5M1NA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound manganese
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
molecule keywords Phage terminase large subunit
total genus 65
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1nA00
5M1FA 5C12A 5C2DA 3C6HA 5C15A 5M1OA 4IEEA 5M1QA 4IDHA 5M1KA 4IFEA 3CPEA 5M1PA 5C2FA 5M1NA 4IEIA 3C6AA 5C10A
chains in the Genus database with same CATH superfamily
1KCFA 4H0YB 4CGJA 1TVRA 4OKJA 3M6GA 4CZFA 4FJXA 3SQ1A 3FLCO 1JL1A 2KKZA 1RT3A 1Q81O 3L2WA 3KWGA 1IBMK 4A5BA 4KV8A 2E2QA 2Q0UA 4B08A 1EWQA 3O9UA 4DR2K 3NMUA 1FJGK 3QLHA 4FWPA 1X9WA 3O08A 4GVMA 4DV1K 1X1PA 4CZKA 4DLEA 4A5AA 1FK9A 3LDSA 3AVKA 4DS5A 2D0BA 1Z05A 1TK5A 1JXEA 4H5RA 1BA1A 4CEAA 4B9SA 4FM2A 1BU6O 3FR0A 5J2PA 4F2RA 3M5RA 4NB4A 1A5WA 4FL9A 1S5JA 2Q97A 5HRSA 3PV8A 3MXIA 4WQ5C 4C1NI 1NKCA 5M1FA 1RDDA 2WUSA 3O4WA 1BL3A 1GLJO 1J54A 4Y1DA 3MCPA 2Z1HA 2NRTA 3FGUA 3AA2A 4M3TA 3CCVN 3E1YA 2Q1NA 1ESVA 1GLLO 3IMXA 4CEQA 2F9WA 4BDPA 4BE2A 1C0FA 3CPEA 3QDKA 4CJVA 4KH5A 4O8UA 4A59A 4CBXA 3VQ6A 3KTQA 2W42A 1RT6A 4A61A 3AARA 2I7PA 3JS6A 1RT2A 5C24A 3IUCA 2XY8A 2QWMA 3KIOA 3KKSA 3HM8A 3LL3A 2WC9A 4HTLA 3CI5A 3VMFB 2ZD1A 4Z4FA 1BISA 4U7BA 3OS1A 3KJVA 4JRQA 5CY4A 1S22A 4JI0K 1E4GT 3HVRA 3O3GA 4M45A 2Q3SA 4RTFD 1Y97A 3HP9A 4K42A 3RWUA 4F3TA 4M3RA 2EX3A 4O55A 1VQ9N 3L0QA 1QE1A 3VEVA 1VQMN 1W9HA 3MDQA 4IDHA 4JKAA 3TAQA 2A5XA 2HHSA 1RBRA 4DFMA 1L3VA 2YI1A 4PA1A 4RWTA 3O4NA 3LZIA 3K5LA 5D3GA 1CXUA 4IOCL 1NJXA 4JI3K 4AHTA 1HNIA 1QSSA 1NGIA 3K9KA 3O9QA 5BR9A 4BVPA 4ELTA 3DLHA 4JI7K 1NK6A 4I9LA 4H8KA 1HYVA 3CD6N 1JLAA 2AJQA 3DLBA 1NJZA 3MN5A 4A2AA 2ZWHA 2VGNA 3D6RA 4KBOA 2YHBA 2A3ZA 3S3MA 5BRDA 4DTJA 3NAEA 5CHIA 3KD5E 5AZIA 4JK9A 1O13A 5GIPA 3SBTA 3LDOA 5B8HA 4DR7K 3TPQA 3AVIA 3T19A 4BC2A 4HUGA 4KH6A 2QEXN 3MWTA 3L2UA 1IV0A 2D0AA 2F9TA 4GVEA 2HHTA 2IC3A 5LMNK 1E3MA 3SV4A 1LAWA 2DTUA 3DWLA 4K25A 4FWOA 5HRRA 3VA0A 4YY3K 4WE1A 2Q31A 5M1OA 4YOUA 2OPSA 4JAXA 4DTSA 3SAHA 3BEXA 3U4LA 3AVCA 4W5RA 4B1ZA 4DTPA 4M42A 4BVOA 4AM6A 3L4IA 2PY5A 1YVUA 4FK4A 2IGIA 2QWQA 2P9SA 5KTQA 3RRGA 3SQ4A 3K59A 5KPTA 2OTLN 1JCEA 2IVPA 1TUUA 4CJFA 4CZGA 4QOZB 1C6VA 3OY9A 2FSJA 1XNQK 1HRHA 1WSGA 3BF3A 3CJ9A 3MWPA 4PHTX 1BG3A 1JJ2M 4BQLA 1UA1A 2A1RA 1VHXA 2NRHA 1NGBA 3E01A 1V4SA 4N76A 2D0CA 3IDHA 3EZWA 1G15A 1JCGA 3RMAA 4DF4A 3NFAA 1RILA 4KI6A 1LWFA 1QQMA 5J2MA 4JHDB 4KHQA 1JCFA 4Z4CA 2X78A 1ILYA 3P5JA 5H1SQ 2P9PA 5J2QA 3ID8A 1BCOA 4HCBA 4CHOA 3SPYA 4K0KK 4FJ9A 1Z26A 4ID5A 3VGMA 3VF2A 1VSMA 1KAYA 4OPAA 4CFBA 4NYFA 1HJRA 4NYNA 1VSKA 3TARA 3V4IA 2BE2A 1U4BA 2OPRA 1JLQA 1T6DA 3OBWA 4JKHA 1Q18A 1SZ2A 4CK2A 1LOTB 3A5OC 4CGHA 4HVJA 3WQUA 3ENOA 1XHXA 4AF1A 2P9LB 4FWMA 1HNXK 4DCHA 1S6PA 5DM7L 3FZKA 3OYGA 4DSLA 1LWEA 3LP2A 3DLEA 4E0DA 3JSMA 3BUZB 2FSKA 1WSEA 4E1JA 2GWKA 3UKUA 1SKSA 1NGHA 4IFEA 3KK1A 4KO0A 3J7AP 3DLGA 1NGFA 4BRNA 3NH0A 4KAZA 3J8AA 2R7YA 3ULEB 4E7IA 3WUHA 3CF5L 3FZMA 1YTUA 3WXIA 3C6TA 2VGMA 1HYSA 5C2DA 1CZBA 3SUNA 1SL0A 2D5RA 4NCBA 2PYLA 2YNGA 5GAHP 5DM6L 2YKMA 2YJFA 4JKGA 3LAKA 2G8HA 1ZBUA 3O3HA 2W40A 1B92A 1VRUA 4RCHA 5AQNA 4B1VA 1D5AA 5EY4A 2G8IA 4DR3K 3TAGA 3Q7BA 3FE1A 3CCQN 3D2EA 4IFYA 4I6MA 3AA4A 4ICLA 3VQ4A 3I55N 4KI4A 1BQMA 3R3LA 2HW3A 2IDOA 3K0SA 3DYAA 5AQWA 4MO4A 3L8BA 4DR1K 4QAGA 4BWJA 5ADXH 3MEDA 4PY5A 4BREA 3HTVA 1U04A 3F9MA 3V9WA 2CH5A 2HB5A 5AQQA 1WAJA 1HKBA 2Z1IA 4CBUA 3M1FA 5EX5A 1IG8A 5KGWA 4FLZA 1MDUB 3MEEA 3AVFA 3V1OA 3ZYYX 4OVLA 1UAXA 2D4WA 4FZYA 1S9GA 3ID6A 1HX1A 4DU1A 1KLMA 3ISNC 1WSHA 2I7NA 3RSEA 2OCEA 1NJIO 5IWAK 2YHAA 4CZEA 1M1KO 2NRVA 1NM1A 3FZLA 4FWKA 4YOWA 4CFCA 1T7PA 2HMPA 2G8KA 1BI4A 3VQPA 4A57A 3SQ0A 3OVNA 4CHQA 3LALA 4O44A 2AA4A 4BRHA 1ZYQA 4JI4K 2O8FB 4JK7A 4NLBA 3WQTA 5JMVA 2ZJRL 3TTFA 1Q86O 4B3SK 4DKWA 4BG8A 3THVA 5AQMA 3PX6A 1C1AA 1VSEA 4DU3A 4JI5K 4CF1A 4YFUA 4CJUA 5M1PA 3QINA 4MLHA 1YJ9N 3Q7CA 2ZGYA 1RDCA 4B3MK 1NK8A 2VG7A 5JICA 4UQGA 2X6SA 5BPLA 1ZBIA 5CZ1A 1RCHA 2P5GA 3KWIA 3ZX2A 2P9NB 4FW1A 3A2FA 1XMOK 1WSJA 2NRZA 4OO1J 1P90A 3CQYA 3JAMO 5HBMA 5BPNA 3OYHA 4JRPA 1GOAA 2O4IA 1C0MA 3QFPA 4IWVA 1RTDA 4HCCA 4U67L 5GAEP 3FFIA 3BF1A 4YHHK 4IJAA 4CCHA 4H03B 3PX4A 1K9MO 1TAUA 3C0BA 4JKBA 3CCLN 4E1NA 3L4QA 4MFBA 2G8WA 4WFNL 1SKRA 1RT5A 2YHWA 3G6EN 2GUIA 1JKHA 3MCAB 3HBTA 3MN9A 2VQFK 3HPOA 1YTAA 1HNVA 2NZTA 4C8MA 4BGAA 4CBWA 4BR0A 5BN8A 2A1SA 2E20A 4RW8A 2Z1GA 3NGZA 1T03A 4IG0A 2BTFA 4IO8A 1VQPN 1KD1O 1OH6A 2QWNA 3CCMN 4FJKA 4DTRA 2GBZA 4AHRA 5HRNA 2EHGA 1A5XA 2CH6A 3OJSA 4DR5K 1YITN 3J7ZO 2GV9A 3E9LA 4B9NA 1DGKN 1EXQA 2RHKA 1C1CA 4Y0WA 3SNNA 1M90O 3TTDA 3K5MA 3ZCMA 1J6ZA 5AQGA 3CFOA 4O0IA 4E3SA 4JLHA 3DLKA 2Y1JA 3VENA 2VWBA 5LY3A 3LANA 3UKUB 4I2PA 3UKRA 2E2OA 4N41A 2P9KA 3NF9A 3EO3A 3W0LA 4FJGA 4FJ8A 3O9RA 2ZJPL 1U2VA 5A2QO 5HL7L 4IEIA 2YHXA 3NVMA 4B1UB 3OYAA 3OYMA 3ZX0A 2JGUA 1SQKA 2F7TA 2X74A 1U45A 1NGDA 1X9MA 1CXQA 1JLBA 3HSTB 4LSLA 4OGEA 2HBKA 4FLWA 2QKBA 1NK0A 3PUFA 5EVZA 1U49A 4JEPA 4B9UA 2YV0X 3JYTA 5E41A 1VSHA 5AQIA 2ITMA 3JXUA 4L8RB 3O1WA 1VAZA 5AQKA 3SCXA 1YVNA 5E26A 1VSLA 4LF4K 2YCHA 3ZSXA 4EHTA 3CQXA 3ZSOA 3HOSA 1YJWN 4X64K 4CE9A 4EHUA 4CGGA 1RBVA 3AVAA 3WXLA 3U3YA 3O3FA 3S41A 5GADP 2F8SA 4H0VB 2OPPA 2GUPA 1SV5A 3AVNA 3OYEA 3DOLA 3TAFA 4DSFA 2B5JA 4ID1A 4RW9A 4AHUA 2UUCK 4OPJA 3G0ZA 3OYKA 1RBSA 4CJRA 1K8KA 2P51A 4FWSA 3PLAA 1L3SA 4BR5A 3DLRA 3ZSVA 5KQ8A 1HQEA 3QO9A 4HWIA 5ADXA 3H3NO 3PO4A 4FXDA 4LF5K 5C10A 2VWJA 2WTUA 1W97L 4WCEL 4HUEA 4W5QA 3ZSRA 2YHYA 3EKSA 3F2KA 1BWFO 1B9DA 2DY4A 3H45C 4E1MA 4C8LA 1T3VA 4BR2A 4KHYA 2D1KA 5AJ3K 3VEYA 3CCRN 4WQ5A 3C7NA 1TL1A 3DAWA 1N6QA 4LFCK 3WNFA 1C0TA 3CC2N 3C65A 4CEDA 1W7AA 3C7NB 3HK2A 4OPKA 2VG6A 4NLCA 4E19A 3I0RA 1VRTA 1D9FA 4DV7K 3QNOA 1KXPA 3A8YA 3O6WA 4LFAK 4H0XB 3AGRA 4KTZA 4K41A 3ZT0A 4IEEA 3OYDA 1RFQA 1WOQA 1U6ZA 3MK6A 1RDUA 3LM9A 3CETA 5AQFA 4F3OA 3RMBA 3SLCA 4WYBA 4H4OA 3VTHA 4B1YB 1IO2A 1RT4A 3D2EB 3T1YK 2UXBK 4IBNA 1WSFA 4XH4A 2QA4N 1GOCA 3P31A 4FM0A 1SKWA 5M1QA 4JS5A 3PSFA 2E6MA 4B1XB 3EEQA 4AHSA 4DFKA 4IDKA 3VEZA 3TAEA 1L3UA 1YJNN 1BCMA 2NUBA 5C2FA 3VOVA 3KLFA 1IBKK 3TWHA 1CZ9A 3K58A 3CCSN 4N47A 3LPTA 1JL2A 1YI2N 3IG1A 5AQVA 2YJEA 3ENHA 3O5BA 2A40A 2DPNA 1HNZK 3F73A 3LPUA 3I8DA 4OGCA 3SUOA 4JI6K 4LD0A 4Y1CA 4OKEA 3EYZA 3EY1A 3M8RA 1GLEG 4W5NA 3LAMA 5C12A 4AHVA 3DXMA 3NVKA 3P1GA 3U3GA 4R5PA 3BGRA 3SBGA 4FK2A 3AO1A 1CLQA 4YDUC 1BI4B 3ASMA 1HKCA 3L2RA 4OPHA 3THWA 4LF8K 2NNWA 4I2QA 5AQSA 3THWB 5AZJA 3QEPA 2IVOA 3AO2A 3V1QA 