5M03A

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-noeuromycin and 1,2-alpha-mannobiose
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
349
Chain Sequence
b'NLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl hydrolase family 71
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
total genus 130
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m03A00
3L4VA 1E1FA 3RO8A 4V27A 4A3YA 2PC8A 1W3LA 2VX5A 1OM0A 2XIIA 3W6MA 1VFOA 3KZSA 2CIPA 5A6LA 3KL5A 1TZ7A 2AMGA 2A3EA 1E43A 2WMKA 4BQ5A 2FDMA 4D6CA 4QDMA 2X1IA 3SCUA 2DQXA 1ZB5A 3CUHA 4M80A 1F4HA 3PZ9A 2EBNA 4ACZA 1EOKA 1H09A 9CGTA 4KRUA 1GCYA 3L4WA 5AYIA 5I3DA 1H0IA 3L4XA 1JXKA 1WB0A 3TTOA 2FGLA 2ZXQA 4L4OA 4HOXA 3VD9A 1E4MM 1CLVA 4AZ7A 3I3BA 5C70A 3ARYA 1C8QA 4LYRA 4W8LA 1C7SA 3S2CA 3ZM8A 2XFFA 3WF2A 2ZICA 4ML4A 4KGJA 1X6LA 2ZWZA 1V3IA 4QLLA 3EMZA 1CNVA 4D6IA 1H5VA 2EPLX 4F9JA 3FW6A 4F66A 4OBRA 2DT3A 2GK1A 3AHZA 3M7SA 5DF0A 3WL1A 1V3KA 4DWSC 1EDGA 1WNOA 2EPOA 1NP0A 3SUVA 3MO4A 2X2YA 2EPMX 1E6RA 1V3JA 1TCMA 3HMCA 4P7NA 2CNCA 4U3AA 5I2UA 1SMAA 2JEPA 3W26A 5M3WA 3RDKA 1RH9A 3BXWA 3WMBA 4UFJA 1TA3B 4OZOA 1FH7A 1HJVA 1VJZA 1O7AA 2WKLA 1ZBCA 1MXDA 4AXNA 1WPCA 4H8HA 1CXHA 3VIKA 1DWGM 2CYGA 1E9LA 3FAWA 2VR5A 4YN5A 1SMDA 2JEQA 1V02E 3FNDA 2XIBA 3TTQA 1FOBA 3ZSSA 3ZT6A 5I6SA 2Y8VA 4GO8A 4J3VA 2FHBA 3GNRA 1KGUA 3AHYA 3FY1A 1PX8A 1TE1A 4RE3A 3N12A 1XH0A 1JNDA 1E4NA 1BQCA 2MANA 4IUGA 5CXPA 5CGTA 5I79A 5KEZA 3MV01 4C7GA 3AXXA 2PBOA 4NRRA 3VUPA 2JIWA 1BVZA 2VVNA 4QLJA 5BXPA 1MWOA 1WDQA 2FHFA 1JAEA 1VEPA 1W2PA 3N1AA 8A3HA 1JDAA 1GOIA 2J62A 3LPFA 1KXQA 5M03A 5EB8A 3VOCA 2E9MA 4AD1A 3AYRA 3MSGA 2BXZA 1B3XA 1VIWA 2WYSA 1JDDA 2J7DA 4GI9A 4MNLA 1YQ2A 2J8FA 3W6LA 4HU8A 5HPCA 1WDRA 2WVSA 2G3NA 3WNLA 3SUWA 2JFEX 4CN6A 2VO5A 2BY2A 3AIQA 1FFQA 4WSKA 2XSBA 1DWJM 1OCQA 4NSBA 1GQLA 3VDHA 1UH3A 1ODUA 1OT1A 3BMWA 3A4WA 1OD8A 2CETA 2E4TA 1OGGA 1ISWA 1M53A 1L0PA 1GPFA 1CBGA 1NQ6A 4M8UA 4W88A 1H41A 1CDGA 4UQEA 1E6SM 2VC9A 5CSYA 4ZE5A 2YL5A 2ZUSA 1HJWA 5BYWA 4ZXLA 5JBDA 1EDQA 1O6IA 3PN8A 1UG6A 1C7TA 4PMXA 4ACYA 2VCAA 5D4YA 3TONA 4AYSA 2WVVA 1WZMA 5E6YA 1SFSA 5EFDA 2Y4SA 5A6BD 4GZIA 1E6NA 1TMQA 3WNNA 5HXMA 4KRTA 2OSXA 5GNYA 3AROA 2Z1SA 2WZEA 1PEZA 1JYWA 4JKLA 1EH9A 3BCDA 1GONA 1B3WA 1HF6A 4H04A 3AMLA 3WD3A 1QI3A 4Q7NA 4MNJA 1XYFA 2UY4A 2XTKA 2GJXA 1J01A 1GOOA 3AS0A 4F9DA 4PTXA 2OLHA 1DWAM 3WDPP 1HL8A 1E0XA 1WZKA 1HKIA 4D6GA 3A47A 1UOKA 3CUJA 2J78A 4U5KA 1HP5A 1Q6GA 3ARRA 3WEZA 4PEEA 1W9BM 3CZKA 1UZ4A 1B3ZA 2YIHA 1QNPA 3CHFA 3AISA 1E0VA 2YOCA 1JZ3A 4HPHA 3ZR6A 4MPKA 4TVDA 3T0DA 1E3XA 4R5EA 1PX3A 1FP8A 3W4RA 1PJ9A 3NDYA 5JBFA 5FKYA 2XFYA 3ALFA 2D1ZA 2J74A 1EA9C 1BAGA 4FLQA 1C8YA 8CGTA 4D72A 5D8ZA 4PRWA 1BFNA 3IJ8A 3POCA 4XV0A 1E73M 3CHEA 1CIUA 2CKRA 3IK2A 3AZTA 2BHYA 4HU0A 3CMJA 4PMVA 1M01A 1MXGA 4CD7A 1IV8A 1E55A 2ZWYA 1FHDA 1C8XA 3OLGA 3VNYA 4B9ZA 3VIJA 3A4XA 2ZUMA 1CXEA 3L4UA 1QVBA 5CLTA 4W7WA 4OIFA 4AZBA 3NJ3A 2PWGA 5BWFA 3ZR5A 4JKMA 3WL0A 4GXPA 2E9LA 4HOWA 3CBWA 3BSGA 1WP6A 2D3NA 3GNPA 5CJ5A 3CZJA 4FLOA 3WQ6A 1XRVA 5FD0A 2ZX5A 4TTGA 2XGIA 4F79A 3AZSA 1GVIA 1JD9A 4B9YA 1QPKA 2ZUUA 4PTMA 3II1A 3WUEA 2NSXA 4QLKA 4C7DA 5HNNA 3VINA 2J7EA 3PZOA 7TAAA 2G4FA 4ZENA 1E3ZA 1J10A 1MW1A 1BTCA 3W24A 4UQCA 2G3MA 3PTMA 4B16A 4BQ2A 2CXGA 3PZNA 4RE2A 1DWIM 1MQRA 2VTFA 1XCWA 4AEFA 2PF0A 1OINA 1GVYA 4LX4A 3ARQA 4J3WA 1VAHA 1FH9A 3VGFA 4X0NA 4J27A 3DYOA 1W1TA 2VRQA 3WF1A 1HP4A 1JYNA 4M1RA 4M29A 2VZVA 3AOFA 1FHLA 4CD6A 4CD4A 1OIFA 3CZEA 2V5DA 4P8UA 3MUZ1 4AZCA 3QHOA 1HKJA 3OGRA 1I1XA 2WWCA 3TOPA 3WQVA 1CECA 4OOUA 2V3DA 2D2OA 3UESA 4OJYA 1CGXA 2DDXA 2X0YA 4JCMA 3NYDA 3LMYA 2RGLA 1TA3A 1JI1A 3WMCA 1UD6A 3RJXA 3ZIZA 5AC4A 2QMKA 3U57A 2UY2A 5CZKA 1E71M 3WD0A 3UEQA 1LL7A 3WENA 3WFZA 2X05A 4PMDA 1W3JA 1K9DA 1W3KA 2RGMA 5JIWA 3VIHA 4UQ9A 3I3EA 1UHVA 3KL3A 5E6ZA 3WKZA 3CTTA 2GJRA 2WCSA 3W53A 5C71A 3U5YA 1ECEA 2YA0A 3PTKA 2E8YA 2ZXBA 3PZQA 2YA1A 3OZOA 4OOZA 1QI4A 4MAZA 5LYRA 3D3AA 2BVTA 2WPGA 2EJ1A 2C7FA 1RPKA 3ZJ8A 1UQYA 1KCLA 4MDPA 4CCEA 4UFIA 2EPNA 1KXHA 2BY0A 2NW0A 3AMKA 1UWQA 1GJUA 3MU7A 4KMQA 3VMPA 1CENA 3E1F1 3VU2A 4M24A 3L4TA 2OWWA 4GQQA 3BSHA 4AISA 4B3LA 2G41A 1VFMA 1JF5A 3OA5A 3KEHA 1AVAA 1LJYA 3SCWA 2NT0A 3QOKA 5I23A 3CMGA 1AQ0A 3WF3A 2J25A 4E8CA 3NIYA 2WW5A 4J3UA 3SCNA 2XGBA 2QMJA 1JG9A 2WMGA 5F7UA 3VILA 1JGIA 3ZO9A 2J7HA 1GUVA 3GXMA 3THDA 5A69A 3MKKA 2W5FA 3WH9A 2UY3A 1WKYA 1XC6A 1JNEA 3GH7A 3GNOA 2CBVA 1WZLA 1JZ5A 4S3KA 3AICA 3SCTA 1AQMA 3MV11 1GJWA 3AIEA 2J7FA 4MJ4A 1JD7A 2WCAA 1B3VA 2QV4A 1KB3A 4AD2A 2WWDA 2XSAA 5HPOA 2W91A 4JFVA 2EXOA 4D6FA 3VX0A 1HKMA 4KGLA 4UFMA 3DYPA 1QHPA 4HZ7A 3UCQA 4PCSA 2VX4A 4XZWA 3SCOA 1HVQA 3CHCA 1E70M 2G8ZA 4JCLA 4P8WA 4UQDA 1PAMA 2WMIA 3CHDA 2FHCA 5IFTA 1ISZA 1ZL1A 1QNSA 3AJ7A 4CN1A 1JYXA 3IANA 1W32A 1XSKA 4MADA 5A95A 3W0KA 2ZUVA 3WBAA 3U5UA 4D6DA 4W89A 5KZ6A 4TTUA 1MW2A 1I1WA 2CITA 1EXPA 5A6SA 1WCGA 5GNZA 4H7VA 1KXTA 1AQHA 1PIFA 1OGBA 4U5IA 3SCRA 3TTSA 4X9YA 3VIGA 1UH4A 5EMYA 3GXFA 4WK9A 3M07A 6TAAA 5LA0A 2VZOA 3AIWA 4PMQA 4Z2GA 3VPLA 2BVYA 1G1YA 2ZOXA 