5M29A

Structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
229
Chain Sequence
AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vitamin B12-binding protein
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Transport protein
total genus 80
structure length 229
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m29A01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m29A02
3MINA 1QH1A 4UTPA 1KARA 3AEQA 3AEUA 1G20B 1M34B 4WNAA 2PRSA 3HH8A 4WZAA 4UTOA 3MINB 1K75A 1QH1B 5JOQA 3AEQB 1G21A 3AEUB 1QGUA 1KAHA 4WNAB 4WZAB 1QH8A 1G21B 1QGUB 2AFHA 4OVKA 3EIXA 4NNPA 3AEKA 4WZBB 3LI2A 1QH8B 1M1NB 4HMOA 4INOA 3AESA 1PSZA 4FNAA 3AEKB 5AFSA 2X4LA 5JPDA 4B8YA 4BBPA 4CL2A 2M6KA 3AESB 4G07A 3MWGA 1ESZA 2PS0A 2YNMC 5HX7A 2Q8QA 1N4DA 1N2CA 5KOHA 3HJTA 3PSHA 4OXRA 2PS3A 2XDQA 4FI3F 3AERA 3GI1A 1N2CB 1PQ4A 4XPIA 5HDQA 5KOHB 5FLYA 1K2VN 2YNMD 2XUZA 2OV1A 4DBLE 2XDQB 4ND8A 2R7AA 3AERB 2M6LA 2ETVA 4UDNA 3CX3A 5GGXA 4ND8B 4UDOA 1XVLA 2AFHB 3AETA 3ZTTA 1TOAA 2WI8A 4WN9A 5GGYA 4IRMA 4FILA 4GICA 3AETB 3U7QA 4MO9A 1MIOA 4LJSA 4LS3A 4OXQA 2WHYA 4WN9B 4M7OA 4MX8A 3TNYA 2OSVA 4H0FA 3EIWA 4HMQA 2O1EA 2Q8PA 1MIOB 5CX1A 1M1YA 1L5HA 1KAEA 4TKUA 2XQVA 4TKVA 1K7SN 4H59A 2R79A 5CX1B 1M1YB 1L5HB 3BE5A 4G09A 3ZK8A 4TKUB 5CR9A 4TKVB 4N01A 1N4AA 3MWFA 5KOJA 2OGWA 4XPIB 1FP4A 1K0FA 5JG7A 3G9QA 3PSAA 5I4KA 2PS9A 4HN9A 1H1LA 1G20A 3LHSA 4HMPA 4NNOA 1FP4B 2XH8A 3ZK7A 4K3VA 3R5TA 1H1LB 3ZK9A 3UJPA 3TLKA 5M3BA 4MLZA 2PHZA 2MINA 5M34A 5M2QA 3HXPA 4WESA 3NU1A 3U7QB 2OV3A 3MFQA 4WZBA 2QI9F 2MINB 5M29A 1M1NA 2AFIA 4INPA 4WESB 5BVHA 3PDIA 1EFDN 2XV1A 4FKMA 4PM4A 3R5SA 2XY4A 3K1AA 4MDYA 2AFIB 3MD9A 4PAGA 5BVHB 3PDIB 5BVGA 3ZKAA 5KHLB 3K1AB 3TEFA 5B58T 5BVGB 2RG7A 5KOJB 1M34A 1N2ZA 3BE6A 5JJ5A
chains in the Genus database with same CATH superfamily
1XRPA 1SJ9A 3MINA 1ESMA 5ILGA 3RSFA 5CA1A 2X76A 4U9HS 3A31A 3KE9A 4FFWA 4LOIA 1Z34A 4JLAA 4CVNA 4DCPA 4X6UA 4DCCA 1TAHA 2C8JA 4HAYA 1KC1A 4TSKA 1QKKA 4OD0A 4EUEA 2Q4BA 4XH9B 3T1YB 3X1KA 4OHRA 2ZAOA 5LUAA 2BMFA 2HMTA 1QO0D 3NR2A 2YNMA 4FMDB 2NWQA 3DWGA 3L7YA 3OE7D 3R7AA 3J7AC 4YREA 4ZFNA 1OLUA 2QTMA 4Y0AA 1Q1EA 2YV4A 1LPNA 1UFOA 1ZR4A 4FNAA 4H3SA 4FTWA 4MQ5A 4RGYA 4L78A 1BRMA 2RBEA 3UG7A 3AR6A 3NHZA 1HE1C 3H6KA 4C0HA 4DIDA 2P4SA 3MGBA 5JSZB 1KJZA 1DCMA 2X1LA 3MRTA 3G8CA 3OIYA 2PS0A 2P5UA 5DH9A 3ONFA 1ADGA 1YVRA 