 2QIWA 3A3WA 3BMVA 1TWDA 3OZPA 3NZPA 4FNRA 3WX7A 3IANA 4CQAA 1VFLA 3W6MA 2PZNA 2WAGA 1VCVA 4O1BA 3GVVA 3VILA 1XX1A 3QV9A 1DYSA 3M7WA 2VCCA 3E2RA 4MB3A 1XLFA 4A6GA 3CL8A 2RJHA 3SRDA 4GBDA 2FMNA 1BQCA 4LGXA 5F2LA 1TV2A 4UFJA 2QCCA 4LS1A 1V5XA 1JPHA 5E0KA 2WHMA 3SQMA 3KOXA 2P1FA 3WG6A 2PGEA 1IXNA 3CZKA 3GR8A 3S6TA 5GPRA 5DXYA 2DVUA 2YGYA 2DGAA 3N04A 1ZCCA 2GGJA 3FSUA 3NDZA 1HT6A 3F1QA 2C6QA 1REQB 3W2LA 3DERA 3P84A 3OZMA 2VTFA 4DHGA 4ILSA 3LHUA 3PF3A 1TTPA 2O9TA 4XIMA 2D0HA 2Z00A 2J27A 4YS1A 2JQXA 3MMDA 1IE7C 4JQ3A 3H7UA 1EC8A 4L4LA 3W74A 2V0TA 2QIIA 1EJTC 3L4XA 4JTSA 1HKVA 4B9YA 4HYVA 1BXCA 3TJXA 5D03A 3S1UA 2RUSA 1E4IA 2GVJA 1EUAA 4CD5A 3MMTA 3GZAA 4FX8A 2J7CA 4L9YA 1MI3A 2I17A 4JN6A 4O1AA 4YHGA 3UP8A 1TV3A 1QHZA 3AIQA 3KAOA 2HTMA 3T2PA 1XIJA 5AFDA 2CBVA 3W07A 4Q4QA 1XYAA 5BRQA 3SY8A 1BYAA 4DBEA 4GH3A 5AYZA 4HHPA 5DMLA 3B97A 2FB3A 2NV2A 2VX7A 3H8AA 3K4DA 2Z27A 3RIKA 1OX5A 3T42A 4XX6A 3H21A 3ZVHB 2XWEA 3UW6A 3AU2A 3AHTA 1EP2A 1JZ8A 3NVTA 4U3CA 2C1HA 1I60A 3ORWA 3PNZA 3PC0A 1CBGA 4NRRA 1UROA 4EPDC 5CZSA 1V0NA 2AAAA 2A79A 3DFQA 1FWSA 4M8UA 4IFOA 2V5JA 4JIIX 1HJWA 4X9YA 4IJBA 1EZWA 3LSBA 3S2NA 1IWBA 3VE9A 4RV8A 1DQUA 2AQOA 1I4NA 4JIEA 1G69A 2PUZA 2Y85A 4D1IA 1FQ0A 3OHIA 1Q2RA 2YOCA 5DBUA 1H4PA 3DG6A 2XJ7A 1VYSX 3MW7A 5A6SA 3ZQ9A 1KM2A 3KCLA 1E1CA 1UMYA 3QY8A 4I7WA 2O7QA 3BARA 4NZFA 1VBHA 3Q58A 2ZBTA 4JTKA 1GYNA 2OSXA 5C9UA 1JDFA 2D3NA 4JZ5A 1FRBA 4BQ2A 1CT5A 1Q6GA 5HUOA 4AFYA 2C79A 1E0TA 1QNPA 1ECEA 3UWZA 2W66A 1LTDA 2A2IA 2VL4A 4GQQA 5FF4A 5I00A 4FOKA 3W1UA 3VD4A 3KWXA 3VGFA 1JFHA 2E67A 2H6RA 1EDGA 2XISA 3IAQA 3WF1A 5I79A 1HL2A 3SM0A 2V8ZA 1H5YA 2GUYA 1OD0A 2DFAA 4C6BA 4AHPA 2CYGA 4JICA 3M9YA 3OGVA 1CXKA 4K37A 1J93A 1RSCA 1AA1B 2J7EA 1W3LA 2NQJA 3XIMA 3CZJA 1GVFA 4PL1A 3TYCA 1WBJA 4A8NA 4M0XA 3T1GA 3U4AA 3S8HA 2C19A 1H49A 2VR4A 4ZFCA 2G0WA 4MMWA 2AGKA 2BVWA 3FW6A 3IUDA 3C5QA 1ML1A 2XIMA 1WAUA 1ZBCA 1R9YA 3SCRA 4JCMA 3VIFA 5XIAA 4L1WA 1X8CA 3GNXA 1XF0A 4GJ1A 5I06A 2DT3A 3H7VA 1VIWA 4LAOA 1O6IA 4BCEA 3U5UA 1A5CA 2CBIA 3PPFA 3CMJA 5TQLA 1HNYA 4I90A 4HZ6A 4AY1A 4EKJA 4QGCA 3QGAC 3GFYA 1MUWA 5EYWA 3IIVA 2A3AA 3UNTA 3LHTA 2HBVA 5CJMA 5KZDA 5CC5A 2AMGA 3A4XA 3KVMA 5DT5A 5EBAA 4LNYA 4EOUA 2CFFA 2YW3A 2F2KA 2XH4A 3PBWA 2JEQA 4MADA 2WSKA 4O17A 3P8JA 1WCGA 3PZTA 2QDDA 1ADOA 4P7OA 2OQLA 2QCDB 2WW5A 3UJSA 3C6CA 2FVMA 4IGMA 