1TR1A 4EAMA 4M81A 5A8OA 3B9DA 2VQTA 2HVMA 3LPOA 4TX6A 1LL4A 1XSIA 4A3HA 3VTRA 4H8VA 3AS3A 1CGTA 1EOMA 2ZXAA 5M5DA 3BC9A 1EIBA 2E40A 3WD2A 1M04A 2V3EA 3UR8A 4W86A 5ABFB 1V03A 1W91A 2E0PA 5ECUA 2DT2A 4CGTA 4WKHA 3THCA 1UA7A 4H2CA 3BAJA 4TUFA 5A6KA 1UWIA 2WM0A 1ZBKA 2YDQA 1HNYA 2D0GA 1JF6A 3MUY1 4RE4A 1HN1A 4HA3A 2CKSA 3TP4A 4QAWA 1UYQA 1MQPA 2CESA 1C3FA 2BFGA 3CGTA 2F61A 2XUCA 5TD4A 5DT7A 1R85A 3PBGA 3ARTA 3PZVA 3ZSTA 1EO7A 1G0CA 3EYPA 3VIPA 3PHAA 1PBGA 1UR9A 4PMOA 5DEZA 4W8AA 1BG4A 3PTQA 5CSUA 4W87A 1CWYA 4IPLA 2XVLA 2E8ZA 3WIJA 3M6DA 1DWFM 3NSMA 1ZBWA 4LQ1A 3MMWA 1OBAA 5BCAA 3ECQA 2J7CA 2W66A 1BPLB 1GOQA 4M82A 4U2YA 4WKAA 4HTYA 1ITXA 4MAVA 2WK2A 3J7HA 3K1DA 3DHPA 3VIIA 1KWKA 2D20A 3L4ZA 1HKKA 4CKQA 5CG0A 1BHGA 1UD5A 3NDZA 1MW3A 1UA3A 5A1AA 4QFUA 5BRQA 2VR4A 1MQQA 2WSKA 4GZJA 1GHRA 1HVXA 2XPKA 5C8BB 3AYSA 1PPIA 2YDRA 4PN2A 2OSYA 1QNOA 2VI0A 5ABEA 3TA9A 1GOWA 2VZTA 1XHGA 4BA0A 4DWSA 4JHZA 3AQUA 3W29A 4UNIA 3ALGA 2WKGA 4CVWA 1G5AA 2J8GA 3WQWA 3K4DA 2J7BA 1NWUA 1RP8A 5A8PA 2WB5A 1KBBA 1OWQA 4P8XA 2ZUTA 2BS9A 1CXFA 1ISXA 3QGVA 3FXYA 4N42A 1B2YA 1PX4A 1DEDA 1I75A 2YDSA 4HMCA 1KBKA 1NWTA 2J47A 1JFXA 2XVKA 3M46A 3CUIA 3U7VA 1J11A 4PUEA 2EQDA 1HXJA 3WEMA 5D9OA 3VX1A 2GK1B 3QR3A 4UR9A 5AYBA 1UKSA 3W37A 3WNOA 1SYTA 1Q4NX 2D0HA 1E15A 3HN3A 4L4PA 5CPSA 4P8VA 1KWGA 2GUYA 1V0KA 2XVNA 1X1NA 1UR8A 3QHNA 2OWCA 1E4IA 3F5JA 3WDIA 1GHSA 2CPUA 2J7GA 4H41A 2O92A 1E0WA 3GM8A 4MB1A 4UQAA 3APGA 1JDCA 1ODZA 3N17A 2EPKX 4Z2IA 1J0ZA 2CERA 1WAWA 3LPPA 1OIMA 5E70A 1CLXA 2A3BA 3AS1A 1LG1A 2XFRA 5A8MA 3OLIA 4V28A 2CHNA 1KQYA 1ZJAA 4JIEA 2XYLA 2YBUA 2YBTA 4CN4A 3EDJA 4Q22A 2A3CA 3VMOA 4GIAA 4X0VA 5ABHA 2G3JA 3OLDA 3BGAA 3ZJKA 4PCTA 5BRPA 3UR7A 1QI2A 3EDDA 4JKKA 1N82A 1CYGA 2PWHA 3K46A 3AXIA 2OYLA 5D8WA 1A3HA 1KXVA 1VFUA 4BZYA 1JI2A 1QNRA 3POHA 1CPUA 2ZXDA 1UQZA 1XCXA 2CHOA 5FL1A 3PZTA 2PWEA 3VM5A 5A3HA 1UWRA 1E5JA 1E72M 4U3CA 4W93A 3WY1A 1EQPA 2ZUWA 2CBUA 2JALA 3AMCA 3AS2A 2O9TA 1TVPA 1QOXA 1S46A 4MJ2A 1R8LA 4UOZA 3SURA 4BCEA 1Q6EA 3VDAA 1CEOA 1MFVA 3WUFA 3VD7A 2DH3A 4N0RA 3W28A 1TG7A 2ZX8A 3OZPA 1C93A 3F4VA 3G6LA 1H49A 1KCKA 5CGMA 1RD6A 2IXVA 4Z2HA 1BSIA 1QW8A 3ARWA 4W5ZA 2WLYA 2PBGA 3QOMA 1UKPA 3AHTA 4YPJA 5DMYA 2XG9A 3CIVA 3BAYA 3JUGA 1HJSA 3GTNA 3WELA 1W9XA 2QHAA 1U33A 4CU7A 3K8MA 4ATLA 2WANA 2V5CA 5D9MA 2QLYA 1LLOA 1KFWA 1IT0A 4IPNB 4PYSA 2VOTA 5FOOA 1H4PA 2O9PA 1FP9A 2ZX9A 3IAQA 1US2A 2DEPA 5GQBA 3SCQA 1L8NA 2PI6A 1J0KA 3WH8A 3EMCA 5FCZA 4E2OA 1UR1A 1TUXA 3WFLA 1SR0A 4CCCA 2BNJA 2ZUNA 1XYZA 2V3FA 4AIOA 4LYQA 3AHVA 4AZ6A 1XGZA 2F2HA 4UQBA 3GZAA 2QPUA 2GDVA 2Y5EA 3MS8A 3AMGA 3T0AA 2W62A 1F4AA 3BCFA 3I3DA 4CVUA 3DECA 1GOKA 2VCCA 1V6WA 4PMYA 3RPMA 4BQ4A 1UD8A 2DPEA 5A8QA 2WMFA 3O9NA 5AC5A 4D6EA 3WSUA 4WF7A 5A6MA 5FIPA 2BY1A 2ZX6A 5DT5A 1XD0A 3T2QA 3VMNA 4Z2LA 1QI0A 1BGAA 1X6NA 1GW1A 2GJXB 1UKQA 1WO2A 2C8NA 2XJ7A 1MW0A 1OB0A 3RJYA 5A8NA 4CCDA 1KR1A 3WF4A 3IJ9A 3N9KA 3T2PA 3WD1A 4U33A 2WSPA 2GDUA 4M56A 3AIUA 4PTWA 4AMCA 4GKLA 5LA1A 2BXYA 2WZHA 2JIEA 3OBAA 3L2MA 3ZMRA 3VM7A 5E0CA 3PZIA 4LGXA 1DWHM 4PUDA 3WDJA 3UG4A 2VURA 3VKKA 3OLEA 2E3ZA 3K4AA 4HZ6A 3WN6A 1B30A 4WKFA 3CO4A 2ZE0A 4Z2JA 1KGWA 2BHUA 1K9FA 4JFTA 2BV9A 3UG3A 1CXLA 3WUBA 2GJPA 4UZUA 2WAGA 1VBRA 4Z2KA 2V38A 3WDHA 1JZ2A 3T0BA 4MB4A 3A4AA 1CTNA 1LWJA 3GXIA 4YHGA 5BXRA 5IDIA 2O9RA 2TAAA 3N15A 1ZS2A 7A3HA 4P7OA 3VGGA 4J3SA 1NWRA 5D9PA 4FMVA 1E40A 1UH2A 2WVTA 4B3KA 1QBAA 3CPUA 1VFFA 1NWSA 1V6UA 4P7QA 5HDRA 4KH2A 2VCBA 2WHMA 1UWTA 1PZ2A 4UCFA 3VIOA 1LQ0A 2DGAA 4UFLA 3DYMA 3GH5A 1XV8A 4ZXOA 4BS0A 3ARZA 2VL4A 3VD4A 3GYCA 1EQCA 3F5LA 2GSJA 1BYCA 1UKTA 3K8LA 3VO0A 3BAKA 3VGHA 2YKKA 2IUZA 3W38A 1EGZA 1JL8A 2YLAA 2YA2A 1V0NA 1PZ3A 5I0DA 3RM8A 3HU7A 1IZKA 4JFWA 1D2KA 1NARA 1P6WA 4U2ZA 5GNXA 5GPRA 2WC7A 1BYAA 3TTYA 4YHEA 2J79A 2WHLA 3WNMA 5CLWA 4JL2A 4CU6A 1B31A 4KWUA 4EK7A 1E4LA 1G01A 1R87A 2DSWA 5LA2A 1K6AA 3GBEA 1B0IA 1YHTA 2ZX7A 1M03A 3GDBA 4HMEA 3BAWA 4AZHA 1V6VA 4PSPA 3T09A 2FGZA 4DM1A 2Y24A 1KQZA 1JZ6A 2XM1A 4IM4A 4W7VA 1HJQA 1UR2A 3FN9A 1VF8A 3W82A 3MMDA 2XHYA 5ABGA 4D1IA 3RM4A 4LXFA 3PZMA 1H2JA 2VX7A 3SCVA 4GO9A 4QCEA 1B90A 3SUTA 1K9TA 1BGGA 1QHOA 2OYKA 2WHKA 3AIVA 2FH8A 3CZGA 2O9OA 2WCGA 1XH2A 1FA2A 2J75A 1NOFA 3T2OA 1Y7VA 1K9EA 3WBEA 4QP0A 4PMUA 2W92A 4W8BA 1IZJA 1VJSA 1R7OA 4AZCB 4C7FA 3ARSA 2DH2A 3ZQ9A 3FHAA 4TOQA 3CUGA 2X09A 2ESCA 5E09A 1B1YA 3RCNA 1JIBA 3ARUA 4ZE4A 3B8SA 1BVNP 4FLSA 2QPSA 4FF5A 4AD3A 5JBEA 1Q6DA 4JAWA 1WDPA 1W3HA 1KGXA 3ZJ7A 4FK9A 4WSJA 1G9HA 1E56A 3S6TA 2XVGA 3ZJ6A 3WH7A 3AZRA 1CGUA 4RL3A 2WBGA 4QCFA 4BQ3A 3ARPA 4AZGA 1J9YA 2VNCA 1E6ZA 3G6MA 3D5HA 4J28A 4XUYA 2GFTA 2WXDM 3AI0A 4XZBA 3L4YA 1W9UA 5IFPA 3RM9A 1TVNA 2WBKA 3VD3A 2OYMA 3VGBA 2X0HA 5FL0A 1QBBA 2D0FA 3MUAA 2J4GA 5I5RA 1JZ7A 3GH4A 4AY1A 4J7RA 1C91A 3DHUA 1ISVA 5A6BA 3CZ8A 5I77A 3AIBA 4NI3A 3MMUA 4XX6A 3RIKA 5CQ1A 1XD1A 2CCRA 3L2LA 1ZU8A 3ZOAA 2D23A 1VB9A 4JHOA 3BLPX 1GORA 3IJ7A 2DT1A 1NOUA 3MSDA 4JZ5A 3NSNA 3WD4A 2W67A 5CPTA 3EDKA 5IHSA 2YJQA 3SEPA 1UZ1A 1BYDA 1LL6A 2UY5A 2VUYA 5BXTA 3WDQA 4MNMA 1BF2A 1JXJA 