1P73A 4GR5A 3SEFA 4DV1B 5K6AC 3VSCA 3D59A 3SSAA 5H9WA 1OLXB 5ITVA 1AG9A 2NQ8A 2MSLA 3H8VA 2J3KA 3TRKA 5DYTA 3KPWA 1K2VN 4FFBA 1T5DX 2Y4NA 4BJ5A 5TEWA 1ZJJA 1Z45A 4Y2HA 5K3OA 4R40A 4BN4A 3N6RA 5CM9C 4BB6A 2JZCA 2EKDA 1QC5B 4HEJA 3RBVA 3E81A 1IAVA 1M2FA 1MD9A 2FWBA 3R3XA 1NJ2A 4M86A 3SQDA 3W5BA 4XOIA 3C3MA 3LSYA 1PG5A 1YR3A 4OLHA 5L40A 4WOJA 2ZCUA 1OE0A 4YMGA 1E61A 1OAOA 2OO7A 4YBRA 5ERGB 5BN4B 4XDYA 5DB4A 3D4NA 2Z2ZA 3GUVA 3D54D 3KTAA 3OPYB 4NU5A 2IYAA 3TX2A 3VH3A 3UOWA 3GD5A 4IVPA 4EG1A 3V7YA 3R3VA 1NJ8A 5IH7A 2F3RA 1KJNA 1ZUWA 2IOFA 4Q3OA 3DE7X 2NADA 3QIAA 3EF0A 3CPSA 5KKAA 1QCCA 1WDWB 4LCJA 4PLZA 5AM0A 1KZHA 3VAZA 4AZ0A 3ERCA 3AVTA 3UJNA 1YJAA 2OQRA 2ZWOA 2JCYA 4HG2A 4JJ7A 1XF9A 5L7TA 4JI6B 4BFWA 5NLLA 3EXIB 3A14A 3SEZA 5B36A 2R60A 5ESRA 4MTLA 1NSYA 4M1SA 2Q45A 4Z0HO 1U1DA 3OIFA 5CT6A 4DY4A 1AQNA 5E8JA 1U3CA 4BMNA 1T4GA 2C31A 3M89A 3OMXA 4QJIA 4URZR 4I8IA 4BU0A 1ZC3A 1XAJA 4A15A 1M5TA 5DASA 2GAFA 1KI6A 4FNOA 2BKXA 1C4OA 4JIMA 1IVYA 3FROA 3UKOA 1V39A 2H3HA 3BB1A 1P61B 3PWZA 5KNLA 4JV5B 1KEZA 1ZMXA 3MILA 3I0MA 2QI9F 3WRXC 2CF6A 4URUR 3M5PA 1C9DB 2IPNA 4L0DA 2IUEA 3K4HA 1E1RD 4GGPA 2IZZA 4PC6A 4MIEA 1QP8A 1NOIA 4TGLA 5DULA 4RU1A 2C04A 3I73A 2XMQA 5I7EA 3TTYA 2PEZA 1PJAA 4ZTZB 4O8CA 3RVKA 2NAFA 5LU8A 1FFHA 3P9RA 4HOYA 4PG7A 2Y27A 3HNOA 3AR4A 3I5MA 2PD6A 1JWAB 1QJCA 2TMDA 3EH2A 4ZDJA 3U44A 1AZWA 4M8NE 1SOMA 3ABOB 1FUUA 1H6CA 4HAOA 3TW8B 1NWCA 3U80A 5LJLA 2TS1A 2GPWA 4IG4A 4PLVA 4RFLA 5AKZA 4EYOA 1T8YA 3CEPB 4I4LA 1MA0A 1Z8HA 4PSDA 2QI9C 3O8QA 3DBRB 1Z4KA 2QTRA 4EUKA 4MR8A 4RX1A 1BGXT 3C6ZA 4WNAB 1RRCA 1S3IA 1XNGA 4PCVA 1AHPA 5KX5F 4CL3A 3MQ2A 2PTGA 5JAMA 4X71A 4DVJA 4CMEC 2XZTA 4O2BF 4ZVOA 3DTNA 4DNFA 1W1IA 4MZDA 3QH4A 1S2OA 4XGKA 3TQOA 2G5CA 3Q7TA 4BVAA 4N49A 4Z9BA 3VNVA 2ZWMA 1ULTA 2EOAA 2UYOA 3A1DA 1OYOA 3OZDA 3F74A 3QPAA 4GF5A 4JZYA 1XX6A 1E3QA 1MC8A 1ZEJA 2ODEA 2R85A 4G01B 4ZPXA 1ODCA 1X1EA 1SO8A 4HH1A 4OGFA 2ATCA 2OXRA 5E2IA 3NVKI 2GX6A 3QPBA 3KOXA 1QKIA 1X9GA 5AKLA 3LDHA 4ZO7A 5E6RB 1OQAA 2IYPA 1XMIA 3ESQA 3HDYA 3KHUA 4OHPA 3UFBA 1QTRA 3EXAA 4LBZA 3IBFA 5A71A 1O57A 2R7MA 4PYIA 1XLTC 2OV1A 2XJ4A 4E1BA 2WD9A 3I72A 4FJ0A 2DSTA 4KIGA 3OSZA 5DVZA 2ZRLA 3WISA 3CX3A 5CDGA 3CYFA 3EEOA 3EF3A 1MOPA 3B1JA 3IUYA 5F1OA 3L43A 1NMXA 1I9GA 1A8SA 2ES4A 2GPNA 1GLVA 1PGQA 2Y1DA 4HDMA 1HYBA 4YMHA 4MCHA 5FA6A 1VKZA 1H4QA 2A57A 3G2LA 4KQJA 