1NKEA 3ZSQA 5FPNA 2DFEA 5AQPA 5LJWA 4E89A 3RMDA 5HRPA 5AZJB 1ASUA 1DLOA 3SQ2A 2OYQA 1L3TA 3W3DA 3C95A 4QS8A 3TSQA 4HHTA 3TANA 4FJJA 2I5JA 1HPMA 2A41A 2UUAK 3WXKA 1U2VB 3LM2A 4GV3A 4GV9A 4FK0A 3H3OB 4QS9A 4FLYA 1X3MA 2ZE2A 1QSLA 5M1NA 1NK5A 4CJKA 1LW0A 4DSKA 1SL2A 2PAVA 4OX9K 4B9MA 5C25A 1P8ZA 4RW4A 1NGAA 5F1XA 2KHOA 4FJ5A 1TK0A 1OKJA 3MEGA 4Z94A 5FPEA 2BANA 1N36K 2KQ2A 3K57A 2A6AA 2XY5A 4QCLA 3MMVA 3HXMA 1TL3A 4CEFA 4KRFA 3V81A 4PKGA 4C23A 2ZJQL 4CJQA 1WBDA 2X6NA 3S3OA 1BIZA 2XY7A 1C1BA 1Y64A 1MA9B 1BDGA 2P9PB 4CHNA 4WF9L 5KGXA 2FBVA 4W5TA 2QTDA 2B4JA 3CM5A 3SUPA 4DSEA 2FBTA 1VQLN 3TU5A 1BO5O 3O4QA 5T7BA 5K14A 4F2SA 4LH5A 5AQRA 1RTJA 5M1KA 3ZEUB 3LP0A 4DSIA 2OTJN 1XC9A 3AA3A 1T05A 3AO4A 3L2VA 4JD2A 3CPWM 1A5VA 4Z4IA 2EWSA 3VF6A 1VQKN 3SAFA 3DM2A 4BRLA 4IKFA 4ELVA 1HJOA 4FWLA 1RT1A 4DV0K 1ITGA 4CF9A 4FVUA 3C6HA 2P9IA 2W6LA 4CJTA 3CC4N 4PKHA 4CD1A 1K6YA 3CMEN 2PZSA 4AH9A 1X9SA 3V9SA 2G8FA 1RDBA 1NMNA 4BR7A 4FJNA 2RKIA 4X66K 3WXMB 3A0IX 4JI8K 4LF9K 5C0YA 5GIOA 4Z4GA 4LF6K 4CJWA 3AVJA 4DS4A 1OVYA 3K2PA 3RTVA 3MECA 1KFSA 2P9KB 5MLCQ 3N4QA 2FC0A 3ULEA 5BR8K 4YOXA 4KB0A 1OH7A 1EO1A 4DTMA 4JYAK 2BDPA 2QWOA 2E2PA 2QM1A 3V1RA 4KTQA 1HMVA 5EOYA 1KVCA 1KSPA 4NO7A 2FBXA 2YNFA 4PKIA 4I6MB 4FWRA 1E4FT 1S3XA 4H4MA 2CGJA 2Q36A 4FW2A 4V19S 4CF8A 4FPBA 2YNHA 4DQ8A 1EX4A 3ZETA 4IOXA 4CZIA 4H0TB 1TKZA 3SPZA 1WNSA 1RDAA 5AQXA 2KLAA 3QIPA 2HBLA 1Q82O 4I9QA 4FJLA 2D0PA 4H5WA 4PUOA 1K8KB 1RBUA 4EAHD 5I3UA 5I9EB 1NK7A 4AHCA 3OYNA 1QVGM 3EL2A 2O8EB 3I8BA 3R9PA 1IG9A 1NOZA 5FDLA 3QEXA 5GINA 3NH2A 4B9LA 1NLVA 4DTUA 4M3XA 3NH1A 3M8PA 4NCAA 4CEZA 4J2BA 3SUQA 4F8RA 4FM1A 3TR8A 2NLXA 4DTOA 4E7JA 4B9VA 1NG9A 1T6CA 2HHUA 3H1QA 4AQYK 4DG1A 4JKDA 2HBMA 4RG8A 1VQ5N 2E4LA 3ZT4A 5AQHA 2HMIA 1YHQN 2NRRA 1C0UA 3SJHA 1QHTA 4ILJA 4K8ZA 3KHYA 1N34K 3QNNA 3WNGA 3VEXA 3C6UA 1T8EA 1ATSA 1NWKA 1RT7A 3DLLL 4BROA 5JVHL 1JLEA 1XC3A 3VPZA 3T1HK 3FFKB 5JS1A 4FPAA 3VQ7A 3A5MC 1VSDA 3U9DA 1J5EK 3KK7A 1JLCA 5LJVA 3V9ZA 3QETA 3L3UA 4E7LA 2HBJA 3U9ZA 4BY9C 3TTCA 2YKNA 3O80A 4B3TK 2VQEK 3G25A 2O4GA 1WUAA 4XH1A 3IAYA 3DXKB 4ZTJA 4FJIA 3MX2A 3NF6A 1WN7A 2B6AA 1HYZA 1F21A 3ZEUA 3K9JA 2PYJA 4DR4K 3WEEA 1WLJA 3NDKA 3R1XA 1GLAG 3SYZA 4B3OA 2QKKA 1QS4A 3KKRA 4EZ6A 4ISGA 3PO5A 4CHPA 3OYFA 5GAGP 3VGKA 4BC4A 4W5OA 4CEBA 4GV6A 3EKUA 2HSTA 1WAFA 4WFAL 4IXCA 3TSPA 1VQ4N 3CJ1A 3QB0A 3UB5A 4KPYA 1RTHA 3ZT2A 4EP5A 3KK2A 3LDNA 3AGKA 1QTMA 4MDAA 1YIJN 1Q9XA 3WNEA 2VYPA 1LW2A 3VEWA 4CEOA 2QWPA 3C94A 1KRPA 1TK8A 5HLFA 5AQUA 4Z4HA 4G9ZA 4ILGB 1L5UA 1I3AA 4YORA 5CE3A 1SL1A 4IJNA 5AQJA 5JLFA 1VK0A 2OZMA 4BWMA 2OANA 4NCGA 1BIUA 3PY8A 1NGJA 3D45A 5AQZA 3CCUN 4GNIA 2GEMA 1S9EA 2Q0RA 1NNEA 1XNRK 3HPGA 2ATQA 4BDYA 3NCIA 4DWIA 3NF8A 1LAVA 3P39A 2E6LA 2V7YA 3KLGA 3ITHA 4Q0BA 2WONA 2F96A 4NXNK 1NK9A 4FLVA 4CZMA 1C0GA 1TV6A 3CJ7A 4IOAL 4KHSA 1QVFM 2XY6A 3GG4A 1KAXA 4BC5A 5KI6A 5FPDA 5CZ2A 5CYQA 1VSIA 3KK3A 2HF3A 2E1ZA 1DEJA 1Q8IA 1R59O 2P9UA 2QWRA 4M3YA 1DKGD 2HHQA 4KTWA 4N56A 1EETA 3OBYA 3VQCA 1J53A 3H08A 2QWLA 1XWLA 3CFPA 1S1WA 3VA3A 3T69A 3P38A 4C1NK 5CR4A 1NJYA 3KVGA 5J2NA 2KFNA 1EWRA 4F4KA 1ASWA 4FWQA 4DQIA 1FKPA 1NJWA 1J5OA 2E8AA 2UYTA 4DV2K 1ZBSA 2AP1A 5AQOA 4CZJA 1YT3A 5AQLA 3HP6A 1Q7YO 4FOEA 5ELZA 4KHNA 1ZXOA 4CJ3A 4H5TA 1S72N 1RNHA 4TSXA 2GTDA 3UE5A 1EKEA 4CECA 4GW6A 3KZBA 2DFHA 2BH1A 4DTNA 2P1JA 3RRHA 3ATVA 2HNZA 3K5OA 3NGYA 3AO5A 4BRGA 3VERA 1IKYA 3T3FA 3HRGA 3CFRA 4CGIA 2FBYA 1CZAN 3DI6A 3A5NC 3HSCA 4M3UA 4DQQA 2HHVA 3R8EA 4LSNA 3GE1A 4DR6K 1SS6A 5CYMA 3EE8A 2YNIA 3HPHA 2CGKA 4CIFA 3L3VA 3RR8A 2A42A 3SZ2A 1EP4A 3LWLA 4M7YA 4WQ4C 4CJPA 5KRTA 3CG7A 5C15A 3NGIA 4DV5K 1NK4A 2KZMA 3NHGA 4BRPA 1W0HA 4MO5A 3DRPA 4LY7A 3CIPA 4F9OA 4OLAA 5HROA 3T7ZA 2H3GX 3VQBA 3QESA 3J7YP 1KFDA 1RTIA 4FCYA 3OS2A 2WFBA 3HJFA 2JWLA 3I0SA 4B9TA 1XMQK 3M3ZA 3A5LC 2ASPA 3CCEN 2V52B 4DQRA 2HHHK 5HOOA 1OVQA 1KTQA 2FSNA 1XQSC 2ZQBA 3DXKA 3F5TA 4JKCA 2E88A 1EQYA 1X3NA 4FVMA 1SAZA 1HQUA 1MU2A 3QBXA 4DMNA 1WBBA 1K8AO 3MXJA 3HYFA 3FZFA 3SMPA 1RGIA 2IOCA 4CI6A 4O8KA 3ZX3A 5BPMA 3WNHA 4BQZA 3OS0A 3RSEB 5FROA 4CZLA 3H46O 1QQOA 4JV5K 3I33A 1S1TA 4CEEA 4AILC 3THYB 5LMUK 4FSVA 3U8XA 2GX9A 4CJ4A 4J2DA 1K73O 1I94K 4CGDA 3NF7A 1KVAA 1ASVA 1KC8O 4KREA 1REVA 2G8UA 2Z1JA 3LDPA 4Z0UA 3G4SN 1KVBA 2O8FA 3V9UA 1S1XA 4IO9L 1QSYA 3OA9A 3OJUA 3KLIA 3HO1A 4JKEA 3K5NA 2KZZA 1DTQA 4IZ9A 5FPMA 3AAQA 2UXDK 3VEOA 1HNWK 3UIQA 3TI0A 4CIEA 1TYQA 1IBLK 4G1QA 3O8MA 1O1WA 5AQTA 2FLOA 4CD3A 3CCJN 4OKKA 1IH7A 3KD1E 4BRKA 2GWJA 3OTOK 4H0PA 1UWBA 3VN5A 4DV6K 4FJHA 3FZHA 1YAGA 3V9XA 2HNYA 4JN4A 1VSFA 3SMSA 3CHWA 3VGLA 4CFAA 2KW4A 4FWNA 4CIGA 1DTTA 1FKOA 3LP3A 1GLBG 3VETA 3OYJA 4B8AB 2ASOA 3EN9A 4UY8O 1VQNN 2UU9K 3ZT1A 1R0AA 3DRSA 4BRFA 1J9AA 3CQ8A 2O8BB 1NGEA 4DV4K 3LZJA 4DF8A 4CFDA 4C8OA 2DFFA 3PIOL 1HKGA 3B6OA 3S3NA 3MN6A 1GLFO 3S9HA 5LL6Z 2HOEA 4MDBA 1MWMA 1HPZA 3GOIA 4BRMA 5AFUH 1BGXT 5AZIB 2F4VK 3TSUA 1VQ6N 4BR9A 3O9TA 2UUBK 2HHXA 1KAZA 3VQ9A 1GLCG 1HUXA 1Z6RA 4JD2B 3DRRA 3VQDA 1H1VA 2PBDA 5FRNA 4B3RK 2RE2A 1V4TA 5FLXO 4YOTA 4BDZA 5JLHA 2Y1IA 1D9DA 4CVNE 3DOKA 5E84A 4CJSA 3GBTA 4LH4A 4OJRA 4JK8A 4CZHA 2YX6A 2F8TA 1JLFA 1B9FA 1YXQA 4O4GA 3UKRB 4ZHRA 4BACA 4J2AA 5SZTA 3OYCA 4LFBK 3AY9A 1LCUA 3U6FA 2IS3A 4A62A 4DV3K 3CYMA 5AFUA 3CERA 3P4IA 4DU4A 1WSIA 3AVBA 3D7EO 1QZ5A 3MX5A 3VQ8A 3HM9A 4K8XA 4IG3A 3SK3A 3QFUA 1UOCA 4GY2B 3AO3A 2QK9A 3ZSZA 1YF5L 3OHRA 1S1UA 1TUYA 2QI2A 1ATNA 4DFPA 1HR0K 4GMJB 3DJCA 3CJBA 4JI1K 4CJEA 2FXUA 3HT3A 3HOTA 2ZGZA 5DK5A 2O8CB 3M8SA 4CHZA 4BE0A 1QQCA 5KPRA 3F9KA 1S6QA 4DHYA 3CC7N 3HVTA 2RF2A 2Q2RA 4BGBA 1RDWX 3CMAN 4RW7A 3H1VX 1TKDA 4HTUA 2WBNA 4CERA 4PQUA 4WFBL 3AA5X 1GOBA 3ZETB 3HI0A 3AAPA 3OYIA 1NGGA 5JVGL 3B8AX 1QHAA 1W2BM 1YUWA 4DFJA 1LV5A 5IT9O 4KFBA 3R6MA 1TGOA 3MN7A 3CXCM 3MAQA 3QICA 2BUPA 1S1VA 2J4RA 3O9SA 4DUZK 3SJJA 2O8EA 2V51B 3CJCA 4KKOA 4L3QA 4MQ3A 4DSJA 5KRSA 4X62K 4M41A 5TKYA 2CGLA 3QMLA 1BHLA 5F2RA 2QXLA 1MWKA 1NU0A 4CF0A 4MLEA 3QEIA 2KTQA 4PL8A 3IKMA 4ILHA 4CF2A 3E9OA 4JNEA 1OH8A 4CHYA 5BRHA 1IKVA 4YDUA 5I42A 2WOMA 4M63C 1N32K 4A2BA 1BQNA 4FOIA 5AQYA 2OZSA 3V6DA 2JWKA 2P9LA 1NGCA 3VESA 4FLTA 2UXCK 5C42A 4EZ9A 2RN2A 3LWMA 4PWDA 4BR4A 3QEVA 1TKTA 4B1WB 1U48A 5BN9A 4O0JA 3C6AA 3O1BA 2FF6A 4CJ5A 3L6QA 4XH5A 1XI1A 4GKKK 5KPZA 3E9PA 1QZ6A 3AV9A 3QEWA 2O8DA 2QW9A 1VQ8N 1IKXA 1UA0A 4K43A 4RW6A 3ZLJA 2ITGA 5BREA 4FZZA 5DMRA 4LF7K 3HL8A 4CW7B 1LWCA 1Q9YA 4EFHA 2XHBA 4NXMK 1X9JA 4H5VA 