1R7AA 4V2XA 1W9PA 5BROA 1R86A 1CGWA 4GQRA 3F5KA 4B15A 4PMZA 2GVYA 4ATDA 4GINA 2E9BA 1FH8A 1D3CA 4S3JA 3KWXA 4TX8A 2YL6A 4TVCA 7CGTA 3SIMA 2AOSA 1EHNA 1BLIA 1CGYA 2PWDA 3VDCA 3CZLA 5AY7A 4ZFMA 4NZCA 1GNXA 1WDSA 1ESWA 5A6AA 1W9DM 2YL8A 4U31A 1UKOA 3WQ4A 4HOZA 5M17A 2VZSA 1HT6A 4ACZB 4BF7A 3WF0A 4D71A 2VZUA 3CLWA 3BLKA 3O6AA 3ZT5A 1KR0A 3RILA 2VT0A 1HX0A 4CD5A 2V3GA 2QF8A 2Y2WA 1OGSA 2A3AA 3K8KA 1H0GA 3NCOA 4PBGA 4CUCA 1E5NA 1WE5A 3WMSA 2DSKA 3VD5A 1DP0A 1G94A 4AWEA 5IXEA 1W1VA 4IISA 3WH6A 1W2VA 1V0LA 5D9NA 4CD8A 1C90A 3VIFA 3NUKA 4AD5A 2WMIB 1J0IA 6A3HA 4AIEA 2XVPA 1ZBVA 1UD2A 3CUFA 1GQIA 4MNKA 1MFUA 3CH9A 2CBIA 1JZ4A 2VRKA 2JF7A 4ATWA 3UERA 1W9VA 4GI6A 1V3LA 3SCPA 2J77A 1PIGA 3AFBA 4UFHA 2DIJA 2EO7A 2VX6A 1H1NA 2EEXA 2UWFA 1GQJA 1E6PA 4OKDA 3VGDA 3VGEA 2ZIDA 2FH6A 4EKJA 2DSZA 3N04A 4ZEPA 1E6XM 1W1YA 4JFUA 1DTUA 2VMFA 2DIEA 3W27A 5A94A 2XWEA 1BYBA 1JAKA 2NT1A 3OG2A 4WJXA 4P7LA 1WZAA 2IXUA 4DWSD 1U2YA 2Y8KA 2BVDA 4WLCA 3WQ5A 2JF6A 3EDFA 2C0HA 4J3XA 5A2CA 2WZIA 4GPNA 4F8XA 4AC1X 3OGVA 1J0YA 3EDEA 4URIA 3WUGA 5E9AA 3MUIA 5A2BA 3BAIA 1NM9A 4PSRA 1JFHA 2VJXA 4OBSA 1VEMA 3W25A 2OSWA 4Y7EA 1V08A 2W61A 3VVGA 1XSJA 3U7BA 3SUSA 1U30A 5I24A 2YLLA 3W81A 1QHZA 1V02A 3B9EA 2Q8XA 2WMJA 1UD3A 4D6JA 2WMHA 3ZT7A 4DUVA 2G3IA 4NF7A 2BHZA 1EHAA 1CGVA 1AMYA 4A4AA 1GOMA 3A6OA 1V3HA 4AW7A 4CU8A 1LF1A 4NRSA 3VIMA 2VRJA 1W1PA 1J12A 2CEQA 3NSXA 4PMRA 4DUWA 4DUXA 1Q6CA 4DM2A 4OUEA 5A2AA 1JZ8A 1QW9A 3WQ8A 1H3GA 3OB8A 3SCSA 1QNQA 2DSVA 3N11A 5A6JA 3VDBA 5JUVA 3BMVA 3GBDA 4AD4A 2YL9A 2D24A 3WH5A 1D7FA 1ISYA 1OD0A 3RMEA 1EDTA 3ARVA 3FHQA 3QHMA 2W4XA 4LYPA 4WIWA 1BG9A 1GQKA 3ARXA 3UETA 3MANA 1OT2A 3BH4A 1B3YA 1Z32X 3AMDA 2VQUA 3SUUA 5CPQA 4J3TA 4MB5A 3WDRA 5IHRA 1Q6FA 4UFKA 1C92A 4AEEA 2JE8A 1A47A 4EE9A 2A3HA 5BXSA 4W5UA 1JYVA 4MB3A 2W63A 4AZIA 1LWHA 1M7XA 4DWSB 3O2LA 1E1EA 4E4PA 4D6HA 1EO5A 3N18A 2WC3A 3GXDA 3EBVA 1J0HA 2WVVB 3AXHA 4W85A 2X8RA 4HZ8A 4R27A 5HBFA 4XB3A 2WC4A 5I78A 2CBJA 1HIZA 4AIUA 4P7RA 4HMDA 4W7UA 1CXIA 1UR4A 3OGSA 2VVSA 4UTFA 1HJUA 5DFAA 1VRXA 4JFSA 3A3HA 3PZGA 2XM2A 4UOQA 6CGTA 2WVUA 1UD4A 3KE0A 1RP9A 1ITCA 1OSEA 3N13A 2WHJA 3WNKA 4PTVA 4LPCA 1DHKA 3LPGA 5ABFA 1UUQA 1US3A 4HA4A 2Z1KA 3VNZA 1B9ZA 2OWXA 4HP5A 4TVUA 1CXKA 1HJXA 4HPGA 4AD0A 3KL0A 3DC0A 3FAXA 1GZJA 3WEOA 2WNWA 1CZ1A 1UWSA 1ZJBA 2BY3A 4GZEA 2D22A 3T08A 2DT0A 1MYRA 1V6YA 3AHXA 2PWFA 4H8UA 4MDOA 4MTVA 4GI8A 1NOWA 1J0JA 2PB1A 4K68A 1VBUA 1UR0A 2DSUA 4E8DA 3EMQA 3HJEA 1H11A 1J18A 2HISA 3B9AA 3IAPA 4D1JA 4UZSA 2D3LA 1V6XA 1V3MA 5HOSA 5E0FA 5EFFA 1UWUA 1FFRA 1V0MA 2B31A 4FLRA 5DO8A 3UG5A 5JIPA 1E6QM 2F8QA 1NP2A 1NH6A 1MVYA 4AZ5A 4EANA 1LG2A 1TFVA 3BAXA 4TXEA 4HA1A 2XWDA 1XH1A 3WNPA 3AIRA 1QI5A 1HL9A 1VENA 4W84A 2WLZA 5EBAA 2AAAA 3OIHA 4PMNA 4JL1A 3PZUA 1VEOA 4UOJA
chains in the Genus database with same CATH superfamily
3H7UA 2CLMA 1IXNA 1OM0A 4LAMA 2CIPA 1FVPA 4OU1A 1NFGA 2FDMA 4OUIA 2DQXA 3CAQA 3CUHA 3I6RA 1ZAJA 4M80A 3A5VA 2ZE3A 3EXTA 3GB6A 2EBNA 3PULA 1SFJA 3O0KA 3I4EA 4DO4A 1XICA 2P8CA 1TJPA 3SRDA 2OG9A 4GXWA 1X98A 3T78A 1WB0A 4ZQMA 4L4OA 2RDXA 5CJNA 3VD9A 2XH0A 5K3VA 3FKKA 2Y8UA 1CLVA 4JTRA 1XFCA 3I3BA 2GOUA 4LYRA 4W8LA 3S2CA 4XISA 2XFFA 4ML4A 3TEVA 3IGSA 2ZWZA 3GS6A 3EMZA 3LHTA 1VHCA 4MIMA 5TNVA 4I9JA 4ASTA 3TN4A 4F9JA 3FW6A 3OVRA 1TWZA 5CG7A 3UPMA 3T0TA 4OBRA 2DT3A 4WXYA 3WL1A 5LGXA 3M64A 1EDGA 3NVTA 3IVUA 4GFIA 3FA5A 1ZRQA 1O66A 3W9ZA 4NL1A 3EXSA 1TCMA 1HKWA 4P7NA 1SMAA 3DGRA 3RDKA 1RH9A 3BXWA 2ZADA 3P2VA 5AC7A 4GUIA 1FH7A 3S5YA 3R0UA 1GG0A 2DW7A 1KA9F 2WKLA 1Z69A 1E9LA 3H24A 4XVEA 1O5QA 1SMDA 2MUCA 4CEXC 4DBEA 4IX0A 2XIBA 5A6TC 3HMJG 1FOBA 3ZSSA 2J9ZA 2Y8VA 3HB9A 4GO8A 3PWIA 4HTBA 3DG3A 4WVXA 5G4HC 2Y6ZA 4QHRA 3T1GA 3TYZA 4UWMA 3I4KA 3AHYA 3Q94A 2A6NA 2PRLA 2I1OA 1TTPA 2PAJA 4N9CA 3N12A 1P48A 3WK3A 2XZ7A 1KLZA 1YTKA 2BOFX 1KRBC 5HJLA 5C2GA 5I79A 4OHQA 1W3IA 4C7GA 1W1B1 3S5NA 4AQLA 1QNVA 4XKYB 4NRRA 4DZ5A 1VPXA 1R3SA 1XIGA 1JDFA 8A3HA 1GOIA 3FDGA 5LNVA 2E9MA 1DV7A 3MSGA 4HKPA 3TW9A 3W1AA 2BXZA 3KAOA 1B3XA 3ONCA 1JDDA 4AAJA 4QM1A 3EWWA 3WLMA 4AY7A 3W6LA 5I3JA 5ENLA 3COTA 2R24A 4D8ZA 2A2IA 4K2SA 3WNLA 3PJWA 1UBSA 2PS2A 4RNIA 3M0IA 2PFHA 3W7NA 1BRLA 2YCLB 4JDBA 1UH3A 1OT1A 3B40A 2CETA 1TV7A 4JYFA 4QISA 1EJXC 3PBWA 3TR2A 5CPOA 2IKIA 1L2UA 3PN8A 3H2FA 1UG6A 4PMXA 2VCAA 3TONA 4GI4A 1V8EA 1WX0A 4D8LA 2NQLA 1R3YA 2VC7A 1WZMA 1CCWB 1XC4A 3RN6A 3TNOA 2WJZA 3V36A 4IX2A 1TMQA 5HXMA 1RLDA 4AVOA 3S9YA 5GNYA 4H1ZA 3AXMA 1PEZA 4NZ3A 4DI8A 2E1DA 1PYFA 1HF6A 3AMLA 2WNZA 4MNJA 1R30A 1GOOA 3PPCA 2R1MA 4PTXA 2EGZA 4FSAA 1HKIA 3B03A 1XUZA 1MMFA 3CUJA 3OPSA 1Q13A 2J78A 4U5KA 4GCXA 4JXCA 4ECLA 1MO0A 4HPJA 4PEEA 4RV8A 1UZ4A 2E28A 3WQGA 1DORA 3QFWA 1M7PA 3BW3A 3AISA 1SR9A 1KFLA 4MPKA 3A3XA 3UA3A 1Q2RA 3TLLA 4TVDA 3T0DA 1PX3A 1FP8A 3P5YA 3TC7A 2WM1A 1US0A 3CAKA 1VIZA 2OGYA 5FKYA 1WDDA 4J35A 3UJSA 3QGKC 2DU2A 2EG6A 2NV2A 4NUWA 2FFIA 4DNHA 3H55A 1BFNA 2PUZA 3VKDA 3QN3A 4HU0A 4M7TA 4CD7A 1IV8A 1E55A 3R4IA 2QT3A 3HQ1A 4O0QA 1C8XA 2B7PA 3OLGA 4PGLA 3JZUA 3G0SA 1CXEA 2HK1A 3P84A 2DP3A 1QVBA 5CLTA 