1OY1A 4G2TA 4XB1A 3KFLA 4J2HA 1JEQA 1MR3F 5EXEA 1H2EA 1IZ9A 3ZDZB 1R4MB 3ZLJA 1NXTA 1CUCA 4PTYA 2J85A 1II8A 1WKBA 2JBHA 1RMYA 5JTTA 5HEKA 5EKDA 2RHJA 4JYZA 3CGWA 4ZO4A 5JI3E 1WW8A 1XDGA 3OCWA 5I9TA 1CIJA 1JSCA 2OWEA 4RZUA 4BXOA 4WOPA 1BQEA 1G8HA 2BHRA 3AZPA 3A4NA 2LNDA 4YRGA 1G20A 2QAGB 5CCBA 2F9LA 3QFHA 5C8ZA 2DU8A 3PJDA 4EX7A 1EK5A 2EXXA 4YN3A 1Q7EA 4MGKR 2EERA 4J0EA 2H1LA 4MARA 1G4UR 4NPHA 1C8BA 3G5LA 2FZ5A 3IQWA 4UE6A 1HEYA 3LV8A 5FYDA 3UJ9A 1SCIA 3QFSA 2Z8XA 1O89A 2G9QA 2ZANA 1AN0A 1VGRA 3R20A 4YA6A 5JE8A 1CPYA 4LVUA 4JAVC 2MSNA 3AHGA 3P4XA 5AIAA 2RIPA 4CFYA 2WJAA 1VHLA 2NV2B 1G6KA 3BKXA 3JQGB 4MS3B 1E0AA 1OX5A 3DL0A 1AKVA 1JQ5A 1P5FA 1GUZA 3FMOB 3QHAA 2PAAA 4ZOAA 2OV8A 3QZUA 3WAJA 2QN8A 3V2GA 3A4MA 2PT6A 4XVRA 2WIJA 1XDSA 3CB4A 3NYRA 1DRKA 4H1VA 1ZMOA 3DPIA 3DR3A 4OQPA 4QYWA 5A05A 2ZG6A 3FVRA 1U3GA 4O2RA 3T9DA 4B47A 1QRRA 2XUKA 1ZM2A 4PAMA 1J8QA 2H3EA 3EPHA 2G80A 1L6IA 3PJEA 2YIJA 4Z8XA 4ZT5A 2Z2IA 5AQEA 2ECOA 2WSYB 1CUIA 4IXDA 4JT4A 3AFIA 3BYZA 2ZK7A 3DP7A 4NFYA 4REMA 4WVFA 3U62A 1KQ3A 2PX4A 3WKEA 2QTCA 4F2DA 3IUNA 3CZ5A 2DJ5A 2FX2A 2AJDA 3HXQA 3I9OA 1I8TA 4LVNA 3VV2A 2W4IA 1QIEA 2JPDA 4KWTA 4BVBA 4BIMA 1PX0A 4TRMA 4A6DA 4EDFA 1L7DA 1QANA 2C2XA 3KB1A 5FTLA 3NMUF 3IV6A 4PONA 2VTDA 1HI9A 2A3NA 2Z08A 3MZ0A 4HLNA 1TO1E 4EKIA 2GM5A 4PN3A 3SS7X 2Z57A 4BQQA 1SXJC 1Y6JA 4XRGA 1M73E 5H68A 4G1BA 4E4YA 3QE4A 1Z5PA 1QBKC 3DA8A 3TPCA 3I64A 4HXFB 4HDAA 1N2CA 2JK1A 4J16C 3UENA 1NV8A 4HI0E 1T8RA 4PGHA 2Q21A 2ZQYA 1V5WA 4YAKA 2FR1A 1P1IA 4HWPA 1ONPA 2GVNA 2H57A 5FLYA 2QR3A 3HZRA 1U1FA 4JI1B 5F4BA 2EW8A 4ZICA 2O48X 2K2WA 2O8NA 3IBSA 3IOEA 3M83A 4M0PA 5FEMA 5HG0A 5F9FA 4P58A 1EG2A 4DMFA 5A0FA 3F3KA 1TKAA 2VDWB 2ZBRA 3RTCA 3Q3EA 4FHCA 1L9KA 4R01A 3H05A 3TQTA 2H2DA 1CD5A 5EUQB 1N7HA 4EJFA 2ZT8A 4NZ9A 1Q21A 4O1IA 3A3OA 1U5CA 4UCFA 1SULA 4D0LB 1P77A 4X45A 2W42A 2P0YA 2OQIA 1YQ9A 2ENUA 3GJSA 3BXFA 4JY7A 1TW2A 2FSSA 2POQX 4V2UA 3LL7A 3IQHX 1YOBA 3KM0A 2F1IA 1CQJB 4HSGA 4J9UE 2GVZC 4O6VA 2PKWA 3EVEA 3D7LA 1OX6A 4FD3A 4JNCA 4R2LA 4RVSA 5FHQA 3WMGA 2NUPA 1K7SN 4OM8A 4C78A 1J8VA 1P1CA 1MXHA 1TJPB 4WKGA 3A6FA 3VR5A 2E21A 3JQ6A 4WV3A 2BFMA 3KBBA 1N4AA 3BHIA 5H4GA 2JHPA 4LJ7A 4Z1OA 2HMVA 2BGNA 1VCHA 5KTPA 2Y6UA 3NBKA 4M21A 4P82A 4YVFA 3PENA 2VK4A 4MPDA 4DRYA 4B6JA 2K87A 2OXCA 3T7TA 3O8RA 3DMHA 4OL0A 4DWJA 7ABPA 4UAJA 3W5AA 1IBMB 2BFDB 5LYJF 