5M1NA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound manganese
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
189
structure length
189
Chain Sequence
PAMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 65
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1nA00
5C2DA 5C15A 4IFEA 5M1QA 3C6HA 4IEEA 5C2FA 5C12A 3CPEA 5M1OA 5M1FA 5M1NA 5C10A 5M1PA 3C6AA 4IDHA 5M1KA 4IEIA
chains in the Genus database with same CATH superfamily
1KLMA 3HM9A 4DSJA 4KO0A 5BR9A 4B3MK 3CC7N 1L3VA 4FOIA 2BUPA 2P9KA 3SMSA 3AVGA 1U45A 3LDLA 3P31A 3NDKA 1DT9A 1HYZA 2NRWA 4A59A 3RMDA 4IEIA 4MQ3A 4H5NA 3L2VA 4DTRA 1NWKA 4CW7B 1C0GA 1KD1O 1OKJA 4J8FA 2I7NA 1MA9B 2CGKA 2BH1A 2PZSA 5ELZA 1Q8IA 2PYLA 1REVA 3L2QA 5AZJB 4DUYK 3VEWA 4B9NA 4HCCA 3F5TA 3GL1A 1VSIA 1KCFA 3WNEA 3ZSZA 2KFNA 4C8MA 2HVHA 1CLQA 2QM1A 4CEDA 1I94K 1EKEA 5AJ3K 3U4LA 4FSVA 5AQPA 1HQUA 3NE6A 3CIPA 3F2KA 1BUPA 1BA0A 4JKGB 1EP4A 4FWLA 3AVCA 3BY5A 3LAKA 5HP1A 4JKBA 3D7EO 1TL1A 3HYFA 1HJOA 4L8RB 1ITGA 4CGFA 1S72N 3PX0A 4KHUA 2P9SB 2NRTA 4ELUA 1TGOA 1ZC6A 3C6UA 3OYBA 4ICLA 4FJHA 3HVTA 1YXQA 3U3GA 3SI6A 4WE1A 3O4NA 4CEBA 2X78A 3AVHA 4BACA 5KPRA 2HMPA 5GAHP 1BISA 3RRGA 2UXBK 5GAEP 2VGMA 5KPTA 2GTDA 1RT3A 2DFEA 1JJ2M 4Z4HA 2G8HA 1XC9A 1OH8A 4IFYA 3D2FB 2UU9K 4B1XB 1IO2A 2G8WA 1NLVA 3DAWA 4K8XA 4O8KA 4DU3A 1RNHA 1JXEA 5GINA 3J81O 4MLEA 2QWRA 1VQON 5AQIA 4CZJA 1SL2A 5F1XA 4PL7A 2P9PB 1OH5A 1M90O 4O0JA 3OS1A 4DLEA 5C0YA 4OGCA 3L8BA 3MEDA 4DUZK 2UUAK 1IG9A 1RBUA 3OYFA 1HYVA 4EAHD 1U47A 1WSEA 4HVJA 4DR6K 3DRSA 3M8PA 3AGKA 4JRPA 2UXDK 1NGBA 3TAFA 4CJUA 2GUPA 4R5PA 5EVZA 3ATVA 1C1AA 3WNHA 1XMOK 3AA4A 2OPPA 4WQ5C 4DSEA 1CZ9A 3VTHA 3V1OA 2G8VA 3DXMA 3EKUA 3DLLL 1QE1A 2AA4A 3VQEA 3RMAA 3L4QA 1VRTA 4BVPA 1HNWK 4MO4A 3WXIA 1Z6RA 3THWA 1GLLO 3QFPA 1L3TA 3NAEA 4IOXA 3P5JA 1HLUA 2RKIA 4HUEA 5KTQA 1P90A 4JI4K 2O8EA 2D0BA 1DLOA 1EX4A 1YJWN 4H0OA 3THXA 3EO3A 1WSHA 3ZYYX 2O8FA 4HWIA 4CJ3A 3HPHA 4LH4A 5KQ8A 3LL3A 4A61A 2NNWA 4KHWA 3OJUA 1VQ5N 4HTUA 4YNQA 4FCYA 3CJBA 4LF7K 5HLFA 3CERA 4NCBA 1BQMA 2Z1HA 2QA4N 4YOUA 1SL0A 4JKHA 2JGUA 4LFCK 4CD1A 3F9MA 1VSEA 3UKRA 2QWMA 3ENOA 3J7YP 3U6FA 2W41A 3VF2A 5AQSA 4BRIA 1JLCA 4OJRA 2ZE2A 4B9QA 4IWVA 4H0VB 5C24A 3WUHA 3UB5A 1NGCA 3C94A 1X9MA 1G99A 1VSFA 3NGYA 4IJAA 2Q36A 3CHWA 3CXCM 4RTFD 1OVYA 2BANA 3KKSA 3WQTA 4DFJA 3MECA 4DTJA 3TAGA 1YVUA 4BWMA 3HJFA 1IKYA 1U2VB 2VG6A 3DI6A 1BA1A 1V4TA 5FPMA 2ZGYA 3P39A 2O8CA 4W5OA 2QWPA 5TKYA 4K0KK 4WQ4A 5DK5A 4LF5K 3V81A 3W3DA 1HKGA 3OYMA 4JI2K 5J2QA 3AVLA 4M3UA 2G8KA 1QHTA 4CJVA 5AQWA 3LZIA 3RR8A 5BPMA 2CH6A 3V9ZA 3V9XA 4KI6A 3MK6A 4DCHA 4B8CA 4ZTJA 3L4IA 3CCSN 4CHNA 3CQXA 2QXFA 1WN7A 3AVIA 4WF9L 3B6PA 3KWIA 4H5VA 3RVCA 1DKGD 1TKXA 2HNYA 4FJJA 4LF8K 3O5BA 1JKHA 2QXLA 3ZX2A 4FJ7A 5AQXA 2NRRA 1LWEA 2ITGA 4BE1A 3QINA 3O1WA 4Z4EA 1BL3A 3OYKA 3VTIA 1C0FA 1RBVA 4DTXA 3RWUA 4CJQA 3ID6A 3KD1E 3K2PA 3FZFA 4H0PA 2P9NB 4BRLA 4GY2B 1S1TA 3ULEB 1YITN 4DR4K 4DR7K 1S5JA 2BTFA 4OKKA 4B9VA 4DG1A 3A5OC 2VYPA 3TU5A 3QEIA 4LD0A 4ISEA 4RW9A 4W5NA 4FJGA 2KTQA 4BQZA 1J53A 1HKCA 4GV3A 4A57A 1NMNA 4KTQA 2O8BA 3O9QA 1MDUB 2YNGA 5TKWA 3CCQN 4CFAA 4CGDA 1SKRA 4CZEA 1IBMK 1YF5L 4A2AA 2OA8A 1RCHA 1WBDA 3F9KA 3ZSOA 2KKZA 1XNRK 4EIAA 4CJTA 2NUBA 4IDKA 3AVJA 3QESA 4NXNK 3O3GA 1WLJA 2E8AA 1HX1A 4F4KA 4Z4CA 2OZMA 3DRPA 3KD5E 2NRZA 4FZZA 1NK5A 4CD3A 1YJ9N 3DXKB 5C2FA 2YNFA 3DYAA 4MDBA 4DR5K 1RT4A 4BRAA 2UUBK 4GKJK 4I9LA 4DQIA 4UY8O 3TAQA 1NK4A 1NBWA 2O4IA 1D9FA 4AHRA 1C0TA 2WBNA 3LP0A 4JYAK 2FF3B 1WB9A 3SUQA 3NF8A 3SYZA 3ZT1A 2QKBA 3ASMA 1RDBA 2P5OA 3I33A 3IFRA 3T7ZA 4Z4FA 3H45C 4DLGA 2P9UB 4EP4A 4BRQA 3KK7A 2OPRA 1NOYA 3MMVA 4CEEA 2HHHK 2O8DB 2JLEA 4J2DA 1S9EA 3NF6A 1NMDA 4CZKA 2IAJA 4LF9K 4JKCA 4B9TA 3HOSA 4M3WA 3T1HK 3TTCA 3ZT4A 3E9OA 2KZZA 3AVMA 5LJWA 4K8ZA 3MX5A 2YV0X 3TSPA 3R8EA 1SL1A 2KQ2A 2G8FA 1NK8A 3LPUA 3C7NB 4A2BA 4DFMA 1S1WA 4Y0WA 2WTUA 4PL8A 4ELTA 3WT0A 2X74A 3OYHA 3VQ4A 3TSQA 4FWOA 2ZWHA 2YHYA 3FZHA 2GV9A 3BZKA 2BGGA 1ATNA 1BI4B 3JAMO 2FF6A 4IG3A 4KHSA 4O5FA 3LP2A 2F96A 3H1VX 1RFQA 1NJXA 5FPEA 3CFRA 1HRHA 1ZBSA 3A5LC 1DTQA 4JEPA 3OYCA 4NCAA 1RBRA 5HRNA 1QZ5A 2FBXA 5HRRA 3MWTA 3KLGA 1EQYA 3CFPA 1UAXA 2DFFA 4CJLA 4IFVA 5LL6Z 2WFBA 3THYA 3V9UA 4M42A 1GLCG 4AH9A 3SQ4A 4CHQA 4BQLA 3AAPA 4BGAA 1T05A 1KVBA 3OVNA 1M1KO 3KVGA 3Q7CA 1NGIA 5BREA 3O6WA 3O80A 3EZWA 1Q7YO 3WXJA 1JCFA 4B1UB 1YT3A 3KLEA 3H3OB 5M1PA 3OTOK 3WXLA 3ZEUB 2FBVA 3BGRA 3QEPA 4YOXA 3VF4A 2HNZA 3VPZA 3GDQA 1ZBIA 1XNQK 1S1UA 4JV5K 4YHHK 4CZHA 4PQUA 4B8AB 3ZX0A 5GIPA 4AF1A 1WNSA 4FPAA 2YI1A 1I3AA 3VQ9A 2V51B 4QS7A 4L3QA 4QCLA 2WUSA 4JHDB 1U04A 4JK9A 1Z26A 1QQMA 2RPIA 4PWDA 3HP6A 1SZ2A 1VQMN 4U67L 2J4RA 2D5RA 1HNXK 1KRPA 2XHBA 2YCHA 3OY9A 3SNNA 4I6MA 3K0SA 2GX9A 4O4GA 1K8AO 1W97L 3MDQA 4Z4IA 1BOTO 3CG7A 4FJLA 3SAHA 2KW4A 1VQ8N 4A62A 4B3SK 3KK1A 4LF4K 2R7YA 1VQLN 1JLEA 1C1CA 2QWLA 4M3XA 2YKMA 4JKGA 1NKCA 3AO4A 3V1QA 1KSPA 1BGXT 3M3ZA 1E4GT 2VWJA 1Q18A 2E20A 3EN9A 3I8BA 1J5EK 4LFAK 3SQ0A 2YHBA 1YHQN 2YNHA 4CF2A 1X9JA 3OJSA 1LWFA 5C10A 1QVGM 4YORA 1QSLA 4BC4A 3MN6A 4BG8A 3S3OA 3QICA 4C8NA 1XWLA 2A6AA 1RT1A 4DR1K 3NH0A 1E3MA 4DWIA 1RT2A 4DQ8A 5BRDA 3K5NA 4AM7A 3DWLA 3CI5A 4KH6A 2P9IB 4CF8A 4H8KA 3AA2A 1K8KB 1EO1A 4FJKA 2FBYA 4B9MA 2IC3A 5M1FA 1JCGA 3JXUA 4Y1CA 3CJ7A 3NHGA 3EYZA 1TYQB 4AHTA 1LWCA 1NGGA 3VQPA 3TAMA 4DQSA 2VWBA 1BO5O 4B1VA 2G8UA 3I55N 4FLUA 3HO1A 1NK6A 4DV4K 3HVRA 1S6QA 3WQUA 3HZ6A 3M5RA 2AP1A 2Y1IA 4BR7A 4KKOA 1EWQA 2P5GA 3DLKA 1SKWA 5JMVA 4DQPA 2HHTA 4F3OA 1Y64A 4IDHA 3NCIA 4FWSA 2F8SA 4GVMA 4KI4A 4OKEA 3RSEA 3S41A 4FLYA 1ZBLA 3VQCA 3O3FA 1VQPN 3P38A 4DV6K 2HBJA 1VHXA 5C12A 4FJ8A 4DSKA 2P9KB 1TUUA 4FM1A 1LAVA 2VWKA 3IRXA 5BN9A 3U9DA 2A1SA 4KB0A 1Q9XA 3SQ1A 2Q0RA 3PUFA 4QAGA 2IIRA 4KAZA 2V7YA 3QERA 5AQTA 4ISGA 4ILHA 4FO0A 2A40A 3K57A 4FW1A 3U8XA 3DRRA 3ISNC 3QFUA 4LSLA 4B08A 3OS0A 3ZSRA 3BF3A 3OYGA 2DTUA 4DFPA 4CK2A 5SWMA 4MDAA 2D0PA 3EE8A 3S9HA 2DFHA 1WSIA 4IG0A 5JS1A 3RR7A 3S3MA 4NB4A 1GLJO 4MLHA 3VQBA 1SV5A 3UE5A 3D0PA 3PO5A 5EY4A 3CC2N 3ZSXA 4IZ9A 3HM8A 4HUFA 4H4OA 1VQNN 1P8ZA 3SV4A 1D9DA 1RT5A 2Q3SA 4PHTX 2OANA 2B5JA 3M6GA 4FM2A 2ZJRL 1JLFA 1LW2A 2HBKA 3DLEA 4LFBK 1IBKK 3G10A 4FLVA 3D2EB 4K25A 2EWSA 3AAQA 3VQ7A 4DV0K 3AA3A 4GKKK 2B4JA 1GLBG 3CCMN 1J54A 3LM2A 2YJFA 4M41A 1HNVA 1CZBA 5HRPA 1BCMA 1G15A 3CD6N 4J2EA 3P83D 3KLFA 1ASUA 4B1ZA 3NVMA 4AILC 1ATRA 1FK9A 3F73A 3H08A 3I0SA 4JKDA 4NYFA 4W5RA 1SAZA 4BE0A 2E2NA 1UWBA 5M1QA 