4AD1A 3MSRA 1VB9A 1HKJA 3BLEA 2V38A 3GTXA 1JGMA 4A3QA 3TN5A 1TV8A 1HW6A 4E8DA 3NL5A 3FYOA 3ARWA 4MZ8A 1HFBA 4GO9A 2EEXA 2V69A 4DXXA 2B4GA 1TA3B 1ONEA 1PCKA 1PUDA 2VELA 3SCVA 1R3TA 2QF8A 3GVGA 3OG3A 4MJMA 1ALDA 3G8RA 1I2OA 1SO4A 5I24A 4RZBA 3PUDA 3EDDA 2EPKX 4B5TA 2FVKA 1GEHA 5FJOA 1IQ8A 1UWRA 5CGMA 2ZUTA 4NQ1A 3L0GA 3NAVA 1AODA 5ENLA 4LYRA 3W82A 1IEXA 3GUGA 2CW6A 4JTAA 3TZNA 1JDAA 3W26A 1ZAIA 3ABRA 3WQFA 4C6DA 2QR6A 4FPSA 3N18A 4JDBA 1LT8A 3QGKC 4PB5A 1OWQA 4ZE4A 2EPMX 2DSZA 3H2CA 1K3UA 4P7NA 2BASA 1E40A 3V7PA 4PFMA 3O16A 4GHRA 3ZS4A 1GKRA 2ZRVA 2XN2A 4UTFA 1XLGA 3UWUA 4HMEA 3BV7A 3NIYA 5A6BA 3C2RA 3POHA 4LQ1A 1O5XA 3CWNA 3L0NA 4B3KA 1UKOA 3IVUA 4GFIA 5LXXA 3EZ4A 2ACSA 2GFTA 4FNSA 4LANA 3NZGA 3C2EA 3RXZA 2P8BA 1YTEA 2CHOA 2WCAA 4UCFA 3S47A 1FWDC 1M04A 1CWYA 3NSXA 4M7SA 4H9TA 3GHRA 1PHWA 2VWSA 1EGZA 1E6NA 2BBFA 5B7YA 2AGTA 4P8WA 2VFGA 4FEZA 1V6XA 1Y65A 1PIFA 1KTNA 4BA0A 3N15A 4KEMA 3VUPA 1VR6A 2PWFA 4DIAA 1KM1A 1UQYA 2W0UA 1HQTA 4LH8A 1C7SA 4UUIA 2WHKA 4JTCA 3TSBA 3SN4A 3QV6A 3P93A 5CSUA 5EMKA 4ZOEA 4NAFA 2QXWA 4H8HA 1OK4A 2BY3A 4S3KA 1Z48A 3N9RA 2YYUA 4E8GA 1TMHA 5DELA 3HZ3A 1VJSA 3HPAA 4EE9A 2VGGA 4XZNX 1SW0A 3AXKA 5BXSA 2IKJA 4D72A 3LTSA 2HVNA 4OIFA 2X0HA 1VAHA 3GC5A 4MOZA 4ZQOA 1EA0A 3MKKA 1VPXA 3QQ0A 4J3TA 1OZQA 4QQ3A 2DSKA 2YA0A 3PWIA 2F9RA 4B3LA 4AX6A 4PCSA 1W8GA 1JPDX 1KCXA 1HJSA 4PZVA 5HPCA 4MLRA 4Z2LA 1R85A 3GHUA 3KCOA 3DESA 4PMNA 1W3TA 3HMJG 3OVRA 2WSYA 2PAJA 4M29A 2DIEA 5CPQA 2NV1A 3UGRA 1PX3A 5IOBA 3AS3A 3W9ZA 4KIEA 1G4SA 3VM5A 3Q67A 1B54A 2OEJA 4PUNA 4IGSA 3KRUA 3IJ6A 4UBPC 3WQWA 2QZRA 1LG2A 1PS9A 3VE7A 3ZOAA 1JZ2A 3CBWA 1J01A 4Q8UA 3MY9A 1EJXC 5FOOA 4M1RA 7REQA 3FHQA 4Y9MA 4IG2B 4IP5A 1XKJA 3LDVA 5EFFA 1TV7A 3FGCB 3AIUA 1IGSA 5CPOA 2Z1BA 1Z6KA 5H2ZA 2QEZA 1AD4A 3KL3A 1OJXA 3MP3A 5FCZA 3HPSA 4MFEA 3FA3A 3E0VA 3E0FA 1NWUA 3H2AA 2FFCA 2NLYA 5CPMA 4GX8A 2BS9A 1HP4A 1A53A 5AVHA 3R79A 4MWAA 1OG6A 3LERA 1RV8A 1DVJA 1JXJA 5I3DA 2BY1A 2HDJA 5KZMA 1NQKA 4GLEA 2A85A 3IJIA 3TNBA 4D6IA 2WMGA 5HR6A 1P6WA 3MKCA 5CLWA 1XH0A 1OQFA 1UP0A 4UNIA 4CQ9A 2AL1A 1WDWA 3L0KA 3REQB 1R46A 4IP7A 1AQFA 1XH2A 3B0XA 1KTCA 5IFTA 3LPOA 1QBAA 3FDKA 4ZTXA 1V3HA 1F6KA 4LYQA 2D73A 1MUMA 2QT3A 1FFRA 3OGRA 2D20A 4Q8WA 4HCLA 5BW6A 3GXTA 2AL2A 1KXQA 3ATYA 1PDYA 1XRSA 1S2TA 1GVOA 1E0VA 5F1UA 4BI6A 5FF0A 2Z6IA 3EXRA 3I3EA 2I5GA 3A4JA 5A6LA 