3W7CA 5D2YA 1B4EA 1A5SA 1E0UA 1QPNA 5TAOA 4Z1AA 4DBWA 4M7SA 3VYLA 4NILA 4KEVA 1ZLPA 2CW6A 4GJJA 3GNPA 3CZJA 1XRVA 2HS6A 1KLYA 3NQ2A 1XG3A 1IT7A 4TTGA 2A6LA 1UWAA 2HXUA 2GVEA 4HK6A 3OVQA 1QPKA 3STPA 5CBIA 2Z6JA 5LNUA 4PUWA 4IPPA 5IRPA 1SFTA 4QLKA 3MP5A 4AX6A 1EL3A 3M41A 3A23A 2BOEX 3M0HA 1W5NA 2Y0FA 1BTCA 1VZWA 1XBYA 3KM8A 4UQCA 2DUAA 2CXGA 4WX2A 3TN3A 2PU0A 5DCBA 4NNCA 1OINA 5E93A 4ZTYA 3PTDA 3FJLA 3ITTA 1JYNA 3U0HA 4ZO6A 1XCFA 1TV3A 5HMEA 3INPA 4M29A 4CD6A 3AOFA 3HA1A 5FSDC 4CD4A 1VGAA 3CZEA 2AKMA 3ELFA 4NXKA 2XIQA 2GQ9A 1UC5A 3UZJA 1CT5A 4DZAA 1I1XA 3TOPA 4Q8PA 1CECA 4NASA 4QJ3B 2V3DA 1A5NC 4Z1CA 3GC5A 3UESA 3PK7A 2X0YA 4PODA 2CLHA 4R85A 4JCMA 1OK6A 3LMYA 4E8GA 2PTDA 1TA3A 1TO3A 2FB2A 3ZIZA 3U57A 5CZKA 2NWRA 3WD0A 1SO6A 4NJGA 1FXPA 2AGTA 4E3TA 4Q8MA 1UZHA 4H6KA 1UPMB 1K9DA 2Y7DA 3ZVHA 4C1NA 4GVIA 4LUSB 1UHVA 4OV4A 5C71A 3U5YA 3PTKA 1Q6LA 4JEQA 2ZXBA 1FWGC 5I06A 3D3AA 4GYPA 4L6OA 2WPGA 2HNEA 3B3DA 4JOMA 4UR7A 2VEMA 3ZJ8A 1ZPTA 1UQYA 1KCLA 2IKJA 2ON3A 4XKMA 5G1TA 3BWWA 4CCEA 4UFIA 3TFXA 2BY0A 3TJLA 1O60A 1Q5MA 2DZPA 3CYVA 4K38A 3E1F1 4M24A 3L4TA 3BSHA 1O94A 1PKLA 1SW3A 3ABSA 1OX4A 1VFMA 5HMFA 4Q4PA 1LJYA 2NT0A 1KRCC 5DQPA 3CMGA 1LLZA 3E49A 4J3UA 3SCNA 5JXQA 2V81A 2QMJA 1JG9A 2WMGA 4O19A 1FTXA 1IGWA 2ZFAA 4UMCA 4Q4MA 1GZ1A 3EB3A 3NR0A 4BKNA 5CAHA 1NQKA 1L6YA 3WMLA 3EEZA 3GNOA 5CPNA 3NA8A 3M9YA 2AL2A 3P14A 3UF9A 4PE8A 5J8LA 1E51A 1WZLA 1I2OA 1EX1A 1MNZA 3MV11 4NVTA 5FA5A 1FWRA 3REQA 3WLNA 1V79A 2V30A 3R12A 4MJ4A 4IG2A 4MFDA 2WCAA 5LHEA 4RCXA 1B3VA 1KB3A 2HNHA 3N2CA 2XSAA 2W91A 4HCDA 4NAEB 4JFVA 1WAUA 3JU2A 4D6FA 1NVMA 3ITOA 4Z0SA 4UFMA 3DYPA 3PFMA 3ZFHA 3UCQA 4M6QA 1OC6A 4XZWA 4HVXA 1E70M 4JCLA 4P8WA 3O6YX 2Q09A 3I7RA 4C6CA 1AH0A 1JYXA 3T9PA 1W32A 2HVOA 1GOXA 3OZYA 1XSKA 4MADA 5A95A 3W0KA 4Q6JA 2ZC1A 3U5UA 4W89A 3KCOA 9XIAA 5I02A 1OADA 3SIZA 4FAMA 1EXPA 5A6SA 3RHGA 3WG6A 5G5IA 3SJNA 1OGBA 3SCRA 5AZ0A 5G1MA 2J9XA 1MEIA 3EOUA 3O05A 3M07A 6TAAA 5LA0A 3U2EA 3P0XA 1FWCC 3NOEA 4FOKA 1W1A1 5D33A 4M81A 3L12A 4C6PA 3B9DA 2VQTA 3UZWA 4TX6A 3KBNA 4G7EA 1LL4A 1XSIA 1OJXA 4A3HA 3ES7A 2VUNA 1VYSX 4ADTA 1VRDA 4KCUA 4UTWA 2QV5A 1CGTA 3UG8A 4JTGA 2ZXAA 4JIIX 3BC9A 3WD2A 2V3EA 1K02A 5ABFB 1V03A 2E0PA 4H9VA 4CGTA 2P88A 3THCA 3FFSA 3BAJA 1UWIA 2WM0A 1ZBKA 1RLCL 4Y9MA 1NU5A 2D0GA 1JF6A 4GGHA 4KCTA 3MBFA 3TP4A 2XIOA 3TU9A 2E6YA 2YCEA 4DB7A 4GQBA 1R85A 4IIEA 5G2IA 3DZ1A 1EO7A 1K1DA 1EJWC 3L9CA 1UROA 4IQEA 3SAZA 2GWGA 4PMOA 1A0EA 4GHRA 5DEZA 4W8AA 4JTLA 3R1ZA 1Q6RA 3DC8A 2XVLA 4GYJA 3WX7A 3DHFA 3TQVA 4NYUA 3BLIA 1S5WA 1F2JA 4YYFA 4B91A 1GW9A 1RJRA 5BCAA 2BSLA 2J7CA 1W1ZA 3C3UA 4HTYA 3DHPA 3VIIA 2O55A 1KV8A 1AJZA 5CG0A 1BHGA 3NDZA 4BK9A 5A1AA 2FMOA 4QFUA 1XIMA 5BRQA 3BTNA 3VKJA 4GZJA 1ONXA 1YMYA 2OSYA 3RYSA 4FF7A 2P1FA 2KAUC 4KRZA 4C6JA 1XLEA 1XHGA 4B5VA 3SRFA 3ALGA 1QK0A 2J8GA 1LBFA 1NY1A 2PP3A 2NXHA 2WV8A 4L65A 1KBBA 3GWQA 4D9PA 3NOYA 1CXFA 4ZO8A 1K8YA 4HU3A 3W7JA 1WBHA 1ZENA 1MEWA 1TQJA 3FXYA 2VC5A 4JN6A 3KRZA 1I75A 4LV4A 2YDSA 3S1WA 4NX0A 2J47A 3I10A 2XVKA 3WQEA 3FYPA 2Y63A 3Q45A 2H90A 2V69A 3M46A 3MY9A 4MZYA 3F2BA 1EEPA 3ZR4A 3U7VA 2AMXA 4XTDA 1FWBC 3TAOA 3QFEA 4LVGA 4QG8A 3NL6A 2BZNA 3VAVA 1U22A 3W7EA 1TUFA 4UR9A 2V8ZA 5AYBA 3W37A 5HWJA 3NEHA 4IL0A 1Q63A 3EEGA 1PKMA 3SGGA 1TJRA 3B0UX 4NZ5A 1KWGA 1UBPC 4LH8A 4DQWA 7ODCA 1TWSA 1UR3M 4AVFA 1X1NA 1JPKA 1ZALA 2OWCA 1QK2A 3SN4A 2VEGA 3HPFA 1GHSA 5FAGA 3U4FA 1XBXA 4LUJA 2EPKX 4Q4QA 1WAWA 4I8DA 1Z7AA 5A8MA 5LIKX 2XINA 5HMDA 1TQXA 1DL3A 1Q6QA 3EDJA 4Q22A 2EPHA 3CEPA 3QQWA 4JEJA 2GGJA 1D7KA 4O0ZA 1QI2A 3EDDA 3HJZA 4O1CA 2PWHA 2FVLA 5U7SA 3LZ5A 3NXFA 2QULA 3WLOA 1XYAA 1UQZA 1XCXA 2NV9A 4U10A 3PZTA 1SO4A 4J40A 1E5JA 2X30A 3EOSA 2E25A 2FLIA 1ME8A 2Y70A 1GKRA 4OV9A 3RR1A 1TRDA 4LB4A 3DIPA 1YNQA 3AS2A 2ZRUA 3JW7A 1TVPA 1QOXA 5HUOA 4S3BA 4UOZA 3WUFA 2DH3A 3KW3A 3LXCA 1VCGA 3W28A 2ZX8A 3G6LA 5CGMA 1TTQA 3GSMA 2TSYA 3V16A 1QW8A 4UTUA 3CASA 4W5ZA 4NNBA 4NHVA 4C6QA 3F4CA 3O63A 1D3GA 3TZNA 3VDGA 3Q65A 3BAYA 1M5WA 2X7VA 3WELA 2FZ9A 1JCXA 1AA1B 1JRBA 4ATLA 3SR7A 4PYSA 3CS2A 5AYZA 2O9PA 1FP9A 4J4KA 2Z7KA 4DI9A 3PS7A 5GQBA 1WOAA 4B5XA 3SCQA 4MZ1A 4LUYA 4H6QA 4H6RA 4XBKA 2YX0A 4Y9PA 1UR1A 1TUXA 4J3ZA 1RY8A 3H2AA 2BNJA 2ZUNA 4AZ6A 2QPUA 4BI7A 1OYBA 3LBOA 5A8QA 4JQAA 3KBVA 2QDEA 2WMFA 1IEVA 4D6EA 2E6FA 3WSUA 3LG3A 4WF7A 2PTYA 3H4WA 3BG3A 5I03A 3MI3A 1QI0A 4Z2LA 2PF8A 1VHNA 2XJ7A 2WJDA 3DFPA 1ZHAA 2R1NA 5DMLA 5CH9A 3T8QA 2WPBA 4AVNA 2BASA 3T2PA 3WD1A 4AMCA 1MRAA 2PDKA 3ZLGA 2WZHA 4O8RA 3ZMRA 1AUSL 3DFSA 3S83A 1RCXB 2GLKA 5E0CA 4HMNA 3NM3A 3P8IA 1ZAHA 4ZOBA 4UXDA 4PUDA 3WDJA 2RKXA 3UG4A 3N3TA 3OLEA 1FCBA 4WKFA 1QMLA 1BD0A 3DFYA 3UG3A 1CXLA 4L80A 3F1QA 3QLLA 3GG0A 3HO8A 4OVXA 3GW0A 3A4AA 1CTNA 4KF1A 4ZOEA 3GXIA 5BXRA 4ORIA 1A5KC 4IMCA 3T7VA 1NWRA 3LOTA 3EGJA 4B3KA 1NJJA 3CPUA 1RHCA 5HDRA 4XD6A 5G2WA 3CTLA 2VCBA 4DJFA 4Q4SA 1UWTA 4BFAA 4LS1A 1LQ0A 1YNPA 2WQDA 3DYMA 1XKYA 2Y61A 1XV8A 3ARZA 2VL4A 1XYMA 1TMLA 2YCLA 1EQCA 1FDJA 2GSJA 1UKTA 4ZQRA 3K8LA 4JX4A 4N2YA 1QOPA 5LNRA 2Q6ZA 1JL8A 2YLAA 4MF4A 5I0DA 1OFDA 2FTWA 