2XY6A 5AQKA 4CJ5A 1T03A 3NF7A 4LSNA 5JVGL 3C6AA 3HPGA 1NK7A 2HNDA 5I9EB 2KHOA 1QQCA 2FC0A 3CCUN 3HT3A 4E1NA 2XY7A 4X66K 3A2FA 3CJAA 4CECA 1U4BA 1FXXA 3MWPA 3S3NA 1UA1A 1L3UA 2IVPA 4CJEA 3HBTA 4F8RA 5KGWA 4CHYA 2EHGA 2OTJN 1RDDA 3PIPL 1HPZA 4OKJA 3K5LA 4M3RA 3TTDA 3O4QA 3K58A 5KPZA 1QSSA 4HTLA 2HHSA 3MN5A 3VEZA 3PIOL 1TK0A 5AQFA 1WBBA 1GLDG 4N47A 1HUXA 4QOZB 1XQSC 1T3VA 3K5OA 4FWPA 1Z05A 3QIOA 2HB5A 4K43A 3VQAA 4AQYK 3CYMA 3TPQA 3O08A 3QDKA 1XC3A 5LJVA 3DJCA 3FFKB 1O1WA 1EETA 5BPNA 1Q81O 4YDUA 4M3TA 2IS3A 4R79A 4RW8A 1VAZA 1IH7A 5J2PA 1H1VA 4DSIA 3O9UA 5FLXO 3G6EN 4FJIA 5FRNA 1ZXOA 3T19A 4CIEA 4EHTA 2W40A 3HI0A 1KAZA 3DXMB 3EE9A 4FJ9A 3SUNA 3DMJA 3L2RA 3TWHA 3V6DA 1RTDA 1EWRA 1YTAA 2F9TA 5AQMA 1J9AA 1VSLA 2E88A 2I7PA 4W5QA 3CQ8A 3H46O 2UXCK 3CM6A 2F8TA 1OH7A 4BR0A 2OZSA 2E4LA 2YX6A 4PKHA 4F2RA 4PA1A 3HRGA 2E1YA 4JI1K 5AQLA 5AQGA 1FKPA 1BQNA 1NGEA 4CFCA 3HL8A 2O8EB 3CCRN 4X64K 2HW3A 2ETJA 4FWMA 3THXB 3ULEA 4KPYA 3T1AA 2QW9A 4PKGA 3LDNA 2XO7A 3IG1A 3WNGA 2O8FB 3CJCA 3L0QA 5J2MA 3HP9A 3CM5A 3NGIA 2ZJPL 4YDUC 1X9WA 2QK9A 3HPOA 2XY8A 4BRHA 4IFEA 3AARA 2RE2A 2D0AA 1T7PA 3J7AP 4CFDA 3NBPA 4DV2K 1NGHA 1DTTA 3OYJA 1S9GA 4DS4A 3UKRB 3ZSYA 2UYTA 3WEEA 3CCVN 3TAPA 5JS2A 3E66A 3I56N 3OYEA 1RT6A 4KV8A 4CF0A 4DR3K 3H6EA 2IOCA 5AFUA 4YOVA 3OS2A 5SZTA 3FR0A 3A5MC 1RT7A 3ITHA 3CMEN 4FK0A 4WQ4C 3J7ZO 4KBOA 3QNOA 4H03B 2P51A 4E7HA 3DXKA 1WAFA 4CEZA 4BWJA 1NOZA 5AFUH 3I8DA 1TL3A 3UKUA 4DTMA 4JKFA 4C23A 4JD2A 3QO9A 4CGJA 4DTUA 1U6ZA 2NRVA 3OYAA 3BDPA 2O8CB 1KAYA 5K14A 4E3SA 3UIQA 3VF6A 4CESA 1S1XA 5MLCQ 1IV0A 4I9QA 2Y1JA 1WSFA 3CPWM 4PY5A 4A5BA 1ILYA 1WUAA 4M45A 3LP3A 4MO5A 3VQ6A 4JNEA 5KRTA 5GADP 3BP8A 5HBMA 1KTQA 3MN9A 2QEXN 1V4SA 3QB0A 4IXCA 3ZT0A 1IJJA 2I5JA 4BDPA 3KKRA 1W0HA 4EZ9A 1TVRA 2VG5A 5KI6A 2ITMA 3GOIA 1SS6A 2G8IA 3CCJN 3C7NA 4JI6K 4CZGA 3ULDA 3VESA 4H0TB 3MEEA 3O1BA 1QTMA 1QVFM 4BR9A 5A2QO 2OPSA 5CYQA 2Z1JA 5DMRA 4BRKA 2QTDA 1MU2A 3M8QA 4WYBA 3SAGA 3MXIA 2V7ZA 1X3MA 2Q0UA 1BI4A 4AM6A 1IKXA 1GOAA 3WXMB 4FXDA 2OCEA 3CQYA 3GBTA 4FWRA 3OYNA 1BDGA 4C8KA 4IKFA 2QI2A 4BRPA 4EZ6A 3LPTA 5AZIA 2A3ZA 5JLFA 2E5LK 4HUGA 3IUCA 1LV5A 3OA9A 1K6YA 2ASOA 4FJ5A 1N32K 3G4SN 2HBMA 4DV1K 4DTNA 1WSGA 3AVBA 2PFUA 4KFBA 4M7XA 5DM7L 1XHZA 2P9LB 3LDOA 2O8BB 3LWMA 3OYIA 1HNIA 4BR4A 4CJ4A 1S22A 4TSXA 3J8AA 2YHAA 4CJ7A 4XIUA 5AQHA 3VQ5A 4CZFA 1HYSA 4M63C 3SJJA 2WOMA 1D8YA 2F7TA 3VN5A 3RRHA 3ZT3A 3VENA 4LH5A 4QS8A 3M1FA 3VETA 3O8MA 3C95A 3MAQA 3IDHA 3ZETA 3SQ2A 3ZEUA 4C1NI 4CCHA 2H3GX 3O4WA 5T7BA 4FZYA 5GIOA 3VEVA 3U3YA 3KHYA 3AV9A 1YVNA 1BWFO 4RG8A 4DV3K 3SAFA 1KC8O 4BDZA 3SUOA 4WCEL 2HHXA 1IG8A 4G9ZA 1QQNA 3CPEA 2CGLA 3W0LA 4KH4A 4B9SA 4H5RA 1T6DA 1TUYA 2F4VK 4BGBA 3AVAA 4BVOA 1RDAA 3M8RA 4OPJA 3PY8A 4KB1A 2FSJA 1UOCA 3K59A 1HNZK 4OLBA 4JKEA 1NGFA 4BRDA 3NH2A 3CC4N 4M3YA 4KRFA 4H5WA 4IBNA 4B9UA 3QETA 1BIZA 2VQFK 1A5XA 2QKKA 3VMFB 4J2AA 1BCOA 3EEQA 1GLFO 3RMBA 5HL7L 4FJNA 1KLNA 3SPZA 2FBTA 4CHOA 1S6PA 4CJWA 4EFHA 3EKSA 1GLAG 3PX6A 1JCEA 5AZJA 3AO3A 4GV6A 3DM2A 3VA0A 3PO4A 4BREA 4FLXA 4X62K 3QLHA 3IMXA 3DOKA 4FLZA 4F9OA 3L3UA 4UQGA 2P9IA 1Y97A 4E7JA 4CEFA 4YY3K 4DQRA 3EZ5A 4DU1A 3DLBA 3L6QA 1X9SA 1LCUA 4GVEA 5BRHA 2OYQA 1RDUA 3E9LA 3MEGA 5IT9O 4RW4A 4XEIA 1OH6A 4X65K 1DGKN 3AY9A 1N6QA 4FWKA 1ZBHA 3IS9A 3SV3A 2QWOA 4FLTA 1MWMA 4GNIA 3C65A 3LDSA 3VQQA 3THYB 2IVOA 3OBYA 4JI0K 1IKVA 4JLHA 5I3UA 3K9KA 4BE2A 3OBWA 1CXUA 3O9TA 4PKIA 2P9SA 3KJVA 4JKAA 5H1SQ 1VQ9N 4Z0UA 1NNEA 4CK3A 1N36K 1A5VA 3BUZB 1KVAA 5J1EA 4JS5A 1VSDA 1D4XA 1NG9A 2Q2RA 3OYLA 3AA5X 1RTHA 2D0OA 2NRXA 4CF9A 2DY4A 4O55A 2ZD1A 3V4IA 3LDQA 5EOYA 3SCXA 4A5AA 1KVCA 4EP5A 2PBDA 4OVLA 1UA0A 3D6RA 4LY7A 4DS5A 1JLAA 3CJ9A 3D2FA 1DEJA 2ZF5O 4AHUA 1YUWA 3KLHA 3QIPA 4CZLA 3V1RA 3CJ1A 1OVQA 2E6LA 4I6MB 2F9WA 4KHPK 3ATUA 5M1OA 3SK3A 2P9PA 4KHYA 1F21A 4CI6A 4I7FA 4CZIA 3ENBA 4FOEA 5LMNK 3T3FA 3ZSVA 4F3TA 3BZCA 2GWKA 3O9RA 3VQ8A 1SUQA 2GWJA 1U48A 3LWLA 3PV8A 4IOAL 5DM6L 2Z1GA 3D2EA 1QZ6A 4YOTA 1NK0A 1BHLA 3VEYA 5FROA 3T69A 4W5TA 4B3OA 1RTIA 3KWGA 4PUOA 4KTZA 3DLRA 2A1RA 3Q7BA 1VQKN 3SLCA 1JLBA 1WAJA 4G1QA 2FSNA 2ZQBA 1R0AA 4NXMK 1X3NA 1X1PA 3CFOA 3LP1A 2HF4A 3QNNA 3GE1A 5LY3A 1HKBA 3KIOA 1N8RO 2E1ZA 3TI0A 1ASVA 3QEWA 2GBZA 3J80O 4CVNE 3L3VA 4WQ5A 1JXBA 3M8SA 5AQYA 4BR2A 1ASWA 3LM9A 4IJNA 4CZMA 3QEVA 3QBWA 3TANA 4OX9K 4FPBA 3IKMA 5AQNA 1NJWA 3P4IA 4E7KA 1VSKA 3VEXA 5AQVA 3ZSWA 1W7AA 4CHZA 5BPLA 1FW6A 2HMIA 1NM1A 1WSJA 4NLCA 4JS4A 4FWQA 4N76A 3PX4A 4BC2A 1TKZA 4CEQA 3VGLA 3ALYA 3KZBA 4DMNA 4CJKA 3P1GA 5HROA 1XHXA 3OHRA 1NGDA 4FJXA 1JLGA 3PSFA 5FDLA 3RSEB 3AO1A 3AGRA 1FKOA 1GLEG 3CF5L 2CH5A 2XRIA 4E0DA 4CBXA 4BROA 3OW2M 2Q97A 5C42A 1RGIA 5CZ1A 3CCEN 4JN4A 5B8HA 4JI8K 3U9ZA 5KRSA 3TTFA 4Z94A 4N41A 2BDPA 5C2DA 1BG3A 4EHUA 1JL2A 4C8OA 5JLHA 1KAXA 1RDWX 1NGJA 2BE2A 5BN8A 4FK2A 3KK3A 4HHTA 4NYNA 2W42A 5I42A 4CF1A 4CE9A 4DFKA 4ELVA 4FK4A 1RTJA 3E9PA 3NH1A 4IO9L 2E2OA 4DV7K 4C8LA 1TK8A 1YAGA 1K9MO 2AJQA 1QSYA 4DSFA 3R6MA 1HQEA 2D1KA 5JVHL 2E2QA 2V52B 4JI3K 1VRUA 3A8YA 1U2VA 3SZ2A 1T6CA 2IGIA 1C0UA 3HK2A 3NF9A 2Q1NA 4JI5K 2YHWA 4U7BA 4JK8A 3PLAA 3AVFA 3R9PA 3G71N 1VQ6N 1NU0A 4BY9C 4B1YB 2HVIA 4BRGA 4JK7A 1VSMA 4FWNA 3DOLA 4LF6K 4CK1A 1O13A 3RMCA 4FYDA 1J6ZA 3DLGA 4WFNL 1RDCA 3C6TA 2FXUA 4GW6A 4ZTFA 1NKEA 3DLHA 4CGIA 4CHPA 4CJFA 1RBTA 1SKSA 5HOOA 3L2WA 4DF8A 2E2PA 1Q82O 4DSLA 5BR8K 3HXMA 3MN7A 3ZSQA 4CJPA 4HCBA 2O4GA 4CIFA 3NVKA 1T8EA 4CEAA 3NGZA 2B6AA 5AQZA 3LZJA 3AVKA 3THWB 4RWTA 3MXJA 5CR4A 5CYMA 4ILGB 3I0RA 5AQJA 4FVUA 3CCLN 4Q5VA 4MFBA 4H5TA 5E26A 2P1JA 3PSIA 1S3XA 1ZYQA 1Q86O 1VSJA 4YOYA 2JWLA 2KLAA 2P9NA 2HHVA 3EL2A 1VQ4N 3O3HA 3WXKA 3VQDA 3ENHA 2YNIA 3TAEA 1QHAA 4ID1A 5FPDA 3T1YK 3E01A 3ZT2A 1XUPO 1GOBA 5FRMA 1I39A 3K9JA 4DTSA 4AHSA 2ATQA 1NJIO 2GUIA 4BC3A 4XH1A 2W6KA 1XI1A 5EXWA 5J2NA 3QBXA 2OPQA 4DTOA 5EX5A 2VQEK 3LAMA 2YJEA 5KGXA 2A5XA 1XMQK 3MCPA 1C6VA 1TAUA 2UUCK 4BRFA 1N33K 2IVNA 2XY5A 1SQKA 4B3TK 4B3RK 4DU4A 4CBWA 1VQ7N 4Z4GA 4CJRA 1T44A 2CGJA 4CJSA 3D45A 4XH5A 1HR0K 3EY1A 4IEEA 4E7IA 3SBGA 4JI7K 2ASMA 2NLXA 2X6SA 3ZLJA 5IWAK 1N34K 2A42A 5AQUA 4XH4A 3VERA 4CGHA 4JRQA 1LW0A 5CHIA 1YIJN 3MXMA 2QWQA 1C0MA 4DR2K 3R1XA 3THVA 5FPNA 4DV5K 4ID5A 5HRSA 1BIUA 3TARA 3CETA 1RBSA 4I2QA 3SPYA 1D5AA 2ASPA 2ZM6K 4M7YA 2HBLA 1U49A 2P9UA 1BU6O 4CFBA 2NRHA 4FL9A 5E84A 4GV9A 1MWKA 2O8DA 3K5MA 1N5YA 3SUPA 1KXPA 4RW7A 4KHNA 1RILA 3SBTA 2A41A 1L3SA 3KTQA 2HSTA 4BR5A 2P9LA 1NKBA 1S1VA 3ID8A 1NJZA 