3NZRA 3NG3A 1WB0A 3MO4A 2ZQ0A 4C65A 4LCSA 1HGYA 4UNLA 2GJLA 2FJKA 5FIPA 2F61A 4OGZA 1W56A 3EWYA 4LNCA 7TIMA 4DWSB 3KM8A 3VZZA 2P10A 3C0LA 1JL8A 5DBTA 4F8XA 3L4ZA 2V3GA 1RZMA 3B8IA 1AL8A 2RHGA 4XO7A 5LA0A 3ZR6A 1GKPA 2HMCA 1QI5A 2WZEA 4B9ZA 4AZ6A 3JS3A 1BAGA 1REQA 5I3HA 4QTGA 2UY2A 2WOQA 3WUBA 3N6HA 3HB9A 1FWAC 5C9RA 3MYPA 1PWMA 2UWFA 4NYYA 3N29A 3VKBA 1L6GA 1FCUA 1WXYA 2OO0A 4WVXA 2Z1SA 5A6TC 1JR1A 1IEWA 1JUBA 4LV9A 5DCEA 4Q4OA 2EPNA 1LBFA 2XH2A 3O2LA 1ZNNA 3PTDA 3LPPA 2W4XA 3O07A 3URNA 1UR1A 5DQPA 2QJHA 1XISA 1UZ1A 3BWWA 4XD6A 3RYSA 4LWWA 3WJYA 1XLIA 2GSJA 3L4TA 2OLHA 9RUBA 1XWYA 3ZIZA 3F4CA 3MUY1 3LX9A 3MV11 4H04A 4L5ZA 1FOBA 3PZNA 1YE4A 2CKSA 4WJEA 2ISSA 3W1PA 3SZ8A 2VX5A 1EYEA 4ROQA 3WJWA 1H3GA 2DUZA 5AC5A 3SB0A 2FGZA 2PODA 1GWJA 3JU2A 2XSAA 4X9SA 3DC8A 1XPGA 3EAUA 4FLRA 4US5D 2PWDA 2CIPA 2NV9A 2GQ9A 1BYCA 1DQWA 5MKGB 1XG3A 4S23A 4ZQRA 4UFMA 4EXBA 2C3ZA 2OT0A 1YDVA 2QJIA 4PTWA 1PL9A 3STPA 1XLJA 2R1LA 4CUCA 3KVKA 4E2BA 1KFBA 3W7JA 1KW1A 1DORA 4IHCA 2HV5A 4K8HA 1T41A 1V7AA 2GUBA 2WK2A 1H7OA 3NQVA 5HQMA 1JXKA 3I65A 3TN4A 4X63A 3GBEA 5CJNA 4N9DA 1LQAA 2I9UA 1LQ2A 4O1DA 1KCKA 3M47A 3AYTA 2QGYA 3ARRA 4P8UA 1EQPA 2QDGA 2WO5A 1PX4A 2YB4A 3WK0A 3P14A 3MDWA 3G1AA 2VFDA 3R13A 2GJXB 4WZHA 1V77A 1JULA 3B8UA 3F2CA 2GQ3A 1B9ZA 2HZGA 2JBMA 1OY0A 1QHOA 4HN8A 4QDMA 1KCLA 2TODA 4XKMA 3PZMA 5E9XA 3P0XA 4DI8A 2YKKA 3WLNA 5C9XA 1E6RA 3ES8A 2A5HA 3W27A 3L5LA 2PD9A 3QC0A 2ASHA 2YCJA 3DGBA 3NPUA 2HXUA 4LCQA 1QVBA 5CXPA 3ECQA 4LX4A 1PHQA 5E6ZA 2FZDA 1BKHA 1ZRQA 1OZMA 1PAMA 4AEFA 1L2UA 3MHGA 4WIWA 3DYPA 1UIOA 1F7BA 2XPKA 3LZ5A 1OFDA 2ZXAA 3KTSA 4FLSA 3AYSA 2Z1VA 4HPXA 4CD6A 1DXIA 3ZJ6A 2OMAA 4X22A 2SFPA 5CKSA 3HOJA 2W92A 1GVQA 1SGJA 1J9YA 4Y6GA 5DY3A 4MVAA 1TIWA 1UWQA 1NDVA 2TYSA 4AIBA 4QSFA 4YTSA 2HPIA 2FZBA 3C8NA 3P7YA 5BRBA 3N2TA 1FP9A 5A8PA 3GY1A 2ZX5A 4DBUA 1GYMA 4DQWA 4D71A 3GBDA 5KTLA 3A9BA 1K6AA 1HIZA 3AIBA 4S3BA 1W5QA 3VGEA 1VH7A 2PDCA 2Y7EA 4EXAA 1WAWA 2Y5EA 1QNOA 2QUNA 3F5JA 3H2MA 2E40A 1YADA 5HWMA 2OQYA 4Q4SA 3NOEA 2BOGX 1U2YA 3UPBA 3UGVA 1CXHA 2X42A 3UG5A 2BOEX 4OJYA 2ZTJA 3FN9A 2E68A 2ZUUA 1EGMA 4OBTA 3TJ4A 1AFSA 1KBIA 3GB6A 3LBCA 2DH3A 5GVJA 1JGIA 2OXNA 3VNKA 4GIYA 4NSBA 3FA5A 4GUGA 3VKCA 1F3EA 4PYSA 1ECQA 3G1DA 3VMOA 1Q5MA 2XZ9A 1FP8A 4KEUA 1RBOB 1V6VA 5DN1A 1VFUA 3N2OA 4MUZA 3CGTA 4RUBA 4G9PA 1UP2A 4F0KA 5A2AA 