1D2KA 3DXIA 3MKCA 4OQVA 1TZZA 2ACSA 3TTYA 4YJ5A 2WHLA 4WY0B 2OELA 2R91A 4CU6A 3FV9A 4EK7A 3B8VA 3K5XA 4IH3A 1K6AA 2WOQA 1B0IA 1ONWA 1YHTA 4CQDA 3TN6A 4AZHA 1RZMA 1V6VA 3GR4A 3GQYA 1IXOA 4DM1A 4PBFA 4F2TA 4PCFA 1Q85A 1MUWA 3FN9A 3S3GA 4LW7A 1ML1A 3W82A 3YPIA 2HXTA 1PUDA 1FQ0A 4TX9A 1B90A 4LBRA 5IBXA 3HFYA 1K9TA 1BGGA 2OYKA 2WHKA 1YDOA 4E2DA 1RV8A 2ISFA 2FH8A 2XU2A 3WBEA 4QP0A 4Y96A 1J5TA 5KZDA 2R8WA 3QMRA 1VJSA 1ITUA 3G0XA 1JUKA 4AZCB 4C7FA 4LS2A 2O56A 2PDGA 4JTHA 4DJFD 3ZQ9A 4TOQA 4MJZA 7XIMA 1X7IA 1XIDA 3RCNA 4HHPA 4ZE4A 1BVNP 2Z4GA 1X39A 4P61A 4AD3A 4IP7A 3N6JA 1WDPA 1V77A 3H23A 4LT9A 4FK9A 2P76A 1EP3A 4LYKA 2A4AA 3ZJ6A 4DJDC 3MMTA 4K7VA 3LRLA 1BKSA 3GR8A 4QNWA 4BF9A 3F03K 1FBAA 2WXDM 4N6FA 3AI0A 4XZBA 3N73A 1I0BA 3DKJA 2OODA 3RM9A 4EWND 1PL9A 1Q8JA 2YYTA 4JTSA 4RK8A 2OYMA 2QGYA 3EXRA 3GIPA 2X0HA 1A5AA 2PDMA 2INZA 3OP2A 2BB0A 4GISA 4QTGA 3GH4A 2D73A 4AY1A 1ISVA 1A5BA 2QIWA 3P7YA 2VFDA 4NI3A 4XX6A 3B4UA 3RIKA 1XD1A 1I45A 1POKA 4IIDA 3BLPX 3MHGA 3V5FA 2PC4A 2DT1A 2PSNA 3NSNA 5FJPA 1XLKA 4KWSA 4FP1A 3D46A 5C5YA 3GXNA 2C6QA 3H54A 2BP1A 1XW8A 1U1HA 2NQZA 5BXTA 3VFLA 4MLJA 4MNMA 3WDQA 3W7PA 4XBSA 4V2XA 2HE8A 4OFCA 1CGWA 4N4QA 4GQRA 3LHYA 1VBHA 5ECVA 2YCKX 4ATDA 1D3CA 4YVPA 4UUIA 3KWXA 4TX8A 2YL6A 7CGTA 3IIPA 4MKSA 3PBYA 1CGYA 1XS2A 1FUYA 1ZCOA 3CZLA 1UJQA 5LIUX 1KM1A 1GNXA 1GTEA 3AYVA 1W9DM 4QROA 5M17A 4C65A 1E9IA 3T55A 2VZSA 1JQVA 2DORA 1GVSA 2XZ9A 4D71A 2VZUA 4LALA 1XLGA 1YADA 1T99A 1XQKA 1QTWA 2VKZG 3RMJA 1KR0A 1RQHA 1YKWA 1VR6A 2VT0A 1HX0A 2C79A 4ZQOA 1JDEA 6ENLA 3SADA 3K8KA 4PBGA 4TV5A 2ACUA 4CUCA 1E5NA 2DSKA 3UZXA 1G94A 1V0LA 5D9NA 4AD5A 3DX5A 3BQ6A 1YIXA 4AIEA 2C3ZA 2X0SA 3VKAA 1RQEA 1SZFA 3CUFA 1GQIA 4MNKA 2CBIA 4K39A 4Y9OA 4G2DA 3AU2A 2ZRYA 4LUSA 2J66A 2DIJA 1Q66A 1X1OA 4MYXA 3LM3A 2F9RA 3TQKA 3PBMA 4RUBA 3MP4A 1GQJA 2J9YA 1E6PA 4IGNA 1SO5A 1ECQA 3VGDA 4G1KA 3UWYA 4GBUA 2OX4A 2ZIDA 2WSRA 2FH6A 3LA4A 1SJDA 3OZMA 2DSZA 4LUIA 1FWTA 3C2YA 3EWCA 2ZDRA 3LSBA 4QITA 3OG2A 4LAKA 1F8MA 4A8LA 2CU0A 2IXUA 1SZEA 5F4SA 3RLVA 3E2RA 4A2SA 3VABA 3T4WA 1PV8A 3O3RA 1HL2A 2JF6A 3EDFA 3ZWSA 2OB3A 2WZIA 3WK1A 3R94A 3OGVA 2NX3A 4URIA 4GIRA 5XIAA 3BAIA 2W3ZA 1JFHA 5E9XA 4OBSA 1VEMA 3W25A 1V08A 2CWNA 1DJYA 1T8XA 4KWOA 3UP8A 1U30A 5I24A 4DJDD 2E77A 4NIRA 4GACA 2YLLA 1GVQA 1QHZA 1AJ0A 4TV6A 1V02A 1PSCA 3AXKA 4WD0A 2Q8XA 2WMJA 1UD3A 3ZT7A 2G3IA 1EHAA 4PB5A 1JCLA 1LF1A 3QQ1A 3A22A 1KD0A 1RCQA 1PWLA 2VRJA 4PMRA 3GY1A 3LCGA 1QWKA 2X1TA 4H00A 3GFZA 4B5WA 1QNQA 3LNMA 3ITVA 2IQTA 4NAEA 4H7ZA 5JUVA 3W7OA 5KZMA 2DIKA 4AB4A 4DBSA 1ISYA 1OD0A 1EDTA 3ARVA 4KERA 1GQKA 3BH4A 2IKHA 1B3YA 1Z32X 3HV8A 2OVLA 2VQUA 2DZWA 1Q6FA 4AEEA 3B04A 3DG6A 3ITLA 2OR2A 1ZP3A 1L6SA 1DJZA 2NVCA 4GYKA 1JYVA 4MB3A 3LI0A 2W63A 1LWHA 1M7XA 3UXLA 4DWSB 1E1EA 4X63A 4GLEA 3GXDA 1J0HA 1VCVA 3CWHA 5BOFA 3AXHA 5C55A 3W23A 4R27A 3DGBA 4F4RA 3K2GA 4L1WA 4AIUA 4DO7A 4HMDA 5ABTA 5JMUA 1YDYA 3NO1A 1HJUA 2ZC8A 1VRXA 1KBJA 3WCZA 5KSWA 3A12A 3PZGA 1ICQA 2PLKA 3KE0A 4MG4A 2EJAA 1ITCA 4XAZA 4PTVA 4FS9A 4LPCA 5ABFA 4G1NA 4N6EA 1US3A 2ZYFA 4HA4A 4GY7A 3T81A 4O50A 2C1IA 2OWXA 1HKVA 4M51A 5DY3A 1HJXA 4L64A 4YVVA 1GJPA 3M16A 4FXFA 4MOZA 4GZEA 4ZQCA 2DZVA 4BWLA 2VFFA 2PWFA 3CB3A 3WJXA 1RSCA 2PB1A 1JPMA 1OFOA 3ITGA 1H7XA 3S4TA 3URQA 4RNJA 4CNOA 1EZWA 3AAMA 1R9YA 5E0FA 5EFFA 3VOIA 1W56A 5TBOA 3M6YA 3KTCA 3P0WA 2F8QA 1RVGA 1MVYA 3W1MA 1S3HA 2EG8A 1O5RA 5FSEC 3NO5A 3P3BA 3WNPA 4YTSA 3HFTA 2QDDA 3AIRA 4I9MA 1HL9A 2ZZ4A 4W84A 1JPIA 1VC4A 2O4QA 1O68A 3LN3A 5EBAA 5D02A 4PMNA 4JL1A 3PZUA 3CNYA 4CN4A 1R38A 3L4VA 1UJPA 2ABAA 4PEKA 4V27A 1N8WA 5IOBA 3KXQA 1W3LA 3GHSA 2XIIA 4L5ZA 3B0PA 2Y1HA 3KL5A 2DJLA 2WMKA 5A5WA 3TK7A 4IMEA 4M0XA 4C6OA 3OYXA 4DVOA 1G7VA 4ACZA 4LBSA 4RZ4A 4S3CA 1KKOA 2NSOA 4MWAA 2O7QA 5I3DA 4S39A 3G1SA 1PTDA 1GVOA 1PO9A 2FQIA 3U8GA 1WUEA 1YRRA 2FGLA 1KKRA 3CL8A 3CV1A 1HO1A 1A5UA 1C8QA 4EVZA 4LEFA 5D03A 1XG4A 4J5NA 3ZM8A 3N14A 4IIGA 4KGJA 3VC6A 2X40A 1FRBA 2H6RA 4UTMA 1QOQA 1AH4A 1IZCA 2OLAA 2Z27A 3TZFA 3AHZA 3M7SA 1V3KA 1KRAC 1F07A 3EOOA 3SN1A 2PLCA 3MO4A 2QJHA 4ERAA 3E0IA 2WSYA 2RJGA 2EPMX 3MP3A 4XIMA 1V3JA 2ATSA 3RR4A 3HMCA 1F6PA 2CNCA 5AECA 2G37A 4UFJA 3UY8A 3GG7A 4GC4A 4JTJA 1VJZA 3DBPA 1RBOB 2VP8A 4GJ1A 1ZBCA 1MXDA 3WLKX 2DUXA 3NPXA 1EWEA 1WPCA 3FSUA 1TX0A 4H8HA 3UR2A 4Q33A 1K7FA 2JEQA 1V02E 3C2FA 4E3VA 3FNDA 4FIRA 4S23A 3TJ4A 3C2OA 2OKTA 3E0FA 3ZT6A 3WLIA 5I6SA 1EF3A 1LRNA 4J3VA 1Q7MA 3PP7A 2Q8LA 4S2CA 4Z1BA 3FY1A 1N7KA 1XH0A 4V33A 3CUZA 1A4MA 6REQB 4JGDA 5CXPA 1TV5A 3MV01 4Z0JA 1EBHA 3AXXA 2PBOA 2WJEA 3R79A 1TRIA 4K8EA 1W2PA 3R58A 1KXQA 5EB8A 2AQOA 3DH7A 3EWZA 3IIZA 4FXSA 3H53A 2FKPA 1A0DA 5LKYA 2YB1A 5C9UA 2WYSA 3Q67A 4D8AA 2J7DA 3LM7A 4MNLA 1YQ2A 2J8FA 1ICSA 4HU8A 5FF7A 5HPCA 3L0GA 2ZVIA 2G3NA 4YYCA 4I6VA 3DAQA 1FFQA 4WSKA 5EMJA 4IJCA 5AZ1A 2GVJA 2XSBA 1DWJM 2WZTA 1GQLA 3AUOA 1ODUA 4R88A 2WNQA 1DHPA 1R5YA 2OT1A 5T9BG 2Z24A 5J5DA 2E4TA 1L0PA 4PZVA 4M8UA 4W88A 1H41A 1XYCA 4UQEA 1KV5A 5SWUA 4ZXLA 5JBDA 2E5CA 1O6IA 3NTYA 2ISWA 3KLKA 3R25A 1H7PA 4INFA 1I9CB 1SJCA 3FJ4A 4GWEA 