1HDGO 3RTAA 1RMTA 1E9DA 5GMOA 1CJTC 1FVHA 2GD0A 4HAVA 4M3NA 4RD0A 4QGHA 1DUVG 4PZDA 3ZGNA 4B40A 1A7JA 2CFRA 2NO5A 1E1CA 3AFMA 1J2YA 4IDPA 1VGQA 1H42A 2P90A 4ZHSA 2I6GA 3F90A 1J2RA 2Y0BA 3EXEB 4W9NA 3SE7A 4CYMA 1NGSA 2V8BA 4KR3A 1QO0A 4B2YA 1EA7A 1J0EA 3OE7A 2FN7A 3PQ5A 4FUQA 3BAZA 2ADOA 2YYAA 4UMDA 1FNBA 5IKOA 3VV3A 1P9WA 3K20A 1TCVA 4CHGA 2Y1KA 3K0FA 4RENA 4GPD1 1CS0B 1V5FA 4Y6QA 3ISVA 5IM4F 4BMZA 3AL2A 3PFFA 1WPXA 2QUZA 2WFLA 3B7WA 4HYQA 4V03A 1S7GA 3IEIA 3BRSA 1FB5A 1GCOA 3ENKA 3IT2A 4NS4A 1GN8A 1YI0A 5DOZA 5GM2A 2R47A 4CUKA 1SIBE 5LP6C 4G25A 4JEIA 3HP4A 2HPZA 3MS2A 3G0DA 3O2SB 4JB3A 1R2QA 3EEQA 4G56A 5EWLB 3WK6A 1H2BA 1ULUA 4A8PA 4G89A 3IFSA 2H5JA 2NVWA 4Z0NA 4RV4A 5CIQA 4AJ1A 2E9SA 2F00A 4G1FA 4Y2XA 4B79A 1TYDE 3LC7O 4ZT2A 4AQDA 5AQ1A 5IDVA 3LQ1A 2OHVA 4C0QC 4FFDA 4PLCA 3OO0A 3BMCA 3PI7A 5K20A 2WVJA 2ZQZA 3KEFA 5JJKA 2A9RA 3DWEX 3H17A 4IJVA 4Q9NA 4RHEA 3GZNB 4KQHA 2WPDD 1Z5UA 1VXOA 3TNLA 2IWRA 4BGIA 1P7YA 2VTKA 3OFKA 1CUVA 3M5DA 4JITA 1MAUA 1UOQA 2WIBA 3IS3A 4FGZA 5DYGA 5BSWA 2I2BA 3MBIA 1AK1A 4FONA 4DDHA 3AERA 4KRGA 3T5CA 2OBMA 2QPAA 5HS6A 2AWOA 3PIIA 5EZYA 1KEPA 2IEIA 3NBUA 5TXGA 2RC5A 5DBFA 4A0SA 1B43A 3PQ4A 3OPNA 4IDOA 4Z3DA 1CY7A 3B13B 3U6BA 1BE6A 5DP1A 2GYUA 3VNUA 1Q15A 2RGYA 3PKIA 1T13A 1RLMA 1I51A 1UL1X 1M75A 1KDRA 3PFBA 1DO8A 5L3ZA 1XD9A 4JOCA 4F1WA 1KQGA 2G8LA 3V2UA 1EQAA 1D2CA 4C03A 4TUYA 2P35A 1YJ8A 3RYTC 2ZBQA 4KE9A 4WY5A 1E4OA 1H1TA 2V58A 4N5HX 4O2BB 5GVRA 3RRFA 3L8HA 5B30A 3I23A 3KPJA 3RTDA 3F6BX 5JYCA 1YBFA 3R74A 1Y9JA 2PV7A 3O03A 2K5UA 3O3OB 4OOFA 4PRZA 3UH0A 1FTGA 5CVTA 4GMHA 5LJIA 2P9HA 1G1AA 1DX4A 5FA5A 3PXGA 1R27A 5JS2A 1E3JA 4MQEA 1NP6A 4R0VA 5B6IA 1E1RA 3GIDA 2HRCA 5AW9A 2VKQA 2X7HA 3O7WA 1BX1A 4W4TA 3ZCTA 3NDJA 3FYUA 1P7CA 3RGGA 4D79A 4COKA 4M83A 3MF4A 3CEJA 1DTEA 4QNNA 1W0KD 3UT0A 3CV3A 3IUQA 3QVWA 4MW6A 5K8IA 3D8UA 1Z06A 2BONA 2FP3A 4KYIB 3AO0B 4ZALA 4K86A 3ITNA 4CU2A 4CV0A 2GF2A 2VUUA 3OOSA 4OCZA 4C6HA 3GRRA 3K4QA 2AX4A 5E0KB 4WESA 4AW9A 3JZMA 5TF0A 4V0OA 4RETA 4KUGA 1KEKA 3AFGA 5C0OE 1JKIA 5C4GB 3FTDA 5I7VA 5LKAA 2ZDHA 4ZVKA 9LDBA 3GPIA 3OCXA 1DKUA 2JJMA 1TK9A 2MSKA 3JPWA 1G17A 2G28A 1LK5A 1AKUA 3ZLUA 1FL9A 2VDRB 4CKYA 3LWNA 1JDBB 2ZI5A 3NB0A 3L05A 3NOVA 1NA5A 1OAOC 1G2QA 3PBKA 4RPLA 4WGGA 4UM8B 3UG6A 1K4MA 3MTBA 1LS6A 2X2PA 1OCEA 3OETA 2VAMA 4YEDA 5AI4A 4ITVA 3F47A 4NG4A 5DNDA 4AJ2A 1CUWA 