2WSRA 3TZFA 1L6FA 5EPDA 4AG0A 1B57A 2PDYA 1V08A 1WQ5A 4GYFA 3BGJA 4JKKA 4PMUA 2WYSA 2JF7A 1T5AA 1V02E 1T0OA 3WNNA 1BEUA 2D2OA 3BG9A 1OFEA 2HSAA 4QE4A 2WLZA 2HS6A 4BS0A 1ZJHA 1BTMA 4H4IA 3NDOA 5PTDA 4QFUA 4IUGA 4WOZA 4RPQA 1SZNA 5C2XA 1DOSA 4HYRA 2D69A 3EX3A 2R14A 1AQMA 3A47A 3GHTA 4Q4MA 1O1ZA 3RO8A 2Z0IA 2ZRWA 3QHMA 5A69A 1N8IA 3NQGA 1TWIA 4E4UA 4XD5A 2QW5A 3W83A 4FS9A 4ZO9A 4UTLA 6XIMA 5BXRA 2NVAA 3ZVIA 3URBA 1CLXA 3N73A 4ZB0A 2G97A 1UR8A 3UJEA 4TIMA 5FJRA 1JCXA 1ELSA 5JMUA 1XCFA 2CHRA 4S3CA 3AWNA 4JGDA 2RAGA 1H0IA 7ENLA 5JU6A 2XYLA 3LCXA 5DLCA 3LRLA 5HUPA 3W24A 5LA1A 3A6OA 2ZUMA 3QQ1A 3WDIA 2EQDA 3BAYA 4QQUA 3VDGA 4ALDA 2VEKA 1XIEA 2BFGA 1G5AA 4E4FA 3PZ9A 3ITXA 4JIPA 2EPLX 4AIEA 3WL1A 1NWRA 5ABFB 1PKYA 4XD4A 4NZ1A 1FWIC 3PBVA 4TMBA 4ZTYA 1X6UA 3GW0A 3QHNA 1BVWA 1DJHA 4WJXA 4GCAA 4OWGA 3STEA 2VDHA 3QMTA 2XZ7A 4UOJA 5G1MA 1M41A 3G1VA 4Q8VA 2UBPC 4IQLA 1VCFA 4LS0A 2GVEA 2XVKA 1DWGM 4MZ1A 2WXDM 5GNXA 4GO8A 4YJ5A 3G77A 1CCWB 4E5TA 4XWUA 2PWHA 5A3HA 3CLWA 1ZJIA 3T09A 1TKKA 4N4PA 1LT7A 1QW9A 2X2YA 3QW3A 4BQ4A 4MWAC 1EPXA 2VZUA 2WMIA 1QPOA 5I5RA 3O06A 3W3OA 5K7JA 1V51A 1NF7A 4FR6A 2GOUA 4IPIA 2FPYA 4NY2A 3NUKA 4ZODA 3SJNA 4CN4A 3M5YA 4RW3A 4H8NA 1OIFA 3BURA 3IPWA 1PCWA 4HA3A 1XBVA 1ME7A 2A6NA 3H4GA 1FTXA 4CD7A 3UXKA 1CXEA 3NQBA 2PC8A 4I5UA 3VNZA 3L2IA 3G0SA 3F2DA 2Q8XA 3M0KA 1P0DA 4YTTA 2BHUA 1ZJBA 3SSJA 3NEVA 1UD3A 5AECA 2XH0A 1GVIA 1XYLA 1NFPA 3N34A 3OA3A 3BGGA 4E0CA 3S1WA 2OEMA 4JKLA 4OOZA 3EEGA 1W3HA 3TV8A 1Q4WA 3VIOA 2F2HA 1NP2A 3CLMA 5C71A 4DLFA 4QLKA 4KFNA 2WSQA 1SSDA 2YSWA 3LCHA 4Q4PA 5D38A 4AMCA 5HQLA 1O5QA 1UC4A 4REQB 1K9FA 4E2VA 5I03A 1MW3A 4NUWA 1X7IA 2ZZ2A 1D8CA 1W1B1 1TVNA 3FFSA 1HVQA 1E6QM 2X8RA 5E9AA 1V93A 1OIMA 5IBXC 3CMFA 2B81A 5JIPA 1BXNA 2YJQA 1W9DM 1I2QA 2E7FA 6XIAA 3WIJA 3IUHA 2EG7A 4N02A 1DWFM 3L9CA 4ONVA 1I1XA 4IG2A 1XIBA 3PY2A 3FGCA 3AS1A 1TJPA 3M0IA 4UQEA 5JUVA 3CL6A 1LP6A 4LVBA 1CW2A 3VDAA 1H09A 3NXLA 4NZJA 4D6GA 4HNVA 1EL3A 3IJQA 1H1YA 3QKZA 3QJAA 2NVDA 4UZUA 4CNTA 5JH2A 1NDZA 4B3ZA 3V5FA 4XK2A 4N9BA 2YDRA 1BD0A 1HF6A 2BZNA 3TN3A 3FHAA 3G18A 1SZEA 2FZNA 1QMLA 1X97A 4S3JA 4L80A 1I2NA 1JCMP 2Z7KA 1ODZA 2E6DA 2OODA 3H23A 4BWLA 1BG4A 4R9OA 1NOUA 3VC6A 1ZHAA 3CUIA 5H6HA 1XUZA 1XYBA 4WQ6A 3B9AA 3HN3A 2Q01A 3CNYA 4N42A 3SCUA 4N9EA 5GJPA 3REQA 5DX7A 2J8FA 2VJXA 4J4KA 3LCLA 3GXDA 1RD5A 1JCLA 