2WVVA 3TSDA 5LGZA 5E6YA 1SFSA 5C0QA 5EFDA 4GVFA 2V5LA 1SQ7A 5A6BD 4GZIA 1E6NA 3GXPA 3E6EA 2ZA1A 5DXXA 3WNNA 4KRTA 3UGVA 4YLWA 3IV8A 2OSXA 3RCMA 4TMCA 2WZEA 3A5FA 1JYWA 3NZ1A 1XIHA 3BCDA 1GONA 4JIPA 1QASA 2YR1A 1IR2A 1QI3A 4Q7NA 1XYFA 3GVRA 1FWEC 3APTA 4JDYA 2G0WA 1WZKA 4O1AA 2Q8ZA 3W7KA 3UWZA 3SO7A 1UOKA 1PVNA 4WUIA 5A8GA 3VZXA 3WQDA 4CEUC 3V1HA 1KTBA 3CHFA 4C6MA 1E0VA 2QJIA 1JEZA 1JZ3A 4HPHA 5CZTA 3W3OA 4R33A 3W71A 3GG8A 5D2WA 4DWDA 1E3XA 4Q8QA 4ROPA 3HQOA 1PKNA 4A35A 3NDYA 5JBFA 3SJ3A 1LBMA 3JRKA 2D1ZA 2R1LA 2Y5JA 3C86A 2J74A 3UW6A 2INFA 4FLQA 1W5QA 3CIXA 3IJ8A 3UA4A 3IK2A 1K77A 2DZTA 3EKGA 1M01A 1R0MA 4IXHA 2ZWYA 4WJEA 3VOFA 3OYZA 3PC0A 3VNYA 3W73A 3BGJA 3QYQA 4GA8A 1V93A 1Z3NA 4W7WA 4OIFA 4AZBA 1KFJA 3UYIA 4MWAE 1IWBA 1JJKA 2NWSA 4GXPA 2E9LA 4FNUA 3MWCA 3HV9A 3WQ6A 3OG3A 2ZX5A 2XGIA 4NP7A 4F79A 5F4WA 5GJMA 1JD9A 4WY0A 4PTMA 3II1A 3WUEA 3A3WA 4GE8A 4HK5A 4XD5A 3KHJA 3VZYA 3G1VA 3QV7A 2ADAA 2G4FA 1HZYA 1O5KA 3LDVA 2QVHA 3NYZA 1YX1A 3W24A 2G3MA 2Y7EA 3PTMA 3OODA 4CQCA 5C6MA 4QX4A 4B16A 4RXFA 4BQ2A 3PZNA 2PTZA 1F3WA 2VTFA 4XAGA 3QGAC 1ADDA 3VA8A 3TYDA 4AEFA 3E0LA 4JR5A 2QCGA 1FH9A 1A5LC 4X0NA 3U9IA 1DJHA 1BQGA 3NXLA 4RKAA 1W1TA 3UJEA 1OEPA 5AC8A 1I6NA 1HGYA 3F7JA 1I2QA 5H6HA 3VZZA 5XIMA 4YTQA 5E0KA 3MUZ1 4AZCA 5PTDA 3KDOA 1UC4A 4IHCA 3WQVA 1IEXA 3GC4A 4PTNA 4OJYA 5CZSA 3K1GA 3UXKA 4UB9A 5DCEA 2RGLA 1F9CA 3GTFA 5AVHA 1X8FA 4XD4A 3RJXA 4GC3A 2HPMA 4C1LA 1SW7A 3UEQA 1Y65A 2X05A 4PMDA 3TSBA 3DUGA 3VIHA 4UQ9A 3LHVA 3KL3A 5E6ZA 4DHGA 3FS2A 2QUUA 3LLXA 2YA1A 4OOZA 1QI4A 3R10A 5LYRA 1JVNA 2BX7A 1QWGA 4X2RA 4IF2A 2EJ1A 3O06A 1SW0A 2J8TA 3DU0A 3CV2A 3ZWTA 8XIMA 2EPNA 1KXHA 4O10A 1UWQA 1BXBA 4E6MA 4KMQA 3VCNA 4A29A 2OWWA 4JD4A 1M65A 3HOJA 2PP0A 4B3LA 4JTEA 2V82A 4IMGA 1AVAA 3VXGA 3QOKA 3C61A 2PA6A 5HINA 1TJ1A 3TW7A 4E0CA 2XN1A 1AW1A 4KEMA 1AQ0A 3EPNA 3WF3A 4E8CA 4LCQA 4KS0A 2NVAA 4HU4A 2WW5A 2Y85A 2I16A 1W0MA 2OMAA 3KS6A 4GX9A 2J7HA 1J93A 1GUVA 3GXMA 1XRFA 2UY3A 4YTUA 3B4YA 1XC6A 1H7RA 3N2XA 5LXXA 1W54A 3GH7A 4JTUA 2X1UA 4IMFA 4Y9NA 2I9UA 5F1VA 1JZ5A 4PL2A 3DHDA 4UMAA 4LTSA 3STEA 3P6LA 3VKCA 3P67A 4NX5A 4AH7A 2J7FA 3NVDA 1W8GA 1Y5XA 1FWFC 4UTIA 3A21A 4UC5A 2BODX 1Q6OA 2VOMA 4KGLA 5K9CA 1TKKA 1XM3A 1QHPA 1AG1O 2Z29A 1J8VA 3IGXA 3NL3A 4PCSA 2VX4A 3PG9A 1JUBA 3EAUA 1QXLA 2OXNA 4O1BA 5KITA 4EACA 4UQDA 4ADUA 2FHCA 4MGGA 1QNSA 3AJ7A 4FPSA 4CN1A 3IGHX 2QXWA 3MZ2A 4PB3A 3WBAA 4D6DA 1D8WA 4TTUA 1RXOB 2CITA 4FNTA 1WCGA 3FYYA 4IIHA 1AQHA 1PIFA 3CL7A 4JNYA 4R7JA 1SGJA 3N4AA 4JN7A 1LUCB 1UH4A 4TIMA 5EMYA 3GXFA 1E0TA 2CLKA 3LLDA 2VZOA 4S3FA 5D38A 1OQFA 3PB0A 3O1NA 1IWPA 4PMQA 2BVYA 2VDIA 1G1YA 2ZOXA 1FWHC 3HPAA 2GJNA 3MCMA 4EAMA 3ITYA 2GQ3A 5A8OA 1S2VA 2C1HA 1SM9A 1NDZA 1YXCA 4REQB 1DQUA 4ICMA 2F7FA 4YCPA 1EFZA 3AS3A 1H7NA 1SFLA 4O54A 1EIBA 3N34A 2E40A 3ITXA 1DIOA 4NJKA 5ECUA 2DT2A 3N6QA 5DLCA 3B8DA 1POJA 2JGYA 2B7QA 3LY0A 5C2CA 5CJMA 3W1UA 4RE4A 1KW1A 1E9ZB 3TLQA 3T0CA 5L9FA 1MQPA 2A1YA 1A3XA 3O8AA 2BFGA 5DT7A 3WYZA 1GQNA 3SZ8A 3CAVA 4HNNA 3ZSTA 1H62A 1VYPX 3DG7A 1L6GA 1WXZA 3H4GA 3LU2A 1BG4A 3NQCA 3PTQA 4IGHA 3WK2A 4HBKA 2IKGA 1KFKA 3FGCB 4IPLA 2ZZ2A 1DOSA 3B8TA 2WO5A 1W37A 1VS1A 4RDYA 3UJRA 1LQAA 4O8AA 3TROA 2WKJA 1S2AA 4WCJA 4IGSA 4LQ1A 1B57A 3QVQA 3GO2A 3MMWA 3RPTA 1K7XA 3FA4A 2W66A 2H3DA 5CC5A 1PZ0A 4I9TA 1GOQA 4U2YA 4WKAA 1ITXA 3V0UA 2OT0A 3W83A 2YW3A 3QY6A 2Y5SA 3M0MA 5AHFA 4DEFA 5AOUA 1MW3A 1UA3A 5H8PA 1RA5A 5DCDA 3W1LA 1TTIA 2GUBA 2QJNA 4KIEA 5DBUA 1GHRA 3RLUA 5C8BB 1KM4A 5FF3A 4NJHA 4UNLA 4AWSA 2ZBTA 1GOWA 4ZMGA 2A7RA 4BA0A 3G1RA 3UWVA 4DWSA 4DN1A 3MDUA 2CLOA 1FY6A 1RP8A 4CNSA 2O7SA 2WB5A 4UTTA 3SN0A 2C16A 2HK0A 1GGOA 2BS9A 4H01A 4YTRA 3HPSA 1ISXA 3QGVA 3B9NA 1ZFJA 4N42A 1PX4A 1TV2A 4JX5A 4A8NA 5DRCA 4HMCA 1KBKA 1NWTA 4MJMA 1JFXA 4PMJA 3S46A 3UY7A 1Z8AA 4LRSA 2EQDA 2Z00A 3W1TA 4LF2A 3WEMA 5D9OA 3VX1A 2GK1B 4K3ZA 3QR3A 2H8XA 3EWUA 3EX1A 4JYDA 4EWJA 1SYTA 1Q4NX 3NQVA 2D0HA 1E15A 5CPSA 3QW3A 1V0KA 2JQXA 2XVNA 2X41A 2XIMA 1XUUA 2V2HA 1MEHA 1E4IA 3F5JA 4H41A 4MB1A 1E0WA 1PS9A 2JGQA 1KM6A 3APGA 3WLQA 5BZAA 4Z2IA 2CERA 3B9OA 1BTMA 3UZZA 4DELA 3IJIA 2XFRA 2CHNA 1ICPA 3RITA 2QJGA 4LC6A 1WXJA 2XYLA 3S2LA 4KCWA 4RXGA 1ENUA 3VMOA 4M5PA 4GIAA 1GEHA 2G3JA 3ZJKA 4JQ1A 3QZ6A 4A21A 4PCTA 4FXJA 2PCQA 1N82A 1CYGA 5GJNA 3AXIA 2OYLA 1T96A 1VFUA 4LC8A 1QCWA 3CLMA 3KWSA 4H9UA 2CHOA 2F6UA 5DY2A 2R6OA 3VM5A 2RDTA 2VD8A 5A3HA 3QXBA 4NZJA 4PCPA 1EQPA 4OECA 2HRWA 1SO3A 3OOQA 3NZQA 3NPVA 2F84A 3RRAA 4MJ2A 3VI2A 1XP3A 2E7FA 4B4FA 2GJLA 2YDAA 3IVSA 3ZS4A 3H8AA 3M0KA 2O0TA 5AB3A 1TJ0A 4GKTA 3UZ5A 1QPOA 1I60A 1H49A 1KCKA 1GKPA 2IXVA 4Z2HA 1BSIA 3ARWA 2PBGA 4JTIA 1KFBA 3VNDA 1Y0EA 1UKPA 4YPJA 4I5RA 4BF5A 4XAYA 1RK6A 2CXEA 4MSSA 2XG9A 2PPGA 3CIVA 4S3GA 1W9XA 2QHAA 5F2MA 1KM5A 4K7YA 3K8MA 3SECA 4CU7A 1P1MA 2ABBA 4YVXA 5AHIA 1LLOA 4HHLA 4WOZA 4YU1A 1KFWA 2VOTA 3V1PA 5FOOA 3IAQA 2AKZA 1I0DA 3TA6A 3N2BA 1MUCA 2PI6A 3QTGA 5D05A 4F0HA 3WH8A 3EMCA 4RPPA 3WFLA 1SR0A 4MWAC 4CCCA 2V3FA 3W1RA 4AIOA 1DPMA 1P7TB 2QAPA 2F2HA 4UQBA 2Y5EA 2GDVA 1DJXA 1TPH1 3MS8A 3AMGA 3TQ0A 