2FE4A 3WQBA 2GASA 1BGWA 3ZE9A 5LD2B 2CB9A 3BRQA 3PK0A 3I30X 1UWVA 1UBGA 2YRWA 3HXMA 2PX0A 3BEOA 1OT5A 3LBYA 4I4CA 1DX6A 3TFWA 3BM5A 3EWIA 1HFKA 3CUTA 2BCGY 2QU7A 5IVDA 4ZXFA 1Y6QA 3KBOA 4L95C 4IX9A 3OEYA 4NS1A 4CDNA 4ZCMA 4LZZA 4AP9A 4CMKA 5EIXA 1AKQA 1PGPA 4IXTA 2JARA 2D3TA 3OAAD 5JSYA 1EX1A 1VFNA 1W52X 4K87A 2X1MA 4A10A 5KJ6A 2G0TA 3UK2A 2E3JA 2Z6VA 4EFLA 2JD0A 5JADA 1VSVA 2WEKA 3GNSA 3WKCA 2D6FA 3WI7A 3PUHA 1A7KA 1NWHA 2JFVA 2ON6A 3E3OA 2Y1XA 1X0XA 5EGNA 2Z6UA 1LPMA 2MYTA 2JW5A 5T41A 4Q03A 3D0OA 4Y98A 2PUWA 1H3FA 1P0QA 3IOCA 5FF9A 4BZQA 4NMMA 2V7XA 2FCRA 2LPMA 3RO7A 2BFCB 4A26A 3QJYA 4C5AA 2F1HA 4EOGA 1Q50A 4DJAA 4WRRA 1U0JA 1P91A 3DCJA 4U2DA 2BM0A 1R3DA 2QZZA 1UXGA 2IU3A 3JWHA 1DIHA 821PA 4OK5A 2D74A 1F48A 1PE0A 1SOVA 4FFSA 2C7VA 1LTKA 2L42A 4FLFA 2J45A 3M3HA 4GPZA 3W0LB 4CXMA 1GGEA 3AEYA 4Y1GA 4AVYA 4G0XA 3K9LA 4WH0A 3AR3A 3ASVA 4U2EA 2CLLB 3QY9A 1XLVA 3PUIA 2PYDA 2B4QA 3IQGX 1S1MA 3K0SA 4OJNA 2DT5A 1ISSA 2VK2A 3AHJA 4DCNA 4EF4A 1P2FA 2Q1UA 3MIZA 5C52B 1CE8B 3QG5A 2GK3A 1AQYA 2DUMA 4Z9XA 4LNUA 1NXSA 2HQOA 3H99A 5MF6A 2PGIA 4R7ZA 4PCLA 1SCKA 1QQTA 1ZM7A 3NNDA 3RFVA 1EH5A 2HN9A 3UVEA 3KETA 1KKUA 2ACKA 2ANBA 2G4CA 2EZ4A 2W9XA 2YZMA 3GDHA 4HADA 4BO4A 4F86A 4ZAFA 3PQ7A 4PC3A 3FSRA 5JMOA 2EWWA 3OJ0A 4XLZA 4CDMA 4GGOA 4C76A 2Z4TA 2J5BA 1RCTE 1DEXA 1N2XA 2XMGA 4WXMA 5JATA 4RSMA 5HKAA 3FPBA 5K1ZA 4H7EA 3UANA 1DV2A 4M7PA 1CUGA 2ZIVB 4TM8A 3ZXIA 4LYYA 3WA6A 1BWPA 5CHYA 5K99A 4IS3A 1A1VA 3O2QB 4F6RB 4GL4A 1ID1A 1SKUA 2Z2YA 1Z56C 4FM9A 1TMYA 1CJSA 5FX2A 1EUCB 2EDAA 4F97A 5A03A 4YMTA 1CZHA 3PRYA 2IYUA 3SVZA 4DVGA 3B6KA 3VSAA 3IRVA 4LGVA 5AVOA 1JSXA 4RPKA 1JHQA 2AF3C 2PO5A 3A6PC 1XDUA 2CZGA 3EPRA 4JI8B 4L9SA 3E05A 3TBKA 2XLCA 2XRFA 3SKYA 2OO5C 3PTAA 1ADCA 1DQNA 4BNXA 4N7JA 4IUCS 5KDLA 2WTUA 2BMWA 3TR5A 2YJNA 4Z9AA 2VCYA 3QENA 3B20A 5KYWB 5DHRA 5EJ5A 3ZPXA 5BN5B 4ZIRB 3L9XA 1X9IA 1FEZA 4RHTA 1N5IA 3J7TA 5HRUA 4MVYA 3H7IA 5B3KA 2WR8A 1JKMA 1M66A 1M5UA 3NNNA 5I01A 2OB2A 2P77A 3M2PA 3OUUA 5JMPA 2R97A 5JSZA 2J0QA 1NW5A 3IVGA 1DMSA 3ND6A 3R77A 3TOCA 1MPXA 3UK1A 5CD1A 9LDTA 3T0GA 1Z0ZA 2FFHA 2FKNA 2Y0CA 1RAHA 5LQCA 1I94B 4NBNA 3VSBA 4DKXA 1GEGA 1OLXA 3C5VA 1DEOA 5I9MA 3O4JA 4FN5A 3T1TA 2HXSA 1KXZA 3RIMA 2LP4Y 1N2JA 2CF5A 2OHGA 3HDQA 3CRVA 1D3AA 2XEXA 2XR1A 4QPNA 3WBJA 5FWNA 4MWSA 2FXIA 1E2BA 2YJTD 1QC5A 2RAPA 2XDQB 1E8DA 1JW9B 4I2NA 