5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
3BMWA 4LGXA 5AY7A 4F66A 1QNRA 2VJXA 4BF7A 3ECQA 3IJ7A 3KE0A 1JDDA 1QW9A 4MB5A 2CEQA 4H2CA 1E4NA 2YL6A 2VRQA 2W4XA 4P8WA 2X09A 3CHCA 1HNYA 2XSBA 2YBTA 1K9DA 2YDQA 3SCUA 3VD7A 4HU0A 4AD4A 1LL6A 2ZX7A 3U7VA 3VPLA 4JFWA 3BLPX 3QOMA 4AWEA 5BROA 4BQ3A 4M80A 1Z32X 3VIIA 3WNMA 4A3HA 1V02A 1UG6A 3VD9A 2WVTA 4F8XA 5LA0A 1GVYA 2W63A 1WDQA 1V6VA 4JIEA 3VMOA 3WDQA 2WK2A 1DWIM 4Z2HA 1E70M 1JZ5A 1NOUA 4D6IA 2YL9A 2YKKA 3PZGA 4GZJA 4MDOA 2D0FA 2DPEA 4PMZA 4MPKA 2W61A 3DHUA 3I3DA 8A3HA 1E1EA 3WEZA 1C91A 3MV11 5E6ZA 1QNOA 2CYGA 4GZEA 1UWUA 4EE9A 1X6NA 4P8VA 4IM4A 1WCGA 3MUY1 5HOSA 3IANA 2ESCA 2J7EA 1ZJBA 2GFTA 3RDKA 1HJWA 3W4RA 3W37A 4UFJA 3CLWA 2YOCA 1CYGA 1WDPA 4PTVA 2WMIB 2YDSA 1FHDA 1JYNA 3AIBA 3WNOA 4PCSA 2DIEA 4D71A 3WENA 2O9RA 2V5CA 1KQZA 1SR0A 4LXFA 3W6LA 5ABFB 1W3JA 2DSVA 2EPOA 1US3A 4C7GA 2CKRA 3MMDA 3F5KA 1MYRA 5LA1A 1ECEA 5A94A 1UR0A 1E72M 3TONA 5IHRA 2FHBA 1ITCA 2OLHA 3VIPA 1QNQA 1TA3A 3AMGA 4DUVA 3GXIA 2VO5A 1DWHM 3AXHA 4FLSA 2EEXA 3CTTA 1R85A 3BAIA 3E1F1 5A8QA 4JFTA 5E0CA 1QI3A 3W6MA 1KBKA 1CGXA 4QLJA 1L0PA 1J0IA 1V0MA 3SUWA 2ZUUA 3FAXA 3MUZ1 4B15A 3BC9A 3UESA 2DGAA 1ISXA 1QBAA 3ZSTA 4DWSA 1ZBWA 4K68A 2ZUVA 3CUIA 1LWJA 2WM0A 1UZ1A 1ISZA 1UD6A 4GI8A 5IDIA 1JYXA 4FLRA 4LYRA 3KL0A 3OGVA 2PWDA 2UY2A 2VZOA 3L4VA 1CXIA 3W29A 3KL3A 1UKPA 3PTQA 1HXJA 1KQYA 2VZVA 1OIMA 2F8QA 1UKOA 3WNKA 3QHNA 5FL0A 1XV8A 4UFHA 3VIOA 2WMFA 4H41A 1XYZA 2XVKA 3WDIA 3CHDA 4UQDA 3M07A 3IJ8A 2E9LA 2DQXA 2FHCA 2CHOA 4CCDA 4OOZA 2Y24A 3EDFA 4DM1A 4CUCA 4TOQA 1ESWA 3ARXA 5A8PA 1E4MM 4UOQA 1V6YA 1E6RA 3SCQA 2J4GA 4PMRA 1M03A 4QFUA 2WWCA 4HA3A 1AVAA 1LWHA 5M17A 2GUYA 5FKYA 5A6AA 1Q6DA 1Q6CA 5DEZA 1JYVA 4CD5A 2VZSA 2PBOA 3CMJA 3WEOA 1NWSA 2YA0A 4U2ZA 3RM4A 1E5NA 1XGZA 1CDGA 2F2HA 3HJEA 2D2OA 2CXGA 3U5YA 4D72A 4U31A 5ABGA 4OKDA 4D6CA 1GPFA 2VOTA 1RPKA 1NOFA 2YL5A 1H09A 2Y8KA 2J7BA 1H3GA 4TTUA 1QOXA 4D1IA 4FLQA 4J3TA 3ARWA 3LPPA 4UQAA 1ZL1A 2CBJA 3OG2A 2Z1SA 4HMEA 1JIBA 2W66A 3VD4A 1EXPA 3MS8A 2XFFA 1J0KA 1GQLA 4BS0A 1CTNA 1OIFA 3K4DA 1KB3A 4JFUA 3CO4A 1BPLB 1QHZA 1BTCA 3VIKA 4OBSA 2OYKA 1SFSA 1CLVA 1G1YA 1PZ3A 2XTKA 2J77A 5A8MA 4D1JA 3WD1A 4GQQA 2DSWA 4UQCA 3CZKA 2ZE0A 3PZTA 5ABHA 2WBGA 1WZAA 3FY1A 1ZU8A 2CBIA 1TG7A 1W9DM 2GSJA 2OWWA 2D3NA 2BFGA 4XZWA 1K9TA 2NW0A 3S2CA 3J7HA 2VQUA 4N0RA 3RJYA 1UWRA 2PWEA 1R7AA 4WIWA 2WKLA 4UFIA 2E8ZA 3MUIA 3ALGA 1XCXA 5CG0A 3T2PA 4QLKA 3M7SA 7TAAA 2CNCA 1TFVA 1D7FA 4Q7NA 3CUJA 1UOKA 2V38A 3AIVA 2YIHA 4J3UA 5EBAA 4F9DA 2WPGA 1H11A 3I3EA 2W91A 3AHTA 4D6DA 4J7RA 3EYPA 5IFPA 3K46A 4M29A 1KGWA 2G4FA 4QDMA 5A6MA 2UY4A 3VX1A 1CLXA 2D24A 2Y5EA 4P8XA 1JZ7A 4HPGA 5AYBA 1HL9A 1GOWA 1ZBKA 1C3FA 1VJSA 5JUVA 1NOWA 4GI6A 3CUHA 1CEOA 4B9ZA 1RP8A 1E0VA 4BZYA 1NARA 1GHSA 4JKMA 1F4HA 3VIFA 4W87A 2WZIA 2FDMA 2UY3A 4UFLA 1DTUA 4W93A 4AD5A 2D22A 1I1XA 1W1TA 1E9LA 1GW1A 1WZKA 4V28A 4PTXA 3AMDA 3BSHA 3BH4A 4J28A 1UD2A 1UUQA 1EOKA 2WWDA 1NWTA 1EHNA 3NSXA 3NCOA 4ZXLA 4AZHA 3QHOA 1BLIA 3W25A 4H04A 3AHXA 5I0DA 5E9AA 2OWXA 1BG4A 5M03A 3AI0A 3MMUA 3AQUA 5E0FA 1WKYA 1K9FA 1U30A 3II1A 3U5UA 2G3JA 5CGMA 2BVTA 4TX6A 3RMEA 5I23A 2VZUA 3WD2A 2DIJA 4XB3A 2QHAA 3WD3A 1GQIA 4RE3A 4AZCB 4X0NA 1JZ3A 2OSYA 4AIOA 4W7WA 1CIUA 3NUKA 4J3SA 5DO8A 4AC1X 2ZXDA 2WYSA 3FHAA 2WXDM 3FHQA 2D0GA 5CSUA 1W9VA 3B9DA 4E2OA 1V3IA 3OLEA 2XVGA 4V2XA 1QNSA 2X0YA 1ZS2A 2VR4A 1UKQA 2IUZA 2ZWYA 2JF6A 1W9XA 4E4PA 3N15A 1VFMA 4WSKA 1KBBA 1H4PA 2EBNA 2GJXA 3QOKA 3GYCA 2VURA 1W3KA 4W8AA 1UQZA 5A6SA 4N42A 4WF7A 3UG3A 2ZUNA 3ARYA 3GH5A 4H7VA 3WKZA 4LYPA 5FOOA 1LG1A 3ARRA 3MO4A 3EMQA 4M8UA 1MWOA 1EDGA 4AEEA 2E4TA 1KCLA 4YHEA 3N18A 1GUVA 4H8VA 5BRPA 2JALA 1E6XM 1JG9A 1V0NA 4UQEA 4WSJA 4TX8A 1FFRA 3OLDA 1F4AA 5I6SA 2BY3A 2GJRA 3L4WA 4DUWA 2VMFA 2BHZA 3CZLA 2WCAA 3BGAA 1R86A 1B0IA 1LL7A 2J7DA 4E8CA 3GXDA 4QLLA 5D9MA 4OZOA 1TUXA 3OB8A 3A4XA 1TVNA 4CN1A 3OA5A 4OUEA 3ZSSA 1CNVA 2OSWA 3WF4A 2WHMA 2QPSA 2GDVA 3NJ3A 1JDAA 1GNXA 1H1NA 1TVPA 1J11A 1KCKA 2XM2A 3UR8A 4Z2GA 4W88A 1V03A 1CZ1A 2O9PA 1M04A 1GZJA 2VR5A 2WMIA 4OOUA 2JIWA 7A3HA 2VCAA 1V3LA 1DP0A 7CGTA 2CBVA 1B3WA 2UY5A 4WKAA 1HKJA 1NP0A 3VNYA 2D0HA 5IFTA 1OM0A 4CD4A 4OBRA 3WIJA 2O9TA 1PX4A 4AD1A 4AMCA 2WMGA 5I79A 3W81A 2VX5A 3PZUA 1D3CA 5IXEA 3AIUA 2EQDA 2YL8A 4Z2LA 1M53A 1VJZA 6TAAA 1JD7A 5CJ5A 3VDAA 2OYMA 2VQTA 3ZT7A 3B8SA 4P7OA 1KXHA 1KXTA 1CGUA 1IV8A 4YPJA 1OSEA 4EKJA 2XJ7A 1J0ZA 2DDXA 2OWCA 3WQWA 4GPNA 4W84A 4JHOA 5I78A 1HL8A 4Z2KA 5FCZA 1FH7A 3APGA 4L4OA 4EK7A 1V3MA 2VC9A 1ZB5A 3POCA 1E71M 3NSMA 5I24A 1GOMA 1WDSA 5E6YA 3FAWA 1U2YA 5A6BD 3VX0A 3WQ5A 1VEMA 5HDRA 1P6WA 1JF6A 5CSYA 1V08A 1V0KA 1HVQA 1DWJM 4PMVA 3W28A 1H49A 4D6EA 2CIPA 4P7QA 1CGYA 1HKMA 3WMBA 1FP8A 2BY2A 2CESA 2BHUA 1GOOA 4NRSA 3CPUA 4W86A 2DT0A 1PX8A 2VVSA 2V3FA 4UZUA 5BCAA 2FGZA 4JFSA 5AC4A 5A6LA 1RD6A 3PBGA 3MKKA 5HPCA 3WY1A 3ARUA 3KWXA 5D4YA 4HPHA 1L8NA 1UR8A 4PBGA 3S6TA 5A2BA 3TTOA 3GH4A 1J0HA 3LPOA 3L4TA 4Y7EA 1CECA 5D9NA 1E43A 4KWUA 1ZBVA 1JI2A 3AIRA 4MADA 1HKIA 4CVWA 1B2YA 