1VQON 3VQ5A 4FO0A 3EE9A 4BRAA 2E5LK 3QBWA 2NRWA 1VSJA 4J8FA 3DMJA 4DB3A 1KLNA 2XO7A 1ZC6A 1FXXA 2QXFA 1DT9A 4YOYA 3D2FB 2IAJA 3PX0A 4FJMA 4R79A 4BRDA 3D2FA 3N4PA 4GKJK 3MXMA 3NE6A 4PL7A 2E1YA 4C8NA 3AVLA 2ZM6K 1D4XA 1U47A 4DLGA 4WQ4A 3EZ5A 3SV3A 4XIUA 5EXWA 3D0PA 4Q5VA 4N5SA 2E2NA 5TKWA 2RPIA 5F0XA 4H0OA 3THYA 3G10A 2KFZA 4FLUA 1N8RO 1JXBA 4M3WA 3LDLA 4KHUA 3BY5A 2ASMA 2W41A 3DXMB 4LC9B 3RR7A 2ETJA 4JS4A 4KHPK 3LDQA 3J81O 1ZBHA 3GDQA 4CESA 1NOYA 3CM6A 4E7HA 1TAQA 2LSNA 1N33K 3SAGA 3WXJA 3BZKA 4CK1A 3I56N 4CJ7A 1IKWA 2VG5A 4QS7A 1N5YA 2G8VA 1BUPA 4DQSA 4J2EA 3H6EA 4CK3A 2V7ZA 3P83D 3VQQA 1TYQB 3BZCA 1RBTA 3QERA 1I39A 2IIRA 3HZ6A 3VQAA 3TABA 1KQSM 1HLUA 2ZF5O 4EP4A 4EIAA 3CJAA 3GL1A 4YOVA 4Z4EA 2P9NA 1FW6A 4O5FA 3OYLA 3THXB 4H5NA 2OA8A 2P9SB 1OH5A 4KHWA 4YNQA 3WT0A 4FZXC 5AR0A 3THXA 2FF3B 1ZBFA 4X65K 4FLXA 3M8QA 4BC3A 3ENBA 5SWMA 2O8CA 2VCPA 3OYBA 4B8CA 2O8BA 3VF4A 3OW2M 4AM7A 5HP1A 3B6PA 3BDPA 3L2QA 4ELUA 3SI6A 3IRXA 1BA0A 4ZTFA 3J80O 4ISFA 2IVNA 1BOTO 2GELA 5J1EA 3ZT3A 1T44A 3AVMA 4BRIA 3TAMA 4HUFA 4JHDA 2P5OA 2P9UB 2BGGA 3ATUA 3IS9A 4BRCA 4KB1A 4CJLA 3NBPA 2HVIA 4C8KA 1NBWA 2NRXA 3ZSYA 4B9QA 3PSIA 4IFVA 2JLEA 3LP1A 3WEEB 1QQNA 4BG9A 3QIOA 4JKFA 4M7XA 3AVHA 4FYDA 4M3ZA 2PFUA 3KLHA 1JLGA 3ALYA 2P9IB 2W6KA 3BP8A 4O5BA 3TAPA 1SUQA 3E66A 2HHWA 1D8YA 2HF4A 4I7FA 1ZBLA 1G99A 2HNDA 4BRQA 2HVHA 1NKBA 4ISEA 3T1AA 4DQPA 4KH4A 4OLBA 3VQEA 3IFRA 1IJJA 3VTIA 4FJ7A 5JS2A 1VQ7N 1ATRA 1WB9A 5KQDA 4CGFA 5EU7A 2O8DB 3PIPL 3G71N 3RVCA 4E7KA 1TKXA 1NMDA 2VWKA 3KLEA 4DUYK 1Z25A 2XRIA 1XHZA 3ZSWA 4BE1A 2D0OA 4XEIA 3RMCA 3AVGA 4JI2K 4JKGB 5BRFA 3ULDA 1XUPO 4DTXA 2OPQA 5FRMA 1GLDG
chains in the Genus database with same CATH topology
3VETA 5BPNA 4H0YB 2ASOA 3EN9A 4PKIA 4UY8O 4I6MB 3M6GA 1VQNN 3QFPA 4IWVA 4CZFA 3FLCO 1E4FT 4FWRA 1S3XA 4BRFA 5GAEP 4U67L 2CGJA 2Q36A 3BF1A 2KKZA 4IJAA 1Q81O 3KWGA 4A5BA 4H03B 1NGEA 2E2QA 2Q0UA 1K9MO 3O9UA 3C0BA 4JKBA 3NMUA 3CCLN 4FWPA 3PIOL 1HKGA 3O08A 3MN6A 3L4QA 4FPBA 4DQ8A 4CZKA 3ZETA 4A5AA 1GLFO 4WFNL 2HOEA 2YHWA 4IOXA 4MDBA 4CZIA 3G6EN 1MWMA 4H0TB 3MCAB 3HBTA 3GOIA 3MN9A 4BRMA 5AFUH 1Z05A 5AZIB 3TSUA 1VQ6N 4H5RA 1BA1A 2NZTA 4BGAA 4CBWA 4BR0A 4BR9A 5AQXA 5BN8A 1BU6O 2E20A 2KLAA 3FR0A 1KAZA 3O9TA 1GLCG 1HUXA 1Z6RA 4JD2B 2HBLA 1Q82O 1H1VA 2PBDA 2D0PA 2RE2A 1V4TA 3M5RA 4FL9A 4H5WA 4NB4A 2BTFA 1K8KB 2Q97A 4IO8A 1VQPN 1KD1O 4EAHD 5I9EB 4WQ5C 2QWNA 4C1NI 3CCMN 5M1FA 2WUSA 3O4WA 1GLJO 2CH6A 4YOTA 1QVGM 3EL2A 3I8BA 3MCPA 3R9PA 5JLHA 1YITN 3J7ZO 2NRTA 3FGUA 5E84A 3E9LA 5GINA 1DGKN 1NLVA 2RHKA 3E1YA 3CCVN 3GBTA 2Q1NA 1ESVA 1GLLO 3IMXA 2F9WA 4Y0WA 1C0FA 3CPEA 1M90O 3QDKA 3TTDA 4JK8A 1J6ZA 4KH5A 4O8UA 5AQGA 4A59A 4CBXA 4CZHA 2YX6A 2NLXA 4A61A 3AARA 3VENA 2VWBA 5LY3A 3UKUB 1YXQA 2I7PA 1T6CA 3UKRB 3H1QA 3JS6A 3UKRA 3IUCA 2E2OA 4JKDA 3AY9A 2P9KA 2QWMA 2HBMA 1VQ5N 1LCUA 3HM8A 3LL3A 2WC9A 4HTLA 3CI5A 3VMFB 4A62A 3EO3A 3W0LA 5AQHA 5AFUA 1YHQN 4U7BA 2NRRA 3O9RA 1U2VA 3CERA 3P4IA 5HL7L 2ZJPL 4IEIA 2YHXA 1S22A 1E4GT 3D7EO 3NVMA 3SJHA 4ILJA 1QZ5A 3KHYA 3MX5A 4RTFD 3VEXA 4K42A 3SK3A 4B1UB 3QFUA 4GY2B 3ZX0A 1VQ9N 1SQKA 1ATSA 3L0QA 1NWKA 2F7TA 3VEVA 1VQMN 1NGDA 4IDHA 3MDQA 3DLLL 1YF5L 3OHRA 4JKAA 2A5XA 2HBKA 4BROA 5JVHL 1XC3A 2YI1A 1TUYA 2QI2A 3VPZA 4RWTA 1ATNA 5EVZA 4JEPA 3FFKB 4FPAA 3DJCA 3A5MC 3CJBA 2FXUA 3U9DA 3KK7A 5AQIA 2ITMA 2ZGZA 3JXUA 5LJVA 3HOTA 4IOCL 3O1WA 2HBJA 1VAZA 5AQKA 3U9ZA 1YVNA 4BY9C 5E26A 3TTCA 1NGIA 3K9KA 2YCHA 4EHTA 3CQXA 3O9QA 5BR9A 3O80A 4BVPA 3HOSA 5KPRA 3G25A 4DHYA 1YJWN 3CC7N 4EHUA 1WUAA 2Q2RA 4XH1A 4BGBA 3WXLA 3CD6N 1RDWX 3CMAN 3H1VX 3DXKB 3MN5A 4A2AA 2WBNA 3MX2A 2ZWHA 4WFBL 3ZETB 3S41A 2VGNA 3D6RA 4KBOA 5GADP 2A3ZA 3HI0A 4H0VB 2GUPA 5BRDA 3AAPA 3K9JA 3ZEUA 1NGGA 5CHIA 3B8AX 5JVGL 5AZIA 4JK9A 1O13A 3WEEA 1QHAA 1W2BM 1YUWA 3R1XA 1GLAG 3SBTA 5GIPA 3LDOA 5B8HA 1K8KA 3R6MA 4FWSA 3PLAA 3MN7A 3CXCM 4ISGA 3QICA 4BR5A 2BUPA 3TPQA 5KQ8A 2J4RA 3O9SA 2V51B 3CJCA 4HWIA 5GAGP 3VGKA 5ADXA 4BC4A 3H3NO 4L3QA 4BC2A 5C10A 4GV6A 3EKUA 2HSTA 4KH6A 4WFAL 2QEXN 1W97L 3MWTA 4IXCA 5TKYA 4WCEL 2CGLA 3QMLA 3TSPA 2F9TA 2YHYA 4GVEA 3EKSA 3F2KA 5F2RA 1VQ4N 2QXLA 1BWFO 1MWKA 4MLEA 3H45C 4PL8A 3IKMA 3DWLA 4K25A 3CJ1A 3QB0A 4FWOA 3UB5A 1T3VA 4BR2A 2D1KA 2Q31A 4ILHA 3E9OA 4JNEA 3LDNA 3AGKA 5M1OA 3VEYA 4WQ5A 3C7NA 4MDAA 5BRHA 3DAWA 4YDUA 3CCRN 1YIJN 4YOUA 4M63C 2VYPA 3CC2N 3C65A 4A2BA 4FOIA 3VEWA 5AQYA 2QWPA 4JAXA 3C7NB 2JWKA 2P9LA 1NGCA 5AQUA 4NLCA 3VESA 3SAHA 4G9ZA 3BEXA 4ILGB 3U4LA 4BR4A 1KXPA 3A8YA 4B1WB 5BN9A 3O6WA 3C6AA 3O1BA 2FF6A 4YORA 3L6QA 5CE3A 4B1ZA 4BVOA 4IJNA 4XH5A 5AQJA 5JLFA 4H0XB 4AM6A 5KPZA 3E9PA 3L4IA 1QZ6A 3AGRA 4K41A 2OANA 2QW9A 2QWQA 1VQ8N 4IEEA 2P9SA 1NGJA 4K43A 5AQZA 5BREA 1RFQA 3CCUN 1WOQA 1U6ZA 4GNIA 2Q0RA 2GEMA 5KPTA 3MK6A 1RDUA 2OTLN 3LM9A 1JCEA 3CETA 5AQFA 2IVPA 4EFHA 1X9JA 4WYBA 4H5VA 3SLCA 1VQON 3VTHA 4FO0A 4B1YB 3EE9A 1TUUA 4BRAA 3QBWA 2NRWA 4J8FA 3D2EB 4CZGA 4DB3A 2FSJA 3P39A 4XH4A 3BF3A 3CJ9A 2V7YA 3MWPA 4PHTX 2QA4N 1BG3A 1JJ2M 1ZC6A 3P31A 4BQLA 5M1QA 4CZMA 1C0GA 3CJ7A 2NRHA 1NGBA 1DT9A 4IOAL 4YOYA 3D2FB 1V4SA 1QVFM 4B1XB 3GG4A 1KAXA 4BC5A 4R79A 4BRDA 3D2FA 3IDHA 5FPDA 3EZWA 3VEZA 1JCGA 1YJNN 3N4PA 4PL7A 2HF3A 2E1YA 1QQMA 5C2FA 2E1ZA 4JHDB 3VOVA 1DEJA 1JCFA 1R59O 2P9UA 1ILYA 5H1SQ 2QWRA 2P9PA 1DKGD 1D4XA 3CCSN 3ID8A 4WQ4A 3OBYA 5EXWA 1YI2N 5AQVA 2YJEA 2E2NA 2QWLA 5TKWA 3ENHA 5F0XA 3O5BA 2A40A 4H0OA 3T69A 3P38A 4C1NK 2DPNA 5CR4A 1N8RO 3KVGA 3LDLA 3VGMA 3VF2A 4FWQA 2ASMA 1KAYA 4OPAA 2E8AA 2UYTA 2W41A 3DXMB 1ZBSA 4LC9B 1GLEG 2AP1A 5AQOA 5C12A 4CZJA 5AQLA 1Q7YO 3LDQA 3DXMA 4FOEA 5ELZA 1ZXOA 1S72N 4H5TA 3GDQA 3NVKA 2GTDA 3UE5A 1T6DA 3SBGA 3OBWA 3KZBA 4JKHA 2BH1A 1Q18A 1SZ2A 4YDUC 3SAGA 1HKCA 4OPHA 3WXJA 1LOTB 2NNWA 3A5OC 3ATVA 3I56N 4CJ7A 4BRGA 5AQSA 3VERA 3WQUA 3HRGA 5AZJA 3ENOA 2P9LB 2IVOA 4AF1A 4FWMA 5FPNA 4QS7A 4DCHA 5DM7L 3FZKA 5AQPA 1CZAN 5LJWA 3A5NC 3HSCA 5AZJB 3BUZB 2FSKA 1BUPA 3R8EA 3GE1A 3W3DA 4QS8A 4E1JA 3TSQA 2GWKA 3UKUA 3H6EA 2V7ZA 1NGHA 1TYQB 1SS6A 1HPMA 2A41A 3EE8A 4IFEA 3WXKA 1U2VB 2CGKA 3LM2A 1NGFA 4GV3A 4GV9A 2IIRA 3HZ6A 2A42A 4BRNA 3H3OB 4QS9A 1KQSM 1X3MA 1HLUA 2ZF5O 4M7YA 4WQ4C 5M1NA 4EIAA 3CJAA 3GL1A 4YOVA 5C15A 2P9NA 3J8AA 4O5FA 3ULEB 3WUHA 3CF5L 3FZMA 3WXIA 4BRPA 2VGMA 4H5NA 2PAVA 4MO5A 5C2DA 2P9SB 1P8ZA 3WT0A 5AR0A 5GAHP 3CIPA 1NGAA 4F9OA 5F1XA 2FF3B 2YJFA 4JKGA 5DM6L 2KHOA 3T7ZA 2H3GX 1OKJA 4Z94A 2W40A 5FPEA 4BC3A 3ENBA 4RCHA 5AQNA 2VCPA 5EY4A 