4Y1FA 1F7UA 2ZU6A 2C2ZA 1KIMA 3WLRA 1VMKA 3KKQA 1U8FO 1ECLA 1JHPA 5JJBA 3I1FA 4MVXA 5ILQA 3COVA 2YR0A 2OEPA 1LJLA 1Z4PX 2C3UA 4YLGA 1E89A 3CKKA 2W2OA 3NJ4A 4PVDA 5FUXA 1KJ9A 5IZCA 1OC4A 1FQJA 1USKA 4G1MB 5BT9A 3Q11A 2A5YB 4IDCA 1DG9A 5U4QA 1UCFA 4MXDA 3TAHA 1DSSG 3TIIA 3ZWOA 2MYUA 5GWXA 5KS2A 1QQAA 5MHTA 1TLTA 1GPJA 1IXSB 1L1QA 4PBRA 4UDXX 3E7DA 1LBEA 4K2HA 5ALIA 3DUFB 3WFZA 3D64A 5LR6A 3QV1A 2CMFA 2RHBA 3KXIA 4DXAA 1E3MA 3WGNA 2HDOA 1LLFA 1EVIA 3B51X 3RABA 5AW0A 3DQZA 3EXIA 3TQSA 4BV9A 4QVGA 3GJRA 1J9ZA 1WMEA 4L8VA 1E2MA 2JAUA 3HVIA 4XJTA 1DAHA 1CQPA 3Q7RA 2COEA 4RLSA 3W77A 1Z0DA 3E0QA 3MFYA 5DLPA 4BFUA 2KE5A 1V8FA 1E58A 1QVZA 1V25A 2P78A 4P4GA 3ZK7A 1A7AA 1TLFA 2XCIA 4GZ6A 3WC4A 4ENUA 4GI1A 3KFXA 4R8VA 2RDMA 2RGNA 1I5OA 1N32B 2RI0A 5AJVB 5FXMA 3STWA 1GTMA 1QTIA 3JQFA 1K97A 5HQJA 5KREA 1E9CA 3TSWA 5J4KA 1KETA 5ELMA 2XF8A 3F6SA 3FLAA 5EZSA 2C7OA 5A3JA 1B16A 4B33A 5GJVC 3WKAA 1TECE 3MLEA 3RS3A 3QEBZ 3OCUA 3KUUA 1A2KC 4D9MA 4FQ7A 4TMFA 2G8NA 2WOOA 2XGGA 2QE6A 3FUVA 3LPLA 5AH0A 2R751 5CGZA 3MMNA 1H2RS 3GH1A 1IN5A 1KMCA 4WOKA 4H7HA 5B1YA 1LLUA 2X3FA 3ZXUB 5ELLA 2OXEA 1BQ3A 3TEFA 4EMUA 4UEKA 3S29A 4PG5A 4W1RA 4Y7CA 3SVLA 2B61A 3I2KA 3TI7A 1ESNA 1R74A 4F2PA 2WUFA 2ORVA 2XUOA 3DBRA 4HNAB 3TR6A 5JBNA 3HWWA 5JJIA 1PR3A 1AU9A 2EU8A 4FEGA 3D3JA 2HLNA 4WNAA 4KN6A 3H42B 1GARA 1TE2A 2FEAA 4HPJB 3U1VA 3D3WB 1XPOA 3Q9NA 3ELBA 3ZWMA 4GX0A 4NULA 1VYUA 5BV0A 1WBDA 3KZOA 5D86A 3TI9A 1G21B 5L4NA 2PD3A 3L6OO 1ZNXA 2A9PA 3GRFA 4RH3A 1CUBA 3KSRA 5KC8A 3GN2A 4HGRA 3HO8A 5DTIA 3C5WP 4CTJA 3SYMA 3OHMA 3VR6D 2RONA 3AYZB 1SD2A 2BEWA 5KB3A 3TW0A 2Q9BA 5JNUA 4QG3A 4KREA 1RFLA 1NSTA 3NATA 4GU5A 5JAHA 3RU9A 1K66A 3QBEA 4MAMA 1A71A 2D7JA 3NCHA 2FOIA 4P4NA 3MCTA 1EE9A 4D3XA 4BS9A 5H5JA 3QWIA 1KSFX 1TA0A 3PHCA 4OY3A 2E37A 5E6RA 3OWXA 3GY0A 4RTSA 2HSJA 3JQQA 1YFZA 2PMWB 4G1VA 3MHTA 4N76A 4RD6A 1UADA 3FMFA 1TJYA 1VL8A 3TMAA 3VI3B 4V1CI 3DZFA 2BZSA 4HHEA 4GEGA 2XT6A 1O3YA 2VS1A 1FJHA 3QMWA 3UCXA 3MYRA 4POAA 1Z5NA 4TMWA 4MJLA 4GAEA 3QWAA 1U3VA 9MHTA 3NM6B 4D57A 1H2YA 4F45A 3P9ZA 1FFAA 1DRVA 3G85A 3PUWA 4YCMA 4WACA 2AFHB 2B21A 2O5EA 1RPTA 1N2SA 1WX1A 2QV7A 3H5LA 3VUFA 1W0KA 3WLJA 2XE8A 3P0EA 3BJZA 1UBSB 3HA3A 1HKHA 3I9NA 4RHYA 4XX0B 1R4MA 5KI6A 4NDNE 3WK7A 4BX0A 4D98A 4FYYA 2PMCA 3HWSA 2UXBB 5DBEX 3KJXA 2UZ0A 2C5LA 1JMKC 4JGGA 4O4HF 1LLQA 3SF8B 1Z5GA 2BOVA 4YDQA 