4P7RA 4GI9A 1CXLA 3AS3A 2WC3A 1HJUA 2XYLA 1GCYA 4MNLA 1UH2A 2EPMX 5CLTA 2DH2A 2WZEA 2D1ZA 1J18A 1ITXA 2A3HA 1JFHA 3AHZA 4X9YA 5HBFA 3KZSA 1IZKA 1X6LA 1HIZA 3MANA 2CBUA 1DEDA 2VL4A 2XSAA 4P7NA 1MFVA 3CIVA 1XC6A 5FIPA 2J8GA 4HMDA 4U5IA 3L2MA 1CGWA 3FW6A 3AHYA 1UR1A 2FH8A 4HOWA 2J8FA 1HF6A 2IXVA 3OGRA 2D20A 4D6HA 3WQ8A 1I1WA 2QV4A 4AYSA 5ECUA 5LYRA 1I75A 1V6UA 2WMJA 3THDA 2VNCA 3AOFA 1D2KA 4YHGA 3CZJA 2YLLA 1H2JA 1BGAA 4PYSA 3A3HA 3AXXA 3T0DA 1V02E 4UR9A 2JE8A 3DYMA 3T09A 1HJSA 1W9PA 1UKSA 1VENA 1DWGM 3VGFA 4LPCA 3MU7A 1DHKA 1VEOA 2BXZA 1W1VA 4D6FA 3GDBA 1QI0A 2ZXAA 1J12A 3VKKA 1QI5A 5KEZA 2NT0A 1QI2A 1S46A 2CPUA 5A6KA 1BG9A 3VDBA 3AYRA 2XFYA 3VIJA 2E9BA 2EJ1A 4KRTA 2YJQA 3WBEA 2D3LA 4MB4A 3FNDA 5DMYA 1R87A 3AJ7A 4URIA 3F4VA 3WQ4A 1OGBA 4WKFA 2HISA 4NSBA 1XH1A 3WNLA 3ZR6A 6A3HA 1NP2A 1WZMA 2WAGA 2JEPA 1E55A 2C7FA 1UKTA 1EA9C 1MQQA 4IISA 3GH7A 4AZBA 1KR0A 5M3WA 1W91A 2W5FA 4DWSD 1MQPA 2VCCA 3OIHA 2WC4A 1UD4A 3WBAA 1E1FA 3SCWA 3SCSA 2YDRA 1BSIA 5CZKA 1G9HA 5A1AA 2WHJA 1HKKA 2PI6A 1BF2A 2EPNA 3AZRA 3F5JA 1MW3A 3UG5A 4PTWA 1UD3A 2CETA 3WDPP 3ZT5A 1UWTA 5C8BB 1JNDA 3RPMA 5BXTA 4UFKA 3T08A 2VVNA 2J78A 1UWQA 3OLIA 3VM7A 1TA3B 4W7VA 2G3NA 3BXWA 1UWIA 5I77A 4QP0A 1B3XA 1J0YA 2OSXA 2VI0A 4AD3A 3VINA 5DT7A 1GHRA 1O7AA 5AYIA 3TTSA 3ZO9A 1UR4A 3WEMA 1MXDA 1EIBA 1HP5A 2F61A 1OGGA 4HU8A 2QF8A 3NDZA 1CGVA 4AISA 1UZ4A 4JL1A 1G94A 5CXPA 3ZT6A 4AZCA 3ALFA 1QHPA 5CPSA 2DT3A 2JF7A 2ZUTA 1EDTA 4Z2IA 1ZBCA 5KZ6A 3ARZA 5JBFA 3W26A 5F7UA 4CU8A 3BCDA 2BY0A 4GO8A 1BAGA 4GIAA 3TTYA 1VBRA 4GO9A 3G6LA 1OT1A 5A2AA 3AMLA 3AS0A 1GONA 3BAJA 1R8LA 3OBAA 5CQ1A 3VNZA 2G3MA 3A4AA 5CGTA 1E5JA 3SCVA 4NRRA 1UD8A 4A4AA 3NDYA 1IT0A 1KWGA 1AQMA 1C7TA 3IAQA 4CD8A 3QR3A 1VFFA 3KL5A 5CLWA 1UHVA 1JNEA 2G8ZA 2XHYA 1VBUA 1H0GA 2DT2A 1Q6GA 1B3VA 3OZPA 1GVIA 1R7OA 2J62A 3SUVA 4D6JA 4GKLA 2WVSA 2GK1A 4CD6A 2YLAA 1W3LA 3QHMA 2PWHA 2BVDA 3FXYA 1J10A 4YN5A 3UEQA 1CXHA 2FH6A 4GXPA 4BQ5A 1UR2A 1V6WA 3W27A 4U5KA 3AROA 5A2CA 3GNRA 3ZJ8A 4CKQA 2XVNA 4AD2A 4CU7A 1A47A 1CENA 1M01A 1J9YA 3WSUA 3VIMA 3EDEA 1WAWA 4S3JA 3SCRA 3VGBA 3UR7A 2YA2A 3GZAA 8CGTA 1B9ZA 4B9YA 2ZX6A 1V3HA 3NIYA 1FP9A 4TXEA 2NT1A 3MMWA 2WMKA 3U7BA 2V3EA 2E3ZA 3T0AA 2WNWA 1PAMA 4TUFA 3PZMA 1WDRA 3PZNA 2O92A 4Z2JA 4S3KA 2VCBA 1HJQA 4AXNA 1XH2A 3VOCA 2J7GA 1C8QA 2EPLX 1BGGA 3VIHA 1SMAA 1M7XA 2XFRA 4UQBA 1GOIA 2WB5A 3CHEA 1PPIA 3EDJA 3WF2A 3LMYA 4ACZB 1ODZA 4DUXA 1C92A 4UOJA 1E0XA 3TA9A 1OBAA 1K9EA 1K6AA 4FF5A 3A6OA 1EQCA 1LJYA 1UD5A 4H8UA 5ABEA 1E4IA 1LQ0A 3PZ9A 3AIQA 1W1YA 3M6DA 3WH9A 1LF1A 4MJ2A 4HA1A 3VMNA 4PMXA 4CN4A 9CGTA 4MNMA 2BS9A 3I3BA 3IK2A 2GVYA 4PMUA 5GNZA 3VM5A 3L4YA 1JDCA 3RIKA 3K8MA 1JL8A 1HN1A 3W38A 4MNJA 2VX4A 3WELA 4ZE4A 1HP4A 1UR9A 1VIWA 3CGTA 1QVBA 4ATWA 2E9MA 4J3WA 1QNPA 2V3DA 3GTNA 4B3KA 4BQ4A 3IJ9A 5D9OA 4JCMA 2AOSA 2ZXBA 3F5LA 4AW7A 4X0VA 3POHA 4AZIA 5BWFA 1OB0A 1C8YA 4U33A 1G01A 2DEPA 1JAKA 1UQYA 4M24A 4QCFA 2RGLA 3KEHA 2CKSA 2W92A 4M1RA 4QAWA 1PIFA 3DECA 2X1IA 3ZJKA 1C90A 3SUTA 4UOZA 4FLOA 5BXRA 1EDQA 1H0IA 1E3XA 1E6PA 2FGLA 1V3KA 5JBEA 1XYFA 2WZHA 2AMGA 3GNOA 4B16A 2WKGA 2UWFA 1E6ZA 5TD4A 3QGVA 2VRJA 3CZGA 4Q22A 1MXGA 3AXIA 4XV0A 3UERA 1ISVA 2WCSA 5AC5A 3WQVA 1ISWA 3ARTA 3AZTA 1E6NA 1OINA 2A3AA 3DYOA 2WVVB 4AZ5A 5ABFA 4ATLA 4AZ6A 2VT0A 4UNIA 1XRVA 1AMYA 2DT1A 4ML4A 1FHLA 3L4UA 3TTQA 3MSGA 4MAVA 3FN9A 3PTKA 3EBVA 3ZIZA 4HOXA 3VILA 1B90A 1VB9A 3UETA 2CERA 4PMNA 4JKLA 3SCNA 1JZ4A 1EH9A 4PUDA 1ZJAA 2BXYA 3AHVA 5IHSA 1W3HA 3BAKA 1W1PA 1MW1A 1BFNA 3O6AA 1XH0A 3N12A 2WLZA 2X8RA 2TAAA 4PMDA 2ZXQA 1WPCA 3IAPA 1UYQA 1DWFM 2XPKA 2XWEA 4W8LA 5CPQA 1SMDA 3W53A 4MB3A 4OJYA 3BAXA 2GJXB 2J7HA 1FFQA 3VTRA 4HZ6A 1US2A 1NH6A 4PN2A 4H8HA 1GOKA 1HX0A 1TE1A 1JF5A 3WDHA 4UCFA 2E40A 3ZQ9A 1E0WA 1BVZA 2VZTA 2ZX9A 1JYWA 3VVGA 2Y8VA 5D9PA 3SEPA 3VDHA 5GNXA 3L2LA 4ZE5A 1C8XA 4BA0A 3RM8A 4P7LA 1E73M 2VTFA 5M5DA 1PX3A 3PN8A 1W32A 5C70A 3VD5A 1V6XA 1EHAA 2ZOXA 3BSGA 4R27A 1E56A 4UQ9A 1CXEA 1LL4A 2PBGA 5LA2A 5GPRA 1G0CA 3WF0A 1EGZA 2WSPA 3SCPA 3GXMA 3WH8A 3WNNA 4PMYA 3VD3A 5E70A 3K4AA 2X0HA 4W8BA 1Q4NX 4NI3A 4BQ2A 1OWQA 3ZOAA 3A4WA 4IUGA 1KXVA 3ZMRA 2XGBA 2YBUA 1BYAA 1UA3A 1X1NA 2NSXA 3HMCA 2PC8A 2FHFA 2J75A 4AZGA 3WD0A 5A95A 3ARSA 5DFAA 1OT2A 3VIGA 1WP6A 2PWGA 5A6JA 3EDDA 3G6MA 4JFVA 3OZOA 2BNJA 2V3GA 1JZ6A 3VDCA 4AY1A 1OCQA 1PJ9A 1CGTA 5HNNA 3CUFA 4JCLA 1VFUA 4PSRA 3N04A 4AIUA 3L4XA 1EO5A 5DT5A 1B3YA 5DF0A 1WNOA 3THCA 4UFMA 4WJXA 2XVPA 2ZUWA 3EMZA 4PSPA 5JIPA 1C93A 4PCTA 3N11A 1ODUA 2XIBA 2JEQA 3BAYA 1KGXA 1V3JA 4HP5A 4BCEA 4W5UA 3B9AA 3AIEA 3W82A 3N13A 5HXMA 2XM1A 4FMVA 4M82A 4ZFMA 2E8YA 1E6QM 5BXSA 1BYCA 2RGMA 2WVUA 4QCEA 4W7UA 1UA7A 4GZIA 4ATDA 2QMKA 1OD0A 3AIWA 3MSDA 4CGTA 1G5AA 2QMJA 4U2YA 2A3BA 4GQRA 1JAEA 2C0HA 3AMKA 3BCFA 3VU2A 4ZENA 3SCTA 4B3LA 5EMYA 4U3CA 3UG4A 3WUEA 1CXFA 5A8NA 3WN6A 3UCQA 4JKKA 3WFLA 4HA4A 3D3AA 1FH9A 3WFZA 1KGUA 1V0LA 2WSKA 3M46A 2WW5A 3SCOA 3PZQA 1B1YA 3HU7A 4PUEA 2DSKA 2WC7A 1GJWA 3GNPA 5C71A 1LG2A 3AMCA 2HVMA 2X2YA 4J3XA 2CHNA 1CBGA 3PZVA 