4B1VA 3VF4A 3OW2M 2A6AA 2WFBA 3FE1A 3Q7BA 3CCQN 3D2EA 3MMVA 4AM7A 2JWLA 4I6MA 3I55N 3M3ZA 3A5LC 2ASPA 3CCEN 2V52B 3R3LA 1BA0A 4PKGA 5AQWA 4MO4A 4C23A 5HOOA 2ZJQL 2FSNA 5ADXH 1XQSC 3DXKA 4JKCA 3F5TA 3HTVA 4BREA 2E88A 1Y64A 1EQYA 4ISFA 3F9MA 1MA9B 1X3NA 1BDGA 2IVNA 1BOTO 2P9PB 4WF9L 2GELA 2CH5A 2QTDA 5AQQA 1SAZA 1T44A 1HKBA 1VQLN 4BRIA 3M1FA 3QBXA 1BO5O 5EX5A 3TU5A 4CBUA 1IG8A 4JHDA 1K8AO 1MDUB 2P9UB 3ATUA 3FZFA 3SMPA 4BRCA 1RGIA 4CI6A 4O8KA 5AQRA 3ZX3A 3ZYYX 5BPMA 5M1KA 1NBWA 2D4WA 3ZEUB 2NRXA 4BQZA 4B9QA 2OTJN 3RSEB 3ID6A 1HX1A 4CZLA 3H46O 3WEEB 2I7NA 1QQOA 3I33A 3RSEA 1QQNA 4JD2A 4BG9A 4JKFA 4M7XA 4FSVA 3CPWM 1NJIO 2EWSA 3U8XA 2GX9A 3VF6A 4CZEA 1M1KO 1VQKN 3SAFA 2NRVA 4BRLA 1K73O 2PFUA 1NM1A 1HJOA 3FZLA 4FWLA 4FWKA 1KC8O 4YOWA 2P9IB 2HMPA 3BP8A 3LDPA 3G4SN 4FVUA 3C6HA 3E66A 2P9IA 2HF4A 4IO9L 3CC4N 3OA9A 1G99A 4PKHA 4A57A 4CD1A 3CMEN 2AA4A 4BRQA 4JKEA 4BRHA 4ISEA 4IZ9A 5FPMA 3AAQA 3VEOA 4BR7A 4JK7A 4KH4A 4NLBA 3WXMB 3IFRA 3WQTA 5JMVA 2ZJRL 1IJJA 3TTFA 3VTIA 1TYQA 1Q86O 3A0IX 3O8MA 5C0YA 4DKWA 5GIOA 4BG8A 5AQTA 5AQMA 2FLOA 1VQ7N 4CD3A 1ATRA 3CCJN 1OVYA 5KQDA 5M1PA 4MLHA 1YJ9N 3Q7CA 4BRKA 2GWJA 2P9KB 2ZGYA 4H0PA 5MLCQ 3N4QA 3PIPL 3ULEA 5JICA 4YOXA 3FZHA 1EO1A 3G71N 1YAGA 3RVCA 1NMDA 5BPLA 2QWOA 2D0OA 4XEIA 4JN4A 3KWIA 2E2PA 2P9NB 3ZX2A 2QM1A 4JKGB 5BRFA 1XUPO 5EOYA 3SMSA 3CHWA 3VGLA 2NRZA 4FWNA 1P90A 4OO1J 3CQYA 4NO7A 1GLBG 1GLDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1F A;  5C12 A;  5C2D A;  3C6H A;  5C15 A;  5M1O A;  4IEE A;  5M1Q A;  4IDH A;  5M1K A;  4IFE A;  3CPE A;  5M1P A;  5C2F A;  5M1N A;  4IEI A;  3C6A A;  5C10 A; 
#chains in the Genus database with same CATH topology
 1KCF A;  4H0Y B;  4CGJ A;  1TVR A;  4OKJ A;  3M6G A;  4CZF A;  4FJX A;  3SQ1 A;  3FLC O;  1JL1 A;  2KKZ A;  1RT3 A;  1Q81 O;  3L2W A;  3KWG A;  1IBM K;  4A5B A;  4KV8 A;  2E2Q A;  2Q0U A;  4B08 A;  1EWQ A;  3O9U A;  4DR2 K;  3NMU A;  1FJG K;  3QLH A;  4FWP A;  1X9W A;  3O08 A;  4GVM A;  4DV1 K;  1X1P A;  4CZK A;  4DLE A;  4A5A A;  1FK9 A;  3LDS A;  3AVK A;  4DS5 A;  2D0B A;  1Z05 A;  1TK5 A;  1JXE A;  4H5R A;  1BA1 A;  4CEA A;  4B9S A;  4FM2 A;  1BU6 O;  3FR0 A;  5J2P A;  4F2R A;  3M5R A;  4NB4 A;  1A5W A;  4FL9 A;  1S5J A;  2Q97 A;  5HRS A;  3PV8 A;  3MXI A;  4WQ5 C;  4C1N I;  1NKC A;  5M1F A;  1RDD A;  2WUS A;  3O4W A;  1BL3 A;  1GLJ O;  1J54 A;  4Y1D A;  3MCP A;  2Z1H A;  2NRT A;  3FGU A;  3AA2 A;  4M3T A;  3CCV N;  3E1Y A;  2Q1N A;  1ESV A;  1GLL O;  3IMX A;  4CEQ A;  2F9W A;  4BDP A;  4BE2 A;  1C0F A;  3CPE A;  3QDK A;  4CJV A;  4KH5 A;  4O8U A;  4A59 A;  4CBX A;  3VQ6 A;  3KTQ A;  2W42 A;  1RT6 A;  4A61 A;  3AAR A;  2I7P A;  3JS6 A;  1RT2 A;  5C24 A;  3IUC A;  2XY8 A;  2QWM A;  3KIO A;  3KKS A;  3HM8 A;  3LL3 A;  2WC9 A;  4HTL A;  3CI5 A;  3VMF B;  2ZD1 A;  4Z4F A;  1BIS A;  4U7B A;  3OS1 A;  3KJV A;  4JRQ A;  5CY4 A;  1S22 A;  4JI0 K;  1E4G T;  3HVR A;  3O3G A;  4M45 A;  2Q3S A;  4RTF D;  1Y97 A;  3HP9 A;  4K42 A;  3RWU A;  4F3T A;  4M3R A;  2EX3 A;  4O55 A;  1VQ9 N;  3L0Q A;  1QE1 A;  3VEV A;  1VQM N;  1W9H A;  3MDQ A;  4IDH A;  4JKA A;  3TAQ A;  2A5X A;  2HHS A;  1RBR A;  4DFM A;  1L3V A;  2YI1 A;  4PA1 A;  4RWT A;  3O4N A;  3LZI A;  3K5L A;  5D3G A;  1CXU A;  4IOC L;  1NJX A;  4JI3 K;  4AHT A;  1HNI A;  1QSS A;  1NGI A;  3K9K A;  3O9Q A;  5BR9 A;  4BVP A;  4ELT A;  3DLH A;  4JI7 K;  1NK6 A;  4I9L A;  4H8K A;  1HYV A;  3CD6 N;  1JLA A;  2AJQ A;  3DLB A;  1NJZ A;  3MN5 A;  4A2A A;  2ZWH A;  2VGN A;  3D6R A;  4KBO A;  2YHB A;  2A3Z A;  3S3M A;  5BRD A;  4DTJ A;  3NAE A;  5CHI A;  3KD5 E;  5AZI A;  4JK9 A;  1O13 A;  5GIP A;  3SBT A;  3LDO A;  5B8H A;  4DR7 K;  3TPQ A;  3AVI A;  3T19 A;  4BC2 A;  4HUG A;  4KH6 A;  2QEX N;  3MWT A;  3L2U A;  1IV0 A;  2D0A A;  2F9T A;  4GVE A;  2HHT A;  2IC3 A;  5LMN K;  1E3M A;  3SV4 A;  1LAW A;  2DTU A;  3DWL A;  4K25 A;  4FWO A;  5HRR A;  3VA0 A;  4YY3 K;  4WE1 A;  2Q31 A;  5M1O A;  4YOU A;  2OPS A;  4JAX A;  4DTS A;  3SAH A;  3BEX A;  3U4L A;  3AVC A;  4W5R A;  4B1Z A;  4DTP A;  4M42 A;  4BVO A;  4AM6 A;  3L4I A;  2PY5 A;  1YVU A;  4FK4 A;  2IGI A;  2QWQ A;  2P9S A;  5KTQ A;  3RRG A;  3SQ4 A;  3K59 A;  5KPT A;  2OTL N;  1JCE A;  2IVP A;  1TUU A;  4CJF A;  4CZG A;  4QOZ B;  1C6V A;  3OY9 A;  2FSJ A;  1XNQ K;  1HRH A;  1WSG A;  3BF3 A;  3CJ9 A;  3MWP A;  4PHT X;  1BG3 A;  1JJ2 M;  4BQL A;  1UA1 A;  2A1R A;  1VHX A;  2NRH A;  1NGB A;  3E01 A;  1V4S A;  4N76 A;  2D0C A;  3IDH A;  3EZW A;  1G15 A;  1JCG A;  3RMA A;  4DF4 A;  3NFA A;  1RIL A;  4KI6 A;  1LWF A;  1QQM A;  5J2M A;  4JHD B;  4KHQ A;  1JCF A;  4Z4C A;  2X78 A;  1ILY A;  3P5J A;  5H1S Q;  2P9P A;  5J2Q A;  3ID8 A;  1BCO A;  4HCB A;  4CHO A;  3SPY A;  4K0K K;  4FJ9 A;  1Z26 A;  4ID5 A;  3VGM A;  3VF2 A;  1VSM A;  1KAY A;  4OPA A;  4CFB A;  4NYF A;  1HJR A;  4NYN A;  1VSK A;  3TAR A;  3V4I A;  2BE2 A;  1U4B A;  2OPR A;  1JLQ A;  1T6D A;  3OBW A;  4JKH A;  1Q18 A;  1SZ2 A;  4CK2 A;  1LOT B;  3A5O C;  4CGH A;  4HVJ A;  3WQU A;  3ENO A;  1XHX A;  4AF1 A;  2P9L B;  4FWM A;  1HNX K;  4DCH A;  1S6P A;  5DM7 L;  3FZK A;  3OYG A;  4DSL A;  1LWE A;  3LP2 A;  3DLE A;  4E0D A;  3JSM A;  3BUZ B;  2FSK A;  1WSE A;  4E1J A;  2GWK A;  3UKU A;  1SKS A;  1NGH A;  4IFE A;  3KK1 A;  4KO0 A;  3J7A P;  3DLG A;  1NGF A;  4BRN A;  3NH0 A;  4KAZ A;  3J8A A;  2R7Y A;  3ULE B;  4E7I A;  3WUH A;  3CF5 L;  3FZM A;  1YTU A;  3WXI A;  3C6T A;  2VGM A;  1HYS A;  5C2D A;  1CZB A;  3SUN A;  1SL0 A;  2D5R A;  4NCB A;  2PYL A;  2YNG A;  5GAH P;  5DM6 L;  2YKM A;  2YJF A;  4JKG A;  3LAK A;  2G8H A;  1ZBU A;  3O3H A;  2W40 A;  1B92 A;  1VRU A;  4RCH A;  5AQN A;  4B1V A;  1D5A A;  5EY4 A;  2G8I A;  4DR3 K;  3TAG A;  3Q7B A;  3FE1 A;  3CCQ N;  3D2E A;  4IFY A;  4I6M A;  3AA4 A;  4ICL A;  3VQ4 A;  3I55 N;  4KI4 A;  1BQM A;  3R3L A;  2HW3 A;  2IDO A;  3K0S A;  3DYA A;  5AQW A;  4MO4 A;  3L8B A;  4DR1 K;  4QAG A;  4BWJ A;  5ADX H;  3MED A;  4PY5 A;  4BRE A;  3HTV A;  1U04 A;  3F9M A;  3V9W A;  2CH5 A;  2HB5 A;  5AQQ A;  1WAJ A;  1HKB A;  2Z1I A;  4CBU A;  3M1F A;  5EX5 A;  1IG8 A;  5KGW A;  4FLZ A;  1MDU B;  3MEE A;  3AVF A;  3V1O A;  3ZYY X;  4OVL A;  1UAX A;  2D4W A;  4FZY A;  1S9G A;  3ID6 A;  1HX1 A;  4DU1 A;  1KLM A;  3ISN C;  1WSH A;  2I7N A;  3RSE A;  2OCE A;  1NJI O;  5IWA K;  2YHA A;  4CZE A;  1M1K O;  2NRV A;  1NM1 A;  3FZL A;  