1Z6ZA 3KV1A 4BKPA 1GAJA 1TT5B 1NBOA 2Q99A 1RU3A 1OYWA 4LBYA 3QF4B 1MG0A 4EO4A 1E9FA 3G82C 2HEGA 3EARA 2HJRA 1WXWA 2QAGA 3IODA 3EDCA 4QM6A 4X24A 2WHQA 3WLSA 4ZDKA 5CDSA 1DC7A 2WQZA 1R0RE 4JVMA 3HKBB 2JFNA 3CF4G 2PN1A 2IPXA 1VJDA 2VCHA 1LRLA 3L8GA 4JVNA 4QYXA 5GZ1A 3LA6A 2WTAA 1P72A 2X8BA 3K7EA 3O4IA 4PC2A 3RJ9A 3T1VA 1VG0B 2RIRA 4Q4HB 1CRPA 4DIFA 3MJ4A 1EE1A 5G4LA 3UAYA 3VJRA 1IEQA 1X1SA 2EARA 3I9JA 3JQGA 4MS3A 4M88A 5J9FA 3T3MB 1BCRB 1EAYA 2Z0MA 4A0GA 4AY3A 4G85A 1EB8A 1EDEA 2QJWA 4I6JA 4MDHA 4PAQA 4QPCA 3P9KA 2F3TA 2XOEA 3FTEA 1BHQ1 4L9RA 1TIBA 5FAXA 2FEXA 1PWYE 1ZSYA 1I1NA 4NAHA 1XZDA 3BFPA 3VHXB 1L3CA 4EG8A 5KUTA 1N5JA 4HUJA 2F3PA 3OAAA 4CJXA 1JI0A 1TAUA 4WW0A 1DBWA 3ND8A 3TD6A 3BE6A 2A1TS 4N3CA 4X91A 2C2YA 4HXGA 2VUHB 5CB8A 3M3DA 3PC8A 1DIGA 1R8QA 3C6BA 5D5QA 1U4SA 1QYCA 3UJ6A 2XMPA 4DAOA 3MMZA 5AVTA 4C7OB 1LVGA 1JV2B 1C1XB 1YHYA 4RUKA 1SKBA 2IPMA 3P0JA 1IE3A 4MWTA 4R1PA 3DVQX 1CERA 3FYUC 1GCGA 2D0DA 3IKMB 4FYKA 3C8MA 7MDHA 1OGJA 3L7JA 4RKFA 3VZCA 1G8AA 1ZP6A 2EFEB 3SHVA 1ITZA 3L06A 3OFJA 4TYWA 1BD4A 2XVXA 1JQKA 2BT4A 2HWWA 5EIFA 3AF0A 1KI8A 1P9OA 4MITA 1EFTA 2WA1A 1CTQA 1YMQA 2LV8A 4XXHA 1JDUA 3NDBB 2CVPA 2RHMA 4BDSA 4D4HA 2Q5FA 4EDHA 4P7KA 4AJ4A 1AHHA 4D8XA 4IJ6A 2FSHA 3BGIA 1KYWA 4GLFA 1SVMA 4YBZA 5IT9A 2CCKA 5JECA 1QGED 3HCAA 2QOEA 1B8PA 4RY2A 5GM1A 2KHZA 2VJBA 3TXYA 3W5IA 3OLWA 3CZRA 1EP2B 1YT5A 4DLXA 2GJAA 3VPAA 4F9EA 3W1EA 5BPHA 2P5SA 2XTZA 2VDWA 2CL0X 3B38A 3FR7A 4KAJA 3ZHCA 5ENZA 4CCYB 1RWWA 3IV7A 3M8KA 5AUPB 1C8KA 3EQZA 3W78A 3K30A 5JZVA 3H4IA 4TT3D 4AYTA 5C7LO 3FFWA 4OREX 4JUCA 1RHQA 5IFKA 1BJKA 4G3XA 5KWIA 4EPVA 4WCFB 1KL7A 3FKSD 4U39A 2Z83A 3BCSA 2FEMA 3TZQA 1MX1A 2EW2A 3GEPA 3VZPA 1GFSA 4UXIA 2JI6A 4QUBA 4Q9LA 1LBSA 4I1VA 4XWAA 1K63A 4NU6A 4L28A 2NMVA 4K9DA 4RXTA 2Q3MA 1R6VA 5CLIA 3GIWA 3DL4A 4N39A 5ALNA 5LKRA 3ZNQA 1VSBA 4C0LA 1ZK1A 1E62A 5B6PA 2F1RA 3SMVA 1PJRA 3QF7A 5FOQA 4IMPA 3T5PA 4ZAGA 1WRBA 4Q9IA 4ETIA 3HYCA 4FT2A 5CFQA 1G42A 2ZUFA 4PIPA 3EOBI 4R3WA 1JPJA 1GPBA 1U94A 5JZSA 4PO3X 4BNWA 2BFDA 1L5FA 3GARA 5HCUA 3TOSA 4DA8A 4FE7A 1WMAA 4QGFA 3Q9UA 4TOIA 5EUBA 3WLIA 3R0ZA 4E88A 4MUHA 1O4WA 1GSOA 1E6LA 2QN9A 4RIIA 1L0BA 3N2YA 3ZZMA 3JQRA 3UC9A 5GJWC 4BMPB 3EXEA 3PEEA 3UWDA 2BGUA 3OJFA 5FDFA 2X8AA 3BZUA 4MEBA 4JEMA 3A36A 4NJMA 5DCLA 2AK2A 2QPLA 4PYKA 3CB2A 4XPZA 3OZUA 2ZUUA 3MS4A 4HDOB 1GZVA 4UUOA 