3DI0A 3I3DA 2NX9A 3DECA 4Z42C 1PDZA 2VCCA 1V6WA 3RPMA 1UD8A 2DPEA 3FX4A 4MUZA 1FWDC 4FNSA 4IJRA 5FIPA 2QUNA 3BG9A 1NELA 1XD0A 3VMNA 1JR1A 1S2UA 2P50A 5XINA 3W7MA 3NL2A 5A8NA 2FPTA 3K4WA 1RA0A 3W74A 3R8GA 4L1GA 4M56A 4PTWA 3M5ZA 3OBAA 3T8LA 1U5VA 4ZFCA 4RR4A 2ZKMX 6REQA 3PPGA 1J4EA 4LGXA 2X1RA 3USZA 2OKOA 2PCEA 3NURA 3KFTA 2E3ZA 1B30A 2HBVA 3CO4A 2ZE0A 5C9ZA 2A79A 1K9FA 2XH4A 3GFYA 5U4NA 4ORMA 3PUOA 3E96A 4MLRA 3GDLA 2FIQA 2V38A 3WDHA 1JZ2A 4AY8A 1DQWA 2AL1A 2FTYA 4MB4A 5IDIA 2O9RA 3I68A 3N15A 7A3HA 4P7OA 4YWSA 5F4XA 3T40A 2VD9A 5D9PA 2A7NA 1UH2A 1QU4A 4IP4A 3LCIA 2ZQ0A 1VFFA 3T4CA 3MHUA 4K8HA 4KH2A 2WHMA 4PA8A 1PZ2A 1E1CA 4UFLA 1DIKA 1F6YA 3GH5A 3C56A 4PRTA 2LLEA 4IMDA 3BAKA 3S2MA 3VGHA 3VOGA 1EGZA 3W1PA 6XIAA 3F2DA 1IZKA 1DXEA 4JFWA 1P6WA 1UB3A 4LNYA 2PRHA 1BYAA 4YHEA 5CPLA 1AZ1A 3W76A 3WNMA 6PTDA 1PZ1A 4KWUA 2W9MA 4AYGA 1R87A 2RFGA 4MUPA 2XDFA 2BLEA 2EAWA 5H1WA 3LB0A 2Y24A 1KQZA 3TKFA 4XZNX 4IL2A 3M0ZA 4IM4A 1UR2A 4I5UA 2OTDA 1QFEA 1YXDA 2W6RA 4D1IA 2AQWA 3U4AA 3PZMA 2VX7A 4GIYA 3W01A 2BTMA 1R3QA 1RVKA 3FJ6A 3AJXA 4XAFA 3CQKA 1M6JA 3KVMA 7PTDA 3CQHA 1P0BA 1XIBA 4WDUA 2J75A 1NOFA 3CEUA 3H26A 3T2OA 3JZEA 3V35A 3CT7A 4PMUA 2W92A 1B3OA 1R7OA 3M1ZA 1R47A 2X09A 1TPUA 3H70A 1B1YA 1DJNA 1B4KA 3ARUA 4GNKB 1S2TA 3FVMA 1R46A 4FF5A 5JBEA 3UWQA 2RDUA 3ZJ7A 1KGXA 4PTDA 2DZAA 1YNYA 5T8GA 1G9HA 1E56A 1GK8A 4AMAA 2XVGA 1CGUA 4RL3A 4QCFA 4NXSA 2E67A 3GUWA 2YZRA 1M1BA 3GIQA 3G6MA 4J28A 3PSWA 2GFTA 3RO6A 3D47A 4IJBA 4QRNA 3QH2A 3O6CA 4LWWA 2WBKA 5E5CA 3VD3A 2X42A 4I3GA 4ZO9A 1PYMA 5FL0A 1QBBA 2A5HA 2D0FA 8TIMA 5JVLA 5I5RA 1HFBA 1VD6A 3B0YA 1JZ7A 4CQBA 3CZ8A 3W7LA 3AIBA 3L65A 4GFSA 3MMUA 2YGYA 5CQ1A 3TVAA 1O12A 1ZY9A 3L2LA 4Q7BA 2QQ6A 3BJSA 2D23A 1VB9A 4JHOA 3ZZ1A 2B0MA 3KRSA 1NOUA 2P5NA 5CPTA 5IHSA 3NDOA 1RALA 2XH7A 3E3HA 1EEXA 4H83A 4FOJA 2NUYA 1JXJA 1R7AA 1U5JA 2QGHA 3QR0A 1W9PA 5BROA 1R86A 2A0NA 4LS0A 1UUMA 4HNCA 2FB3A 2XN0A 1GYMA 1K70A 1S2WA 4LY8A 1TPDA 4D2JA 2QCNA 3FLUA 4L6DA 4HQVA 4TVCA 3N19B 4DO5A 3WQFA 3SIMA 1EHNA 2CFFA 3B8UA 2Q02A 5AY7A 4XZIA 2EF9A 1EP2A 1WDSA 3O15A 3S5OA 4HGXA 1S5VA 6TIMA 1Z48A 1UKOA 2QDHA 4HOZA 3KP0A 4HPXA 3RNDA 4XUGA 4XD3A 3RGTA 4WSHA 3WF0A 1K03A 3CLWA 4CNPA 3BLKA 3O6AA 1PB0A 3BK0A 5TIMA 3LX9A 1UASA 1UUOA 2GUUA 2TODA 1DIDA 2V3GA 2QF8A 1AQFA 2A3AA 3NCOA 1Q45A 4HNVA 2PZNA 1DP0A 1W1VA 3WH6A 1W2VA 2P3ZA 1C90A 3NUKA 4FX8A 4LVBA 3V5CA 2IQDA 1ZBVA 1L2QA 1XGDA 1FCVA 1UD2A 4R7WA 2ZRZA 4RZ5A 1EC9A 2JF7A 4ATWA 4BJHA 1UMYA 4BI5A 3SCPA 2J77A 3GTXA 2PEVA 3SDOA 4I7UA 3TYAA 3UVAA 2VX6A 2J6XA 1RPXA 1H1NA 7REQB 2UWFA 1EWDA 3KUMA 1N55A 4ZVJA 2JKEA 1TTJA 2P3EA 4OKDA 4C6FA 2OO0A 1P6BA 3ERPA 4GYFA 4EKJA 4JIHA 5D2VA 3STFA 4QE1A 3W72A 1XIIA 4ZB2A 4IFRA 4JFUA 3TR9A 3KBJA 1QRQA 5E1QA 2DIEA 4EIVA 2NT1A 1UMLA 4WJXA 4P7LA 1WZAA 3U2CA 4BHYA 3GVQA 3HBLA 2Y8KA 5CC7A 2QCMA 2C0HA 4J3XA 4BI6A 1EUAA 4GPNA 4XG1A 4F8XA 3LS9A 3FXGA 3ONBA 1J0YA 3E0VA 4GD0A 3WFAA 3EDEA 3N4EA 1QW7A 3WUGA 5BMXA 3CU2A 3RX2A 4GH3A 3SQSA 1P0NA 3IV3A 4GIEA 1AL7A 2V68A 1DE5A 7ENLA 3C0SA 1H61A 4DYEA 4DUVA 2PDPA 4QJ1A 1SZNA 2KZHA 1JULA 5LZLA 3CQJA 4CNNA 1V3HA 4ICCX 2AQVA 1H63A 4DUWA 3NSXA 3S8HA 1Q6CA 1K4GA 4DM2A 3GU9A 4OUEA 1QW9A 3SBFA 3WQ8A 1H3GA 3SCSA 4S38A 3N11A 4L7ZA 3VDBA 1EJUC 3URAA 3WH5A 4FR1A 1HQTA 1D7FA 1MUMA 2E6AA 3M7WA 3M5YA 1DJWA 1NEYA 3EKZA 1BG9A 1GG1A 5D04C 1TPEA 4DF0A 2PLJA 3UETA 4DO6A 3MANA 4XVDA 2VEFA 5CPQA 4J3TA 4J9JA 3MB9A 4MVAA 4UFKA 1C92A 2ZZ7A 4YWIA 4J2PA 3NO3A 3R2GA 3L68A 4EE9A 1KFCA 4XZLX 1EC7A 5BXSA 5I3FA 4HYWA 4B5SA 4IFOA 2CLEA 3W1XA 4C6NA 2NQJA 5HUPA 3O2LA 3IJQA 1QO5A 4E4PA 1YPFA 1EO5A 3N18A 1Z6KA 1GYLA 2X8RA 1BF6A 3QPEA 4HZ8A 5C9RA 4I6KA 5I78A 3O07A 4W7UA 1CXIA 3C2RA 3OGSA 2WNNA 4UTFA 3FOKA 2BVWA 4JFSA 3NM1A 4REQA 3OHMB 6CGTA 1EZ2A 3NQFA 3QMSA 4HJFA 1RP9A 3N13A 3WNKA 3SSZA 4UCGA 1DHKA 3NPUA 1NDVA 2Z1KA 5EBUA 2PLMA 3I7QA 3PAJA 4A8RA 2INEA 4DZHA 3GFXA 3LK6A 1CXKA 4AD0A 3DC0A 3FAXA 5HR7A 1EJSC 1X97A 3WEOA 5LIXX 1UWSA 2BY3A 3MDWA 3EPMA 1MYRA 3T08A 1BVWA 5G1YA 3CIWA 3AHXA 3W86A 4X22A 4MTVA 3RX3A 2Y62A 1J0JA 3LTSA 5DBTA 5I3KA 1VBUA 5J5RA 1X7FA 3EMQA 2HISA 3MW7A 3RFAA 3FGCA 3HM7A 1V3MA 3HTWA 5HOSA 3DI1A 2FPVA 1TV4A 3GU2A 1LOSA 1EP1A 5JIPA 1VYRA 3NZGA 4IGMA 1E6QM 4CCZA 3C0JA 4DXKA 1NH6A 4EANA 1OG6A 4LY4A 1TFVA 4RNHA 1GPWA 4Q3MA 1GEQA 3GDMA 1LOQA 2ZTJA 5EPDA 1ALDA 2AAAA 3PUDA 2BGQA 4A3YA 3XIMA 2GVGA 2PC8A 3R8RA 3FEMA 1J5SA 1G4SA 3PANA 3A13A 5DN1A 1IF2A 1M68A 1VFOA 2QR6A 3W1QA 3KZSA 3OA3A 1G4EA 1TZ7A 2A3EA 2AMGA 3BQ5A 1UIOA 4BQ5A 4D6CA 2FVMA 4QDMA 2X1IA 3SY8A 1OF6A 3SCUA 3SY1A 3TX9A 1ZB5A 1WXYA 1NAL1 3BW4A 3PZ9A 5BRBA 4HSOA 4FO4A 1EOKA 2GYIA 1AZ2A 1H09A 5LHFA 4KRUA 1GCYA 3L4WA 1XFBA 3MJYA 3U2ZA 2OO6A 1E4MM 4AZ7A 3BE7A 5C70A 3BDKA 5FF2A 1XIJA 3H12A 2ZICA 1XJBA 1DBTA 1YW1A 5KETA 1EPVA 4QLLA 4US5D 2QCDB 1CNVA 1RBLA 4IQLA 3G24A 2EPLX 1ZSXA 1LDCA 2GGIA 4C5ZA 2GK1A 5DF0A 2QPXA 4DWSC 3QRHA 4NYYA 4KCVA 4H9MA 1NP0A 4ZODA 1LCOA 3SUVA 4O52A 3RG6A 3S6OA 4HPNA 3DN5A 4N4PA 5AFDA 1E6RA 3UU0A 1SU5A 3THUA 2PDCA 5I2UA 3D0CA 2JEPA 3W26A 3WMBA 4DIAA 1TA3B 4OZOA 1OX6A 