5I5RA 1XD0A 4PRWA 4UTFA 4HTYA 1FA2A 1Q6FA 1XHGA 4CN6A 2ZUSA 3WL0A 1QI4A 1HVXA 5EFDA 1E15A 2EPKX 1W2VA 2B31A 3WUBA 2EO7A 4GINA 2Y2WA 4CCEA 2D23A 2JFEX 1EO7A 5D8WA 1OGSA 3WNPA 1QPKA 2EXOA 4R5EA 3ZJ6A 5A8OA 4F79A 4LYQA 1GQJA 4PMOA 1U33A 3HN3A 3VO0A 3N9KA 2OYLA 2ZWZA 3CMGA 4CVUA 1XSIA 2DSZA 1FOBA 1C7SA 2E0PA 4ZXOA 2PB1A 1HT6A 3ARVA 2J25A 4OIFA 2ZIDA 2XVLA 4RE4A 3DHPA 3O2LA 3A47A 4J27A 4DWSB 4DM2A 1YQ2A 4HMCA 1BYBA 3L4ZA 1E3ZA 1WB0A 1B31A 1JXJA 2BVYA 4MAZA 3W24A 1AQ0A 3DC0A 4MTVA 4AD0A 3LPFA 2VX7A 2WMHA 5BYWA 2Z1KA 5I3DA 3W0KA 3ARPA 4HOZA 1VFOA 4ACZA 2V5DA 1XD1A 4TVCA 4NF7A 4LQ1A 3RCNA 2BY1A 4JAWA 1N82A 1VRXA 3VGGA 4A3YA 1JXKA 1OD8A 1UH3A 2IXUA 2J7CA 4EANA 1XSKA 4KGJA 2J79A 3RJXA 3RILA 3WDJA 2J7FA 1LLOA 2VUYA 4CU6A 1CWYA 1JFXA 2BHYA 6CGTA 4E8DA 2WBKA 3K8LA 2J47A 1TR1A 2GDUA 2CITA 3WF1A 4C7FA 1VEPA 4PEEA 3SIMA 2CCRA 1MW2A 5HPOA 2A3EA 1H5VA 2WHKA 1MQRA 1WO2A 5EFFA 2G41A 4MB1A 3BLKA 5JBDA 5FL1A 1Y7VA 2XWDA 2QPUA 2AAAA 3D5HA 2WANA 3T0BA 4TVUA 4J3VA 1GOQA 2MANA 2W62A 2GJPA 3N17A 1EOMA 3LPGA 4M81A 1NQ6A 1GORA 4LX4A 1WE5A 1PEZA 5D8ZA 4V27A 3WUGA 1CXKA 4WKHA 3TOPA 2WCGA 2C8NA 3ARQA 3EDKA 1B30A 3AFBA 4UZSA 1JI1A 1KFWA 3WF3A 4AZ7A 1J01A 1H41A 2PWFA 4U3AA 2XUCA 3VGEA 5BRQA 1CPUA 3CBWA 4KH2A 1TZ7A 4C7DA 3BAWA 3CH9A 3K8KA 1GQKA 1UWSA 2JIEA 4L4PA 3JUGA 2WVVA 3VGDA 1HJVA 1A3HA 1VF8A 4TTGA 1ISYA 2Q8XA 1J0JA 1KWKA 2O9OA 1BQCA 4JHZA 1W2PA 3WH7A 2YA1A 3CHFA 4XX6A 1RP9A 1FH8A 4WK9A 3DYPA 3VMPA 3U57A 4W5ZA 4AIEA 4M56A 1BHGA 1PZ2A 3K1DA 1KXQA 1JZ8A 1DWAM 3WMCA 1XCWA 3AS2A 4KRUA 4MNKA 4ACYA 1SYTA 2WLYA 3T2QA 3O9NA 4PTMA 1MFUA 4MDPA 3WD4A 1B3ZA 1TMQA 5A69A 2QLYA 5EB8A 4RL3A 5FD0A 3SURA 5E09A 4CD7A 3BMVA 3WH6A 2G3IA 3PZOA 3OGSA 2ZICA 2XG9A 1BYDA 3WH5A 1W9UA 4NZCA 4HZ8A 4KGLA 1W9BM 1E4LA 1Q6EA 5JIWA 3VUPA 3ZM8A 3PZIA 3NYDA 3VGHA 4XZBA 4IPNB 3MUAA 4P8UA 5CPTA 3SUUA 4CCCA 1O6IA 3T2OA 1RH9A 4JZ5A 4XUYA 5A3HA 2DH3A 1TCMA 4AEFA 3WQ6A 3PTMA 3AS1A 1IZJA 2XIIA 2ZX5A 1JD9A 1NM9A 2PF0A 3WUFA 2J74A 2GK1B 1BVNP 2VRKA 2WHLA 4D6GA 1PIGA 1YHTA 1KR1A 3B9EA 1WZLA 1GJUA 4IPLA 1VAHA 3AYSA 1XSJA 2Y4SA 3MV01 3GXFA 2ZUMA 3GM8A 4F9JA 4PMQA 4DWSC 3OLGA 3WL1A 3GBEA 1QHOA 4W85A 4MJ4A 3WDRA 4TVDA 1JGIA 3AICA 1PBGA 1EQPA 2A3CA 2XGIA 1JZ2A 3PHAA 1NWRA 3N1AA 4RE2A 5I2UA 2W67A 1QBBA 1QW8A 3SUSA 1E6SM 4JL2A 4EAMA 1MVYA 4HZ7A 4FK9A 3ZR5A 3NSNA 5A6BA 5BXPA 1NWUA 3AISA 3RO8A 2X05A 1MW0A 2DSUA 3ZJ7A 5GNYA 3WMSA 2BV9A 3TP4A 3CUGA 3RM9A 3CZEA 3GBDA 4W89A 3EMCA 1UH4A 4ZEPA 1E40A 3AZSA 1AQHA 1HJXA 4WLCA 5GQBA 2VX6A 4KMQA 2ZX8A 3CZ8A
chains in the Genus database with same CATH superfamily
1IGSA 2WQPA 4PFHA 4LGXA 1AJ2A 4F66A 1QNRA 2VJXA 2E6YA 3IJ7A 3NQMA 1TYGA 2BGSA 4HHMA 1EBHA 2CEQA 3CNYA 4DRSA 4YYCA 4FPSA 4I6VA 2W4XA 5CC5A 3F2CA 5I3FA 4F0HA 4QQUA 1R2TA 3U8GA 1EJUC 4OBTA 4DJFD 3LNMA 4HU0A 3QW3A 5EKYA 3S42A 3VPLA 3HFYA 4AWEA 5BROA 5K3VA 1Z32X 1OG0A 3ZR4A 3IIOA 3VD9A 4FF7A 4NVTA 4R9XA 3CT7A 4ZO6A 2JKPA 2W63A 1V6VA 4E5TA 4JQ3A 2WK2A 4Z2HA 4TO8A 1E70M 2GVEA 4D6IA 3BGJA 4AY8A 2WQDA 1Z69A 1LOSA 4BWLA 3A24A 4S3EA 2W61A 1GVOA 3Q37A 3I3DA 8A3HA 3HG3A 1IE7C 3WEZA 1RSCA 3CH0A 3CLMA 8RUCA 3H21A 4K37A 1X6NA 3ATZA 3ABQA 4IM4A 1WCGA 2P53A 2V5KA 1KA9F 3MUY1 1T7LA 2PS2A 2QDDA 4XAZA 2WSQA 4KCVA 3LN3A 3UPMA 3DFTA 3CV1A 4XO7A 3RDKA 3W4RA 3PP7A 3W37A 3SFWA 1WDPA 3N4EA 2YDSA 4HYWA 4IP7A 4I90A 3BTNA 3RR1A 3WNOA 4CEUC 2GQAA 1JUEA 2PTZA 4EX4A 4GYKA 1KQZA 4LXFA 5C7HA 2WM1A 5D09A 2P0IA 3MMDA 2PGRA 1KM1A 3GSMA 1SGJA 2C14A 4Q6XA 2VEKA 3OW1A 4IL0A 2FHBA 3AMGA 2VO5A 5IOBA 2I57A 3AXHA 4HBKA 4FLSA 3CTTA 4MWAD 4GVFA 3HTWA 2A7NA 1KBKA 1CGXA 4QLJA 1U5JA 4GY1A 5D05A 2CLPA 4XD4A 2ZUUA 5BWAA 4QROA 1A4MA 2PTXA 1F6KA 5LXXA 3KM8A 3LI0A 3UF9A 4O50A 5FJTA 3S2JA 4HJFA 3KOWA 4KCWA 2NUYA 4GCAA 4H9YA 4TQTA 4FHAA 4IOTA 1ISZA 3GZ3A 3IGXA 1UD6A 1L6WA 4KIEA 3QPEA 3GHRA 4XSLA 3VNJA 5L6UA 1OFRA 3L4VA 1E0TA 4MWAE 1GYNA 3W29A 3PTQA 2RH9A 1XLFA 2NQJA 1ME9A 1TELA 4I8YA 2F8QA 1UKOA 4R7WA 3HQ1A 3EX6A 1XV8A 2FJKA 4H41A 5HWJA 5LIKX 1L6SA 3CHDA 4JYEA 2BASA 2CHOA 5CC7A 1ML1A 3N2MA 2V2CA 3EDFA 4D8LA 3DH7A 3OTRA 1HO1A 4FB7A 3CWHA 3VOIA 2WWCA 5K9DA 5RUBA 1AVAA 4M19A 2AQOA 4NXSA 1Q6DA 3E0IA 4CEXC 1Q6CA 2VZSA 3CMJA 2WNNA 4U2ZA 5U4NA 3RM4A 3KTXA 3H2CA 4QG8A 4YVVA 1CDGA 1XJBA 2BX7A 4FA3A 3HGOA 2OMAA 2VOTA 1RPKA 2YL5A 3QC3A 1H09A 2J7BA 1H3GA 4NIRA 2NLIA 4D1IA 4FLQA 5AYYA 3ABOA 4K6AA 4HK6A 1S1PA 3OG2A 1JIBA 4BI7A 2OX4A 1A5OC 1WKEA 2XFFA 4S3AA 1J0KA 1CTNA 1I0BA 2PRHA 4OECA 3CO4A 2G96A 3QV7A 1QHZA 3IUDA 4OBSA 5BU9A 1A5UA 4WY0A 1G1YA 1PZ3A 2XTKA 4MGGA 5A8MA 2DSWA 3TCSA 4GUFA 1TX0A 3FKRA 4HNCA 4FEZA 2D69A 1KTBA 1TTQA 3PAJA 1PYMA 3DDMA 1EC7A 4LVDA 4Z1AA 1ZU8A 4S23A 2R24A 2PDMA 5FEXA 4XZWA 3S2CA 3J7HA 2VQUA 3RJYA 3LYEA 4GGHA 5CSSA 4MJMA 4WIWA 4UFIA 1XCXA 3S2MA 3NGFA 3I65A 4IJRA 1E9IA 2GL5A 2RAGA 3CO8A 5F4WA 3BZGA 3QF0A 3A13A 1VFTA 1ZPTA 1TMHA 2VFIA 2Y1HA 4GXWA 2I9EA 1VKFA 4O28A 3HGJA 3NYZA 1YRRA 3AHTA 1PIIA 1RA5A 4FXJA 4DLMA 4P8XA 4AX6A 3N25A 3R11A 5AYBA 3QC0A 5T26A 1MUMA 1C3FA 4DNHA 5JUVA 4GI6A 1CEOA 2QT3A 1RP8A 1SJCA 