1VQTA 1FWNA 4XBKA 4MYXA 4EK7A 3QM3A 3WH7A 1BHGA 4UXDA 4MNKA 4JBRA 2H9AB 2IW0A 3WF2A 3TA9A 2VGIA 4H19A 3ZO9A 4KCWA 1QCWA 1ONRA 5C54A 2P88A 3M6YA 3PSWA 4XZWA 2BXZA 3ABXA 3BW2A 3GVQA 3SAZA 4WCJA 4Z0SA 1C29A 3MU7A 2Q02A 3AHYA 4YTQA 3MYOA 2X1UA 2NUWA 3UESA 5CBJA 1QR7A 4AXNA 2YCKX 1P1XA 2EO7A 2XG9A 5FD0A 5C9WA 4JNMA 5E6YA 3LGEA 2O9PA 3U3HA 3PJUA 2Q8LA 3NQ2A 4DWSA 1KR1A 1JCNA 4CEUC 1A5AA 4H00A 3TCSA 3MS8A 2W9MA 1UYQA 1RBAA 3CIXA 4EPKA 5IRPA 3FJ4A 1IZCA 4C6LA 3OBAA 3VO0A 1FWJC 1KQZA 1JVNA 5IDIA 3ARZA 1LWIA 3CB8A 2J7DA 1E73M 2NZLA 4L64A 4PA8A 1HKMA 3Q94A 2PI6A 3TWAA 4PMVA 4E38A 1Q7ZA 4W88A 1PYFA 1LG1A 4WJ8A 3JZUA 3V1HA 1F6YA 4C6CA 3OVGA 3GLCA 3MMWA 2DZTA 2V5CA 1XG4A 1LWJA 2ZZ4A 5DEZA 2O92A 5BROA 5C55A 3VINA 4TXEA 3DBNA 2ZRXA 4GINA 3U2ZA 2C14A 4DZHA 2QPXA 3ITGA 3LRKA 2WLYA 3RUBL 3L4YA 4Q22A 1J8VA 2PDFA 1V6UA 4TVUA 4PUMA 4G7EB 2V5DA 3NVDA 1OG0A 3JR2A 2O4QA 3A5FA 3W86A 3WD1A 4Z2KA 3BTNA 1XIIA 2QJGA 3T05A 1WXZA 3A3XA 4PMRA 5CC3A 1J6OA 2D1ZA 4AWUA 3MSGA 1ZALA 3UR8A 6REQA 1DWAM 1LL6A 3BQ6A 4CKQA 1XKYA 2DP3A 4OZOA 3IS4A 5HR7A 2KZHA 5AVNA 2VKZG 1US0A 4GABA 4HMNA 5FESA 3CZGA 3FAXA 4E4PA 3IWPA 2GOKA 4EXQA 1JZ6A 4IX2A 2PWEA 1PZ1A 3CIVA 1W3IA 2O4MA 1BF6A 3VTRA 1ZSXA 1ICQA 4PFHA 4XAFA 1G7UA 1OM0A 1IXQA 1WOBA 3KZPA 3VI2A 3GNDA 4ZGYA 1XL9A 3NPXA 3VKJA 3CZEA 5JBEA 1TE1A 3WFZA 1IYXA 3T55A 3W2UA 3BOXA 1F8MA 4YXGA 5I6SA 7XIMA 1L6WA 1TTQA 5AHEA 1ZBVA 4JEJA 4K1GA 3R0DA 3TYAA 1U83A 1RQEA 3QXBA 2VD9A 4Y96A 1NJJA 4DNMA 5A6BD 5GJNA 1DJIA 1WDRA 1ZBWA 3W2NA 1H50A 4KWVA 2ALDA 1M5WA 1S5MA 1JPKA 2HE5A 1QWKA 1J12A 2NQ9A 2G8ZA 4GWEA 2V3EA 3EGJA 2VENA 3UCCA 1SM9A 3N19B 1LZOA 3GG7A 2YX0A 3KW3A 1O1HA 4LYKA 2GJXA 4MZYA 1AZ1A 1YTKA 2ZZ5A 1TREA 2XUCA 3RO6A 1V3KA 1J79A 1UUOA 4KH2A 3GTHA 5D9PA 4DO7A 1F07A 1PSCA 3BAJA 6PTDA 3HURA 4WEVX 1Y5XA 2CNCA 3D3FA 4A4AA 1FFQA 1NFGA 3P67A 1WZAA 2F6KA 2GK1B 4S3GA 3E0WA 4V33A 1VHCA 1AQHA 4M5PA 3EOSA 3PG8A 1PEZA 1X7FA 3THQA 3BPWA 3WBAA 3BE7A 1WP6A 1KBBA 1EHAA 2RJGA 4RE2A 4PL2A 3KCJA 3M46A 3V1PA 1HP5A 3HFTA 4QS6A 3CASA 7ODCA 4QBXA 4WKAA 3SGUA 3EWXA 1R3SA 1PTDA 3RNDA 1Z89A 5A5WA 4OUIA 1IXPA 2V9DA 2CHNA 2F7FA 3UQNA 3EOUA 5EMUA 1Q8JA 4F3HA 4YNGA 1RH9A 1IR2A 1JPIA 2H8XA 2DT2A 1NU5A 4AHOA 2A6LA 3VM7A 2WCSA 1X39A 4UIOA 4W86A 4Y9NA 4Y9PA 1UWAA 3H26A 1X98A 3IRDA 2ZRUA 3V75A 1TQJA 1K8XA 4H7ZA 3S0CA 4R33A 2C18A 2VC7A 4GGBA 4GZEA 4Q8TA 