4FWK A;  4YOW A;  4CFC A;  1T7P A;  2HMP A;  2G8K A;  1BI4 A;  3VQP A;  4A57 A;  3SQ0 A;  3OVN A;  4CHQ A;  3LAL A;  4O44 A;  2AA4 A;  4BRH A;  1ZYQ A;  4JI4 K;  2O8F B;  4JK7 A;  4NLB A;  3WQT A;  5JMV A;  2ZJR L;  3TTF A;  1Q86 O;  4B3S K;  4DKW A;  4BG8 A;  3THV A;  5AQM A;  3PX6 A;  1C1A A;  1VSE A;  4DU3 A;  4JI5 K;  4CF1 A;  4YFU A;  4CJU A;  5M1P A;  3QIN A;  4MLH A;  1YJ9 N;  3Q7C A;  2ZGY A;  1RDC A;  4B3M K;  1NK8 A;  2VG7 A;  5JIC A;  4UQG A;  2X6S A;  5BPL A;  1ZBI A;  5CZ1 A;  1RCH A;  2P5G A;  3KWI A;  3ZX2 A;  2P9N B;  4FW1 A;  3A2F A;  1XMO K;  1WSJ A;  2NRZ A;  4OO1 J;  1P90 A;  3CQY A;  3JAM O;  5HBM A;  5BPN A;  3OYH A;  4JRP A;  1GOA A;  2O4I A;  1C0M A;  3QFP A;  4IWV A;  1RTD A;  4HCC A;  4U67 L;  5GAE P;  3FFI A;  3BF1 A;  4YHH K;  4IJA A;  4CCH A;  4H03 B;  3PX4 A;  1K9M O;  1TAU A;  3C0B A;  4JKB A;  3CCL N;  4E1N A;  3L4Q A;  4MFB A;  2G8W A;  4WFN L;  1SKR A;  1RT5 A;  2YHW A;  3G6E N;  2GUI A;  1JKH A;  3MCA B;  3HBT A;  3MN9 A;  2VQF K;  3HPO A;  1YTA A;  1HNV A;  2NZT A;  4C8M A;  4BGA A;  4CBW A;  4BR0 A;  5BN8 A;  2A1S A;  2E20 A;  4RW8 A;  2Z1G A;  3NGZ A;  1T03 A;  4IG0 A;  2BTF A;  4IO8 A;  1VQP N;  1KD1 O;  1OH6 A;  2QWN A;  3CCM N;  4FJK A;  4DTR A;  2GBZ A;  4AHR A;  5HRN A;  2EHG A;  1A5X A;  2CH6 A;  3OJS A;  4DR5 K;  1YIT N;  3J7Z O;  2GV9 A;  3E9L A;  4B9N A;  1DGK N;  1EXQ A;  2RHK A;  1C1C A;  4Y0W A;  3SNN A;  1M90 O;  3TTD A;  3K5M A;  3ZCM A;  1J6Z A;  5AQG A;  3CFO A;  4O0I A;  4E3S A;  4JLH A;  3DLK A;  2Y1J A;  3VEN A;  2VWB A;  5LY3 A;  3LAN A;  3UKU B;  4I2P A;  3UKR A;  2E2O A;  4N41 A;  2P9K A;  3NF9 A;  3EO3 A;  3W0L A;  4FJG A;  4FJ8 A;  3O9R A;  2ZJP L;  1U2V A;  5A2Q O;  5HL7 L;  4IEI A;  2YHX A;  3NVM A;  4B1U B;  3OYA A;  3OYM A;  3ZX0 A;  2JGU A;  1SQK A;  2F7T A;  2X74 A;  1U45 A;  1NGD A;  1X9M A;  1CXQ A;  1JLB A;  3HST B;  4LSL A;  4OGE A;  2HBK A;  4FLW A;  2QKB A;  1NK0 A;  3PUF A;  5EVZ A;  1U49 A;  4JEP A;  4B9U A;  2YV0 X;  3JYT A;  5E41 A;  1VSH A;  5AQI A;  2ITM A;  3JXU A;  4L8R B;  3O1W A;  1VAZ A;  5AQK A;  3SCX A;  1YVN A;  5E26 A;  1VSL A;  4LF4 K;  2YCH A;  3ZSX A;  4EHT A;  3CQX A;  3ZSO A;  3HOS A;  1YJW N;  4X64 K;  4CE9 A;  4EHU A;  4CGG A;  1RBV A;  3AVA A;  3WXL A;  3U3Y A;  3O3F A;  3S41 A;  5GAD P;  2F8S A;  4H0V B;  2OPP A;  2GUP A;  1SV5 A;  3AVN A;  3OYE A;  3DOL A;  3TAF A;  4DSF A;  2B5J A;  4ID1 A;  4RW9 A;  4AHU A;  2UUC K;  4OPJ A;  3G0Z A;  3OYK A;  1RBS A;  4CJR A;  1K8K A;  2P51 A;  4FWS A;  3PLA A;  1L3S A;  4BR5 A;  3DLR A;  3ZSV A;  5KQ8 A;  1HQE A;  3QO9 A;  4HWI A;  5ADX A;  3H3N O;  3PO4 A;  4FXD A;  4LF5 K;  5C10 A;  2VWJ A;  2WTU A;  1W97 L;  4WCE L;  4HUE A;  4W5Q A;  3ZSR A;  2YHY A;  3EKS A;  3F2K A;  1BWF O;  1B9D A;  2DY4 A;  3H45 C;  4E1M A;  4C8L A;  1T3V A;  4BR2 A;  4KHY A;  2D1K A;  5AJ3 K;  3VEY A;  3CCR N;  4WQ5 A;  3C7N A;  1TL1 A;  3DAW A;  1N6Q A;  4LFC K;  3WNF A;  1C0T A;  3CC2 N;  3C65 A;  4CED A;  1W7A A;  3C7N B;  3HK2 A;  4OPK A;  2VG6 A;  4NLC A;  4E19 A;  3I0R A;  1VRT A;  1D9F A;  4DV7 K;  3QNO A;  1KXP A;  3A8Y A;  3O6W A;  4LFA K;  4H0X B;  3AGR A;  4KTZ A;  4K41 A;  3ZT0 A;  4IEE A;  3OYD A;  1RFQ A;  1WOQ A;  1U6Z A;  3MK6 A;  1RDU A;  3LM9 A;  3CET A;  5AQF A;  4F3O A;  3RMB A;  3SLC A;  4WYB A;  4H4O A;  3VTH A;  4B1Y B;  1IO2 A;  1RT4 A;  3D2E B;  3T1Y K;  2UXB K;  4IBN A;  1WSF A;  4XH4 A;  2QA4 N;  1GOC A;  3P31 A;  4FM0 A;  1SKW A;  5M1Q A;  4JS5 A;  3PSF A;  2E6M A;  4B1X B;  3EEQ A;  4AHS A;  4DFK A;  4IDK A;  3VEZ A;  3TAE A;  1L3U A;  1YJN N;  1BCM A;  2NUB A;  5C2F A;  3VOV A;  3KLF A;  1IBK K;  3TWH A;  1CZ9 A;  3K58 A;  3CCS N;  4N47 A;  3LPT A;  1JL2 A;  1YI2 N;  3IG1 A;  5AQV A;  2YJE A;  3ENH A;  3O5B A;  2A40 A;  2DPN A;  1HNZ K;  3F73 A;  3LPU A;  3I8D A;  4OGC A;  3SUO A;  4JI6 K;  4LD0 A;  4Y1C A;  4OKE A;  3EYZ A;  3EY1 A;  3M8R A;  1GLE G;  4W5N A;  3LAM A;  5C12 A;  4AHV A;  3DXM A;  3NVK A;  3P1G A;  3U3G A;  4R5P A;  3BGR A;  3SBG A;  4FK2 A;  3AO1 A;  1CLQ A;  4YDU C;  1BI4 B;  3ASM A;  1HKC A;  3L2R A;  4OPH A;  3THW A;  4LF8 K;  2NNW A;  4I2Q A;  5AQS A;  3THW B;  5AZJ A;  3QEP A;  2IVO A;  3AO2 A;  3V1Q A;  1NKE A;  3ZSQ A;  5FPN A;  2DFE A;  5AQP A;  5LJW A;  4E89 A;  3RMD A;  5HRP A;  5AZJ B;  1ASU A;  1DLO A;  3SQ2 A;  2OYQ A;  1L3T A;  3W3D A;  3C95 A;  4QS8 A;  3TSQ A;  4HHT A;  3TAN A;  4FJJ A;  2I5J A;  1HPM A;  2A41 A;  2UUA K;  3WXK A;  1U2V B;  3LM2 A;  4GV3 A;  4GV9 A;  4FK0 A;  3H3O B;  4QS9 A;  4FLY A;  1X3M A;  2ZE2 A;  1QSL A;  5M1N A;  1NK5 A;  4CJK A;  1LW0 A;  4DSK A;  1SL2 A;  2PAV A;  4OX9 K;  4B9M A;  5C25 A;  1P8Z A;  4RW4 A;  1NGA A;  5F1X A;  2KHO A;  4FJ5 A;  1TK0 A;  1OKJ A;  3MEG A;  4Z94 A;  5FPE A;  2BAN A;  1N36 K;  2KQ2 A;  3K57 A;  2A6A A;  2XY5 A;  4QCL A;  3MMV A;  3HXM A;  1TL3 A;  4CEF A;  4KRF A;  3V81 A;  4PKG A;  4C23 A;  2ZJQ L;  4CJQ A;  1WBD A;  2X6N A;  3S3O A;  1BIZ A;  2XY7 A;  1C1B A;  1Y64 A;  1MA9 B;  1BDG A;  2P9P B;  4CHN A;  4WF9 L;  5KGX A;  2FBV A;  4W5T A;  2QTD A;  2B4J A;  3CM5 A;  3SUP A;  4DSE A;  2FBT A;  1VQL N;  3TU5 A;  1BO5 O;  3O4Q A;  5T7B A;  5K14 A;  4F2S A;  4LH5 A;  5AQR A;  1RTJ A;  5M1K A;  3ZEU B;  3LP0 A;  4DSI A;  2OTJ N;  1XC9 A;  3AA3 A;  1T05 A;  3AO4 A;  3L2V A;  4JD2 A;  3CPW M;  1A5V A;  4Z4I A;  2EWS A;  3VF6 A;  1VQK N;  3SAF A;  3DM2 A;  4BRL A;  4IKF A;  4ELV A;  1HJO A;  4FWL A;  1RT1 A;  4DV0 K;  1ITG A;  4CF9 A;  4FVU A;  3C6H A;  2P9I A;  2W6L A;  4CJT A;  3CC4 N;  4PKH A;  4CD1 A;  1K6Y A;  3CME N;  2PZS A;  4AH9 A;  1X9S A;  3V9S A;  2G8F A;  1RDB A;  1NMN A;  4BR7 A;  4FJN A;  2RKI A;  4X66 K;  3WXM B;  3A0I X;  4JI8 K;  4LF9 K;  5C0Y A;  5GIO A;  4Z4G A;  4LF6 K;  4CJW A;  3AVJ A;  4DS4 A;  1OVY A;  3K2P A;  3RTV A;  3MEC A;  1KFS A;  2P9K B;  5MLC Q;  3N4Q A;  2FC0 A;  3ULE A;  5BR8 K;  4YOX A;  4KB0 A;  1OH7 A;  1EO1 A;  4DTM A;  4JYA K;  2BDP A;  2QWO A;  2E2P A;  2QM1 A;  3V1R A;  4KTQ A;  1HMV A;  5EOY A;  1KVC A;  1KSP A;  4NO7 A;  2FBX A;  2YNF A;  4PKI A;  4I6M B;  4FWR A;  1E4F T;  1S3X A;  4H4M A;  2CGJ A;  2Q36 A;  4FW2 A;  4V19 S;  4CF8 A;  4FPB A;  2YNH A;  4DQ8 A;  1EX4 A;  3ZET A;  4IOX A;  4CZI A;  4H0T B;  1TKZ A;  3SPZ A;  1WNS A;  1RDA A;  5AQX A;  2KLA A;  3QIP A;  2HBL A;  1Q82 O;  4I9Q A;  4FJL A;  2D0P