4W87A 5PTDA 3R0UA 1QK0A 2WZIA 2V69A 2FDMA 1DTUA 2DW7A 2D22A 3E6EA 1ZUAX 1E9LA 1WZKA 4O1BA 4V28A 2J6XA 3AMDA 2ABBA 3GO2A 1VRDA 3ZS4A 4RZ6A 1XDJA 2PTWA 1YPIA 3EB4A 1EHNA 1M7JA 3PB0A 3QHOA 1AFSA 4H04A 3AHXA 4QSHA 4LUYA 3HIJA 5AVNA 3R0DA 3II1A 2V9DA 2BBFA 3U4FA 3H70A 5CGMA 3PNUA 4TX6A 3T1GA 2L5HA 1RJQA 5HNRA 4XB3A 3IGHX 1A4LA 3W2JA 4JTIA 4EWJA 3QMSA 3SY5A 1WAUA 1W5MA 4ZMGA 2CZEA 2X1SA 2D0GA 2JKEA 3IV8A 1JR1A 4JS3A 2HJPA 3TJ4A 1Q4WA 2PGWA 1REQB 4IWWA 3T0CA 1DV7A 3NPWA 3C2YA 3PG8A 2GSEA 3LHWA 1NDWA 2JF6A 4AU0A 2QCEA 4E4PA 3YPIA 4N7QA 1EGVA 2VDHA 2Z1XA 3QOKA 3GDTA 4E3VA 3EKZA 4NX5A 4ECLA 3FA4A 4N42A 4F3HA 2ZUNA 4DJEA 5JH2A 2HZGA 1VGAA 3E0LA 2IW0A 4LYPA 5FOOA 3DI0A 1A50A 1KM2A 1EDGA 4B2DA 4AEEA 4BF5A 2QJGA 3UYIA 4H8VA 1GUVA 5BRPA 1JG9A 1ONWA 4HU3A 1WV2A 2ONEA 1BF6A 1V0NA 3DAQA 1M41A 2QCDB 3N6JA 2AAMA 3L4WA 5CPNA 4LBSA 2B81A 3CZLA 2WCAA 2BOFX 2O7QA 4KWWA 2ZTKA 4RDYA 3NWRA 4KT2A 3GXDA 1IR2A 4GG9A 4QLLA 1MEHA 4LY8A 4OZOA 1TUXA 3A4XA 4HPNA 1K02A 4XZNX 4N4QA 4K8GA 3I7RA 2OSWA 3T81A 5EL1A 3KX6A 3NJ3A 1TVPA 3ANUA 4PCNA 1V03A 1CZ1A 2OOFA 1M04A 1GZGA 5I03A 3S6DA 3LXCA 4OOUA 2QCHA 2JIWA 1XINA 1S38A 4CQ9A 1D9EA 1EWDA 4Q8UA 3UFYA 1B3WA 1HKJA 1NP0A 3VNYA 4O14A 4UTMA 3DERA 4OBRA 2PU0A 1PX4A 3QM3A 5I79A 3W81A 1XQLA 1QWKA 3PZUA 1DJIA 1F05A 2YL8A 3QY7A 4AHPA 1XYCA 4F0KA 6TAAA 5CJ5A 3VDAA 1KCZA 1NJJA 2Y7FA 2HROA 4Q32A 5REQB 5EU9A 5D2TA 2V30A 3P74A 4Y9NA 2NUWA 1Q2RA 3UJEA 1W8GA 4ZQCA 4D9PA 4CLMA 5AHNA 1OFBA 1XLJA 1J0ZA 1F6PA 5SWUA 2SFPA 1W5QA 3LLFA 3KP0A 4EK7A 3LHYA 1GVRA 3WLKX 4JTKA 3DU0A 1Y5VA 1IZCA 3NSMA 1GOMA 1P7TA 3KOFA 1FWRA 1V7AA 5M2FX 1NDYA 1VEMA 5HDRA 3GKAA 5CSYA 2VFEA 1BVWA 1HVQA 3LRLA 4D6EA 5TIMA 2OQLA 3WMBA 3ONCA 2CESA 4ZTXA 2Y7EA 3GR8A 1A5SA 3TSBA 1GOOA 2BOGX 1CI1A 4W86A 2VVSA 2V3FA 4UZUA 5BCAA 4JFSA 5FF0A 5CPLA 5D2VA 2I16A 3P0XA 1P1MA 3WY1A 3KWXA 5DLCA 1R3WA 4H7ZA 1A0CA 2Z2BA 3GH4A 2OPJA 2P88A 1IGWA 1ZBVA 1B2YA 3N19B 5E93A 4MFEA 3RX4A 2BVWA 5DRIA 3ZWTA 1J18A 5DBUA 1ONXA 3TA6A 4HB7A 3CEUA 3EGJA 3W1LA 3URBA 3RF9A 2NWSA 4JNMA 4P7NA 3T05A 1MFVA 1TQXA 1X7IA 1WKFA 3DN5A 1U5HA 4RKAA 1CGWA 4KEZA 3IV3A 2FZ8A 3TW7A 4HOWA 2J8FA 1HF6A 2MUCA 2IXVA 3IRDA 2XIOA 3WO8A 2QV4A 4LU0A 3CUZA 1QW7A 3SGUA 1WX0A 1DIDA 1V6UA 4ZO7A 3THDA 2NV1A 4PYSA 3AXXA 1YDYA 1X1ZA 1TWSA 4E3TA 1HJSA 4HHLA 2FIQA 3MU7A 1DHKA 4WQ6A 1VEOA 2BXZA 3FXGA 4AC7C 4XZ9A 1J12A 1XLEA 2E77A 1QI5A 1HUVA 4MWAB 2NT0A 3LOTA 4NASA 1QI2A 2ISWA 2CPUA 3MVIA 1BG9A 3AYRA 2XFYA 3MP5A 3PUOA 3VIJA 1GPWA 1DORA 2E9BA 4KRTA 2GGHA 3WBEA 2D3LA 3ICJA 4MB4A 3S1VA 3FJNA 3WLNA 4HNOA 2NQHA 3SM0A 4WD0A 3RG6A 3WQ4A 3K1GA 1XH1A 4HNVA 3ZR6A 1TMLA 1NP2A 1CT5A 3CUXA 3TW6A 4ML9A 3S0CA 4PA8A 3W1RA 2VC5A 1IIGA 2C7FA 3HPXA 4RDVA 1KR0A 1W91A 4UCGA 2VCCA 1F8IA 1UD4A 2OEMA 2C1GA 1E1FA 4H3DA 1A3XA 3SCWA 2GZXA 1BSIA 4PE8A 2EPNA 1MW3A 1J8VA 3DG6A 1P0NA 1EC8A 2CETA 5C8BB 5BXTA 2VVNA 1UWQA 1E51A 3VM7A 1DJYA 3C8FA 3MSRA 2G3NA 1EBGA 5GJPA 1HQTA 3BXWA 4AD3A 1RVKA 4WDTA 1A5BA 3O6CA 1Q5MA 3BOFA 3E0FA 3WEMA 1MXDA 4CQCA 4DZ5A 1PDZA 3WQCA 3P62A 4AISA 3MDWA 3W1PA 3REQB 4J5NA 2QS8A 1Y0EA 5F2IA 4AZCA 3INPA 5H91A 5CPSA 4HNTA 2ZUTA 4WHBA 1EDTA 2CZ5A 1M65A 4WJ8A 3W1QA 4Z2IA 4WDWA 3V1HA 3V5CA 3ARZA 3QTPA 5DMNA 2Z1WA 5F7UA 3W02A 4CU8A 1UP3A 2I5GA 3FK4A 4GIAA 3QN3A 5EGRA 4KWSA 3IUHA 5CPMA 1S5WA 1EFZA 3SECA 4GUIA 1KTCA 4S1FA 1OT1A 1UB3A 4R7JA 3FJLA 3AS0A 3BAJA 4Q8PA 3OVGA 3OBAA 5CQ1A 2OGYA 5HJYA 5HANA 4KF1A 3N2TA 3NDYA 4JIIX 6ALDA 1KWGA 3CMFA 4RJEA 4PUKA 4E2BA 3IAQA 1VFFA 3KL5A 4NL1A 1JNEA 3TSMA 3MCMA 4Q6JA 1R7OA 2J62A 4HVXA 4AHOA 4JICA 4CD6A 2YLAA 4CQAA 5DCDA 1P0KA 4ZOEA 1TPH1 3FXYA 1J10A 1YMYA 3NQ2A 2E25A 3EWCA 5K9XA 1UR2A 3AC0A 1QAPA 4C5ZA 3KBVA 2XVNA 3VOFA 3WQPA 1J9YA 1XUZA 4IIHA 1FCQA 1WAWA 2RJHA 3UR7A 3M43A 1XIFA 3RPDA 8CGTA 4HCDA 3PBYA 1M3UA 4TXEA 2QUTA 3I7QA 2YCLB 3TZFA 1PAMA 4TUFA 4Z2JA 2O92A 3LI1A 3RCMA 2VCBA 1HJQA 1YXDA 1J2WA 1QK2A 2OG9A 1QOQA 1C8QA 2J7GA 3QQ0A 1VFSA 1ZCOA 3SGZA 5KZMA 4UQBA 3KRZA 1GOIA 3MHFA 3CHEA 4RNFA 3EDJA 1P1XA 3LMYA 3W1UA 4G7EA 1JCLA 1P5BA 2PWVA 3MPGA 2Z27A 1K9EA 3A6OA 1DJZA 1E4IA 1LQ0A 1AD4A 1TV4A 3KVJA 4UBPC 1R3TA 3MI2A 3GR7A 2Z2AA 1NQKA 5G1TA 2DZSA 2C3ZA 1AW5A 3BW3A 2BS9A 2HBVA 3I3BA 3WLQA 2HCVA 4Y90A 3L4YA 3PBVA 3VDGA 3K8MA 1JL8A 1HN1A 4GY7A 2OGJA 5EMMA 5KZEA 2Y63A 4PCPA 3DZ1A 1UR9A 3CGTA 3GDKA 4FOJA 1J6PA 4ATWA 2E9MA 4OFCA 3STCA 5T91A 3N73A 4N9DA 3F7JA 4OU1A 3IJ9A 3PJTA 2GVGA 1MRQA 3A23A 3LNPA 3TOYA 4M6PA 1X98A 2NX9A 3BARA 2FZDA 3QKEA 1O5RA 1DHPA 4QAWA 3DECA 4C5YA 2V68A 2X1IA 4FLOA 1J2BA 1EDQA 2FGLA 5CEWA 1V3KA 5JBEA 1XYFA 2CZVA 4K39A 1YBQB 3BPWA 4GYFA 3GB6A 5CCZA 1E6ZA 4IUOA 4GJJA 5BRBA 2VRJA 4DO5A 3N14A 3AXIA 2NV9A 3C2FA 3WQVA 1ISWA 1GOXA 4ZQNA 1E6NA 3G3MA 4AZ5A 1NDVA 1MEIA 2VT0A 4LUSB 3BV7A 2FZNA 3N4FA 3FN9A 4QNWA 3ZIZA 3D47A 1A5LC 3UETA 1V6TA 3VC5A 3MI6A 3WZ0E 3SCNA 4DAFA 2E68A 3LLDA 3UG8A 2C6QA 1A5MC 2CZFA 1RQHA 3NQBA 1W1PA 3I6EA 4UTJA 3O6AA 2TAAA 4PMDA 2ZXQA 1WPCA 2PPGA 1VCVA 1SO3A 4MB3A 4X22A 4OJYA 3BAXA 4XO6A 1DVJA 1F07A 1VS1A 1US2A 5LIXX 1HX0A 1TE1A 