1K73O 3JS6A 3SMPA 4IO8A 2HHWA 3BF1A 4FW2A 4LC9B 4FJMA 4KHQA 4NCGA 4RCHA 1A5WA 4O5BA 4FZXC 2X6NA 3WEEB 4OLAA 1B92A 5KQDA 5D3GA 1TAQA 3A0IX 3TR8A 4DKWA 4BRMA 3JSMA 4M3ZA 2Q31A 3ZX3A 2WC9A 1TKTA 4OPAA 5GAGP 1Z25A 3O9SA 4KREA 4Q0BA 3H3NO 4YOWA 2VG7A 3WNFA 4WFAL 3TABA 2QWNA 3TSUA 4H4MA 3FZMA 2NZTA 3MCAB 2OTLN 3C0BA 3UKUB 4FM0A 3BEXA 1KQSM 2D4WA 4N56A 4FVMA 4JD2B 2ZGZA 3FZKA 1C1BA 4O0IA 4O8UA 2EX3A 1VSHA 3V9SA 3V9WA 4AHCA 2IDOA 3B8AX 1TK5A 3ZCMA 1LAWA 1EXQA 1HMVA 4F2SA 5BRFA 2HOEA 3FE1A 1ZBUA 2RHKA 2JWKA 3HTVA 2VCPA 1JLQA 1VK0A 3SJHA 5M1NA 3CMAN 4BG9A 4BC5A 1NJYA 2W6LA 3G0ZA 4JAXA 3VGMA 4NO7A 1JL1A 2PAVA 4ZHRA 3NMUA 3VEOA 1R59O 3FGUA 3E1YA 5C25A 2KFZA 4AHVA 3KLIA 5JICA 4BRNA 1J5OA 1YI2N 3LDPA 1WOQA 2FSKA 4K41A 4E1MA 2YHXA 1NK9A 1L5UA 3QMLA 4E1JA 3R3LA 5F2RA 2PY5A 4JHDA 5ADXA 2VGNA 4NLBA 4GMJB 4H0XB 4B9LA 3VGKA 4DTPA 3FLCO 4C1NK 3OYDA 1KFSA 3VA3A 4YFUA 5AZIB 4N5SA 4OO1J 3G25A 4CGGA 5M1KA 1KFDA 2HF3A 3RTVA 5AQQA 1Q9YA 4RW6A 3AO5A 4ILJA 5ADXH 1FJGK 3H1QA 1E4FT 4Y1DA 4E89A 4CEOA 1CZAN 4OPKA 3A5NC 3FZLA 4K42A 4I2PA 4J2BA 1ESVA 3GG4A 3JYTA 4DHYA 3IAYA 2PYJA 1W2BM 3MX2A 5CY4A 4BRCA 5C15A 2E6MA 2FLOA 4DB3A 5CE3A 4V19S 2Z1IA 1HJRA 4O44A 1IKWA 3KK2A 4H0YB 2KZMA 3ZETB 1LOTB 1ZBFA 2ZJQL 3N4QA 4CBUA 4KH5A 1IBLK 4QS9A 4DF4A 3B6OA 3L2UA 3NFAA 1CXQA 4CERA 1YTUA 1NGAA 4B1WB 2RN2A 1K8KA 4ISFA 1B9FA 1GOCA 2HHQA 4BDYA 2GEMA 3LANA 5EU7A 4E7LA 1TYQA 5AQOA 5CZ2A 1ATSA 3QEXA 2HHUA 3LALA 3VOVA 1QQOA 4OGEA 2RF2A 4E19A 4DQQA 3AO2A 5F0XA 1W9HA 4CIGA 2LSNA 4KTWA 1B9DA 4FLWA 1TKDA 2D0CA 5LMUK 4WFBL 3C6HA 3HSTB 3HOTA 3FFIA 2YKNA 4OPHA 3N4PA 2GELA 1YJNN 2WONA 3HSCA 5E41A 1TV6A 5AR0A 4IOCL 1HPMA 3AVNA 5AQRA 2DPNA 1QS4A
chains in the Genus database with same CATH topology
3U9ZA 3TTFA 4Z94A 5BR9A 3CC7N 5LJWA 4FOIA 2BUPA 3C7NB 2P9KA 3SMSA 4A2BA 1NGHA 3LDLA 3P31A 5C2DA 1BG3A 1DT9A 3UKRB 4EHUA 2NRWA 2UYTA 3WEEA 4A59A 5JLHA 3CCVN 1KAXA 4Y0WA 3E66A 1RDWX 1NGJA 4IEIA 4PL8A 5BN8A 3WT0A 4H5NA 3I56N 1KD1O 1NWKA 1C0GA 1OKJA 4J8FA 2I7NA 3TSQA 1MA9B 3H6EA 4FWOA 2CGKA 2BH1A 2ZWHA 2YHYA 3FZHA 5ELZA 5AFUA 4YOVA 3E9PA 1ATNA 5AZJB 4IO9L 3FR0A 3VEWA 2FF6A 3A5MC 3CMEN 2E2OA 3F5TA 3GL1A 4O5FA 4WQ4C 3J7ZO 4KBOA 3H1VX 1YAGA 1K9MO 1RFQA 4H03B 2QM1A 5FPEA 3DXKA 3R6MA 1ZBSA 2D1KA 5AFUH 5JVHL 2E2QA 3A5LC 3UKUA 2V52B 4JEPA 4JKFA 4C23A 3A8YA 1U2VA 4JD2A 1QZ5A 1T6CA 4FSVA 3U4LA 1U6ZA 2NRVA 3MWTA 5AQPA 1EQYA 1KAYA 2Q1NA 3CIPA 2YHWA 3VF6A 4U7BA 5MLCQ 4JK8A 3PLAA 3F2KA 1BUPA 3R9PA 1BA0A 4JKGB 3G71N 3CPWM 4FWLA 4A5BA 1VQ6N 4BY9C 1ILYA 1WUAA 4B1YB 4BRGA 4JK7A 2WFBA 4JKBA 4MO5A 4FWNA 3D7EO 4JNEA 5GADP 3BP8A 1GLCG 1O13A 3MN9A 1J6ZA 1HJOA 3AAPA 4BGAA 4BQLA 4WFNL 2QEXN 1V4SA 3QB0A 1S72N 2FXUA 4IXCA 1M1KO 3KVGA 1IJJA 3Q7CA 1NGIA 5BREA 3O6WA 3O80A 3EZWA 2P9SB 2NRTA 1Q7YO 3WXJA 1JCFA 5HOOA 2E2PA 4B1UB 1ZC6A 1Q82O 2ITMA 3GOIA 3H3OB 3MN7A 5M1PA 1SS6A 3WXLA 3ZEUB 4YOXA 1YXQA 3VF4A 3VPZA 3GDQA 3CCJN 3C7NA 4CZGA 3NVKA 3VESA 4H0TB 5KPRA 2HMPA 3O1BA 4CZHA 4BR9A 1QVFM 3ZX0A 5GAHP 5AQZA 5GIPA 4AF1A 5GAEP 2VGMA 5KPTA 2GTDA 4RWTA 4FPAA 4BRKA 2YI1A 5CR4A 2QTDA 4WYBA 3SAGA 2V7ZA 2V51B 4ILGB 4QS7A 1JJ2M 1X3MA 5AQJA 4L3QA 2Q0UA 2WUSA 4JHDB 4FVUA 4JK9A 4AM6A 1QQMA 3D2FB 4B1XB 3WXMB 3CCLN 3CQYA 3GBTA 4FWRA 4H5TA 5E26A 1NLVA 1BDGA 1SZ2A 3DAWA 4U67L 1VQMN 1S3XA 2J4RA 2QI2A 4O8KA 2YCHA 5GINA 4BRPA 4I6MA 1Q86O 4YOYA 2GX9A 2JWLA 2KLAA 5JLFA 2P9NA 2A3ZA 4MLEA 5AZIA 1K8AO 2QWRA 1W97L 1VQON 5AQIA 3MDQA 4CZJA 1BOTO 3EL2A 3IUCA 3OA9A 5F1XA 2ASOA 2P9PB 4A62A 4PL7A 3SAHA 3G4SN 1M90O 1VQ8N 1VQ4N 2HBMA 1VQLN 5C0YA 3WXKA 3ENHA 2QWLA 2PFUA 1QHAA 4M7XA 5FPDA 5DM7L 4JKGA 1XUPO 2P9LB 3M3ZA 4EAHD 1E4GT 1Q18A 3LDOA 3K9JA 2E20A 3EN9A 3I8BA 1NJIO 4BC3A 4XH1A 4BR4A 3AGKA 5EXWA 3QBXA 1YHQN 1NGBA 1S22A 5EX5A 1X9JA 2GUPA 3J8AA 4CJ7A 5EVZA 5AQHA 4CZFA 2YJEA 3ATVA 2A5XA 4M63C 3MCPA 2F7TA 5C10A 1QVGM 4YORA 4WQ5C 4BRFA 3VENA 2IVNA 4QS8A 3M1FA 3VETA 3O8MA 4BC4A 3MN6A 1SQKA 4BG8A 3IDHA 3QICA 3VTHA 3ZETA 4CBWA 2A6AA 3ZEUA 3DXMA 1VQ7N 3EKUA 3DLLL 4C1NI 2AA4A 2H3GX 3O4WA 4DQ8A 5BRDA 5GIOA 1T44A 2CGJA 3DWLA 3VEVA 4AM7A 3CI5A 3KHYA 3L4QA 4KH6A 4XH5A 2P9IB 4IEEA 4BVPA 3SBGA 4MO4A 3WXIA 1K8KB 1YVNA 1BWFO 1EO1A 2ASMA 1Z6RA 2NLXA 5M1FA 1JCGA 1GLLO 3JXUA 3SAFA 3CJ7A 3QFPA 2A42A 1TYQB 5AQUA 4XH4A 3VERA 1NGGA 1KC8O 5CHIA 1YIJN 2QWQA 4WCEL 4IOXA 1IG8A 4G9ZA 1QQNA 1BO5O 1HLUA 2VWBA 3CPEA 3R1XA 5FPNA 4B1VA 3I55N 2CGLA 3W0LA 1P90A 3CETA 4KH4A 3WQUA 4H5RA 1T6DA 3HZ6A 1TUYA 2AP1A 3M5RA 2ASPA 4BR7A 1YJWN 4M7YA 2HBLA 4H0OA 5JMVA 2P9UA 4BGBA 1BU6O 3EO3A 1Y64A 4IDHA 2NRHA 4BVOA 4FL9A 4FWSA 5E84A 3ZYYX 4GV9A 1MWKA 4HWIA 2FSJA 5KQ8A 3LL3A 4JKEA 2NNWA 4A61A 1VQ5N 3RSEA 1KXPA 3S41A 1NGFA 4BRDA 3SBTA 2A41A 3CC4N 3P38A 1VQPN 2HSTA 4BR5A 2P9LA 4H5WA 2HBJA 3ID8A 1K73O 3JS6A 3SMPA 3CJBA 4IO8A 5C12A 3BF1A 3CERA 4LC9B 2QA4N 4YOUA 2P9KB 1TUUA 4JKHA 5BN9A 4RCHA 3U9DA 3VMFB 3F9MA 4CD1A 3UKRA 3WEEB 2Q0RA 5KQDA 2QWMA 1GLFO 3ENOA 2W41A 5HL7L 2IIRA 3A0IX 2V7YA 3VF2A 5AQSA 5AQTA 4ISGA 4BRIA 4DKWA 4BRMA 4ILHA 4B9QA 4IWVA 4FO0A 2Q31A 2A40A 4H0VB 4EFHA 3ZX3A 3EKSA 1GLAG 3U8XA 3WUHA 2WC9A 3UB5A 1NGCA 1JCEA 3QFUA 4OPAA 5GAGP 5AZJA 1G99A 4GV6A 3BF3A 3O9SA 4IJAA 3H3NO 4BREA 2Q36A 4YOWA 3CHWA 4MDAA 4WFAL 2D0PA 4RTFD 3EE8A 3IMXA 3CXCM 1OVYA 4F9OA 2QWNA 2P9IA 3TSUA 3FZMA 3WQTA 2NZTA 4NB4A 3MCAB 1GLJO 4MLHA 3L6QA 2OTLN 3C0BA 3UKUB 1LCUA 4GVEA 5BRHA 3BEXA 1KQSM 2D4WA 3UE5A 1U2VB 4JD2B 2ZGZA 3FZKA 1RDUA 5EY4A 3CC2N 1BA1A 1V4TA 3E9LA 2ZGYA 5FPMA 3P39A 4IZ9A 3HM8A 4O8UA 4XEIA 1VQNN 1P8ZA 2QWPA 1DGKN 3AY9A 5TKYA 4FWKA 3B8AX 4PHTX 4WQ4A 2OANA 3M6GA 2QWOA 3W3DA 1MWMA 4GNIA 3C65A 1HKGA 5BRFA 2HOEA 2ZJRL 2IVOA 2HBKA 3OBYA 3FE1A 2RHKA 2JWKA 3HTVA 3K9KA 3D2EB 3TSPA 3OBWA 4K25A 2EWSA 3AAQA 3O9TA 2VCPA 5AQWA 4PKIA 5M1NA 3SJHA 3CMAN 5BPMA 2CH6A 4BG9A 4BC5A 2P9SA 1GLBG 4JKAA 5H1SQ 4JAXA 3VGMA 4NO7A 4IOCL 1VQ9N 3CCMN 3MK6A 3LM2A 2PAVA 2YJFA 3BUZB 4DCHA 3NMUA 3L4IA 3VEOA 3CCSN 1R59O 3CQXA 3FGUA 3E1YA 1D4XA 2Q2RA 3CD6N 4WF9L 3KWIA 4B1ZA 5JICA 2D0OA 2NRXA 3NVMA 4H5VA 3RVCA 1ATRA 4BRNA 1DKGD 4JKDA 1SAZA 1YI2N 3LDPA 2E2NA 3LDQA 5M1QA 3O5BA 5AQKA 2QXLA 1WOQA 5JVGL 2FSKA 4K41A 2YHXA 5EOYA 3ZX2A 4A5AA 3C6AA 3QMLA 5AQXA 4E1JA 2PBDA 5I9EB 3R3LA 2NRRA 2KHOA 3D6RA 5F2RA 4JHDA 3CJ9A 3D2FA 3O1WA 2VGNA 1DEJA 2ZF5O 5ADXA 3CCUN 4NLBA 1YUWA 1C0FA 3VTIA 4H0XB 3CJAA 4CZLA 3VGKA 3CJ1A 3ID6A 3MWPA 3FLCO 4C1NK 2IVPA 2F9WA 3FZFA 3ATUA 3HBTA 4I6MB 4H0PA 5M1OA 2P9NB 5AZIB 4BRLA 4GY2B 1YITN 3ULEB 