A;  4H5W A;  4PUO A;  1K8K B;  1RBU A;  4EAH D;  5I3U A;  5I9E B;  1NK7 A;  4AHC A;  3OYN A;  1QVG M;  3EL2 A;  2O8E B;  3I8B A;  3R9P A;  1IG9 A;  1NOZ A;  5FDL A;  3QEX A;  5GIN A;  3NH2 A;  4B9L A;  1NLV A;  4DTU A;  4M3X A;  3NH1 A;  3M8P A;  4NCA A;  4CEZ A;  4J2B A;  3SUQ A;  4F8R A;  4FM1 A;  3TR8 A;  2NLX A;  4DTO A;  4E7J A;  4B9V A;  1NG9 A;  1T6C A;  2HHU A;  3H1Q A;  4AQY K;  4DG1 A;  4JKD A;  2HBM A;  4RG8 A;  1VQ5 N;  2E4L A;  3ZT4 A;  5AQH A;  2HMI A;  1YHQ N;  2NRR A;  1C0U A;  3SJH A;  1QHT A;  4ILJ A;  4K8Z A;  3KHY A;  1N34 K;  3QNN A;  3WNG A;  3VEX A;  3C6U A;  1T8E A;  1ATS A;  1NWK A;  1RT7 A;  3DLL L;  4BRO A;  5JVH L;  1JLE A;  1XC3 A;  3VPZ A;  3T1H K;  3FFK B;  5JS1 A;  4FPA A;  3VQ7 A;  3A5M C;  1VSD A;  3U9D A;  1J5E K;  3KK7 A;  1JLC A;  5LJV A;  3V9Z A;  3QET A;  3L3U A;  4E7L A;  2HBJ A;  3U9Z A;  4BY9 C;  3TTC A;  2YKN A;  3O80 A;  4B3T K;  2VQE K;  3G25 A;  2O4G A;  1WUA A;  4XH1 A;  3IAY A;  3DXK B;  4ZTJ A;  4FJI A;  3MX2 A;  3NF6 A;  1WN7 A;  2B6A A;  1HYZ A;  1F21 A;  3ZEU A;  3K9J A;  2PYJ A;  4DR4 K;  3WEE A;  1WLJ A;  3NDK A;  3R1X A;  1GLA G;  3SYZ A;  4B3O A;  2QKK A;  1QS4 A;  3KKR A;  4EZ6 A;  4ISG A;  3PO5 A;  4CHP A;  3OYF A;  5GAG P;  3VGK A;  4BC4 A;  4W5O A;  4CEB A;  4GV6 A;  3EKU A;  2HST A;  1WAF A;  4WFA L;  4IXC A;  3TSP A;  1VQ4 N;  3CJ1 A;  3QB0 A;  3UB5 A;  4KPY A;  1RTH A;  3ZT2 A;  4EP5 A;  3KK2 A;  3LDN A;  3AGK A;  1QTM A;  4MDA A;  1YIJ N;  1Q9X A;  3WNE A;  2VYP A;  1LW2 A;  3VEW A;  4CEO A;  2QWP A;  3C94 A;  1KRP A;  1TK8 A;  5HLF A;  5AQU A;  4Z4H A;  4G9Z A;  4ILG B;  1L5U A;  1I3A A;  4YOR A;  5CE3 A;  1SL1 A;  4IJN A;  5AQJ A;  5JLF A;  1VK0 A;  2OZM A;  4BWM A;  2OAN A;  4NCG A;  1BIU A;  3PY8 A;  1NGJ A;  3D45 A;  5AQZ A;  3CCU N;  4GNI A;  2GEM A;  1S9E A;  2Q0R A;  1NNE A;  1XNR K;  3HPG A;  2ATQ A;  4BDY A;  3NCI A;  4DWI A;  3NF8 A;  1LAV A;  3P39 A;  2E6L A;  2V7Y A;  3KLG A;  3ITH A;  4Q0B A;  2WON A;  2F96 A;  4NXN K;  1NK9 A;  4FLV A;  4CZM A;  1C0G A;  1TV6 A;  3CJ7 A;  4IOA L;  4KHS A;  1QVF M;  2XY6 A;  3GG4 A;  1KAX A;  4BC5 A;  5KI6 A;  5FPD A;  5CZ2 A;  5CYQ A;  1VSI A;  3KK3 A;  2HF3 A;  2E1Z A;  1DEJ A;  1Q8I A;  1R59 O;  2P9U A;  2QWR A;  4M3Y A;  1DKG D;  2HHQ A;  4KTW A;  4N56 A;  1EET A;  3OBY A;  3VQC A;  1J53 A;  3H08 A;  2QWL A;  1XWL A;  3CFP A;  1S1W A;  3VA3 A;  3T69 A;  3P38 A;  4C1N K;  5CR4 A;  1NJY A;  3KVG A;  5J2N A;  2KFN A;  1EWR A;  4F4K A;  1ASW A;  4FWQ A;  4DQI A;  1FKP A;  1NJW A;  1J5O A;  2E8A A;  2UYT A;  4DV2 K;  1ZBS A;  2AP1 A;  5AQO A;  4CZJ A;  1YT3 A;  5AQL A;  3HP6 A;  1Q7Y O;  4FOE A;  5ELZ A;  4KHN A;  1ZXO A;  4CJ3 A;  4H5T A;  1S72 N;  1RNH A;  4TSX A;  2GTD A;  3UE5 A;  1EKE A;  4CEC A;  4GW6 A;  3KZB A;  2DFH A;  2BH1 A;  4DTN A;  2P1J A;  3RRH A;  3ATV A;  2HNZ A;  3K5O A;  3NGY A;  3AO5 A;  4BRG A;  3VER A;  1IKY A;  3T3F A;  3HRG A;  3CFR A;  4CGI A;  2FBY A;  1CZA N;  3DI6 A;  3A5N C;  3HSC A;  4M3U A;  4DQQ A;  2HHV A;  3R8E A;  4LSN A;  3GE1 A;  4DR6 K;  1SS6 A;  5CYM A;  3EE8 A;  2YNI A;  3HPH A;  2CGK A;  4CIF A;  3L3V A;  3RR8 A;  2A42 A;  3SZ2 A;  1EP4 A;  3LWL A;  4M7Y A;  4WQ4 C;  4CJP A;  5KRT A;  3CG7 A;  5C15 A;  3NGI A;  4DV5 K;  1NK4 A;  2KZM A;  3NHG A;  4BRP A;  1W0H A;  4MO5 A;  3DRP A;  4LY7 A;  3CIP A;  4F9O A;  4OLA A;  5HRO A;  3T7Z A;  2H3G X;  3VQB A;  3QES A;  3J7Y P;  1KFD A;  1RTI A;  4FCY A;  3OS2 A;  2WFB A;  3HJF A;  2JWL A;  3I0S A;  4B9T A;  1XMQ K;  3M3Z A;  3A5L C;  2ASP A;  3CCE N;  2V52 B;  4DQR A;  2HHH K;  5HOO A;  1OVQ A;  1KTQ A;  2FSN A;  1XQS C;  2ZQB A;  3DXK A;  3F5T A;  4JKC A;  2E88 A;  1EQY A;  1X3N A;  4FVM A;  1SAZ A;  1HQU A;  1MU2 A;  3QBX A;  4DMN A;  1WBB A;  1K8A O;  3MXJ A;  3HYF A;  3FZF A;  3SMP A;  1RGI A;  2IOC A;  4CI6 A;  4O8K A;  3ZX3 A;  5BPM A;  3WNH A;  4BQZ A;  3OS0 A;  3RSE B;  5FRO A;  4CZL A;  3H46 O;  1QQO A;  4JV5 K;  3I33 A;  1S1T A;  4CEE A;  4AIL C;  3THY B;  5LMU K;  4FSV A;  3U8X A;  2GX9 A;  4CJ4 A;  4J2D A;  1K73 O;  1I94 K;  4CGD A;  3NF7 A;  1KVA A;  1ASV A;  1KC8 O;  4KRE A;  1REV A;  2G8U A;  2Z1J A;  3LDP A;  4Z0U A;  3G4S N;  1KVB A;  2O8F A;  3V9U A;  1S1X A;  4IO9 L;  1QSY A;  3OA9 A;  3OJU A;  3KLI A;  3HO1 A;  4JKE A;  3K5N A;  2KZZ A;  1DTQ A;  4IZ9 A;  5FPM A;  3AAQ A;  2UXD K;  3VEO A;  1HNW K;  3UIQ A;  3TI0 A;  4CIE A;  1TYQ A;  1IBL K;  4G1Q A;  3O8M A;  1O1W A;  5AQT A;  2FLO A;  4CD3 A;  3CCJ N;  4OKK A;  1IH7 A;  3KD1 E;  4BRK A;  2GWJ A;  3OTO K;  4H0P A;  1UWB A;  3VN5 A;  4DV6 K;  4FJH A;  3FZH A;  1YAG A;  3V9X A;  2HNY A;  4JN4 A;  1VSF A;  3SMS A;  3CHW A;  3VGL A;  4CFA A;  2KW4 A;  4FWN A;  4CIG A;  1DTT A;  1FKO A;  3LP3 A;  1GLB G;  3VET A;  3OYJ A;  4B8A B;  2ASO A;  3EN9 A;  4UY8 O;  1VQN N;  2UU9 K;  3ZT1 A;  1R0A A;  3DRS A;  4BRF A;  1J9A A;  3CQ8 A;  2O8B B;  1NGE A;  4DV4 K;  3LZJ A;  4DF8 A;  4CFD A;  4C8O A;  2DFF A;  3PIO L;  1HKG A;  3B6O A;  3S3N A;  3MN6 A;  1GLF O;  3S9H A;  5LL6 Z;  2HOE A;  4MDB A;  1MWM A;  1HPZ A;  3GOI A;  4BRM A;  5AFU H;  1BGX T;  5AZI B;  2F4V K;  3TSU A;  1VQ6 N;  4BR9 A;  3O9T A;  2UUB K;  2HHX A;  1KAZ A;  3VQ9 A;  1GLC G;  1HUX A;  1Z6R A;  4JD2 B;  3DRR A;  3VQD A;  1H1V A;  2PBD A;  5FRN A;  4B3R K;  2RE2 A;  1V4T A;  5FLX O;  4YOT A;  4BDZ A;  5JLH A;  2Y1I A;  1D9D A;  4CVN E;  3DOK A;  5E84 A;  4CJS A;  3GBT A;  4LH4 A;  4OJR A;  4JK8 A;  4CZH A;  2YX6 A;  2F8T A;  1JLF A;  1B9F A;  1YXQ A;  4O4G A;  3UKR B;  4ZHR A;  4BAC A;  4J2A A;  5SZT A;  3OYC A;  4LFB K;  3AY9 A;  1LCU A;  3U6F A;  2IS3 A;  4A62 A;  4DV3 K;  3CYM A;  5AFU A;  3CER A;  3P4I A;  4DU4 A;  1WSI A;  3AVB A;  3D7E O;  1QZ5 A;  3MX5 A;  3VQ8 A;  3HM9 A;  4K8X A;  4IG3 A;  3SK3 A;  3QFU A;  1UOC A;  4GY2 B;  3AO3 A;  2QK9 A;  3ZSZ A;  1YF5 L;  3OHR A;  1S1U A;  1TUY A;  2QI2 A;  1ATN A;  4DFP A;  1HR0 K;  4GMJ B;  3DJC A;  3CJB A;  4JI1 K;  4CJE A;  2FXU A;  3HT3 A;  3HOT A;  2ZGZ A;  5DK5 A;  2O8C B;  3M8S A;  4CHZ A;  4BE0 A;  1QQC A;  5KPR A;  3F9K A;  1S6Q A;  4DHY A;  3CC7 N;  3HVT A;  2RF2 A;  2Q2R A;  4BGB A;  1RDW X;  3CMA N;  4RW7 A;  3H1V X;  1TKD A;  4HTU A;  2WBN A;  4CER A;  4PQU A;  4WFB L;  3AA5 X;  1GOB A;  3ZET B;  3HI0 A;  3AAP A;  3OYI A;  1NGG A;  5JVG L;  3B8A X;  1QHA A;  1W2B M;  1YUW A;  4DFJ A;  1LV5 A;  