4ICNA 2H6RA 3PS7A 2VGIA 3ZLFA 1XS2A 2P0OA 2WSRA 3RLVA 3RHGA 1KKOA 3SR7A 5HWMA 4QS6A 2VTFA 2FB3A 3LCXA 2PD9A 3VD5A 3HB9A 1EHAA 1LCOA 4DZIA 4TIMA 2E5DA 1XXXA 4GUGA 3CL8A 3TIMA 3WJWA 5C0QA 3MB9A 3G0SA 1EF2A 3OVRA 4ZCWA 5GPRA 1Q65A 3WF0A 2XH0A 2D73A 1G4TA 2WSPA 4S3GA 3VXGA 1EX1A 3FJ4A 5C2GA 1EYWA 5HJXA 5E70A 3K4AA 2X0HA 2XN1A 4LF1A 3P5ZA 4L1XA 3LS9A 4FI4A 3GC2A 4IUGA 4HNUA 1JPHA 4TX9A 3Q45A 1T40A 4DZHA 1PKLA 4H4IA 2QF7A 1XICA 4KFOA 1JCNA 3PSVA 5H2ZA 5DXYA 1JQXA 2H8XA 3DBNA 1OT2A 3VIGA 3WK1A 1OABA 4AVOA 5A6JA 4LUTB 1S3HA 2BNJA 1JZ6A 2Z2UA 2CWXA 3VDCA 2E6FA 1LZOA 2ZADA 1O1ZA 2PSNA 4ZZ9A 1VFUA 2X41A 1XYMA 1IXOA 1B3YA 4RV8A 4JYFA 3ERPA 4N6FA 4GC3A 5DRCA 1XYAA 2OEKA 1C93A 1Q13A 1U5VA 4HP5A 5FEWA 2C91A 3KUMA 4M82A 4ZFMA 4B4HA 1AG1O 4X63A 2FPVA 2RGMA 2WVUA 4WXZA 1EJSC 1F61A 2QMKA 3SRHA 4NAFA 1Y65A 1OD0A 2X42A 3MSDA 3HQOA 4U2YA 2VELA 4KBXA 2C0HA 1ZAJA 3WLLA 3M44A 3VU2A 4JQ1A 4A22A 3GQYA 2F9RA 4B3LA 5C5YA 4U3CA 4GIRA 4O16A 1CXFA 4C6MA 4C1LA 2YCEA 4CCZA 4HA4A 3RFAA 2R1NA 1DIKA 2PODA 2V2HA 1DPMA 3PZQA 4PUEA 3GNPA 3JW7A 2HVMA 2X2YA 2ZRZA 1XD0A 3GU9A 3HQPA 4ZOAA 4AAJA 4UTFA 4J2PA 1L2QA 5AB3A 2OLAA 4GVGA 1MDRA 2ZUSA 2Z29A 3DFHA 3SBFA 3RRAA 1QI4A 2ANUA 4MZYA 2IMRA 1F7BA 1SFTA 5BMXA 2OKTA 2AL2B 4GINA 4GD0A 1GJPA 1FVPA 4DX3A 3APTA 1BTMA 5D37A 1AH4A 4MSSA 2X40A 4F79A 5D03A 4JEJA 2GGIA 3QYQA 1T41A 3VO0A 2J8TA 1K7EA 4JTDA 4YWIA 5FA5A 2FGBA 4NZ5A 2OYLA 1A3WA 3LEPA 3O7UA 4CVUA 1AW1A 2DSZA 1IXPA 2PF8A 2PB1A 5F4SA 3SIZA 3AU2A 3ARVA 3M0IA 2ZIDA 4RE4A 1R2SA 4HNLA 3O2LA 3PPFA 2YCIX 2XZ9A 1OVDA 4DM2A 4HMCA 3L4ZA 5BW6A 2V81A 1S39A 1WB0A 2DZTA 1B31A 2BVYA 2QUNA 4Y8FA 4CQBA 3W24A 4AD0A 3HURA 4EWND 2Q71A 2Z1KA 1SO5A 3QR1A 4L80A 5CH9A 4LUJA 1GVFA 2Q09A 3U2EA 4TVCA 4N9EA 4NF7A 4DXVA 3EPMA 2VWTA 3VGGA 1FDYA 5HWNA 1OD8A 3FKKA 1H7NA 4L1GA 3AUOA 4IQLA 1FCVA 5C6MA 1D7KA 3AU6A 4LJ3A 1XSKA 2J79A 3RILA 2J7FA 1XLDA 1H5YA 4CU6A 3MZ2A 3THAA 3MSYA 1ZTVA 2VENA 3LTYA 3NQCA 4GACA 2J47A 1Y5XA 1OJXA 1TR1A 2Z00A 4ZGYA 4J3ZA 3NZ1A 1PCWA 2CCRA 1MW2A 2A3EA 4LF2A 1H5VA 2I7GA 3AALA 4XKMA 3T6CA 1TX2A 4MB1A 1S2UA 2PFHA 3BLKA 3VE7A 1Y7VA 3W7NA 4NKCA 1PWMA 1QASA 1GOQA 3GVVA 4JGDA 4JTCA 4IIGA 2XH4A 3N17A 3C2VA 4LX4A 1KRBC 3R89A 1PEZA 5D8ZA 1CXKA 4WKHA 4JY9A 4Q8MA 2C8NA 3GAKA 4RPPA 4BY3A 3DKLA 1H41A 3M0LA 3S1WA 4A2SA 3NL3A 3BAWA 2GOUA 4DVOA 3EWXA 3VI2A 3MYOA 3U4AA 4L4PA 3JUGA 3VGDA 1ZHAA 3Q94A 4V1YA 1TJPA 2FZ9A 5LZLA 2PAJA 1BQCA 1D8WA 3H24A 3WH7A 4XX6A 2ZC8A 3UY7A 3L9CA 3DYPA 1H50A 2FMOA 4Q8OA 4W5ZA 4A35A 5CJNA 3K1DA 4O1CA 3EKLA 4YL2A 1KXQA 1Q63A 1JZ8A 1DWAM 1S2CA 3H2EA 2ADAA 4KRUA 3TQVA 2WLYA 4S3CA 2QVHA 4WJEA 4O57A 4DXKA 4F48A 3O63A 4IIDA 5EB8A 3SURA 1FUYA 1QDSA 2PGEA 3WH6A 3VC6A 2ZICA 3BLIA 3B9OA 1LRNA 4NZCA 4ZSUA 1HG3A 4LV9A 1Q6EA 3ZM8A 4LNCA 5DMLA 3ZZ1A 4IJCA 4P8UA 1O6IA 4RR4A 4KEVA 2DH3A 4AEFA 3KLLA 3L5LA 1JD9A 2GYIA 2PF0A 3WUFA 4D2JA 1EC9A 1UMYA 3ABXA 5H8MA 4Z0SA 2Z7GA 1VAHA 3GXFA 1K8YA 4DWSC 1KFLA 3VABA 1TPB1 1JGIA 1BWKA 1SZGA 2WNQA 3W07A 1JZ2A 1JCMP 2CLHA 1PWLA 3N1AA 5HQMA 3OHIA 1AUSL 3CHVA 3GFZA 3GU2A 3L0NA 4EAMA 4HZ7A 4FK9A 1RR2A 1X8FA 5BXPA 2C0AA 5BOOA 5H8PA 2C15A 1ADSA 1MW0A 2QIIA 1JUKA 3RXZA 3KRUA 3PWGA 1V79A 3RM9A 4W89A 1UUMA 1QNVA 3EMCA 4JIHA 4Q4MA 1G4EA 5B80A 4Z1BA 3AZSA 1AQHA 2W79A 3KDOA 4KMQA 3UJFA 3N2XA 4WOZA 3BMWA 2ABAA 4JTSA 4PRTA 5AY7A 5EBUA 3NVTA 3KE0A 3BV4A 2WO5A 1FWCC 3CIXA 2VRQA 2O4QA 1M1BA 3CHCA 1HNYA 1PTDA 2XSBA 4YVPA 4I5RA 4KWOA 3PANA 1K9DA 2YDQA 5EPDA 3SCUA 3VD7A 1GKPA 3ITVA 4XD3A 4AD4A 4ZR8A 3HA1A 3U7VA 1PYFA 1F8MA 4XZMX 4BQ3A 3TV8A 4BI5A 4A3HA 3CAVA 1V02A 1XPYA 2ZKMX 1UG6A 5CC6A 1A0DA 4PUMA 4DPQA 3B0VC 3LBMA 3URNA 1R3YA 4RNHA 3MP3A 3VMOA 3WDQA 4ZQRA 3CV7A 1NOUA 3PZGA 4RZ5A 2G97A 3T8QA 5CPOA 3Q65A 3LM3A 4DYJA 3OEXA 4MPKA 3DHUA 2PP3A 1E1EA 1PE1A 1XUUA 5C9WA 3IIVA 3FGCA 1ME7A 4H7CA 1OCJA 1VPYA 1EJTC 2R82A 4LS0A 4NYYA 3LG3A 3KDNA 1XDMA 3GW3A 4GMEA 1PHQA 4I9AA 2R1MA 4XVDA 4IFKA 3GDMA 4NT0A 1XPGA 3P7YA 2MNRA 1ZJBA 2GFTA 1HJWA 3CLWA 4K7YA 3FJ6A 3UXDA 1I2QA 2JQXA 4FS9A 1JYNA 3ITGA 1OYCA 2DIEA 4D71A 3P81A 4WCJA 2O9RA 5FF4A 1EJXC 4WXYA 3H26A 2DUXA 1UPPA 2R6OA 3GRIA 3F2BA 2FMNA 1SW0A 4C6FA 5IHRA 3JU2A 4DJDC 1V77A 3VIPA 1QNQA 4DUVA 1TV5A 3GXIA 3MWCA 1DWHM 3O07A 2WPBA 3RGTA 2I1OA 2R14A 3E1F1 4JY8A 5A8QA 1Z41A 3G5EA 3CV2A 4QRNA 1EYEA 7REQB 3ABZA 4XBSA 1J0IA 5FEZA 1UC5A 4HSOA 4MKSA 1DYSA 3SUWA 3TYBA 3BLFA 1PVNA 3S1GA 3MUZ1 3V1PA 2DGAA 1ISXA 1QBAA 3ZSTA 4DWSA 1EWEA 2FVLA 1ZBWA 4NP7A 1E9YB 3W7HA 4K68A 2ZUVA 1UOZA 1JRBA 1LWJA 2V8ZA 4ILSA 1UZ1A 3DESA 4LY4A 2ZVRA 2YXGA 3KRSA 1JPIA 3OGVA 2PWDA 4H2HA 4HSNA 4EXQA 1LUCA 3BQ6A 5LNSA 1A53A 1N8FA 4KCTA 2XIJA 4AVNA 3HPAA 5FL0A 2YGYA 2WMFA 3BG9A 3L0GA 1LP6A 4R85A 4UQDA 5HULA 3IJ8A 5HUPA 4CCDA 1L9WA 4OOZA 5AOUA 3U3HA 2CWNA 5A8PA 2FLIA 1KM3A 1E4MM 4UOQA 1V6YA 1UUOA 4NILA 4QG9A 1TPUA 2FPTA 3SCQA 2J4GA 1M03A 4QFUA 4HA3A 3P84A 5M17A 3S83A 2GUYA 4K2SA 2NQ5A 4CD5A 2PBOA 3WEOA 1OG6A 2DORA 3UWVA 1Z44A 1XGZA 1P6CA 1ZALA 2D2OA 2YW3A 3V3WA 3AWOA 3B97A 4D6CA 4NAEB 1NOFA 3R79A 2Y8KA 4TTUA 3S47A 