4ZB5A 1GG0A 1Q6FA 3DG3A 3EPMA 2PC4A 4L4MA 4Q8OA 4UFKA 4RDZA 3NQ7A 2GWGA 4GISA 4BI7A 1M3UA 3MI2A 1FWCC 3T78A 1L6SA 4DYJA 3CV2A 4GQBA 4RXFA 1SPQA 1GQKA 1D8WA 3N17A 3PULA 3EB2A 3PB2A 4J3WA 1GOXA 2FTPA 2DSVA 2PDQA 1KM0A 2Q3OA 1X1OA 4YVXA 4QR6A 5E09A 2ALRA 2C7FA 3EKLA 3L4VA 3TH6A 4C7FA 3W02A 2RDWA 3OYXA 3VOCA 1J0IA 4LW7A 5DMMA 4X0NA 2D23A 1PZ3A 2CXGA 4H7CA 3ONCA 3CAVA 1RBLA 4DPPA 2PDXA 1TQXA 4GI4A 3VKKA 4MWAD 4IFKA 3WJXA 1LLOA 4JCLA 2VQTA 2VC9A 1AH4A 1W9XA 2X0YA 2V82A 2W3ZA 3PUOA 3AICA 2YW4A 4JQ1A 3TQKA 3EKZA 1EH9A 3R8GA 4QISA 2ZE0A 2RGMA 2UV8G 3ITVA 3AO0A 4AZHA 1GEQA 4F2UA 2QJMA 4Q4RA 1U5JA 3LI0A 3PAJA 3N4AA 2OO6A 1XBYA 3PANA 3BAWA 5I78A 2VRKA 3M6DA 2GVGA 2GJPA 1ZS2A 2NSOA 1E0WA 4Z1YA 1Q7QA 2PD5A 5I7GA 1KXHA 1VEOA 3SEPA 1SO5A 2PTDA 2VR5A 1UZHA 3UZWA 1UBPC 4LVFA 4ZA0A 3ZLHA 3EXTA 4C6KA 3WUEA 4G6CA 3BLFA 3BAXA 1CGTA 4ZEPA 1WA3A 4POCA 1TTJA 1U1HA 5F2MA 3VIPA 3NYZA 4DM2A 4WKHA 3ITOA 4LBUA 1Q6OA 2HEJA 5FACA 3RILA 4GX9A 1NSJA 2YA2A 1AJ2A 2CZFA 1L0PA 5AC6A 3GDLA 2D0FA 4E6MA 1BF2A 1A5NC 3A23A 3AMGA 3EWWA 4U5KA 1IZJA 5ABFA 3UXAA 2EGZA 2BWGA 5DFAA 4HPJA 3O15A 4P8VA 1TSIA 4DAFA 3R7MA 2Y8VA 3CU2A 3BMWA 3L5MA 1KBKA 4DEFA 1P5BA 1GQLA 4JIQA 4CNOA 2YA1A 4M6PA 1UASA 4NKCA 3BZJA 4JIRA 4HNUA 1UUMA 3OA5A 4XZBA 1CZ1A 3A5VA 4KGJA 1QXLA 1BYBA 2X0SA 1CENA 2UY4A 1YIXA 2ZADA 2PTWA 3QPZA 3NNTA 1W54A 1K6WA 1DHKA 2OFJA 4GZ7A 3R8RA 1XD1A 2REQB 3IGHX 1A50A 4GRSA 4NT0A 5HULA 5CEWA 3AMLA 3GZ3A 4KEVA 1MXDA 4LV4A 2VFFA 1AUSL 3NL2A 3G1RA 4NI8A 1UA7A 4NL1A 3OB8A 1UWIA 3BUVA 2XFYA 3BCDA 4S3FA 3IK4A 4BWLC 3GU1A 4HN4A 1CGYA 4EX4A 2QV5A 5LNUA 1RY0A 3NQDA 1N2VA 3R58A 3WQ5A 4D6JA 5A8OA 3MO7A 1YE6A 2DDXA 1EF3A 2WKGA 3U4FA 5JXQA 4LAKA 4UB9A 4AC1X 4LU0A 4ES4A 4H9UA 4A3HA 3GNOA 5BWAA 3MANA 4WUIA 4NF7A 4CCZA 4CNNA 2PTYA 1RK6A 4EWJA 1V8EA 3NJ3A 4J9JA 1VJIA 1GOMA 1T8QA 4WF7A 3FS2A 3GSMA 1I8JA 1UWSA 5CPNA 3QMSA 3TR2A 4RR4A 2BY2A 2XVPA 1BWKA 4REQA 3W23A 1C9WA 1ZQ5A 3KEHA 2HK1A 1DIDA 4C1KA 1GOIA 5M3WA 4PN2A 3E3HA 1TMQA 1G94A 1CPUA 1JNDA 3GXMA 1MVYA 3WH5A 1SZRA 3M1ZA 1GZJA 4HQVA 4WDTA 3D47A 1HKWA 3LYEA 3SY5A 3U7VA 3VABA 2CLEA 1B3OA 3PAOA 4JFTA 4M80A 3LU2A 4HVXA 2A21A 4M56A 2A3HA 3LG3A 2DV0A 2YZRA 3H4WA 5TNVA 4D8ZA 2HJPA 4RLIA 3GG8A 2QJJA 4TTUA 4QCEA 1CXFA 3VZYA 3MSYA 2NLIA 1A0DA 4PEKA 1UB3A 3M43A 1ZCOA 2VZVA 2W67A 4LF2A 3KLLA 4AWSA 3N25A 2NT1A 1TB3A 2FTWA 4C6JA 