5IT9 O;  4KFB A;  3R6M A;  1TGO A;  3MN7 A;  3CXC M;  3MAQ A;  3QIC A;  2BUP A;  1S1V A;  2J4R A;  3O9S A;  4DUZ K;  3SJJ A;  2O8E A;  2V51 B;  3CJC A;  4KKO A;  4L3Q A;  4MQ3 A;  4DSJ A;  5KRS A;  4X62 K;  4M41 A;  5TKY A;  2CGL A;  3QML A;  1BHL A;  5F2R A;  2QXL A;  1MWK A;  1NU0 A;  4CF0 A;  4MLE A;  3QEI A;  2KTQ A;  4PL8 A;  3IKM A;  4ILH A;  4CF2 A;  3E9O A;  4JNE A;  1OH8 A;  4CHY A;  5BRH A;  1IKV A;  4YDU A;  5I42 A;  2WOM A;  4M63 C;  1N32 K;  4A2B A;  1BQN A;  4FOI A;  5AQY A;  2OZS A;  3V6D A;  2JWK A;  2P9L A;  1NGC A;  3VES A;  4FLT A;  2UXC K;  5C42 A;  4EZ9 A;  2RN2 A;  3LWM A;  4PWD A;  4BR4 A;  3QEV A;  1TKT A;  4B1W B;  1U48 A;  5BN9 A;  4O0J A;  3C6A A;  3O1B A;  2FF6 A;  4CJ5 A;  3L6Q A;  4XH5 A;  1XI1 A;  4GKK K;  5KPZ A;  3E9P A;  1QZ6 A;  3AV9 A;  3QEW A;  2O8D A;  2QW9 A;  1VQ8 N;  1IKX A;  1UA0 A;  4K43 A;  4RW6 A;  3ZLJ A;  2ITG A;  5BRE A;  4FZZ A;  5DMR A;  4LF7 K;  3HL8 A;  4CW7 B;  1LWC A;  1Q9Y A;  4EFH A;  2XHB A;  4NXM K;  1X9J A;  4H5V A;  1VQO N;  3VQ5 A;  4FO0 A;  3EE9 A;  4BRA A;  2E5L K;  3QBW A;  2NRW A;  1VSJ A;  4J8F A;  3DMJ A;  4DB3 A;  1KLN A;  2XO7 A;  1ZC6 A;  1FXX A;  2QXF A;  1DT9 A;  4YOY A;  3D2F B;  2IAJ A;  3PX0 A;  4FJM A;  4R79 A;  4BRD A;  3D2F A;  3N4P A;  4GKJ K;  3MXM A;  3NE6 A;  4PL7 A;  2E1Y A;  4C8N A;  3AVL A;  2ZM6 K;  1D4X A;  1U47 A;  4DLG A;  4WQ4 A;  3EZ5 A;  3SV3 A;  4XIU A;  5EXW A;  3D0P A;  4Q5V A;  4N5S A;  2E2N A;  5TKW A;  2RPI A;  5F0X A;  4H0O A;  3THY A;  3G10 A;  2KFZ A;  4FLU A;  1N8R O;  1JXB A;  4M3W A;  3LDL A;  4KHU A;  3BY5 A;  2ASM A;  2W41 A;  3DXM B;  4LC9 B;  3RR7 A;  2ETJ A;  4JS4 A;  4KHP K;  3LDQ A;  3J81 O;  1ZBH A;  3GDQ A;  4CES A;  1NOY A;  3CM6 A;  4E7H A;  1TAQ A;  2LSN A;  1N33 K;  3SAG A;  3WXJ A;  3BZK A;  4CK1 A;  3I56 N;  4CJ7 A;  1IKW A;  2VG5 A;  4QS7 A;  1N5Y A;  2G8V A;  1BUP A;  4DQS A;  4J2E A;  3H6E A;  4CK3 A;  2V7Z A;  3P83 D;  3VQQ A;  1TYQ B;  3BZC A;  1RBT A;  3QER A;  1I39 A;  2IIR A;  3HZ6 A;  3VQA A;  3TAB A;  1KQS M;  1HLU A;  2ZF5 O;  4EP4 A;  4EIA A;  3CJA A;  3GL1 A;  4YOV A;  4Z4E A;  2P9N A;  1FW6 A;  4O5F A;  3OYL A;  3THX B;  4H5N A;  2OA8 A;  2P9S B;  1OH5 A;  4KHW A;  4YNQ A;  3WT0 A;  4FZX C;  5AR0 A;  3THX A;  2FF3 B;  1ZBF A;  4X65 K;  4FLX A;  3M8Q A;  4BC3 A;  3ENB A;  5SWM A;  2O8C A;  2VCP A;  3OYB A;  4B8C A;  2O8B A;  3VF4 A;  3OW2 M;  4AM7 A;  5HP1 A;  3B6P A;  3BDP A;  3L2Q A;  4ELU A;  3SI6 A;  3IRX A;  1BA0 A;  4ZTF A;  3J80 O;  4ISF A;  2IVN A;  1BOT O;  2GEL A;  5J1E A;  3ZT3 A;  1T44 A;  3AVM A;  4BRI A;  3TAM A;  4HUF A;  4JHD A;  2P5O A;  2P9U B;  2BGG A;  3ATU A;  3IS9 A;  4BRC A;  4KB1 A;  4CJL A;  3NBP A;  2HVI A;  4C8K A;  1NBW A;  2NRX A;  3ZSY A;  4B9Q A;  3PSI A;  4IFV A;  2JLE A;  3LP1 A;  3WEE B;  1QQN A;  4BG9 A;  3QIO A;  4JKF A;  4M7X A;  3AVH A;  4FYD A;  4M3Z A;  2PFU A;  3KLH A;  1JLG A;  3ALY A;  2P9I B;  2W6K A;  3BP8 A;  4O5B A;  3TAP A;  1SUQ A;  3E66 A;  2HHW A;  1D8Y A;  2HF4 A;  4I7F A;  1ZBL A;  1G99 A;  2HND A;  4BRQ A;  2HVH A;  1NKB A;  4ISE A;  3T1A A;  4DQP A;  4KH4 A;  4OLB A;  3VQE A;  3IFR A;  1IJJ A;  3VTI A;  4FJ7 A;  5JS2 A;  1VQ7 N;  1ATR A;  1WB9 A;  5KQD A;  4CGF A;  5EU7 A;  2O8D B;  3PIP L;  3G71 N;  3RVC A;  4E7K A;  1TKX A;  1NMD A;  2VWK A;  3KLE A;  4DUY K;  1Z25 A;  2XRI A;  1XHZ A;  3ZSW A;  4BE1 A;  2D0O A;  4XEI A;  3RMC A;  3AVG A;  4JI2 K;  4JKG B;  5BRF A;  3ULD A;  1XUP O;  4DTX A;  2OPQ A;  5FRM A;  1GLD G; 
#chains in the Genus database with same CATH homology
 3VET A;  5BPN A;  4H0Y B;  2ASO A;  3EN9 A;  4PKI A;  4UY8 O;  4I6M B;  3M6G A;  1VQN N;  3QFP A;  4IWV A;  4CZF A;  3FLC O;  1E4F T;  4FWR A;  1S3X A;  4BRF A;  5GAE P;  4U67 L;  2CGJ A;  2Q36 A;  3BF1 A;  2KKZ A;  4IJA A;  1Q81 O;  3KWG A;  4A5B A;  4H03 B;  1NGE A;  2E2Q A;  2Q0U A;  1K9M O;  3O9U A;  3C0B A;  4JKB A;  3NMU A;  3CCL N;  4FWP A;  3PIO L;  1HKG A;  3O08 A;  3MN6 A;  3L4Q A;  4FPB A;  4DQ8 A;  4CZK A;  3ZET A;  4A5A A;  1GLF O;  4WFN L;  2HOE A;  2YHW A;  4IOX A;  4MDB A;  4CZI A;  3G6E N;  1MWM A;  4H0T B;  3MCA B;  3HBT A;  3GOI A;  3MN9 A;  4BRM A;  5AFU H;  1Z05 A;  5AZI B;  3TSU A;  1VQ6 N;  4H5R A;  1BA1 A;  2NZT A;  4BGA A;  4CBW A;  4BR0 A;  4BR9 A;  5AQX A;  5BN8 A;  1BU6 O;  2E20 A;  2KLA A;  3FR0 A;  1KAZ A;  3O9T A;  1GLC G;  1HUX A;  1Z6R A;  4JD2 B;  2HBL A;  1Q82 O;  1H1V A;  2PBD A;  2D0P A;  2RE2 A;  1V4T A;  3M5R A;  4FL9 A;  4H5W A;  4NB4 A;  2BTF A;  1K8K B;  2Q97 A;  4IO8 A;  1VQP N;  1KD1 O;  4EAH D;  5I9E B;  4WQ5 C;  2QWN A;  4C1N I;  3CCM N;  5M1F A;  2WUS A;  3O4W A;  1GLJ O;  2CH6 A;  4YOT A;  1QVG M;  3EL2 A;  3I8B A;  3MCP A;  3R9P A;  5JLH A;  1YIT N;  3J7Z O;  2NRT A;  3FGU A;  5E84 A;  3E9L A;  5GIN A;  1DGK N;  1NLV A;  2RHK A;  3E1Y A;  3CCV N;  3GBT A;  2Q1N A;  1ESV A;  1GLL O;  3IMX A;  2F9W A;  4Y0W A;  1C0F A;  3CPE A;  1M90 O;  3QDK A;  3TTD A;  4JK8 A;  1J6Z A;  4KH5 A;  4O8U A;  5AQG A;  4A59 A;  4CBX A;  4CZH A;  2YX6 A;  2NLX A;  4A61 A;  3AAR A;  3VEN A;  2VWB A;  5LY3 A;  3UKU B;  1YXQ A;  2I7P A;  1T6C A;  3UKR B;  3H1Q A;  3JS6 A;  3UKR A;  3IUC A;  2E2O A;  4JKD A;  3AY9 A;  2P9K A;  2QWM A;  2HBM A;  1VQ5 N;  1LCU A;  3HM8 A;  3LL3 A;  2WC9 A;  4HTL A;  3CI5 A;  3VMF B;  4A62 A;  3EO3 A;  3W0L A;  5AQH A;  5AFU A;  1YHQ N;  4U7B A;  2NRR A;  3O9R A;  1U2V A;  3CER A;  3P4I A;  5HL7 L;  2ZJP L;  4IEI A;  2YHX A;  1S22 A;  1E4G T;  3D7E O;  3NVM A;  3SJH A;  4ILJ A;  1QZ5 A;  3KHY A;  3MX5 A;  4RTF D;  3VEX A;  4K42 A;  3SK3 A;  4B1U B;  3QFU A;  4GY2 B;  3ZX0 A;  1VQ9 N;  1SQK A;  1ATS A;  3L0Q A;  1NWK A;  2F7T A;  3VEV A;  1VQM N;  1NGD A;  4IDH A;  3MDQ A;  3DLL L;  1YF5 L;  3OHR A;  4JKA A;  2A5X A;  2HBK A;  4BRO A;  5JVH L;  1XC3 A;  2YI1 A;  1TUY A;  2QI2 A;  3VPZ A;  4RWT A;  1ATN A;  5EVZ A;  4JEP A;  3FFK B;  4FPA A;  3DJC A;  3A5M C;  3CJB A;  2FXU A;  3U9D A;  3KK7 A;  5AQI A;  2ITM A;  2ZGZ A;  3JXU A;  5LJV A;  3HOT A;  4IOC L;  3O1W A;  2HBJ A;  1VAZ A;  5AQK A;  3U9Z A;  1YVN A;  4BY9 C;  5E26 A;  3TTC A;  1NGI A;  3K9K A;  2YCH A;  4EHT A;  3CQX A;  3O9Q A;  5BR9 A;  3O80 A;  4BVP A;  3HOS A;  5KPR A;  3G25 A;  4DHY A;  1YJW N;  3CC7 N;  4EHU A;  1WUA A;  2Q2R A;  4XH1 A;  4BGB A;  3WXL A;  3CD6 N;  1RDW X;  3CMA N;  3H1V X;  3DXK B;  