2DZVA 5D2WA 4I6KA 3DUGA 2W66A 4LANA 3HQNA 3UZYA 1RAKA 4Z42C 4BS0A 5E5CA 3PPGA 2HK1A 3K4DA 4M1BA 3WK3A 4GK8A 3UNDA 3M47A 2R94A 5LNWA 4FSAA 1SFSA 3LCIA 1BWLA 1Q7QA 4LCQA 3KLKA 1YNPA 5ABHA 3C61A 4K8EA 3L0KA 1W9DM 3GC4A 2BFGA 4B91A 1FXPA 1S2TA 3CB8A 2YZ5A 3BE7A 4O4VA 3TLLA 4W9TA 1H1YA 3L67A 5CBIA 3MUIA 2IKJA 1XKJA 2UV8G 3QW4B 4E8GA 4QLKA 2AKZA 3H4XA 1D7FA 3M0ZA 1KW1A 3T9PA 3AIVA 2ACQA 4DJDA 2WPGA 4N9BA 4NI8A 3I3EA 2W91A 3MW7A 4D6DA 4J7RA 4M29A 4J9JA 4NZ4A 3VX1A 2D24A 4HPGA 5LIWX 1UBSA 1VJSA 4XKYA 2CXEA 1NOWA 4M3PA 5F1UA 3LA4A 4JKMA 1GHSA 3VIFA 1O5KA 1RQEA 3O15A 4I5XA 1T99A 4MHBA 2UY3A 2VOMA 3CJPA 2E28A 5CZSA 1W1TA 1GW1A 4PTXA 1GTHA 3BSHA 3XINA 3BH4A 3N2OA 1UUQA 1O60A 3O1NA 3NSXA 3NCOA 1BLIA 3W25A 5I0DA 3RLUA 2Q6ZA 5E9AA 3VCNA 1BG4A 2VYOA 3DBPA 5M03A 3LD5A 3MMUA 1DL3A 1RUSA 5E0FA 1WKYA 1K9FA 4GX8A 3LGGA 2G3JA 1KRCC 5I23A 1XBVA 3WD2A 2DIJA 3W70A 2FTPA 3IS4A 2C71A 3PF3A 4RE3A 5LHFA 1JZ3A 1V5XA 3NUKA 4J3SA 4ROPA 4AC1X 2CLLA 1R0MA 4IX0A 1TKKA 5CSUA 1AL7A 4E2OA 4IQDA 1V3IA 3OLEA 4O0KA 3SRFA 2ZRXA 2QCNA 4JX5A 3R4IA 1ZS2A 2VR4A 1KM5A 4L65A 3LQGA 3GNDA 1W9XA 3FCPA 1VFMA 4DI8A 2ZA2A 2GJXA 2R1KA 2X7WA 4GVIA 3VA8A 1UQZA 5A6SA 2J27A 3KHDA 3ARYA 1U22A 4QITA 3GH5A 4H7VA 1SR9A 3ARRA 4KFPA 2G37A 3QSRA 1AMKA 3OOQA 2H90A 4YHEA 4FX6M 1U83A 1WXZA 4WSJA 4AF0A 3CEPA 1FFRA 5CBBA 3OLDA 2BY3A 2GJRA 4DUWA 4FXSA 2QW5A 1R86A 1B0IA 2V5BA 2VUNA 2J7DA 4FNQA 4AX7A 4A21A 4O13A 4IZGA 4IIEA 4H9TA 1TVNA 1UC4A 4I3GA 3OA5A 4OUEA 1RBLA 2HMCA 3WF4A 2Z1VA 2WHMA 2QPSA 1DJHA 2IS7A 4AYGA 3TXVA 3EKGA 4GYJA 1J11A 1KCKA 2WJDA 2VR5A 5D2YA 4WX2A 2VCAA 1V3LA 7CGTA 1W54A 4IF2A 2HVNA 2UY5A 2W9MA 4WKAA 4WDUA 4N02A 2D0HA 4JX4A 3M7WA 1S5TA 1TPC1 4AD1A 4AMCA 2WMGA 4QG6A 2QXWA 2EG8A 5IXEA 4DYEA 1CX9A 2EQDA 3W6YA 1M53A 3CPGA 4X2PA 3W7MA 1OFAA 3C4UA 2C79A 4WRHA 4NJIA 1W17A 4H9MA 3B8SA 3NO3A 3A12A 4P7OA 1UZDA 3TYZA 1CGUA 3N3MA 5FF2A 1OSEA 3NURA 1FWFC 3VNIA 4B90A 4OV9A 4C6EA 2OWCA 3H54A 2NXGA 3G1SA 4WOQA 1FH7A 4UR8A 1V3MA 2VC9A 1YDOA 1ZB5A 3POCA 4HN8A 1WOBA 5F1VA 1IEWA 3VX0A 1AJZA 5I3KA 3WQ5A 2D2GA 2TYSA 2INEA 1J6OA 1DWJM 3W1AA 3TYDA 1I2OA 4CNSA 3UJ2A 4HK7A 4Q4OA 4MLJA 1CGYA 1PTGA 1YNQA 1D8CA 2BY2A 4L4MA 4L9ZA 1OYBA 3TAKA 3PBMA 3NQ6A 4NRSA 4D8AA 2DUAA 3CPUA 1PX8A 3URAA 3W83A 2ZCGA 1AZ1A 3BL3A 2PDHA 5HQLA 2YDAA 4S39A 4HPHA 4ZB2A 3S6TA 1J0HA 4I7WA 1JGMA 3L4TA 4Y7EA 4S38A 3SAZA 3G77A 5HMFA 4CVWA 3HPSA 4GI9A 3FVMA 4YTRA 3AS3A 3WYZA 1X6UA 1HJUA 3MBDA 1GCYA 2EPMX 5CLTA 3CAWA 2WZEA 3O0FA 2D1ZA 4JIRA 2A3HA 1Z42A 1JFHA 4DXXA 5HBFA 2EG6A 1US0A 4IG2B 1GZ1A 4YYFA 2RFGA 3BJFA 4F40A 1J96A 2CBUA 4OGZA 1RLDA 1H51A 3PPHA 5FIPA 1XC6A 4J4KA 4HMDA 2EG7A 4U5IA 3OBEA 3L2MA 3FW6A 1QPRA 2IQTA 1UR1A 4LALA 2FH8A 1IHIA 3AYTA 4YWSA 2B7OA 1UBPC 2P8CA 5D02A 2IKGA 5HQEA 4AYSA 4AMAA 4IL2A 2C1HA 5DELA 1Z3NA 1C8VA 3W73A 2YLLA 4PGLA 2G4JA 2PP1A 4DBWA 2PDWA 4UR9A 2JE8A 4BFAA 2TODA 3DYMA 5HMSA 1IYXA 2HNEA 3MCOA 1SZNA 2HRWA 1HO4A 1EL3A 1YDNA 3NL5A 1VENA 3SO7A 4BK9A 4X2RA 4BI6A 1DTNA 4D6FA 1QI0A 2W27A 4KEMA 1Z6KA 4PODA 3R43A 1S46A 3M4HA 2YXOA 1ALDA 3DFSA 3VDBA 4Q7IA 5KINA 2YJQA 1BXCA 5LKYA 5HK4A 3S8HA 1KD0A 5DMYA 4CNUA 3AJ7A 3AWNA 3F4VA 4LFYA 1OGBA 3N4AA 1NU5A 3WNLA 1S5NA 1R3RA 3NVDA 1K7FA 3UA4A 3KBSA 3DG7A 4PMJA 1UKTA 2REQB 4AZBA 4MF4A 3I4KA 2W5FA 2WC4A 2BDQA 1TRIA 3SCSA 2YDRA 3B0UX 1YXYA 1FWHC 1G9HA 3M64A 4GH1A 2J66A 3FIGA 3AZRA 2PI6A 1BF2A 5LHEA 3PJWA 3UG5A 4PTWA 3PWAA 1UWTA 2P10A 3RPMA 3NGJA 3T08A 2Y62A 3OLIA 1UWAA 1K03A 4HTBA 1GEQA 4E38A 3HZ3A 1UWIA 5I77A 4QP0A 1J0YA 1KM4A 3VINA 5DT7A 4PL2A 1GHRA 1SQ7A 2OKOA 3P61A 3TTSA 4I9TA 3AXKA 5D2XA 1UR4A 5I02A 4FIQA 1EIBA 1FKXA 2Q01A 5D38A 4HU8A 1CGVA 1XRFA 4G7FA 4JL1A 4IGSA 5EMKA 5CXPA 3ZT6A 2FFIA 3ALFA 1K8XA 2ZZ5A 4Y96A 3TCEA 3MP4A 3IACA 1YPFA 5AHMA 2DT3A 4ZQMA 3FV9A 4DF2A 2P1FA 1YXCA 4ICCX 4XUGA 4US5D 2H8ZA 3IJIA 4JTLA 5LSMA 2FPYA 2OZ3A 2BY0A 1K7XA 3ITOA 4GO8A 1BAGA 2YFOA 3GKFA 4QISA 4GO9A 3G6LA 2VFDA 4R3UA 1W5OA 1WXJA 2Y88A 3E5PA 1GONA 2X30A 1OCNA 3A4AA 2GDQA 4EAYA 2V2DA 1UD8A 4K1GA 3QLLA 3NPUA 3STGA 7TIMA 1F6YA 4KQNA 4MY8A 4JIPA 2VGBA 2YZRA 1IT0A 4GGBA 3PFRA 3TEVA 3RU8X 2XN2A 3IIZA 3BLEA 4CD8A 1CW2A 3L5MA 5CLWA 4NXKA 3KBMA 1KFKA 1QWGA 2QCDA 2XHYA 2OZ0A 3OZPA 4LYKA 2ISFA 3LHUA 2GK1A 4JEQA 4DO7A 1RLCL 1EP2A 2H3DA 2PWHA 2GJLA 4O1AA 1AJ0A 4LAKA 2Q8LA 1CXHA 2FH6A 4XZIA 2RDTA 3UWEA 1TPWA 1V6WA 3CQHA 1TIWA 2J9ZA 4XTIA 5A2CA 3GNRA 3ZJ8A 4CKQA 3CM4A 4CU7A 1GVEA 1ZENA 4LEQA 3WSUA 3QJAA 2XU2A 1OYAA 3L23A 3B8VA 3RYSA 3R8GA 1G4PA 1V3HA 3NIYA 4RDWA 2Q3RA 3RO6A 3KRBA 3MMWA 3U7BA 4PUWA 4MWAC 1WDRA 3PZMA 3G1YA 4S3KA 1LBMA 1XH2A 3VOCA 3JR2A 1QO2A 1EJRC 1ITUA 3VAVA 1SMAA 8XIAA 2OEJA 2R9RA 1XIGA 3WF2A 3D6NA 3MC5A 2YBVA 3TC7A 4ACZB 1BKHA 1E0XA 3NOEA 3IJDA 3LHVA 4Q7BA 1TV3A 1XG4A 3RR4A 1LJYA 1UD5A 2PLKA 3PZ9A 3AIQA 4GKTA 1LT8A 1TV8A 3HO8A 3UZXA 3KBJA 1LF1A 4HA1A 1EIXA 1GVSA 2OO0A 3VMNA 1JDEA 4ZL1A 1FWWA 3CL7A 3PBWA 4CN4A 2BWGA 5MHBA 4MNMA 1ZJIA 4F2BA 3IK2A 2PDJA 4AIBA 3RIKA 2DZAA 3W38A 1NFBA 4IH3A 4NJHA 1FHVA 3T78A 3UWQA 2Q8ZA 4OV4A 4J40A 1VQTA 