4R7OA 2JALA 4S39A 4O18A 2JIWA 1WDDA 1R3YA 1RJRA 5MF5A 3F4VA 3T0TA 4FOJA 4RPPA 1VD6A 2CERA 3RCMA 2V5BA 1SO3A 3WD4A 3BL3A 4DUXA 1W32A 3DN5A 2WVVA 3WNOA 3G6MA 3TMQA 2Z26A 3QQWA 3W28A 8RUCA 3OQ8A 2EG6A 3TKFA 1NEYA 1FWFC 4O4VA 1FY6A 1MEHA 4U4MA 3FK4A 4AXKA 1E1FA 3LM3A 1BQGA 3M7SA 5EB8A 2WMHA 3TYEA 1KM5A 3OZOA 4L6HA 4Z0JA 3ZJKA 3WL0A 1F4HA 1NH6A 1QHPA 3Q45A 4QRNA 4YL2A 3WMBA 3DCPA 4F79A 2ON3A 4C1NA 4H7VA 3WEOA 3VIMA 3GU9A 4MPQA 1FWRA 1R2TA 2Y8UA 3VNDA 3OO2A 5CC6A 3WH6A 3TDFA 1R0MA 4QP0A 1P7TB 3GR4A 1SR9A 4I3GA 3TYBA 4F0HA 1I2PA 4DJEA 1QI2A 1LBLA 3Q65A 1CGWA 3LZ3A 1EIXA 2B7QA 3H12A 3K1DA 3ZWTA 1YXDA 2J79A 2Z29A 2QDHA 4G7FA 3RLHA 1POJA 3WF3A 4AIOA 1XI3A 2PP0A 3B03A 4IIEA 4ZQMA 4E2DA 4QEHA 4JAWA 4YU1A 3RHGA 3GYCA 2BX7A 2IS7A 4YCOA 5CQ1A 1XM3A 4V2XA 4NJJA 3QY7A 2OEKA 1DXEA 3M07A 4HU3A 5KETA 4TR9A 4KWSA 4D9PA 3LHZA 4G7EA 3W6LA 3U48A 4HA4A 1BVZA 5EKYA 4CU6A 1GKQA 3VDHA 3B3DA 2HPMA 4JPGA 5JH1A 1ZY9A 3DI1A 1XDMA 1OCNA 1QPNA 3THCA 4KW2A 4JYDA 4ZQCA 2WZMA 2FKPA 4HA0A 3PJTA 1KD0A 4HK5A 2E5DA 2Z2UA 3C56A 1G4TA 2OTDA 1TPVA 3W38A 1G6CA 4MJ2A 4QAWA 3RAOA 3PJXA 3W4RA 3PZGA 2XN0A 2WCGA 4GI8A 3T40A 3S5OA 4M6QA 5JVLA 3GDRA 1XC6A 5I3JA 2TMDA 1Z32X 3ARXA 4HCHA 2PDJA 1N55A 3QLDA 2BXYA 4OHQA 4FP1A 1B4KA 3HA1A 4FXJA 4GUJA 4IPLA 3CS2A 1D9EA 2R8WA 2Y7FA 3ISIX 4B91A 2NVCA 2VZOA 4US6A 4V1XA 4HNTA 2HQAA 3WLRA 3KE0A 3D5HA 3TTQA 4K1WA 1JCJA 6CGTA 5C6MA 3UXLA 5EL1A 3EWZA 5DRIA 1V3MA 3PBYA 1ISZA 1OFAA 7PTDA 3BLIA 2GVLA 3GH7A 1XGZA 2GGGA 2MUCA 3FEQA 1AMYA 4FF5A 5CGTA 2QAPA 3NZQA 1QWGA 4QJ1A 4FIQA 1WDPA 5MHBA 1AMKA 4DI9A 5KINA 2QAFA 3VD5A 1WKYA 2J7BA 3LV5A 5BOOA 1B3YA 1S38A 3CWHA 4U2YA 3W1QA 3ITTA 2BODX 3SSZA 3B05A 5D02A 4V15A 3O6CA 4PMYA 1HKKA 3GX9A 4GUHA 5BYWA 4X2PA 4WY0F 1O68A 4M6UA 3IV8A 3FLUA 4ACYA 3UWQA 3QPYA 3BVJA 4W8LA 3HG2A 5DXXA 5HJYA 2VZSA 4BF9A 4US5A 2GK1A 2FGLA 1QT1A 3U0HA 3F2BA 4UFIA 3RRXA 2QUTA 4V27A 3O05A 4EAYA 3SUSA 1P0NA 4UR7A 3STFA 1GPWA 3FXGA 1FHLA 2LLEA 3WJSA 4IIFA 5M03A 3E6EA 4XD3A 1Q6DA 1K1DA 1LOQA 1YX1A 1R38A 3BICA 3W1RA 2VO5A 3HQ1A 3WQVA 1M7PA 3GXNA 4CNSA 3AIRA 3T0CA 3IRSA 1M7XA 1CGXA 3B4YA 3BXWA 3LSCA 3BW4A 2OSYA 4JL1A 4LAUA 3H22A 1XLMA 1QFEA 1JYXA 3OVPA 1MQQA 4CCEA 3KZSA 1S5VA 2HVOA 1M68A 1HL8A 4PMZA 2ZRYA 4MM1A 3DH7A 1MYRA 3QTGA 1W3NA 3VX1A 3HGOA 4QAIA 4KEZA 3GH5A 3KFTA 3WENA 4MB4A 5BMWA 1VFOA 1C9DA 4KESA 4J27A 4H6EA 