1HJVA 3ES8A 3ZLFA 4RPQA 3K13A 3H2NA 1Z41A 3KOXA 2VEPA 1CXHA 1GWJA 4QDPA 1DWGM 5IM51 3FAWA 2VR5A 4YN5A 3VE9A 2CZDA 3AO0A 3HG4A 1XX1A 4X9SA 3C8FA 4DJEC 3PAOA 4GCAA 3KBMA 3LBCA 3S47A 2QS8A 1PX8A 4MFEA 4RE3A 1E4NA 4IUGA 2VR2A 1QPQA 5CGTA 5KEZA 4S3AA 3KVKA 1J79A 3TCEA 1TZ9A 5EKYA 1CX9A 1ZUAX 3ZVIA 1BVZA 2VVNA 4QLJA 1MWOA 3BL3A 1U83A 1VEPA 1JDAA 4HB7A 2J62A 1XLHA 3LPFA 1KCXA 3QJAA 3BLEA 3VOCA 5M03A 4AD1A 5AVNA 3MKVA 1VIWA 3VNJA 1LZOA 1V4YA 4GI9A 3UCCA 4FR6A 3L5MA 2I7GA 3QPZA 3P74A 3M4HA 2JKAA 3SUWA 2JFEX 1KO0A 4O15A 4CN6A 5DX7A 4AFYA 5EA9A 2E5DA 3BMXA 1RBAA 1VCFA 1L9WA 3W7IA 2GGGA 3LZ3A 3EPOA 4O53A 4O18A 3LXAA 4JQ2A 2PD9A 1ISWA 1IQ8A 1M53A 3REQB 3L21A 3S1VA 3E0WA 1CBGA 4L6HA 5CSYA 1YE6A 2VC9A 2L5HA 3VE7A 5BYWA 1EDQA 3WBWA 3R8HA 5K2ZA 5HQMA 5FEXA 5BW6A 1BWVA 4Y8FA 4H19A 4AYSA 5D2XA 2C19A 3UT0A 3H2CA 5FEPA 3G8EA 3UWWA 3M0VA 3G77A 2G50A 4QS5A 1CB7B 1K8ZA 3QZEA 3AROA 3H22A 4JKLA 1TX2A 1EH9A 3S5ZA 3KBWA 4C6DA 1EGMA 5H8MA 4ICNA 2VWTA 2UY4A 2XTKA 1J01A 3D6NA 4F9DA 2OLHA 3EX2A 1DWAM 3WDPP 1OCNA 2YB4A 1HL8A 1E0XA 2PDYA 1XRTA 2GGEA 4QE5A 2NQ5A 3Q37A 1IYXA 3WJWA 3LGGA 4EP8C 1W9BM 2PDNA 3CZKA 2ASHA 4XO7A 3W07A 2J13A 3LUTA 2Q71A 2YOCA 1WA3A 5HR6A 4NAFB 4H7CA 4O12A 4R5EA 3QEZA 4KT2A 2YXGA 1PJ9A 1OZQA 4FALA 3BO9A 2XFYA 1PDYA 1HUVA 2V9DA 3RUBL 1A53A 1EA9C 1REQA 1B5TA 4D72A 3L7RA 4PRWA 5LXEA 4DY1A 4XV0A 3LCLA 1CIUA 2BHYA 3CMJA 4PMVA 1MXGA 3TFCA 4B92A 1THFD 3M0LA 4B9ZA 1S39A 1XLBA 3A4XA 4H9YA 3G1HA 3C6CA 1FHVA 3NJ3A 1P0DA 4DJED 1GZGA 5BWFA 3ZR5A 4JKMA 1VQTA 1L6WA 2HCVA 3SQMA 3QC0A 3RX4A 4RW5A 3LMZA 3GVVA 3V4BA 2D3NA 3O6DA 4R7OA 1AW2A 2HSAA 4B2DA 1YEYA 4Y8EA 3AZSA 1ZJHA 2OQLA 1F6KA 3LI1A 1F3EA 5HNNA 2J7EA 1YXYA 1RCOB 4K36A 1WDWA 3QLDA 7TAAA 1J10A 3IPWA 1I4NA 4H8NA 1ME7A 4Y6GA 3S2JA 3TWAA 3WLSA 3IACA 4K8GA 1DWIM 1XCWA 2QW5A 2J24A 4N9EA 1GVYA 1QPRA 2QIIA 3ARQA 4J3WA 4LX4A 4WR3A 1VAHA 2QEZA 3P60A 3CL6A 4YS1A 2VRQA 4DPQA 4XZ9A 3P80A 3PWAA 3WF1A 3MCOA 4M1RA 3B0VC 4S2BA 1OIFA 2V5DA 4HHMA 4P8UA 2YXOA 2RJHA 3VOHA 5CAKA 1HKJA 2DZBA 2YBVA 4WEVX 1V6TA 4OOUA 4Q6XA 3DEQA 4AXKA 2RAGA 4O28A 2I57A 4LAZA 2DDXA 3N29A 2GL5A 1UP3A 1RUSA 3N2MA 5K4XA 4A6GA 2POZA 1UD6A 2VC6A 1OVDA 5AC4A 2QMKA 1E71M 4IPJA 3WFZA 4OTKA 1Y5WA 1T6MA 4B2DD 4PC8A 4LU0A 3FIGA 5JIWA 2RGMA 3LCHA 4W9TA 3I3EA 3WKZA 3CTTA 3W53A 2WCSA 1ECEA 2YA0A 3MSYA 2E8YA 3PBUA 3OZOA 4AUBA 4MAZA 4MKNA 4IQDA 3ITCA 3G1YA 3AALA 2C7FA 1SPQA 3C0LA 3FKRA 4Y9AA 1ELSA 4MDPA 2NW0A 1GJUA 1F61A 3VMPA 1OX5A 3W7GA 2QCLA 4GQQA 4Q7IA 4AISA 4HCLA 1FWWA 4XKYA 4V1XA 4B90A 4G9PA 1XPGA 3OA5A 4TMBA 2V5KA 1F74A 4C5YA 1XXXA 5I23A 5DXYA 1UCWA 4JTAA 3QW4B 1LT8A 4GXMA 3NIYA 2BG5A 3T05A 2XGBA 5F7UA 1JGIA 2F38A 3FSTA 2YCIX 2UV8G 4S3DA 2W5FA 5BWAA 3WH9A 1R2SA 3E74A 1SSDA 1WKYA 3BW2A 4R9OA 1FWSA 1W8SA 3CJPA 1G7UA 1DTNA 1HTIA 4BY3A 2CBVA 2WZMA 1LTDA 1R6WA 2TYSA 3WLHA 4ZQPA 4S3KA 2VHLA 4LJ3A 3TXZA 1FWIC 3AIEA 1TCDA 3S1GA 2DVXA 2E1WA 1EYWA 5L6UA 1RK5A 5HNRA 3RCYA 2WWDA 5HPOA 4Z1YA 1GVEA 4WHBA 2EXOA 3VX0A 3HG3A 4O4WA 1HKMA 4NKCA 2EKGA 3NQAA 4G8TA 4XO6A 5AHNA 2A21A 4GUFA 3SCOA 1HVQA 4GX8A 3GTIA 1BKHA 4V15A 4EXQA 2NUWA 3WLRA 3PR2A 1XYLA 1HGWA 3CHDA 3PJXA 5IFTA 4NT0A 4GOAA 4Q8WA 3R13A 4H9ZA 1XLAA 5FJRA 4DNMA 1TE6A 3VNLA 1MW2A 1I1WA 1F76A 1Q7QA 4PFMA 5GNZA 3W22A 7REQA 4U5IA 3TTSA 4GZ7A 1NF0A 1AODA 2Z1VA 4X9YA 2POTA 4MM1A 2H9AB 4RLIA 3IJ6A 4QSFA 3LTYA 3GDRA 3AIWA 4Z2GA 4MPQA 3IJLA 1MRQA 1TR1A 5FEWA 4IIFA 5BNKA 3LPOA 2RH9A 4DF1A 4DUOA 1HW6A 1GVRA 3BJFA 3VTRA 3THAA 2C13A 4H8VA 3WLPA 3W7DA 1ONRA 3FK4A 1S5MA 5M5DA 4UIOA 3UR8A 1W91A 3PVFA 1CLKA 3LHUA 3NZRA 1VPYA 2DY3A 1HNYA 3UJFA 1NSJA 1HN1A 2QCEA 3LLFA 1VJIA 1XISA 1C3FA 3CGTA 2F61A 3R11A 4GQ0A 3PBGA 4GY1A 1V51A 3ARTA 3LD5A 3PZVA 1TPB1 1G0CA 4A2RA 3VIPA 1PBGA 1F8IA 3ME3A 3IWPA 3NQ7A 3O7UA 5CSUA 4W87A 1CWYA 4DX3A 2RDWA 3Q2DA 4AU0A 2GGHA 2JK2A 2HTMA 1FXQA 3WIJA 3OW1A 3NSMA 1ZBWA 3GNNA 5FJOA 2VFHA 3W88A 5BOOA 3QZAA 1SSGA 3ECQA 4M82A 4MAVA 2WK2A 3J7HA 4LF1A 2RHGA 2D20A 3L4ZA 1HKKA 1T5AA 1J6PA 2GVLA 2VR4A 4MHBA 2WSKA 1I8JA 3U2OA 2FZMA 2OJPA 1EX5A 1PPIA 2YDRA 4PN2A 4K6AA 2YFNA 4NZ4A 1QNOA 3G1XA 3TA9A 1MDLA 4KFOA 1Z42A 1TPC1 4JHZA 3W29A 1DQXA 5FJIA 4CVWA 1A3WA 5M1TA 5CSSA 2J7BA 1NWUA 5A8PA 3LCWA 4QG6A 1N2VA 1OWQA 3IEBA 2ZUTA 4AEOA 4JNMA 1QR7A 4F0MA 4GVGA 5RUBA 3UWUA 4YNGA 1B2YA 1DIEA 3CPGA 1QDSA 1XF0A 4QNEA 4DJDA 2Y88A 1H50A 1YPXA 1J6OA 1SVDA 3CUIA 3OIXA 3TQPA 3BOXA 1HXJA 1F3TA 1IT8A 4Q8UA 3B8WA 3NG3A 4POCA 1TPFA 4YL2A 3O0FA 3MPGA 1C29A 3GAKA 2Z2BA 3WNOA 1RQBA 2WSQA 2YPIA 1W5PA 2Z1BA 1XR2A 4P8VA 2GUYA 4JTDA 1F3XA 3AU6A 4ZSTA 4WRHA 1EXBA 5CCZA 2J7GA 2O92A 3GM8A 4E2BA 4UQAA 4HK7A 2PWVA 5HK4A 1JDCA 3N17A 2QAFA 3FJNA 1WYIA 4WDTA 3LPPA 2HEJA 2VGGA 3GKAA 5E70A 3AS1A 5HWMA 4AG0A 1ME9A 3EA2A 3TYCA 1OFEA 5HA7A 1KQYA 5DANA 1ZJAA 1NTHA 3EWBX 3ICJA 4PCNA 2HQAA 2VFEA 1RJPA 5ABHA 4O0KA 3OLDA 4E2VA 5BRPA 3UR7A 4ERGA 3PF3A 4PUJA 3K46A 4FNPA 4HNLA 5D8WA 1A3HA 1KXVA 1J96A 1T8QA 2FFCA 3POHA 3TC6A 4GYPC 4QGCA 7TIMA 1CPUA 4JY9A 3QTPA 5FL1A 3PPHA 2CLIA 1JCJA 1UWRA 2ZRXA 3EA1A 2G96A 1KM3A 4U3CA 4UTHA 1FKWA 4CQ9A 4M6PA 2OZ0A