3SN0A 4J35A 4B3KA 2NUXA 4LNYA 4BQ4A 9XIMA 5AKQA 1MDLA 4QJ1A 2ZXBA 3F5LA 3USBA 3H7RA 4AZIA 4FX7A 1C8YA 3TC6A 4HD5A 1G01A 4XVEA 1JAKA 4MG4A 2RGLA 3KEHA 3TLQA 2CKSA 5GJNA 4EACA 4OHQA 4O1EA 3DHDA 3ZJKA 4ORMA 4BKNA 4DJFA 4IIFA 4PZVA 3MBFA 3ORWA 3QY6A 3GNOA 1NELA 3SN4A 2HBXA 2WKGA 2QDHA 5TD4A 3HGSA 3IJQA 3CZGA 1K8CA 4Q22A 1AZ2A 4F0SA 2QUMA 2KAUC 1I0DA 3M0XA 3AZTA 2A3AA 3A5VA 2WVVB 1SJBA 4R7OA 1XRVA 1LROA 2VEMA 1AMYA 5H6HA 4FR1A 4PULA 3MSGA 4MAVA 3TTQA 3W87A 3E0VA 3NQFA 1B90A 1VB9A 4MIMA 3FDGA 3WBXA 4D8ZA 5EA9A 2FB2A 3G1RA 1JZ4A 1EH9A 3G1FA 3NXLA 1MW1A 4QDPA 1BFNA 3TSDA 3I6TA 3IAPA 2UZ9A 1DWFM 2XPKA 3GR4A 3E38A 2PDFA 2GJXB 2J7HA 1XW8A 4LB3A 3MO7A 3GXTA 5C7VA 4PN2A 1ZRQA 3A4JA 3AUJA 3WDHA 1BRLB 2ZRUA 3F4DA 3B8DA 3VVGA 5D9PA 4JDBA 4ZE5A 1R47A 3QV6A 5AHEA 4FO4A 4L5ZA 5G1MA 4AF0B 4AHQA 1W32A 1SSGA 4IICA 1R9XA 4JNZA 3BSGA 4MWAA 3CL6A 3RX3A 5LA2A 3H53A 1TPFA 3W76A 1F74A 3VE9A 4C1KA 3C5QA 4DLFA 1H7OA 3QYSA 3PWIA 4IQEA 3G8EA 3WNNA 3STEA 4PBFA 4PMYA 3B8TA 4LRTA 3VD3A 1HGWA 1Q4NX 2WNZA 4BQ2A 1OWQA 2Y5JA 1W56A 4JDYA 3R8RA 1KXVA 4JHMA 2XGBA 1Z8AA 2HS8A 2CW6A 2QDGA 5LNUA 4GBDA 3LXBA 3R0KA 2A5HA 2PLMA 2J75A 1FXQA 1H63A 3IK4A 4ZQOA 4ZOCA 3TN6A 4R53A 3S46A 1F9CA 5KITA 4JFVA 2AQVA 4AY1A 3E9AA 1KLYA 2IKHA 5HNNA 4YU1A 4NJGA 3LK6A 4DPPA 4JCLA 3O0KA 3N04A 4JTJA 1AQFA 4AIUA 4GZ7A 5DT5A 5DF0A 2JK2A 2XVPA 3EMZA 1O12A 3B3DA 2Y7DA 4BCEA 1TVLA 2XISA 5HXMA 2XM1A 4FMVA 2INFA 2E8YA 2VR2A 2OR2A 1L6FA 4G9PA 3REQA 3VUSA 3Q67A 2DZUA 4EXBA 2P3ZA 1G69A 2QMJA 1YE4A 4M7SA 4GQRA 4MY1A 1JAEA 4LEFA 2WSYA 5G5IA 3FFSA 4LH8A 3AMKA 3LRKA 3BCFA 1G7UA 3SCTA 4KIRA 2ATMA 3SJ3A 2DW6A 5EMYA 4WVXA 4JTAA 3IJ6A 4PUNA 3I6RA 3O6YX 3WN6A 5K2ZA 3S5SA 4UNLA 2IPWA 3D3AA 3NO1A 3P8IA 1KGUA 5A5WA 1RHCA 2O55A 3OJGA 1P0BA 3NDOA 4DBSA 1KC7A 3L66A 3L21A 3WG6A 1XBYA 3M0KA 2CHNA 1CBGA 3N6HA 3PZVA 4DHGA 4ZBCA 4PRWA 1Y8BA 5XIMA 1QOPA 1Q6FA 1XHGA 4CN6A 1AODA 2GJNA 2VD8A 3W9ZA 4QEEA 1E15A 4M5PA 3WUBA 2EO7A 4ZB5A 1FWBC 2XGZA 3U2ZA 1TPVA 4ORIA 1EO7A 4GISA 3S9IA 3C86A 3R8HA 1OGSA 1WQ5A 1IF2A 1QPKA 3ZJ6A 1Z48A 5A8OA 4G2DA 3CT2A 1VC4A 3VKDA 2BZNA 4DJEC 2PDLA 2OZTA 3HN3A 2DU2A 3R5EA 1LORA 1QRQA 2PDQA 2ZWZA 3H2NA 1C7SA 6REQB 1VZWA 4DBEA 2XVLA 4N4PA 3DHPA 3B8IA 1LQ2A 2YCLA 3QFEA 5CJMA 3ZVHB 1YQ2A 5I06A 4Z1YA 5CZ0A 1TZZA 1PKYA 3OODA 1AQ0A 1DQUA 2QAPA 3VKCA 4XD6A 2V6AA 5BYWA 4S2CA 4M6UA 3ARPA 1VFOA 1XRTA 2V5DA 3TR2A 3EX4A 3G1VA 3JS3A 2YYTA 3PUEA 3NOYA 4K1WA 2ZTJA 1JXKA 3W1TA 3EOUA 1WOAA 3VZYA 3ZLGA 5JXQA 5T9BG 4LAOA 2IXUA 2J7CA 3EA3A 4KGJA 3WJSA 3WDJA 3RJXA 1LLOA 2VUYA 3WLRA 5AC7A 2VFGA 2BHYA 1UPMB 1ZCCA 2FVKA 4V33A 4XAYA 3K8LA 4UMAA 3KBNA 1SO4A 4DF1A 5J04A 3VOJA 1VEPA 4PEEA 2WHKA 3EOLA 5E0KA 4I9MA 3VNKA 4A3QA 5FSDC 1GYLA 1TV7A 3TZNA 3H2MA 4TR9A 3H2FA 2WANA 5G2IA 3W00A 3NZQA 4TVUA 3NA8A 3CXOA 4S3BA 3QRHA 4NQ1A 2YR1A 1XWYA 3E49A 3ITTA 4M81A 4Z1DA 1RQBA 1POJA 1OCBA 4XAGA 3WUGA 3W1NA 3B9NA 3GVGA 3TOPA 2ZDRA 4RW3A 4LC8A 1QATA 4ZSTA 3O6DA 3WF3A 4AZ7A 1J01A 1YBQA 5FESA 3W3OA 3NFUA 1SO6A 2V5LA 3ID7A 1FWTA 1S2AA 3BANA 2DP3A 1UWSA 4C1NB 4H6QA 4XD5A 2JIEA 3FEQA 3GG8A 1HJVA 1A3HA 2GUUA 1VF8A 4LUSA 5K4ZA 1KWKA 1K70A 5GVJA 1UASA 2O9OA 3DG3A 3CHFA 1FH8A 1V93A 4WK9A 2QCLA 3VMPA 4C6NA 1XIEA 4MUPA 1BHGA 1PZ2A 2QCCA 1FDJA 1JPKA 1X1OA 1W1ZA 1XCWA 3AS2A 4ACYA 3SFKA 4HNNA 1SYTA 3IRSA 3O9NA 3UZ5A 3HV8A 5TNVA 5C54A 4MDPA 1B3ZA 3BLOA 1TMQA 1XL9A 5FD0A 5E09A 4CD7A 3PC0A 3TE9A 4H9VA 4IPJA 5FI8A 1ICQA 1VHCA 4KGLA 1SZRA 2BMBA 1E4LA 5JIWA 1DJXA 3NYDA 3QGAC 2VP8A 3SUUA 5CPTA 3K5XA 4CCCA 3BZJA 2O56A 1RH9A 1ONRA 3A22A 1VHNA 1TCMA 3WQ6A 1UJPA 3AS1A 1IZJA 2XIIA 4IHCA 3VZZA 2ZX5A 1XIBA 3G8RA 3R94A 2OQHA 1VLWA 2J74A 2GK1B 3R25A 2GGGA 4IX2A 4IPLA 1YHTA 1KR1A 3W7CA 2XZ7A 3MV01 3QKZA 3OLGA 4W85A 1OX5A 5C9RA 3WDRA 3AICA 2G5WA 1EQPA 1QTWA 5J5DA 3OYXA 3G3DA 2DVUA 2VGGA 3PHAA 1NWRA 2W67A 3W2LA 2VFHA 2B7NA 4HJWA 1E6SM 3GDRA 1OX4A 3NQEA 1DXFA 3EXSA 1A80A 3FOKA 2WJZA 1MO0A 1NWUA 4ERGA 3NPXA 1QO5A 1VBJA 2X05A 5CAHA 3ZJ7A 1FCBA 3WMSA 2BV9A 3TP4A 3C3NA 1W3NA 2DY3A 3CZEA 2A2IA 4ZEPA 4LUTA 4RLIA 3TQPA 4PR4A 2VX6A 1R30A 1F3EA 2ZX8A 3KWSA 1T5AA 1IQ8A 1TCDA 4KRZA 3G1HA 5DQPA 2EPHA 3C56A 3MHGA 1V4YA 1RD5A 4IP5A 3ECQA 5DY2A 3W75A 1JDDA 1QW9A 4IMCA 4DEFA 1MZHA 3WK0A 4H2CA 2YL6A 3TTEA 4P8WA 2X09A 3NQ7A 1SVDA 3DFYA 3K4WA 4HHPA 1XLKA 1LL6A 1O4UA 1K4GA 2ZX7A 1LM1A 3BLPX 3QOMA 4CNPA 3NAVA 2ISDA 3WNMA 2GLKA 3VIIA 2H9AB 2WVTA 1MEWA 2Q02A 4F8XA 4IQJA 5LA0A 1PO9A 1GVYA 4XISA 4PTDA 1O66A 3APYA 1IWPA 3KCOA 2NQ9A 4JIEA 3A9IA 1DWIM 3HOJA 5I3IA 2QZRA 4JN8A 2YL9A 2YKKA 4GZJA 2C13A 1W1A1 4TU1A 2FFCA 3PM6A 4LAUA 1B54A 3EA2A 1C91A 3FEMA 3MV11 5E6ZA 4O15A 4QS5A 1QNOA 3K2GA 4PUJA 1LTDA 2CYGA 4GZEA 4EE9A 4P8VA 3RPTA 1TTJA 4YJ5A 4ZA0A 5HOSA 3K30A 3BURA 3IANA 2ESCA 1OFOA 1RA0A 4OWGA 3FDKA 4UFJA 2YOCA 1B57A 3G22A 2OODA 3A21A 2WMIB 4Y2WA 3OG3A 3H7VA 3QPYA 2J13A 4PCSA 4AY7A 2PDIA 3S2LA 3WENA 4GLEA 3UXKA 4DF0A 2NX1A 2V5CA 2NV2A 4Y9AA 2AL2A 1W3JA 2DSVA 2EPOA 4C7GA 2CKRA 4IMAA 4XAFA 4Y8EA 4XQ6A 2BB0A 1ECEA 4WGHA 5A94A 4EOUA 2RUSA 3W2KA 3MUXA 