4OO1J 2OTJN 3G25A 5M1KA 3PIPL 2HF3A 3SK3A 5AQQA 2P9PA 4ILJA 5ADXH 3H1QA 1E4FT 3TTDA 4CI6A 5KPZA 2BTFA 4HTLA 4CZIA 3ENBA 3A5OC 1CZAN 2VYPA 3MN5A 4FOEA 3TU5A 4ISEA 3VEZA 3PIOL 5AQFA 1GLDG 3A5NC 3FZLA 1HUXA 4BQZA 1XQSC 1T3VA 1HKCA 4FWPA 4GV3A 4A57A 2GWKA 1Z05A 3O9RA 4K42A 2GWJA 3O9QA 4K43A 1MDUB 5TKWA 3TPQA 3O08A 1ESVA 3QDKA 3CCQN 1XC3A 5LJVA 3GG4A 4IOAL 4DHYA 5DM6L 3D2EA 3DJCA 1QZ6A 3FFKB 4CZEA 1W2BM 1YF5L 3MX2A 4YOTA 4A2AA 5BPNA 3VEYA 4BRCA 1Q81O 4YDUA 3T69A 5C15A 2FLOA 2KKZA 3KWGA 4EIAA 4R79A 1VAZA 1H1VA 3O9UA 4DB3A 3G6EN 5CE3A 1ZXOA 3Q7BA 4EHTA 1VQKN 4H0YB 3SLCA 2W40A 3ZETB 2E8AA 1LOTB 2FSNA 1HX1A 3HI0A 1X3NA 1KAZA 3DXMB 3EE9A 2HF4A 2ZJQL 3GE1A 3N4QA 4CBUA 5LY3A 4KH5A 1HKBA 4QS9A 1N8RO 2NRZA 4CD3A 1YJ9N 2E1ZA 2F9TA 5AQMA 1NGAA 3DXKB 5C2FA 4MDBA 4B1WB 4BRAA 2E88A 2I7PA 1K8KA 4ISFA 4WQ5A 3H46O 5AQYA 4BR2A 4IJNA 3LM9A 2GEMA 4CZMA 4UY8O 3QBWA 1NBWA 1TYQA 5AQOA 4BR0A 4FPBA 1ATSA 2YX6A 3IKMA 5AQNA 4PKHA 2WBNA 3P4IA 3VOVA 3HRGA 1QQOA 3VEXA 5AQVA 2FF3B 2E1YA 5BPLA 5AQLA 5AQGA 1NGEA 5F0XA 1NM1A 3CCRN 3I33A 4NLCA 3IFRA 3T7ZA 4FWMA 4FWQA 4WFBL 3C6HA 3H45C 4BC2A 3HOTA 2P9UB 3ULEA 3KK7A 4BRQA 3VGLA 2QW9A 4PKGA 3KZBA 3LDNA 3MMVA 4OPHA 3CJCA 3L0QA 3OHRA 3N4PA 1NGDA 1NMDA 4CZKA 2GELA 4YDUC 2ZJPL 3HSCA 1YJNN 4JKCA 5AR0A 3RSEB 3HOSA 3AGRA 1GLEG 4BRHA 3CF5L 1HPMA 2CH5A 4IFEA 3TTCA 5AQRA 4BROA 4CBXA 3OW2M 2Q97A 3E9OA 3AARA 1RGIA 3CCEN 2RE2A 4JN4A 2DPNA 5B8HA 3MX5A 3R8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2D A;  5C15 A;  4IFE A;  5M1Q A;  3C6H A;  4IEE A;  5C2F A;  5C12 A;  3CPE A;  5M1O A;  5M1F A;  5M1N A;  5C10 A;  5M1P A;  3C6A A;  4IDH A;  5M1K A;  4IEI A; 
#chains in the Genus database with same CATH topology
 1KLM A;  3HM9 A;  4DSJ A;  4KO0 A;  5BR9 A;  4B3M K;  3CC7 N;  1L3V A;  4FOI A;  2BUP A;  2P9K A;  3SMS A;  3AVG A;  1U45 A;  3LDL A;  3P31 A;  3NDK A;  1DT9 A;  1HYZ A;  2NRW A;  4A59 A;  3RMD A;  4IEI A;  4MQ3 A;  4H5N A;  3L2V A;  4DTR A;  1NWK A;  4CW7 B;  1C0G A;  1KD1 O;  1OKJ A;  4J8F A;  2I7N A;  1MA9 B;  2CGK A;  2BH1 A;  2PZS A;  5ELZ A;  1Q8I A;  2PYL A;  1REV A;  3L2Q A;  5AZJ B;  4DUY K;  3VEW A;  4B9N A;  4HCC A;  3F5T A;  3GL1 A;  1VSI A;  1KCF A;  3WNE A;  3ZSZ A;  2KFN A;  4C8M A;  2HVH A;  1CLQ A;  2QM1 A;  4CED A;  1I94 K;  1EKE A;  5AJ3 K;  3U4L A;  4FSV A;  5AQP A;  1HQU A;  3NE6 A;  3CIP A;  3F2K A;  1BUP A;  1BA0 A;  4JKG B;  1EP4 A;  4FWL A;  3AVC A;  3BY5 A;  3LAK A;  5HP1 A;  4JKB A;  3D7E O;  1TL1 A;  3HYF A;  1HJO A;  4L8R B;  1ITG A;  4CGF A;  1S72 N;  3PX0 A;  4KHU A;  2P9S B;  2NRT A;  4ELU A;  1TGO A;  1ZC6 A;  3C6U A;  3OYB A;  4ICL A;  4FJH A;  3HVT A;  1YXQ A;  3U3G A;  3SI6 A;  4WE1 A;  3O4N A;  4CEB A;  2X78 A;  3AVH A;  4BAC A;  5KPR A;  2HMP A;  5GAH P;  1BIS A;  3RRG A;  2UXB K;  5GAE P;  2VGM A;  5KPT A;  2GTD A;  1RT3 A;  2DFE A;  1JJ2 M;  4Z4H A;  2G8H A;  1XC9 A;  1OH8 A;  4IFY A;  3D2F B;  2UU9 K;  4B1X B;  1IO2 A;  2G8W A;  1NLV A;  3DAW A;  4K8X A;  4O8K A;  4DU3 A;  1RNH A;  1JXE A;  5GIN A;  3J81 O;  4MLE A;  2QWR A;  1VQO N;  5AQI A;  4CZJ A;  1SL2 A;  5F1X A;  4PL7 A;  2P9P B;  1OH5 A;  1M90 O;  4O0J A;  3OS1 A;  4DLE A;  5C0Y A;  4OGC A;  3L8B A;  3MED A;  4DUZ K;  2UUA K;  1IG9 A;  1RBU A;  3OYF A;  1HYV A;  4EAH D;  1U47 A;  1WSE A;  4HVJ A;  4DR6 K;  3DRS A;  3M8P A;  3AGK A;  4JRP A;  2UXD K;  1NGB A;  3TAF A;  4CJU A;  2GUP A;  4R5P A;  5EVZ A;  3ATV A;  1C1A A;  3WNH A;  1XMO K;  3AA4 A;  2OPP A;  4WQ5 C;  4DSE A;  1CZ9 A;  3VTH A;  3V1O A;  2G8V A;  3DXM A;  3EKU A;  3DLL L;  1QE1 A;  2AA4 A;  3VQE A;  3RMA A;  3L4Q A;  1VRT A;  4BVP A;  1HNW K;  4MO4 A;  3WXI A;  1Z6R A;  3THW A;  1GLL O;  3QFP A;  1L3T A;  3NAE A;  4IOX A;  3P5J A;  1HLU A;  2RKI A;  4HUE A;  5KTQ A;  1P90 A;  4JI4 K;  2O8E A;  2D0B A;  1DLO A;  1EX4 A;  1YJW N;  4H0O A;  3THX A;  3EO3 A;  1WSH A;  3ZYY X;  2O8F A;  4HWI A;  4CJ3 A;  3HPH A;  4LH4 A;  5KQ8 A;  3LL3 A;  4A61 A;  2NNW A;  4KHW A;  3OJU A;  1VQ5 N;  4HTU A;  4YNQ A;  4FCY A;  3CJB A;  4LF7 K;  5HLF A;  3CER A;  4NCB A;  1BQM A;  2Z1H A;  2QA4 N;  4YOU A;  1SL0 A;  4JKH A;  2JGU A;  4LFC K;  4CD1 A;  3F9M A;  1VSE A;  3UKR A;  2QWM A;  3ENO A;  3J7Y P;  3U6F A;  2W41 A;  3VF2 A;  5AQS A;  4BRI A;  1JLC A;  4OJR A;  2ZE2 A;  4B9Q A;  4IWV A;  4H0V B;  5C24 A;  3WUH A;  3UB5 A;  1NGC A;  3C94 A;  1X9M A;  1G99 A;  1VSF A;  3NGY A;  4IJA A;  2Q36 A;  3CHW A;  3CXC M;  4RTF D;  1OVY A;  2BAN A;  3KKS A;  3WQT A;  4DFJ A;  3MEC A;  4DTJ A;  3TAG A;  1YVU A;  4BWM A;  3HJF A;  1IKY A;  1U2V B;  2VG6 A;  3DI6 A;  1BA1 A;  1V4T A;  5FPM A;  2ZGY A;  3P39 A;  2O8C A;  4W5O A;  2QWP A;  5TKY A;  4K0K K;  4WQ4 A;  5DK5 A;  4LF5 K;  3V81 A;  3W3D A;  1HKG A;  3OYM A;  4JI2 K;  5J2Q A;  3AVL A;  4M3U A;  2G8K A;  1QHT A;  4CJV A;  5AQW A;  3LZI A;  3RR8 A;  5BPM A;  2CH6 A;  3V9Z A;  3V9X A;  4KI6 A;  3MK6 A;  4DCH A;  4B8C A;  4ZTJ A;  3L4I A;  3CCS N;  4CHN A;  3CQX A;  2QXF A;  1WN7 A;  3AVI A;  4WF9 L;  3B6P A;  3KWI A;  4H5V A;  3RVC A;  1DKG D;  1TKX A;  2HNY A;  4FJJ A;  4LF8 K;  3O5B A;  1JKH A;  2QXL A;  3ZX2 A;  4FJ7 A;  5AQX A;  2NRR A;  1LWE A;  2ITG A;  4BE1 A;  3QIN A;  3O1W A;  4Z4E A;  1BL3 A;  3OYK A;  3VTI A;  1C0F A;  1RBV A;  4DTX A;  3RWU A;  4CJQ A;  3ID6 A;  3KD1 E;  3K2P A;  3FZF A;  4H0P A;  2P9N B;  4BRL A;  4GY2 B;  1S1T A;  3ULE B;  1YIT N;  4DR4 K;  4DR7 K;  1S5J A;  2BTF A;  4OKK A;  4B9V A;  4DG1 A;  3A5O C;  2VYP A;  3TU5 A;  3QEI A;  4LD0 A;  4ISE A;  4RW9 A;  4W5N A;  4FJG A;  2KTQ A;  4BQZ A;  1J53 A;  1HKC A;  4GV3 A;  4A57 A;  1NMN A;  4KTQ A;  2O8B A;  3O9Q A;  1MDU B;  2YNG A;  5TKW A;  3CCQ N;  4CFA A;  4CGD A;  1SKR A;  4CZE A;  1IBM K;  1YF5 L;  4A2A A;  2OA8 A;  1RCH A;  1WBD A;  3F9K A;  3ZSO A;  2KKZ A;  1XNR K;  4EIA A;  4CJT A;  2NUB A;  4IDK A;  3AVJ A;  3QES A;  4NXN K;  3O3G A;  1WLJ A;  2E8A A;  1HX1 A;  4F4K A;  4Z4C A;  2OZM A;  3DRP A;  3KD5 E;  2NRZ A;  4FZZ A;  1NK5 A;  4CD3 A;  1YJ9 N;  3DXK B;  5C2F A;  2YNF A;  3DYA A;  4MDB A;  4DR5 K;  1RT4 A;  4BRA A;  2UUB K;  4GKJ K;  4I9L A;  4DQI A;  4UY8 O;  3TAQ A;  1NK4 A;  1NBW A;  2O4I A;  1D9F A;  4AHR A;  1C0T A;  2WBN A;  3LP0 A;  4JYA K;  2FF3 B;  1WB9 A;  3SUQ A;  3NF8 A;  3SYZ A;  3ZT1 A;  2QKB A;  3ASM A;  1RDB A;  2P5O A;  3I33 A;  3IFR A;  3T7Z A;  4Z4F A;  3H45 C;  4DLG A;  2P9U B;  