3MN5 A;  4A2A A;  2WBN A;  3MX2 A;  2ZWH A;  4WFB L;  3ZET B;  3S41 A;  2VGN A;  3D6R A;  4KBO A;  5GAD P;  2A3Z A;  3HI0 A;  4H0V B;  2GUP A;  5BRD A;  3AAP A;  3K9J A;  3ZEU A;  1NGG A;  5CHI A;  3B8A X;  5JVG L;  5AZI A;  4JK9 A;  1O13 A;  3WEE A;  1QHA A;  1W2B M;  1YUW A;  3R1X A;  1GLA G;  3SBT A;  5GIP A;  3LDO A;  5B8H A;  1K8K A;  3R6M A;  4FWS A;  3PLA A;  3MN7 A;  3CXC M;  4ISG A;  3QIC A;  4BR5 A;  2BUP A;  3TPQ A;  5KQ8 A;  2J4R A;  3O9S A;  2V51 B;  3CJC A;  4HWI A;  5GAG P;  3VGK A;  5ADX A;  4BC4 A;  3H3N O;  4L3Q A;  4BC2 A;  5C10 A;  4GV6 A;  3EKU A;  2HST A;  4KH6 A;  4WFA L;  2QEX N;  1W97 L;  3MWT A;  4IXC A;  5TKY A;  4WCE L;  2CGL A;  3QML A;  3TSP A;  2F9T A;  2YHY A;  4GVE A;  3EKS A;  3F2K A;  5F2R A;  1VQ4 N;  2QXL A;  1BWF O;  1MWK A;  4MLE A;  3H45 C;  4PL8 A;  3IKM A;  3DWL A;  4K25 A;  3CJ1 A;  3QB0 A;  4FWO A;  3UB5 A;  1T3V A;  4BR2 A;  2D1K A;  2Q31 A;  4ILH A;  3E9O A;  4JNE A;  3LDN A;  3AGK A;  5M1O A;  3VEY A;  4WQ5 A;  3C7N A;  4MDA A;  5BRH A;  3DAW A;  4YDU A;  3CCR N;  1YIJ N;  4YOU A;  4M63 C;  2VYP A;  3CC2 N;  3C65 A;  4A2B A;  4FOI A;  3VEW A;  5AQY A;  2QWP A;  4JAX A;  3C7N B;  2JWK A;  2P9L A;  1NGC A;  5AQU A;  4NLC A;  3VES A;  3SAH A;  4G9Z A;  3BEX A;  4ILG B;  3U4L A;  4BR4 A;  1KXP A;  3A8Y A;  4B1W B;  5BN9 A;  3O6W A;  3C6A A;  3O1B A;  2FF6 A;  4YOR A;  3L6Q A;  5CE3 A;  4B1Z A;  4BVO A;  4IJN A;  4XH5 A;  5AQJ A;  5JLF A;  4H0X B;  4AM6 A;  5KPZ A;  3E9P A;  3L4I A;  1QZ6 A;  3AGR A;  4K41 A;  2OAN A;  2QW9 A;  2QWQ A;  1VQ8 N;  4IEE A;  2P9S A;  1NGJ A;  4K43 A;  5AQZ A;  5BRE A;  1RFQ A;  3CCU N;  1WOQ A;  1U6Z A;  4GNI A;  2Q0R A;  2GEM A;  5KPT A;  3MK6 A;  1RDU A;  2OTL N;  3LM9 A;  1JCE A;  3CET A;  5AQF A;  2IVP A;  4EFH A;  1X9J A;  4WYB A;  4H5V A;  3SLC A;  1VQO N;  3VTH A;  4FO0 A;  4B1Y B;  3EE9 A;  1TUU A;  4BRA A;  3QBW A;  2NRW A;  4J8F A;  3D2E B;  4CZG A;  4DB3 A;  2FSJ A;  3P39 A;  4XH4 A;  3BF3 A;  3CJ9 A;  2V7Y A;  3MWP A;  4PHT X;  2QA4 N;  1BG3 A;  1JJ2 M;  1ZC6 A;  3P31 A;  4BQL A;  5M1Q A;  4CZM A;  1C0G A;  3CJ7 A;  2NRH A;  1NGB A;  1DT9 A;  4IOA L;  4YOY A;  3D2F B;  1V4S A;  1QVF M;  4B1X B;  3GG4 A;  1KAX A;  4BC5 A;  4R79 A;  4BRD A;  3D2F A;  3IDH A;  5FPD A;  3EZW A;  3VEZ A;  1JCG A;  1YJN N;  3N4P A;  4PL7 A;  2HF3 A;  2E1Y A;  1QQM A;  5C2F A;  2E1Z A;  4JHD B;  3VOV A;  1DEJ A;  1JCF A;  1R59 O;  2P9U A;  1ILY A;  5H1S Q;  2QWR A;  2P9P A;  1DKG D;  1D4X A;  3CCS N;  3ID8 A;  4WQ4 A;  3OBY A;  5EXW A;  1YI2 N;  5AQV A;  2YJE A;  2E2N A;  2QWL A;  5TKW A;  3ENH A;  5F0X A;  3O5B A;  2A40 A;  4H0O A;  3T69 A;  3P38 A;  4C1N K;  2DPN A;  5CR4 A;  1N8R O;  3KVG A;  3LDL A;  3VGM A;  3VF2 A;  4FWQ A;  2ASM A;  1KAY A;  4OPA A;  2E8A A;  2UYT A;  2W41 A;  3DXM B;  1ZBS A;  4LC9 B;  1GLE G;  2AP1 A;  5AQO A;  5C12 A;  4CZJ A;  5AQL A;  1Q7Y O;  3LDQ A;  3DXM A;  4FOE A;  5ELZ A;  1ZXO A;  1S72 N;  4H5T A;  3GDQ A;  3NVK A;  2GTD A;  3UE5 A;  1T6D A;  3SBG A;  3OBW A;  3KZB A;  4JKH A;  2BH1 A;  1Q18 A;  1SZ2 A;  4YDU C;  3SAG A;  1HKC A;  4OPH A;  3WXJ A;  1LOT B;  2NNW A;  3A5O C;  3ATV A;  3I56 N;  4CJ7 A;  4BRG A;  5AQS A;  3VER A;  3WQU A;  3HRG A;  5AZJ A;  3ENO A;  2P9L B;  2IVO A;  4AF1 A;  4FWM A;  5FPN A;  4QS7 A;  4DCH A;  5DM7 L;  3FZK A;  5AQP A;  1CZA N;  5LJW A;  3A5N C;  3HSC A;  5AZJ B;  3BUZ B;  2FSK A;  1BUP A;  3R8E A;  3GE1 A;  3W3D A;  4QS8 A;  4E1J A;  3TSQ A;  2GWK A;  3UKU A;  3H6E A;  2V7Z A;  1NGH A;  1TYQ B;  1SS6 A;  1HPM A;  2A41 A;  3EE8 A;  4IFE A;  3WXK A;  1U2V B;  2CGK A;  3LM2 A;  1NGF A;  4GV3 A;  4GV9 A;  2IIR A;  3HZ6 A;  2A42 A;  4BRN A;  3H3O B;  4QS9 A;  1KQS M;  1X3M A;  1HLU A;  2ZF5 O;  4M7Y A;  4WQ4 C;  5M1N A;  4EIA A;  3CJA A;  3GL1 A;  4YOV A;  5C15 A;  2P9N A;  3J8A A;  4O5F A;  3ULE B;  3WUH A;  3CF5 L;  3FZM A;  3WXI A;  4BRP A;  2VGM A;  4H5N A;  2PAV A;  4MO5 A;  5C2D A;  2P9S B;  1P8Z A;  3WT0 A;  5AR0 A;  5GAH P;  3CIP A;  1NGA A;  4F9O A;  5F1X A;  2FF3 B;  2YJF A;  4JKG A;  5DM6 L;  2KHO A;  3T7Z A;  2H3G X;  1OKJ A;  4Z94 A;  2W40 A;  5FPE A;  4BC3 A;  3ENB A;  4RCH A;  5AQN A;  2VCP A;  5EY4 A;  4B1V A;  3VF4 A;  3OW2 M;  2A6A A;  2WFB A;  3FE1 A;  3Q7B A;  3CCQ N;  3D2E A;  3MMV A;  4AM7 A;  2JWL A;  4I6M A;  3I55 N;  3M3Z A;  3A5L C;  2ASP A;  3CCE N;  2V52 B;  3R3L A;  1BA0 A;  4PKG A;  5AQW A;  4MO4 A;  4C23 A;  5HOO A;  2ZJQ L;  2FSN A;  5ADX H;  1XQS C;  3DXK A;  4JKC A;  3F5T A;  3HTV A;  4BRE A;  2E88 A;  1Y64 A;  1EQY A;  4ISF A;  3F9M A;  1MA9 B;  1X3N A;  1BDG A;  2IVN A;  1BOT O;  2P9P B;  4WF9 L;  2GEL A;  2CH5 A;  2QTD A;  5AQQ A;  1SAZ A;  1T44 A;  1HKB A;  1VQL N;  4BRI A;  3M1F A;  3QBX A;  1BO5 O;  5EX5 A;  3TU5 A;  4CBU A;  1IG8 A;  4JHD A;  1K8A O;  1MDU B;  2P9U B;  3ATU A;  3FZF A;  3SMP A;  4BRC A;  1RGI A;  4CI6 A;  4O8K A;  5AQR A;  3ZX3 A;  3ZYY X;  5BPM A;  5M1K A;  1NBW A;  2D4W A;  3ZEU B;  2NRX A;  4BQZ A;  4B9Q A;  2OTJ N;  3RSE B;  3ID6 A;  1HX1 A;  4CZL A;  3H46 O;  3WEE B;  2I7N A;  1QQO A;  3I33 A;  3RSE A;  1QQN A;  4JD2 A;  4BG9 A;  4JKF A;  4M7X A;  4FSV A;  3CPW M;  1NJI O;  2EWS A;  3U8X A;  2GX9 A;  3VF6 A;  4CZE A;  1M1K O;  1VQK N;  3SAF A;  2NRV A;  4BRL A;  1K73 O;  2PFU A;  1NM1 A;  1HJO A;  3FZL A;  4FWL A;  4FWK A;  1KC8 O;  4YOW A;  2P9I B;  2HMP A;  3BP8 A;  3LDP A;  3G4S N;  4FVU A;  3C6H A;  3E66 A;  2P9I A;  2HF4 A;  4IO9 L;  3CC4 N;  3OA9 A;  1G99 A;  4PKH A;  4A57 A;  4CD1 A;  3CME N;  2AA4 A;  4BRQ A;  4JKE A;  4BRH A;  4ISE A;  4IZ9 A;  5FPM A;  3AAQ A;  3VEO A;  4BR7 A;  4JK7 A;  4KH4 A;  4NLB A;  3WXM B;  3IFR A;  3WQT A;  5JMV A;  2ZJR L;  1IJJ A;  3TTF A;  3VTI A;  1TYQ A;  1Q86 O;  3A0I X;  3O8M A;  5C0Y A;  4DKW A;  5GIO A;  4BG8 A;  5AQT A;  5AQM A;  2FLO A;  1VQ7 N;  4CD3 A;  1ATR A;  3CCJ N;  1OVY A;  5KQD A;  5M1P A;  4MLH A;  1YJ9 N;  3Q7C A;  4BRK A;  2GWJ A;  2P9K B;  2ZGY A;  4H0P A;  5MLC Q;  3N4Q A;  3PIP L;  3ULE A;  5JIC A;  4YOX A;  3FZH A;  1EO1 A;  3G71 N;  1YAG A;  3RVC A;  1NMD A;  5BPL A;  2QWO A;  2D0O A;  4XEI A;  4JN4 A;  3KWI A;  2E2P A;  2P9N B;  3ZX2 A;  2QM1 A;  4JKG B;  5BRF A;  1XUP O;  5EOY A;  3SMS A;  3CHW A;  3VGL A;  2NRZ A;  4FWN A;  1P90 A;  4OO1 J;  3CQY A;  4NO7 A;  1GLB G;  1GLD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...