3MKCA 4HK5A 1Q8AA 2EEXA 4L64A 1R85A 3BAIA 1UIPA 2Q3OA 3U0HA 1SZFA 3W6MA 2VEFA 3WCZA 3EA1A 3KAOA 2Z6JA 2HEJA 4B3ZA 3B8WA 1DKWA 1FKWA 3NZRA 4IMGA 3Q2DA 3FAXA 3HV9A 2Y89A 2X2GA 3CIWA 2Y61A 4E6MA 2CLIA 1M7OA 1X97A 5TQLA 3MCNA 3CUIA 1XR2A 2RKXA 4LWWA 1XIJA 1KO0A 4GI8A 3UCCA 3C2RA 1H7RA 4JQ2A 1JYXA 4FLRA 2XFWA 1EZWA 4H6EA 2DJLA 2G3FA 2WOQA 4JD4A 2VZOA 1CXIA 2LLEA 4L61A 1WKDA 4NZJA 4R34A 1EEXA 1VH7A 2D2JA 1RV8A 4UWMA 1OIMA 5CGQA 3QGKC 4UFHA 4Q8QA 2XVKA 2J24A 3M07A 1KCXA 2E9LA 2QKFA 2DQXA 3IIXA 3THQA 3MA8A 2Y24A 3GIYA 1ESWA 5F2GA 3ARXA 5LNVA 3TN4A 1GG0A 3G18A 1E6RA 4Y9MA 3FLUA 1JYVA 2WKJA 3T40A 4GC4A 4HYVA 4L1WA 1Z7AA 3UJSA 3U5YA 5ABGA 1GPFA 1W5NA 4A6GA 2DVXA 1ZAHA 1OQFA 1QOXA 1Z89A 4J3TA 4TV6A 4IT1A 3ARWA 3LPPA 1E9ZB 2E1WA 4NNCA 1ZL1A 4FNRA 2CBJA 4DN1A 2Z1SA 3VD4A 3IWPA 1EXPA 3DFNA 3MS8A 1G6CA 3AAMA 5FJOA 5B7YA 1OIFA 1SW3A 2ISVA 2BSLA 4L4LA 3E12A 4HMNA 5AC6A 1WUEA 4ADUA 3JZUA 1CLVA 3H4WA 1OADA 2X1UA 1PDYA 4D1JA 3WD1A 3BWWA 5DCBA 1OC7A 4LCSA 2ZE0A 3PZTA 2AGTA 3L2IA 1G4SA 1VR6A 3H12A 3VZXA 4ERIA 3VNDA 3FY1A 1RCOB 5AZ1A 3RK8A 1IWBA 3EOEA 2CBIA 3ISIX 5KZDA 3TYCA 4UTUA 4K8HA 2GSJA 5C2CA 2OWWA 3BG3A 2D3NA 2NW0A 1F76A 4N0RA 1S3TC 1F5ZA 3LXAA 2BGQA 2PCQA 2PWEA 1R7AA 1PSCA 2E8ZA 3ALGA 5CG0A 4HZMA 3UXLA 1R38A 3EWZA 4HKPA 3KS5A 1P43A 3M7SA 4GWEA 4IMDA 7TAAA 2CNCA 1RVGA 3CUJA 4Q7NA 4M6VA 2YIHA 2ZQ0A 1L6YA 4J3UA 5EBAA 3ONBA 3UP8A 3WMLA 1H61A 3GVWA 3N6QA 3NEVA 2A85A 1LLWA 3EYPA 5IFPA 1KGWA 1EX5A 1YTDA 5A6MA 2UY4A 1CLXA 1M7PA 2IPFA 4UTWC 1GT8A 1HL9A 3OU8A 1GOWA 1VD6A 5E1QA 3U9IA 1M68A 8XIMA 1IEIA 4Q4PA 2AL1A 3PAOA 4BZYA 4NZ1A 3UBPC 4WEVX 2NVAA 4G8TA 4UFLA 3DENA 4W93A 5G1YA 1I1XA 4J28A 2FYMA 1NFGA 1EOKA 2PZ0A 3A9BA 1A5AA 4ZXLA 4AZHA 2CLKA 2CHRA 3H4GA 3S3GA 1KFBA 3DFQA 1OC5A 2IPGA 1Q7ZA 2IKIA 1OF6A 1TJ1A 1XI3A 3CAQA 5CZJA 4ZVJA 4XIMA 4PB3A 1JCTA 2VZUA 3LTSA 3TAOA 3KTSA 1J5TA 3WD3A 3ZWSA 1GQIA 4S2BA 4PL1A 1M6JA 1OFDA 3LY0A 4X0NA 2OELA 2OSYA 3WLJA 4W7WA 3S5OA 1CIUA 1TWWA 2YPIA 2ZE3A 5JH1A 4H1ZA 2W0UA 3FHAA 2WXDM 2J6VA 4K36A 1W9VA 2QYGA 3B9DA 4H83A 1TWZA 2HDJA 2P8BA 4F4RA 4V2XA 3MMTA 1OC6A 1TSIA 4GJIA 2YB4A 3F2DA 2X0YA 2PTYA 3O16A 1UKQA 2IUZA 3R10A 2ZWYA 5EY5A 4FNPA 5XINA 3DC8A 5EMLA 4WSKA 1KBBA 1H4PA 2Y0FA 1W3KA 4W8AA 4NYUA 1PKNA 4B5UA 3C2OA 3OA3A 3WBYA 2G0WA 2OX1A 3QR0A 3WKZA 1QPNA 3S6OA 2QV5A 1LG1A 3WQOA 1P6BA 1MWOA 4EPKA 3NR0A 1T8XA 4RZ4A 2I5IA 2JALA 1E6XM 3AXMA 4TX8A 4Z1CA 1F4AA 4HA0A 3H55A 4X60A 4QE4A 3CV6A 3BGAA 4MYXA 3V0UA 1LL7A 5JU6A 4MY9A 4E8CA 3PJUA 3WX7A 5D9MA 5BZAA 1VJIA 1SJAA 5K7JA 1YE6A 2PCEA 2TMDA 3ZSSA 1XX1A 1CNVA 1QCWA 3NQVA 1JDAA 1JUBA 4FOKA 1GNXA 1XM3A 3HG5A 3PUGA 2YFNA 3N29A 3UA3A 1F2JA 4Z2GA 2TPSA 4N2YA 1W3TA 2O9PA 1EP3A 3BO9A 5TBOA 7ENLA 4LV4A 2CBVA 4H6KA 1C9DA 4PH6A 1LT7A 2E67A 3KW3A 5MF5A 1OM0A 2F84A 1DJWA 3GAYA 4EXAA 1JULA 2O9TA 4H01A 4X61A 3V0TA 3MTWA 1DQXA 4OT7A 3NM1A 1PTAA 4C6OA 3BJSA 5T9CE 4UTWA 4C91A 4FXFA 3ZT7A 3DGRA 3CWOX 5FAGA 2Z7KA 1PB0A 3WFAA 7REQA 1KXTA 3OP2A 4YPJA 2GVLA 1SSDA 3GK0A 3H6OA 2XJ7A 1I2RA 2DDXA 3WQWA 1DBTA 4JHOA 5I78A 3BLLA 1HL8A 1A49A 5HATA 3KOXA 1FWIC 2FZMA 2Z28A 3SY1A 1E1CA 4KETA 4B5XA 5A6BD 1PHWA 5F4XA 1FWAC 2F6KA 1OY0A 1P6WA 1JF6A 2BLEA 3VCCA 1V08A 1BXBA 3P5YA 1EZ2A 1S1RA 2YCKX 4PMVA 3W28A 4KEUA 1PKMA 3SADA 1I4NA 1ZNNA 4U10A 3M5YA 4ZFCA 4MYAA 1HKMA 3UWZA 1FP8A 2BHUA 2QJJA 3NG3A 1RCQA 1WYIA 2DT0A 3LZ3A 2FGZA 4LOCA 5A6LA 4X3ZA 1RD6A 1V51A 1YKWA 3EZ4A 5HPCA 3ARUA 1L8NA 1UR8A 4PBGA 1TJ0A 3TTOA 3LPOA 1T6MA 1M5WA 2EKGA 3GS6A 1JI2A 3AIRA 4MADA 2C18A 1OX4B 4P7RA 2X16A 2A4AA 1KRAC 3KTCA 1PXGA 2XYLA 3VFLA 4MNLA 2DH2A 3GUGA 1IXNA 3MZNA 2EHHA 3SQMA 3AHZA 4X9YA 4NAEA 1IZKA 1X6LA 3TQ0A 1HIZA 3C0JA 3MANA 2YX0A 2ZZ1A 2VL4A 1H62A 4LBRA 1H60A 3UJRA 1TUFA 1Q2SA 2F7FA 3AHYA 1P48A 1FWGC 4KS0A 1YW1A 2ZZ6A 1KBJA 1VBGA 2D20A 3IEBA 1G67A 3HPZA 5ECUA 4O8AA 4LC6A 2E5CA 4HHHA 5HNUA 2PD5A 2VNCA 3AOFA 4N6EA 4YHGA 4AWUA 1BGAA 3A3HA 2VEIA 5C9XA 4I7VA 2QUUA 4GI4A 3T09A 2CZDA 1W9PA 2HVOA 3P14A 3VCRA 6XIMA 3H8AA 3CB3A 1DWGM 3TQKA 3MHUA 1W1VA 1W0MA 3IIPA 2ZXAA 5KEZA 4UTKA 3EX3A 3N3TA 1OHLA 2PDUA 5HUOA 5A6KA 2QIWA 3T7VA 4CNNA 1IIHA 2EJ1A 3QMTA 3CWNA 3XISA 5BOFA 3W7IA 1K6WA 1R87A 4K3ZA 4URIA 2BG5A 4XZHA 4IFOA 4WKFA 4DY1A 2QJHA 2J88A 1ZP4A 2Y5SA 3WK2A 2J9XA 2JEPA 5LGXA 1KM0A 2B0MA 5FJJA 1MQQA 3HJZA 1SFLA 4Q4KA 5AZ0A 5M3WA 2PE4A 1MQPA 4YXGA 1YPXA 3RAOA 7PTDA 4ERAA 4R33A 4GQGA 2WHJA 3UPWA 3LQLA 3IVSA 1RY8A 3F4CA 1ZZMA 2BXVA 2Y85A 5KSWA 1JNDA 4UFKA 2J78A 4S3FA 1LLZA 4DO6A 4W7VA 3S5YA 2HXTA 3QLDA 2P3EA 5EMUA 3GTXA 1B3XA 3NPVA 2FKPA 3Q58A 2RHGA 1O7AA 4DIAA 3LSBA 4O53A 3HM7A 2ZDSA 3TWBA 2ZZ3A 1ZQ5A 2F61A 1OGGA 1EUNA 3CK5A 4MLRA 4C6IA 2KX9A 1G94A 3G2GA 2HTMA 2OFJA 1VYRA 5MKGB 1QHPA 1OZMA 2QAFA 3P2VA 2OU4A 3NO5A 5KZ6A 5JBFA 1A5CA 3W26A 3H23A 4C90A 4IGMA 4EVZA 4OVXA 1TB3A 3EWUA 5DMMA 2FVMA 4OTKA 3TTYA 1L8PA 2QPXA 3AMLA 3NEHA 3B4UA 4O12A 2G3MA 1E5JA 4GE8A 4NRRA 4A4AA 3IUIA 4FZIA 4H6RA 1AQMA 1IEVA 3S1UA 3OQEA 1DE6A 3QR3A 4ONVA 1F3XA 1GKRA 4IPPA 3LM7A 1UHVA 4GYPC 1VBUA 3UU0A 1Q6GA 1B3VA 5DN1A