4EP4 A;  4BRQ A;  3KK7 A;  2OPR A;  1NOY A;  3MMV A;  4CEE A;  2HHH K;  2O8D B;  2JLE A;  4J2D A;  1S9E A;  3NF6 A;  1NMD A;  4CZK A;  2IAJ A;  4LF9 K;  4JKC A;  4B9T A;  3HOS A;  4M3W A;  3T1H K;  3TTC A;  3ZT4 A;  3E9O A;  2KZZ A;  3AVM A;  5LJW A;  4K8Z A;  3MX5 A;  2YV0 X;  3TSP A;  3R8E A;  1SL1 A;  2KQ2 A;  2G8F A;  1NK8 A;  3LPU A;  3C7N B;  4A2B A;  4DFM A;  1S1W A;  4Y0W A;  2WTU A;  4PL8 A;  4ELT A;  3WT0 A;  2X74 A;  3OYH A;  3VQ4 A;  3TSQ A;  4FWO A;  2ZWH A;  2YHY A;  3FZH A;  2GV9 A;  3BZK A;  2BGG A;  1ATN A;  1BI4 B;  3JAM O;  2FF6 A;  4IG3 A;  4KHS A;  4O5F A;  3LP2 A;  2F96 A;  3H1V X;  1RFQ A;  1NJX A;  5FPE A;  3CFR A;  1HRH A;  1ZBS A;  3A5L C;  1DTQ A;  4JEP A;  3OYC A;  4NCA A;  1RBR A;  5HRN A;  1QZ5 A;  2FBX A;  5HRR A;  3MWT A;  3KLG A;  1EQY A;  3CFP A;  1UAX A;  2DFF A;  4CJL A;  4IFV A;  5LL6 Z;  2WFB A;  3THY A;  3V9U A;  4M42 A;  1GLC G;  4AH9 A;  3SQ4 A;  4CHQ A;  4BQL A;  3AAP A;  4BGA A;  1T05 A;  1KVB A;  3OVN A;  1M1K O;  3KVG A;  3Q7C A;  1NGI A;  5BRE A;  3O6W A;  3O80 A;  3EZW A;  1Q7Y O;  3WXJ A;  1JCF A;  4B1U B;  1YT3 A;  3KLE A;  3H3O B;  5M1P A;  3OTO K;  3WXL A;  3ZEU B;  2FBV A;  3BGR A;  3QEP A;  4YOX A;  3VF4 A;  2HNZ A;  3VPZ A;  3GDQ A;  1ZBI A;  1XNQ K;  1S1U A;  4JV5 K;  4YHH K;  4CZH A;  4PQU A;  4B8A B;  3ZX0 A;  5GIP A;  4AF1 A;  1WNS A;  4FPA A;  2YI1 A;  1I3A A;  3VQ9 A;  2V51 B;  4QS7 A;  4L3Q A;  4QCL A;  2WUS A;  4JHD B;  1U04 A;  4JK9 A;  1Z26 A;  1QQM A;  2RPI A;  4PWD A;  3HP6 A;  1SZ2 A;  1VQM N;  4U67 L;  2J4R A;  2D5R A;  1HNX K;  1KRP A;  2XHB A;  2YCH A;  3OY9 A;  3SNN A;  4I6M A;  3K0S A;  2GX9 A;  4O4G A;  1K8A O;  1W97 L;  3MDQ A;  4Z4I A;  1BOT O;  3CG7 A;  4FJL A;  3SAH A;  2KW4 A;  1VQ8 N;  4A62 A;  4B3S K;  3KK1 A;  4LF4 K;  2R7Y A;  1VQL N;  1JLE A;  1C1C A;  2QWL A;  4M3X A;  2YKM A;  4JKG A;  1NKC A;  3AO4 A;  3V1Q A;  1KSP A;  1BGX T;  3M3Z A;  1E4G T;  2VWJ A;  1Q18 A;  2E20 A;  3EN9 A;  3I8B A;  1J5E K;  4LFA K;  3SQ0 A;  2YHB A;  1YHQ N;  2YNH A;  4CF2 A;  1X9J A;  3OJS A;  1LWF A;  5C10 A;  1QVG M;  4YOR A;  1QSL A;  4BC4 A;  3MN6 A;  4BG8 A;  3S3O A;  3QIC A;  4C8N A;  1XWL A;  2A6A A;  1RT1 A;  4DR1 K;  3NH0 A;  1E3M A;  4DWI A;  1RT2 A;  4DQ8 A;  5BRD A;  3K5N A;  4AM7 A;  3DWL A;  3CI5 A;  4KH6 A;  2P9I B;  4CF8 A;  4H8K A;  3AA2 A;  1K8K B;  1EO1 A;  4FJK A;  2FBY A;  4B9M A;  2IC3 A;  5M1F A;  1JCG A;  3JXU A;  4Y1C A;  3CJ7 A;  3NHG A;  3EYZ A;  1TYQ B;  4AHT A;  1LWC A;  1NGG A;  3VQP A;  3TAM A;  4DQS A;  2VWB A;  1BO5 O;  4B1V A;  2G8U A;  3I55 N;  4FLU A;  3HO1 A;  1NK6 A;  4DV4 K;  3HVR A;  1S6Q A;  3WQU A;  3HZ6 A;  3M5R A;  2AP1 A;  2Y1I A;  4BR7 A;  4KKO A;  1EWQ A;  2P5G A;  3DLK A;  1SKW A;  5JMV A;  4DQP A;  2HHT A;  4F3O A;  1Y64 A;  4IDH A;  3NCI A;  4FWS A;  2F8S A;  4GVM A;  4KI4 A;  4OKE A;  3RSE A;  3S41 A;  4FLY A;  1ZBL A;  3VQC A;  3O3F A;  1VQP N;  3P38 A;  4DV6 K;  2HBJ A;  1VHX A;  5C12 A;  4FJ8 A;  4DSK A;  2P9K B;  1TUU A;  4FM1 A;  1LAV A;  2VWK A;  3IRX A;  5BN9 A;  3U9D A;  2A1S A;  4KB0 A;  1Q9X A;  3SQ1 A;  2Q0R A;  3PUF A;  4QAG A;  2IIR A;  4KAZ A;  2V7Y A;  3QER A;  5AQT A;  4ISG A;  4ILH A;  4FO0 A;  2A40 A;  3K57 A;  4FW1 A;  3U8X A;  3DRR A;  3ISN C;  3QFU A;  4LSL A;  4B08 A;  3OS0 A;  3ZSR A;  3BF3 A;  3OYG A;  2DTU A;  4DFP A;  4CK2 A;  5SWM A;  4MDA A;  2D0P A;  3EE8 A;  3S9H A;  2DFH A;  1WSI A;  4IG0 A;  5JS1 A;  3RR7 A;  3S3M A;  4NB4 A;  1GLJ O;  4MLH A;  3VQB A;  1SV5 A;  3UE5 A;  3D0P A;  3PO5 A;  5EY4 A;  3CC2 N;  3ZSX A;  4IZ9 A;  3HM8 A;  4HUF A;  4H4O A;  1VQN N;  1P8Z A;  3SV4 A;  1D9D A;  1RT5 A;  2Q3S A;  4PHT X;  2OAN A;  2B5J A;  3M6G A;  4FM2 A;  2ZJR L;  1JLF A;  1LW2 A;  2HBK A;  3DLE A;  4LFB K;  1IBK K;  3G10 A;  4FLV A;  3D2E B;  4K25 A;  2EWS A;  3AAQ A;  3VQ7 A;  4DV0 K;  3AA3 A;  4GKK K;  2B4J A;  1GLB G;  3CCM N;  1J54 A;  3LM2 A;  2YJF A;  4M41 A;  1HNV A;  1CZB A;  5HRP A;  1BCM A;  1G15 A;  3CD6 N;  4J2E A;  3P83 D;  3KLF A;  1ASU A;  4B1Z A;  3NVM A;  4AIL C;  1ATR A;  1FK9 A;  3F73 A;  3H08 A;  3I0S A;  4JKD A;  4NYF A;  4W5R A;  1SAZ A;  4BE0 A;  2E2N A;  1UWB A;  5M1Q A;  2XY6 A;  5AQK A;  4CJ5 A;  1T03 A;  3NF7 A;  4LSN A;  5JVG L;  3C6A A;  3HPG A;  1NK7 A;  2HND A;  5I9E B;  2KHO A;  1QQC A;  2FC0 A;  3CCU N;  3HT3 A;  4E1N A;  2XY7 A;  4X66 K;  3A2F A;  3CJA A;  4CEC A;  1U4B A;  1FXX A;  3MWP A;  3S3N A;  1UA1 A;  1L3U A;  2IVP A;  4CJE A;  3HBT A;  4F8R A;  5KGW A;  4CHY A;  2EHG A;  2OTJ N;  1RDD A;  3PIP L;  1HPZ A;  4OKJ A;  3K5L A;  4M3R A;  3TTD A;  3O4Q A;  3K58 A;  5KPZ A;  1QSS A;  4HTL A;  2HHS A;  3MN5 A;  3VEZ A;  3PIO L;  1TK0 A;  5AQF A;  1WBB A;  1GLD G;  4N47 A;  1HUX A;  4QOZ B;  1XQS C;  1T3V A;  3K5O A;  4FWP A;  1Z05 A;  3QIO A;  2HB5 A;  4K43 A;  3VQA A;  4AQY K;  3CYM A;  3TPQ A;  3O08 A;  3QDK A;  1XC3 A;  5LJV A;  3DJC A;  3FFK B;  1O1W A;  1EET A;  5BPN A;  1Q81 O;  4YDU A;  4M3T A;  2IS3 A;  4R79 A;  4RW8 A;  1VAZ A;  1IH7 A;  5J2P A;  1H1V A;  4DSI A;  3O9U A;  5FLX O;  3G6E N;  4FJI A;  5FRN A;  1ZXO A;  3T19 A;  4CIE A;  4EHT A;  2W40 A;  3HI0 A;  1KAZ A;  3DXM B;  3EE9 A;  4FJ9 A;  3SUN A;  3DMJ A;  3L2R A;  3TWH A;  3V6D A;  1RTD A;  1EWR A;  1YTA A;  2F9T A;  5AQM A;  1J9A A;  1VSL A;  2E88 A;  2I7P A;  4W5Q A;  3CQ8 A;  3H46 O;  2UXC K;  3CM6 A;  2F8T A;  1OH7 A;  4BR0 A;  2OZS A;  2E4L A;  2YX6 A;  4PKH A;  4F2R A;  4PA1 A;  3HRG A;  2E1Y A;  4JI1 K;  5AQL A;  5AQG A;  1FKP A;  1BQN A;  1NGE A;  4CFC A;  3HL8 A;  2O8E B;  3CCR N;  4X64 K;  2HW3 A;  2ETJ A;  4FWM A;  3THX B;  3ULE A;  4KPY A;  3T1A A;  2QW9 A;  4PKG A;  3LDN A;  2XO7 A;  3IG1 A;  3WNG A;  2O8F B;  3CJC A;  3L0Q A;  5J2M A;  3HP9 A;  3CM5 A;  3NGI A;  2ZJP L;  4YDU C;  1X9W A;  2QK9 A;  3HPO A;  2XY8 A;  4BRH A;  4IFE A;  3AAR A;  2RE2 A;  2D0A A;  1T7P A;  3J7A P;  4CFD A;  3NBP A;  4DV2 K;  1NGH A;  1DTT A;  3OYJ A;  1S9G A;  4DS4 A;  3UKR B;  3ZSY A;  2UYT A;  3WEE A;  3CCV N;  3TAP A;  5JS2 A;  3E66 A;  3I56 N;  3OYE A;  1RT6 A;  4KV8 A;  4CF0 A;  4DR3 K;  3H6E A;  2IOC A;  5AFU A;  4YOV A;  3OS2 A;  5SZT A;  3FR0 A;  3A5M C;  1RT7 A;  3ITH A;  3CME N;  4FK0 A;  4WQ4 C;  3J7Z O;  4KBO A;  3QNO A;  4H03 B;  2P51 A;  4E7H A;  3DXK A;  1WAF A;  4CEZ A;  4BWJ A;  1NOZ A;  5AFU H;  3I8D A;  1TL3 A;  3UKU A;  4DTM A;  