5A8MA 1RR2A 4UC5A 4KWUA 2FYMA 3OU8A 2V30A 3K4WA 3W7GA 4Y90A 1IWPA 1C3FA 3DHDA 1LLZA 2G3JA 1UPMB 1UR3M 1DTNA 3GRIA 6A3HA 3POCA 4NAFB 2CWXA 1WV2A 4DBWA 4MY9A 3TW9A 1T99A 4QJ5B 3O63A 5BCAA 3DAQA 7A3HA 1R9ZA 2VR2A 1O5RA 5M5DA 4UTTA 1KFCA 4H9XA 3AWOA 1NWSA 1H7WA 1Q2SA 2VHLA 1QU4A 3CK5A 1CB2A 4ZMGA 2XM2A 1US3A 3AXIA 5RUBA 3QW4B 1YXCA 1V4YA 2P3ZA 3QR0A 5D2YA 1XQLA 3VGHA 5CSRA 2ZUSA 4A22A 2ACQA 3AUJA 3LPFA 1IT7A 3PPCA 4HZ7A 4PRTA 2Y89A 4E8CA 1VHNA 1BTCA 1O5KA 4Q6JA 3ABQA 4FXRA 4PRWA 5ECVA 1TJ0A 1XV8A 4JTGA 3S5NA 1DJNA 5M17A 4IUOA 5EY5A 4Q8QA 1O66A 1GNXA 2J9XA 4FMVA 2GUUA 3E5PA 4B2DD 2ZWYA 2XTKA 1X8FA 4MG4A 1VBUA 3CTTA 4MKSA 4X0VA 1NIUA 3N4EA 4K7VA 2G95A 4QEEA 3M5VA 2VRQA 3CYJA 4M6VA 3NO3A 4M82A 3V36A 1BGAA 3CQIA 1XYCA 1F3WA 3MZ2A 1Q7MA 1TELA 3ZZ1A 5BXPA 1CECA 3ZMRA 3W2MA 5TF0A 4RJEA 4HPHA 1FDJA 1VIZA 1OGBA 2J7GA 2CWNA 3F5KA 2OZ8A 2OWWA 4AD0A 4H1ZA 4AWTA 1QI3A 3N6JA 2PDPA 3CH0A 3VD3A 3NCOA 4TV6A 1NDYA 2INFA 5AHFA 4JYFA 2PDBA 1OADA 1OF6A 4TTGA 3E2VA 1B4EA 3G1HA 2YR1A 3B0YA 4XIAA 3S2CA 4AISA 1C7TA 1OCBA 1Q6RA 4HJWA 2DZWA 2DEPA 1A5KC 3EWBX 2J78A 3UWEA 3AIVA 5SWUA 3AAMA 4N6FA 2IPJA 4JIHA 4A3RA 3XISA 2DSUA 3A3HA 5D05A 4JQ4A 3BANA 4J28A 1VFTA 3DYMA 3DFHA 3PZIA 4XTIA 4S38A 3TE9A 4R85A 3C3NA 5DCDA 4DF1A 4CD8A 3GWQA 3WQ6A 4IIBA 4ECLA 1XP3A 4WSHA 4L61A 2B7PA 1PZ0A 3NGJA 1E4MM 5CZJA 2Z2BA 4NJHA 5A8GA 4GNJA 4HNCA 1V02A 1KCZA 4I7VA 3USZA 2FZ8A 4WSJA 1ICSA 3G0UA 3BG3A 4PUEA 1YHTA 3NQAA 4MLJA 4IQJA 4FALA 1VYRA 2Y70A 5DCBA 4TX8A 1I6NA 3RN6A 5CLTA 4AVNA 1UW9A 2REQA 3KTXA 3H2FA 4Y9AA 1JI2A 4Q8PA 1JF5A 1TPB1 4ORMA 1D3HA 3LOTA 2AL2B 1Y7VA 4PUJA 3VZXA 2CLFA 3E1F1 1CDGA 2O56A 2ONEA 1H61A 1S5NA 4LC6A 1J10A 4JTEA 1P0EA 1W1TA 5LGZA 3TXVA 3R8HA 5LA2A 4C6MA 3UPMA 2PU0A 5AC7A 1W1YA 3VMNA 2XVNA 1RD6A 3SIZA 3UXIA 4J5NA 1DJZA 1DPMA 3UZJA 4R9XA 1FVPA 3UBPC 1WNOA 1X96A 1Z9AA 4A8IA 4M3PA 2RFGA 2VX6A 2G41A 3W7KA 4NXKA 1S5WA 1HJQA 2PRLA 4CN6A 5FI8A 2YL9A 1H1NA 4UQCA 3IIXA 4WSKA 4XTDA 1HZYA 4ZO8A 3RPDA 3RG6A 4GKTA 2ZVRA 1OSEA 4A3YA 3NA8A 2R82A 2IMRA 4JY8A 2ZTKA 4GE8A 4DZIA 1XICA 1BLIA 3W87A 3TQ0A 3F4DA 5DANA 2J8TA 1EJSC 3PPHA 4W5ZA 1GVRA 2ABAA 1JDCA 3K8LA 3ARYA 1TVPA 3WDHA 3BSMA 1TX2A 1JZ7A 4LUTA 2EJAA 1W5OA 1JPMA 4EPBC 2PMQA 3TTYA 1H2JA 2D2JA 1PBGA 4CVWA 2QMKA 3RX3A 3Q2DA 3HPZA 3BQ5A 3YPIA 2W63A 4DJEC 4QJ4B 1K9DA 4C90A 2I14A 4S2CA 2G4JA 5HAOA 3C52A 1KKRA