4JKF A;  4C23 A;  4JD2 A;  3QO9 A;  4CGJ A;  4DTU A;  1U6Z A;  2NRV A;  3OYA A;  3BDP A;  2O8C B;  1KAY A;  5K14 A;  4E3S A;  3UIQ A;  3VF6 A;  4CES A;  1S1X A;  5MLC Q;  1IV0 A;  4I9Q A;  2Y1J A;  1WSF A;  3CPW M;  4PY5 A;  4A5B A;  1ILY A;  1WUA A;  4M45 A;  3LP3 A;  4MO5 A;  3VQ6 A;  4JNE A;  5KRT A;  5GAD P;  3BP8 A;  5HBM A;  1KTQ A;  3MN9 A;  2QEX N;  1V4S A;  3QB0 A;  4IXC A;  3ZT0 A;  1IJJ A;  2I5J A;  4BDP A;  3KKR A;  1W0H A;  4EZ9 A;  1TVR A;  2VG5 A;  5KI6 A;  2ITM A;  3GOI A;  1SS6 A;  2G8I A;  3CCJ N;  3C7N A;  4JI6 K;  4CZG A;  3ULD A;  3VES A;  4H0T B;  3MEE A;  3O1B A;  1QTM A;  1QVF M;  4BR9 A;  5A2Q O;  2OPS A;  5CYQ A;  2Z1J A;  5DMR A;  4BRK A;  2QTD A;  1MU2 A;  3M8Q A;  4WYB A;  3SAG A;  3MXI A;  2V7Z A;  1X3M A;  2Q0U A;  1BI4 A;  4AM6 A;  1IKX A;  1GOA A;  3WXM B;  4FXD A;  2OCE A;  3CQY A;  3GBT A;  4FWR A;  3OYN A;  1BDG A;  4C8K A;  4IKF A;  2QI2 A;  4BRP A;  4EZ6 A;  3LPT A;  5AZI A;  2A3Z A;  5JLF A;  2E5L K;  4HUG A;  3IUC A;  1LV5 A;  3OA9 A;  1K6Y A;  2ASO A;  4FJ5 A;  1N32 K;  3G4S N;  2HBM A;  4DV1 K;  4DTN A;  1WSG A;  3AVB A;  2PFU A;  4KFB A;  4M7X A;  5DM7 L;  1XHZ A;  2P9L B;  3LDO A;  2O8B B;  3LWM A;  3OYI A;  1HNI A;  4BR4 A;  4CJ4 A;  1S22 A;  4TSX A;  3J8A A;  2YHA A;  4CJ7 A;  4XIU A;  5AQH A;  3VQ5 A;  4CZF A;  1HYS A;  4M63 C;  3SJJ A;  2WOM A;  1D8Y A;  2F7T A;  3VN5 A;  3RRH A;  3ZT3 A;  3VEN A;  4LH5 A;  4QS8 A;  3M1F A;  3VET A;  3O8M A;  3C95 A;  3MAQ A;  3IDH A;  3ZET A;  3SQ2 A;  3ZEU A;  4C1N I;  4CCH A;  2H3G X;  3O4W A;  5T7B A;  4FZY A;  5GIO A;  3VEV A;  3U3Y A;  3KHY A;  3AV9 A;  1YVN A;  1BWF O;  4RG8 A;  4DV3 K;  3SAF A;  1KC8 O;  4BDZ A;  3SUO A;  4WCE L;  2HHX A;  1IG8 A;  4G9Z A;  1QQN A;  3CPE A;  2CGL A;  3W0L A;  4KH4 A;  4B9S A;  4H5R A;  1T6D A;  1TUY A;  2F4V K;  4BGB A;  3AVA A;  4BVO A;  1RDA A;  3M8R A;  4OPJ A;  3PY8 A;  4KB1 A;  2FSJ A;  1UOC A;  3K59 A;  1HNZ K;  4OLB A;  4JKE A;  1NGF A;  4BRD A;  3NH2 A;  3CC4 N;  4M3Y A;  4KRF A;  4H5W A;  4IBN A;  4B9U A;  3QET A;  1BIZ A;  2VQF K;  1A5X A;  2QKK A;  3VMF B;  4J2A A;  1BCO A;  3EEQ A;  1GLF O;  3RMB A;  5HL7 L;  4FJN A;  1KLN A;  3SPZ A;  2FBT A;  4CHO A;  1S6P A;  4CJW A;  4EFH A;  3EKS A;  1GLA G;  3PX6 A;  1JCE A;  5AZJ A;  3AO3 A;  4GV6 A;  3DM2 A;  3VA0 A;  3PO4 A;  4BRE A;  4FLX A;  4X62 K;  3QLH A;  3IMX A;  3DOK A;  4FLZ A;  4F9O A;  3L3U A;  4UQG A;  2P9I A;  1Y97 A;  4E7J A;  4CEF A;  4YY3 K;  4DQR A;  3EZ5 A;  4DU1 A;  3DLB A;  3L6Q A;  1X9S A;  1LCU A;  4GVE A;  5BRH A;  2OYQ A;  1RDU A;  3E9L A;  3MEG A;  5IT9 O;  4RW4 A;  4XEI A;  1OH6 A;  4X65 K;  1DGK N;  3AY9 A;  1N6Q A;  4FWK A;  1ZBH A;  3IS9 A;  3SV3 A;  2QWO A;  4FLT A;  1MWM A;  4GNI A;  3C65 A;  3LDS A;  3VQQ A;  3THY B;  2IVO A;  3OBY A;  4JI0 K;  1IKV A;  4JLH A;  5I3U A;  3K9K A;  4BE2 A;  3OBW A;  1CXU A;  3O9T A;  4PKI A;  2P9S A;  3KJV A;  4JKA A;  5H1S Q;  1VQ9 N;  4Z0U A;  1NNE A;  4CK3 A;  1N36 K;  1A5V A;  3BUZ B;  1KVA A;  5J1E A;  4JS5 A;  1VSD A;  1D4X A;  1NG9 A;  2Q2R A;  3OYL A;  3AA5 X;  1RTH A;  2D0O A;  2NRX A;  4CF9 A;  2DY4 A;  4O55 A;  2ZD1 A;  3V4I A;  3LDQ A;  5EOY A;  3SCX A;  4A5A A;  1KVC A;  4EP5 A;  2PBD A;  4OVL A;  1UA0 A;  3D6R A;  4LY7 A;  4DS5 A;  1JLA A;  3CJ9 A;  3D2F A;  1DEJ A;  2ZF5 O;  4AHU A;  1YUW A;  3KLH A;  3QIP A;  4CZL A;  3V1R A;  3CJ1 A;  1OVQ A;  2E6L A;  4I6M B;  2F9W A;  4KHP K;  3ATU A;  5M1O A;  3SK3 A;  2P9P A;  4KHY A;  1F21 A;  4CI6 A;  4I7F A;  4CZI A;  3ENB A;  4FOE A;  5LMN K;  3T3F A;  3ZSV A;  4F3T A;  3BZC A;  2GWK A;  3O9R A;  3VQ8 A;  1SUQ A;  2GWJ A;  1U48 A;  3LWL A;  3PV8 A;  4IOA L;  5DM6 L;  2Z1G A;  3D2E A;  1QZ6 A;  4YOT A;  1NK0 A;  1BHL A;  3VEY A;  5FRO A;  3T69 A;  4W5T A;  4B3O A;  1RTI A;  3KWG A;  4PUO A;  4KTZ A;  3DLR A;  2A1R A;  3Q7B A;  1VQK N;  3SLC A;  1JLB A;  1WAJ A;  4G1Q A;  2FSN A;  2ZQB A;  1R0A A;  4NXM K;  1X3N A;  1X1P A;  3CFO A;  3LP1 A;  2HF4 A;  3QNN A;  3GE1 A;  5LY3 A;  1HKB A;  3KIO A;  1N8R O;  2E1Z A;  3TI0 A;  1ASV A;  3QEW A;  2GBZ A;  3J80 O;  4CVN E;  3L3V A;  4WQ5 A;  1JXB A;  3M8S A;  5AQY A;  4BR2 A;  1ASW A;  3LM9 A;  4IJN A;  4CZM A;  3QEV A;  3QBW A;  3TAN A;  4OX9 K;  4FPB A;  3IKM A;  5AQN A;  1NJW A;  3P4I A;  4E7K A;  1VSK A;  3VEX A;  5AQV A;  3ZSW A;  1W7A A;  4CHZ A;  5BPL A;  1FW6 A;  2HMI A;  1NM1 A;  1WSJ A;  4NLC A;  4JS4 A;  4FWQ A;  4N76 A;  3PX4 A;  4BC2 A;  1TKZ A;  4CEQ A;  3VGL A;  3ALY A;  3KZB A;  4DMN A;  4CJK A;  3P1G A;  5HRO A;  1XHX A;  3OHR A;  1NGD A;  4FJX A;  1JLG A;  3PSF A;  5FDL A;  3RSE B;  3AO1 A;  3AGR A;  1FKO A;  1GLE G;  3CF5 L;  2CH5 A;  2XRI A;  4E0D A;  4CBX A;  4BRO A;  3OW2 M;  2Q97 A;  5C42 A;  1RGI A;  5CZ1 A;  3CCE N;  4JN4 A;  5B8H A;  4JI8 K;  3U9Z A;  5KRS A;  3TTF A;  4Z94 A;  4N41 A;  2BDP A;  5C2D A;  1BG3 A;  4EHU A;  1JL2 A;  4C8O A;  5JLH A;  1KAX A;  1RDW X;  1NGJ A;  2BE2 A;  5BN8 A;  4FK2 A;  3KK3 A;  4HHT A;  4NYN A;  2W42 A;  5I42 A;  4CF1 A;  4CE9 A;  4DFK A;  4ELV A;  4FK4 A;  1RTJ A;  3E9P A;  3NH1 A;  4IO9 L;  2E2O A;  4DV7 K;  4C8L A;  1TK8 A;  1YAG A;  1K9M O;  2AJQ A;  1QSY A;  4DSF A;  3R6M A;  1HQE A;  2D1K A;  5JVH L;  2E2Q A;  2V52 B;  4JI3 K;  1VRU A;  3A8Y A;  1U2V A;  3SZ2 A;  1T6C A;  2IGI A;  1C0U A;  3HK2 A;  3NF9 A;  2Q1N A;  4JI5 K;  2YHW A;  4U7B A;  4JK8 A;  3PLA A;  3AVF A;  3R9P A;  3G71 N;  1VQ6 N;  1NU0 A;  4BY9 C;  4B1Y B;  2HVI A;  4BRG A;  4JK7 A;  1VSM A;  4FWN A;  3DOL A;  4LF6 K;  4CK1 A;  1O13 A;  3RMC A;  4FYD A;  1J6Z A;  3DLG A;  4WFN L;  1RDC A;  3C6T A;  2FXU A;  4GW6 A;  4ZTF A;  1NKE A;  3DLH A;  4CGI A;  4CHP A;  4CJF A;  1RBT A;  1SKS A;  5HOO A;  3L2W A;  4DF8 A;  2E2P A;  1Q82 O;  4DSL A;  5BR8 K;  3HXM A;  3MN7 A;  3ZSQ A;  4CJP A;  4HCB A;  2O4G A;  4CIF A;  3NVK A;  1T8E A;  4CEA A;  3NGZ A;  2B6A A;  5AQZ A;  3LZJ A;  3AVK A;  3THW B;  4RWT A;  3MXJ A;  5CR4 A;  5CYM A;  4ILG B;  3I0R A;  5AQJ A;  4FVU A;  3CCL N;  4Q5V A;  4MFB A;  4H5T A;  5E26 A;  2P1J A;  3PSI A;  1S3X A;  1ZYQ A;  1Q86 O;  1VSJ A;  4YOY A;  2JWL A;  2KLA A;  2P9N A;  2HHV A;  3EL2 A;  1VQ4 N;  3O3H A;  3WXK A;  3VQD A;  3ENH A;  2YNI A;  3TAE A;  1QHA A;  4ID1 A;  5FPD A;  3T1Y K;  3E01 A;  3ZT2 A;  1XUP O;  1GOB A;  5FRM A;  1I39 A;  3K9J A;  4DTS A;  4AHS A;  2ATQ A;  1NJI O;  2GUI A;  4BC3 A;  4XH1 A;  2W6K A;  1XI1 A;  5EXW A;  5J2N A;  3QBX A;  2OPQ A;  4DTO A;  5EX5 A;  2VQE K;  3LAM A;  2YJE A;  5KGX A;  2A5X A;  1XMQ K;  3MCP A;  1C6V A;  1TAU A;  2UUC K;  4BRF A;  1N33 K;  2IVN A;  2XY5 A;  1SQK A;  4B3T K;  4B3R K;  4DU4 A;  4CBW A;  1VQ7 N;  4Z4G A;  4CJR A;  1T44 A;  2CGJ A;  4CJS A;  3D45 A;  4XH5 A;  1HR0 K;  3EY1 A;  4IEE A;  4E7I A;  3SBG A;  4JI7 K;  2ASM A;  2NLX A;  2X6S A;  3ZLJ A;  5IWA K;  1N34 K;  2A42 A;  5AQU A;  4XH4 A;  3VER A;  4CGH A;  4JRQ A;  1LW0 A;  5CHI A;  1YIJ N;  3MXM A;  2QWQ A;  1C0M A;  4DR2 K;  3R1X A;  3THV A;  5FPN A;  4DV5 K;  4ID5 A;  5HRS A;  1BIU A;  3TAR A;  3CET A;  1RBS A;  4I2Q A;  3SPY A;  1D5A A;  2ASP A;  2ZM6 K;  4M7Y A;  2HBL A;  1U49 A;  2P9U A;  1BU6 O;  4CFB A;  2NRH A;  4FL9 A;  5E84 A;  4GV9 A;  1MWK A;  2O8D A;  3K5M A;  1N5Y A;  3SUP A;  1KXP A;  4RW7 A;  4KHN A;  1RIL A;  3SBT A;  2A41 A;  1L3S A;  3KTQ A;  2HST A;  4BR5 A;  2P9L A;  1NKB A;  1S1V A;  3ID8 A;  1NJZ A;  1K73 O;  3JS6 A;  3SMP A;  4IO8 A;  2HHW A;  3BF1 A;  4FW2 A;  4LC9 B;  4FJM A;  4KHQ A;  4NCG A;  4RCH A;  1A5W A;  4O5B A;  4FZX C;  2X6N A;  3WEE B;  4OLA A;  1B92 A;  5KQD A;  5D3G A;  1TAQ A;  3A0I X;  3TR8 A;  4DKW A;  4BRM A;  3JSM A;  4M3Z A;  2Q31 A;  3ZX3 A;  2WC9 A;  1TKT A;  4OPA A;  5GAG P;  1Z25 A;  3O9S A;  4KRE A;  4Q0B A;  3H3N O;  4YOW A;  2VG7 A;  3WNF A;  4WFA L;  3TAB A;  2QWN A;  3TSU A;  4H4M A;  3FZM A;  2NZT A;  3MCA B;  2OTL N;  3C0B A;  3UKU B;  4FM0 A;  3BEX A;  1KQS M;  2D4W A;  4N56 A;  4FVM A;  4JD2 B;  2ZGZ A;  3FZK A;  1C1B A;  4O0I A;  4O8U A;  2EX3 A;  1VSH A;  3V9S A;  3V9W A;  4AHC A;  2IDO A;  3B8A X;  1TK5 A;  3ZCM A;  1LAW A;  1EXQ A;  1HMV A;  4F2S A;  5BRF A;  2HOE A;  3FE1 A;  1ZBU A;  2RHK A;  2JWK A;  3HTV A;  2VCP A;  1JLQ A;  1VK0 A;  3SJH A;  5M1N A;  3CMA N;  4BG9 A;  4BC5 A;  1NJY A;  2W6L A;  3G0Z A;  4JAX A;  3VGM A;  4NO7 A;  1JL1 A;  2PAV A;  4ZHR A;  3NMU A;  3VEO A;  1R59 O;  3FGU A;  3E1Y A;  5C25 A;  2KFZ A;  4AHV A;  3KLI A;  5JIC A;  4BRN A;  1J5O A;  1YI2 N;  3LDP A;  1WOQ A;  2FSK A;  4K41 A;  4E1M A;  2YHX A;  1NK9 A;  1L5U A;  3QML A;  4E1J A;  3R3L A;  5F2R A;  2PY5 A;  4JHD A;  5ADX A;  2VGN A;  4NLB A;  4GMJ B;  4H0X B;  4B9L A;  3VGK A;  4DTP A;  3FLC O;  4C1N K;  3OYD A;  1KFS A;  3VA3 A;  4YFU A;  5AZI B;  4N5S A;  4OO1 J;  3G25 A;  4CGG A;  5M1K A;  1KFD A;  2HF3 A;  3RTV A;  5AQQ A;  1Q9Y A;  4RW6 A;  3AO5 A;  4ILJ A;  5ADX H;  1FJG K;  3H1Q A;  1E4F T;  4Y1D A;  4E89 A;  4CEO A;  1CZA N;  4OPK A;  3A5N C;  3FZL A;  4K42 A;  4I2P A;  4J2B A;  1ESV A;  3GG4 A;  3JYT A;  4DHY A;  3IAY A;  2PYJ A;  1W2B M;  3MX2 A;  5CY4 A;  4BRC A;  5C15 A;  2E6M A;  2FLO A;  4DB3 A;  5CE3 A;  4V19 S;  2Z1I A;  1HJR A;  4O44 A;  1IKW A;  3KK2 A;  4H0Y B;  2KZM A;  3ZET B;  1LOT B;  1ZBF A;  2ZJQ L;  3N4Q A;  4CBU A;  4KH5 A;  1IBL K;  4QS9 A;  4DF4 A;  3B6O A;  3L2U A;  3NFA A;  1CXQ A;  4CER A;  1YTU A;  1NGA A;  4B1W B;  2RN2 A;  1K8K A;  4ISF A;  1B9F A;  1GOC A;  2HHQ A;  4BDY A;  2GEM A;  3LAN A;  5EU7 A;  4E7L A;  1TYQ A;  5AQO A;  5CZ2 A;  1ATS A;  3QEX A;  2HHU A;  3LAL A;  3VOV A;  1QQO A;  4OGE A;  2RF2 A;  4E19 A;  4DQQ A;  3AO2 A;  5F0X A;  1W9H A;  4CIG A;  2LSN A;  4KTW A;  1B9D A;  4FLW A;  1TKD A;  2D0C A;  5LMU K;  4WFB L;  3C6H A;  3HST B;  3HOT A;  3FFI A;  2YKN A;  4OPH A;  3N4P A;  2GEL A;  1YJN N;  2WON A;  3HSC A;  5E41 A;  1TV6 A;  5AR0 A;  4IOC L;  1HPM A;  3AVN A;  5AQR A;  2DPN A;  1QS4 A; 
#chains in the Genus database with same CATH homology
 3U9Z A;  3TTF A;  4Z94 A;  5BR9 A;  3CC7 N;  5LJW A;  4FOI A;  2BUP A;  3C7N B;  2P9K A;  3SMS A;  4A2B A;  1NGH A;  3LDL A;  3P31 A;  5C2D A;  1BG3 A;  1DT9 A;  3UKR B;  4EHU A;  2NRW A;  2UYT A;  3WEE A;  4A59 A;  5JLH A;  3CCV N;  1KAX A;  4Y0W A;  3E66 A;  1RDW X;  1NGJ A;  4IEI A;  4PL8 A;  5BN8 A;  3WT0 A;  4H5N A;  3I56 N;  1KD1 O;  1NWK A;  1C0G A;  1OKJ A;  4J8F A;  2I7N A;  3TSQ A;  1MA9 B;  3H6E A;  4FWO A;  2CGK A;  2BH1 A;  2ZWH A;  2YHY A;  3FZH A;  5ELZ A;  5AFU A;  4YOV A;  3E9P A;  1ATN A;  5AZJ B;  4IO9 L;  3FR0 A;  3VEW A;  2FF6 A;  3A5M C;  3CME N;  2E2O A;  3F5T A;  3GL1 A;  4O5F A;  4WQ4 C;  3J7Z O;  4KBO A;  3H1V X;  1YAG A;  1K9M O;  1RFQ A;  4H03 B;  2QM1 A;  5FPE A;  3DXK A;  3R6M A;  1ZBS A;  2D1K A;  5AFU H;  5JVH L;  2E2Q A;  3A5L C;  3UKU A;  2V52 B;  4JEP A;  4JKF A;  4C23 A;  3A8Y A;  1U2V A;  4JD2 A;  1QZ5 A;  1T6C A;  4FSV A;  3U4L A;  1U6Z A;  2NRV A;  3MWT A;  5AQP A;  1EQY A;  1KAY A;  2Q1N A;  3CIP A;  2YHW A;  3VF6 A;  4U7B A;  5MLC Q;  4JK8 A;  3PLA A;  3F2K A;  1BUP A;  3R9P A;  1BA0 A;  4JKG B;  3G71 N;  3CPW M;  4FWL A;  4A5B A;  1VQ6 N;  4BY9 C;  1ILY A;  1WUA A;  4B1Y B;  4BRG A;  4JK7 A;  2WFB A;  4JKB A;  4MO5 A;  4FWN A;  3D7E O;  4JNE A;  5GAD P;  3BP8 A;  1GLC G;  1O13 A;  3MN9 A;  1J6Z A;  1HJO A;  3AAP A;  4BGA A;  4BQL A;  4WFN L;  2QEX N;  1V4S A;  3QB0 A;  1S72 N;  2FXU A;  4IXC A;  1M1K O;  3KVG A;  1IJJ A;  3Q7C A;  1NGI A;  5BRE A;  3O6W A;  3O80 A;  3EZW A;  2P9S B;  2NRT A;  1Q7Y O;  3WXJ A;  1JCF A;  5HOO A;  2E2P A;  4B1U B;  1ZC6 A;  1Q82 O;  2ITM A;  3GOI A;  3H3O B;  3MN7 A;  5M1P A;  1SS6 A;  3WXL A;  3ZEU B;  4YOX A;  1YXQ A;  3VF4 A;  3VPZ A;  3GDQ A;  3CCJ N;  3C7N A;  4CZG A;  3NVK A;  3VES A;  4H0T B;  5KPR A;  2HMP A;  3O1B A;  4CZH A;  4BR9 A;  1QVF M;  3ZX0 A;  5GAH P;  5AQZ A;  5GIP A;  4AF1 A;  5GAE P;  2VGM A;  5KPT A;  2GTD A;  4RWT A;  4FPA A;  4BRK A;  2YI1 A;  5CR4 A;  2QTD A;  4WYB A;  3SAG A;  2V7Z A;  2V51 B;  4ILG B;  4QS7 A;  1JJ2 M;  1X3M A;  5AQJ A;  4L3Q A;  2Q0U A;  2WUS A;  4JHD B;  4FVU A;  4JK9 A;  4AM6 A;  1QQM A;  3D2F B;  4B1X B;  3WXM B;  3CCL N;  3CQY A;  3GBT A;  4FWR A;  4H5T A;  5E26 A;  1NLV A;  1BDG A;  1SZ2 A;  3DAW A;  4U67 L;  1VQM N;  1S3X A;  2J4R A;  2QI2 A;  4O8K A;  2YCH A;  5GIN A;  4BRP A;  4I6M A;  1Q86 O;  4YOY A;  2GX9 A;  2JWL A;  2KLA A;  5JLF A;  2P9N A;  2A3Z A;  4MLE A;  5AZI A;  1K8A O;  2QWR A;  1W97 L;  1VQO N;  5AQI A;  3MDQ A;  4CZJ A;  1BOT O;  3EL2 A;  3IUC A;  3OA9 A;  5F1X A;  2ASO A;  2P9P B;  4A62 A;  4PL7 A;  3SAH A;  3G4S N;  1M90 O;  1VQ8 N;  1VQ4 N;  2HBM A;  1VQL N;  5C0Y A;  3WXK A;  3ENH A;  2QWL A;  2PFU A;  1QHA A;  4M7X A;  5FPD A;  5DM7 L;  4JKG A;  1XUP O;  2P9L B;  3M3Z A;  4EAH D;  1E4G T;  1Q18 A;  3LDO A;  3K9J A;  2E20 A;  3EN9 A;  3I8B A;  1NJI O;  4BC3 A;  4XH1 A;  4BR4 A;  3AGK A;  5EXW A;  3QBX A;  1YHQ N;  1NGB A;  1S22 A;  5EX5 A;  1X9J A;  2GUP A;  3J8A A;  4CJ7 A;  5EVZ A;  5AQH A;  4CZF A;  2YJE A;  3ATV A;  2A5X A;  4M63 C;  3MCP A;  2F7T A;  5C10 A;  1QVG M;  4YOR A;  4WQ5 C;  4BRF A;  3VEN A;  2IVN A;  4QS8 A;  3M1F A;  3VET A;  3O8M A;  4BC4 A;  3MN6 A;  1SQK A;  4BG8 A;  3IDH A;  3QIC A;  3VTH A;  3ZET A;  4CBW A;  2A6A A;  3ZEU A;  3DXM A;  1VQ7 N;  3EKU A;  3DLL L;  4C1N I;  2AA4 A;  2H3G X;  3O4W A;  4DQ8 A;  5BRD A;  5GIO A;  1T44 A;  2CGJ A;  3DWL A;  3VEV A;  4AM7 A;  3CI5 A;  3KHY A;  3L4Q A;  4KH6 A;  4XH5 A;  2P9I B;  4IEE A;  4BVP A;  3SBG A;  4MO4 A;  3WXI A;  1K8K B;  1YVN A;  1BWF O;  1EO1 A;  2ASM A;  1Z6R A;  2NLX A;  5M1F A;  1JCG A;  1GLL O;  3JXU A;  3SAF A;  3CJ7 A;  3QFP A;  2A42 A;  1TYQ B;  5AQU A;  4XH4 A;  3VER A;  1NGG A;  1KC8 O;  5CHI A;  1YIJ N;  2QWQ A;  4WCE L;  4IOX A;  1IG8 A;  4G9Z A;  1QQN A;  1BO5 O;  1HLU A;  2VWB A;  3CPE A;  3R1X A;  5FPN A;  4B1V A;  3I55 N;  2CGL A;  3W0L A;  1P90 A;  3CET A;  4KH4 A;  3WQU A;  4H5R A;  1T6D A;  3HZ6 A;  1TUY A;  2AP1 A;  3M5R A;  2ASP A;  4BR7 A;  1YJW N;  4M7Y A;  2HBL A;  4H0O A;  5JMV A;  2P9U A;  4BGB A;  1BU6 O;  3EO3 A;  1Y64 A;  4IDH A;  2NRH A;  4BVO A;  4FL9 A;  4FWS A;  5E84 A;  3ZYY X;  4GV9 A;  1MWK A;  4HWI A;  2FSJ A;  5KQ8 A;  3LL3 A;  4JKE A;  2NNW A;  4A61 A;  1VQ5 N;  3RSE A;  1KXP A;  3S41 A;  1NGF A;  4BRD A;  3SBT A;  2A41 A;  3CC4 N;  3P38 A;  1VQP N;  2HST A;  4BR5 A;  2P9L A;  4H5W A;  2HBJ A;  3ID8 A;  1K73 O;  3JS6 A;  3SMP A;  3CJB A;  4IO8 A;  5C12 A;  3BF1 A;  3CER A;  4LC9 B;  2QA4 N;  4YOU A;  2P9K B;  1TUU A;  4JKH A;  5BN9 A;  4RCH A;  3U9D A;  3VMF B;  3F9M A;  4CD1 A;  3UKR A;  3WEE B;  2Q0R A;  5KQD A;  2QWM A;  1GLF O;  3ENO A;  2W41 A;  5HL7 L;  2IIR A;  3A0I X;  2V7Y A;  3VF2 A;  5AQS A;  5AQT A;  4ISG A;  4BRI A;  4DKW A;  4BRM A;  4ILH A;  4B9Q A;  4IWV A;  4FO0 A;  2Q31 A;  2A40 A;  4H0V B;  4EFH A;  3ZX3 A;  3EKS A;  1GLA G;  3U8X A;  3WUH A;  2WC9 A;  3UB5 A;  1NGC A;  1JCE A;  3QFU A;  4OPA A;  5GAG P;  5AZJ A;  1G99 A;  4GV6 A;  3BF3 A;  3O9S A;  4IJA A;  3H3N O;  4BRE A;  2Q36 A;  4YOW A;  3CHW A;  4MDA A;  4WFA L;  2D0P A;  4RTF D;  3EE8 A;  3IMX A;  3CXC M;  1OVY A;  4F9O A;  2QWN A;  2P9I A;  3TSU A;  3FZM A;  3WQT A;  2NZT A;  4NB4 A;  3MCA B;  1GLJ O;  4MLH A;  3L6Q A;  2OTL N;  3C0B A;  3UKU B;  1LCU A;  4GVE A;  5BRH A;  3BEX A;  1KQS M;  2D4W A;  3UE5 A;  1U2V B;  4JD2 B;  2ZGZ A;  3FZK A;  1RDU A;  5EY4 A;  3CC2 N;  1BA1 A;  1V4T A;  3E9L A;  2ZGY A;  5FPM A;  3P39 A;  4IZ9 A;  3HM8 A;  4O8U A;  4XEI A;  1VQN N;  1P8Z A;  2QWP A;  1DGK N;  3AY9 A;  5TKY A;  4FWK A;  3B8A X;  4PHT X;  4WQ4 A;  2OAN A;  3M6G A;  2QWO A;  3W3D A;  1MWM A;  4GNI A;  3C65 A;  1HKG A;  5BRF A;  2HOE A;  2ZJR L;  2IVO A;  2HBK A;  3OBY A;  3FE1 A;  2RHK A;  2JWK A;  3HTV A;  3K9K A;  3D2E B;  3TSP A;  3OBW A;  4K25 A;  2EWS A;  3AAQ A;  3O9T A;  2VCP A;  5AQW A;  4PKI A;  5M1N A;  3SJH A;  3CMA N;  5BPM A;  2CH6 A;  4BG9 A;  4BC5 A;  2P9S A;  1GLB G;  4JKA A;  5H1S Q;  4JAX A;  3VGM A;  4NO7 A;  4IOC L;  1VQ9 N;  3CCM N;  3MK6 A;  3LM2 A;  2PAV A;  2YJF A;  3BUZ B;  4DCH A;  3NMU A;  3L4I A;  3VEO A;  3CCS N;  1R59 O;  3CQX A;  3FGU A;  3E1Y A;  1D4X A;  2Q2R A;  3CD6 N;  4WF9 L;  3KWI A;  4B1Z A;  5JIC A;  2D0O A;  2NRX A;  3NVM A;  4H5V A;  3RVC A;  1ATR A;  4BRN A;  1DKG D;  4JKD A;  1SAZ A;  1YI2 N;  3LDP A;  2E2N A;  3LDQ A;  5M1Q A;  3O5B A;  5AQK A;  2QXL A;  1WOQ A;  5JVG L;  2FSK A;  4K41 A;  2YHX A;  5EOY A;  3ZX2 A;  4A5A A;  3C6A A;  3QML A;  5AQX A;  4E1J A;  2PBD A;  5I9E B;  3R3L A;  2NRR A;  2KHO A;  3D6R A;  5F2R A;  4JHD A;  3CJ9 A;  3D2F A;  3O1W A;  2VGN A;  1DEJ A;  2ZF5 O;  5ADX A;  3CCU N;  4NLB A;  1YUW A;  1C0F A;  3VTI A;  4H0X B;  3CJA A;  4CZL A;  3VGK A;  3CJ1 A;  3ID6 A;  3MWP A;  3FLC O;  4C1N K;  2IVP A;  2F9W A;  3FZF A;  3ATU A;  3HBT A;  4I6M B;  4H0P A;  5M1O A;  2P9N B;  5AZI B;  4BRL A;  4GY2 B;  1YIT N;  3ULE B;  4OO1 J;  2OTJ N;  3G25 A;  5M1K A;  3PIP L;  2HF3 A;  3SK3 A;  5AQQ A;  2P9P A;  4ILJ A;  5ADX H;  3H1Q A;  1E4F T;  3TTD A;  4CI6 A;  5KPZ A;  2BTF A;  4HTL A;  4CZI A;  3ENB A;  3A5O C;  1CZA N;  2VYP A;  3MN5 A;  4FOE A;  3TU5 A;  4ISE A;  3VEZ A;  3PIO L;  5AQF A;  1GLD G;  3A5N C;  3FZL A;  1HUX A;  4BQZ A;  1XQS C;  1T3V A;  1HKC A;  4FWP A;  4GV3 A;  4A57 A;  2GWK A;  1Z05 A;  3O9R A;  4K42 A;  2GWJ A;  3O9Q A;  4K43 A;  1MDU B;  5TKW A;  3TPQ A;  3O08 A;  1ESV A;  3QDK A;  3CCQ N;  1XC3 A;  5LJV A;  3GG4 A;  4IOA L;  4DHY A;  5DM6 L;  3D2E A;  3DJC A;  1QZ6 A;  3FFK B;  4CZE A;  1W2B M;  1YF5 L;  3MX2 A;  4YOT A;  4A2A A;  5BPN A;  3VEY A;  4BRC A;  1Q81 O;  4YDU A;  3T69 A;  5C15 A;  2FLO A;  2KKZ A;  3KWG A;  4EIA A;  4R79 A;  1VAZ A;  1H1V A;  3O9U A;  4DB3 A;  3G6E N;  5CE3 A;  1ZXO A;  3Q7B A;  4EHT A;  1VQK N;  4H0Y B;  3SLC A;  2W40 A;  3ZET B;  2E8A A;  1LOT B;  2FSN A;  1HX1 A;  3HI0 A;  1X3N A;  1KAZ A;  3DXM B;  3EE9 A;  2HF4 A;  2ZJQ L;  3GE1 A;  3N4Q A;  4CBU A;  5LY3 A;  4KH5 A;  1HKB A;  4QS9 A;  1N8R O;  2NRZ A;  4CD3 A;  1YJ9 N;  2E1Z A;  2F9T A;  5AQM A;  1NGA A;  3DXK B;  5C2F A;  4MDB A;  4B1W B;  4BRA A;  2E88 A;  2I7P A;  1K8K A;  4ISF A;  4WQ5 A;  3H46 O;  5AQY A;  4BR2 A;  4IJN A;  3LM9 A;  2GEM A;  4CZM A;  4UY8 O;  3QBW A;  1NBW A;  1TYQ A;  5AQO A;  4BR0 A;  4FPB A;  1ATS A;  2YX6 A;  3IKM A;  5AQN A;  4PKH A;  2WBN A;  3P4I A;  3VOV A;  3HRG A;  1QQO A;  3VEX A;  5AQV A;  2FF3 B;  2E1Y A;  5BPL A;  5AQL A;  5AQG A;  1NGE A;  5F0X A;  1NM1 A;  3CCR N;  3I33 A;  4NLC A;  3IFR A;  3T7Z A;  4FWM A;  4FWQ A;  4WFB L;  3C6H A;  3H45 C;  4BC2 A;  3HOT A;  2P9U B;  3ULE A;  3KK7 A;  4BRQ A;  3VGL A;  2QW9 A;  4PKG A;  3KZB A;  3LDN A;  3MMV A;  4OPH A;  3CJC A;  3L0Q A;  3OHR A;  3N4P A;  1NGD A;  1NMD A;  4CZK A;  2GEL A;  4YDU C;  2ZJP L;  3HSC A;  1YJN N;  4JKC A;  5AR0 A;  3RSE B;  3HOS A;  3AGR A;  1GLE G;  4BRH A;  3CF5 L;  1HPM A;  2CH5 A;  4IFE A;  3TTC A;  5AQR A;  4BRO A;  4CBX A;  3OW2 M;  2Q97 A;  3E9O A;  3AAR A;  1RGI A;  3CCE N;  2RE2 A;  4JN4 A;  2DPN A;  5B8H A;  3MX5 A;  3R8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...