1X7GA 4HUQB 5ESDA 4PAGA 3KZNA 5IF9A 5A9SB 1LZLA 1CS0A 1TAQA 4MS1B 1J23A 2BE7A 1Q3HA 2CHUA 3HA7A 3L9WA 5H81A 4WZBE 1C50A 1G3QA 5HK8A 5IC6A 1R8SA 5LA6F 3V46A 3VPHA 4E6EA 4ER3A 3WJ1A 1XEWX 3R0JA 2TMKA 1W49A 4BYMA 3QX9A 2DKOA 3LCVB 3UMGA 1AB6A 4JODA 1ZCZA 1OA1A 4PG4A 3G2OA 2Z56A 5HCNA 4FSDA 3SOPA 4MA0A 4DJTA 4GOMD 4IDNA 4F0JA 5EWLA 3LYHA 5FBZA 4DYHA 3K6SB 2PGNA 5J47A 4LDAA 2CVFA 2CVQA 3KG2A 3PX3A 4IGFA 1BW9B 4RD3A 3WWDA 2HF9A 3I2IA 5BOSB 2FOXA 2ZR0A 4F3NA 3HCEA 4YRSA 3VX4A 4OXNA 1BEUB 1P8JA 2QDXA 2WWWA 5A5VA 3GG2A 5BQ3A 2IX9A 1L7BA 2MSCB 3EFHA 4XYLA 1G21E 2F1OA 3AP3A 2AUTA 4AG3A 3KLNA 3MUEA 2FXVA 3NETA 1K8RA 4CKWB 3GZNA 1J07A 3A4TA 1CUJA 4LRSB 5TQ2B 1KO4A 1SBNE 3GDGA 4RTRA 3IT3A 3LX5A 3H5AA 1LPAB 2ZIFA 4X90A 1DAEA 4G37A 3T7KA 3O95A 2VJMB 3QX8A 4KO2S 1QZ3A 2ORED 3O74A 2DFDA 4AJLA 3QU4A 4DWWA 4GX5A 4ZYUA 3O38A 3P5BA 1Z25A 1BU8A 2AI3A 2IPOA 3A9RA 3EE6A 2HV9A 4IJWA 4XVHA 1JJBA 3K2IA 5EE5B 4EHNA 5C1DA 2FLKA 4KXWA 4XWWA 3FFAA 2IK8A 3DTVB 4Y9SA 1JYSA 5JRJA 3D43A 3GMTA 1LPOA 4EJSC 3QOXA 1SY7A 2GDJA 3DWIA 2Q3DA 1HOTA 1P7VA 2QL7A 3T5BA 1O9HA 3TTUA 3IPYA 1I3NA 3FNEA 4IHAA 1JHOA 2H9AA 3F97A 4N03A 2Q6LA 2P9BA 2FPGB 4FR0A 4OHWA 2AKAB 2JCXA 3DOIA 4DCOA 2I62A 4MEJA 1UJ5A 3HXKA 3UJHA 4GP6A 1QHHB 2VG8A 4RXUA 3RPEA 1B6SA 4XDZA 3Q2IA 2PUDA 4IV5A 1FS5A 3HA2A 3E9ZA 1GL3A 2EATA 3TFQA 3V32A 1G7RA 4FNMA 1ESCA 3BE5A 1RYEA 4WZZA 5AWFC 4GPAA 2B9EA 3O91A 4X3OA 3BFXA 5BRAA 1H6AA 5KOJA 1S6YA 3TS1A 2BL4A 4NYJQ 4XB6B 1U2RA 3ZJTA 4DA4A 1SBQA 4IG9A 1QRAA 4YJ2F 3PFKA 3FWZA 4KL8S 4BRWA 3EGIA 3LGSA 3W7BA 4DC9A 2C59A 3ZY5A 4LQDA 5AVUA 1ZH6A 4UQOA 5IYZB 3NH6A 1E0DA 2O3RA 4R54A 1KVTA 1WEHA 4AN0A 4BNZA 4DIBA 4EYGA 1GM5A 2DBQA 1I3CA 2B94A 3CR3C 4QREA 3WMRA 3OFND 1U7OA 4C4TA 1INLA 5CB6A 3GVPA 5F5LA 3ZE0B 1U8YA 3GNQA 4WN3A 1TZJA 2X0DA 4Q3KA 3WQSB 3WNVA 4Q12A 2JIRA 4URVR 1D9XA 2RHGB 3QU2A 1GJRA 4LY6A 1JTFA 1TU0A 4PVCA 3JATB 2FSIA 3LKBA 2XDAA 1AA6A 3R5SA 5DI9A 3BG5A 1T9DA 3ZW9A 3WWEA 2OENG 5IZCC 5ED0A 3F49S 3D6MA 3VR6A 5B57C 4O4HB 1T29A 1TT7A 2WIAA 1AMUA 1GADO 1HC7A 3NTUA 3ZWDA 3VKWA 4RDCA 3ZIUA 2NSDA 2XYRA 4KIJA 3RCBA 3RW9A 3ANNA 2YDYA 3V7FA 4NEGA 4JI5B 1RP1A 4AMGA 1S2NA 2NSHA 4OGWA 4HAWA 2IW1A 2ZYGA 3OLCX 3OQ6A 4ZD6A 4CT5A 5IRCD 1SHKA 2O1WA 2I1LA 1QAQA 3JU3A 3REFA 3PL5A 4NCIA 1UH5A 5EUCA 3IP1A 1XRRA 4PXYA 8MHTA 5LLTA 1IUNA 3GQVA 4FZ5A 1CR2A 5EMMA 4D4JA 2PMDA 2Z5VA 1JLRA 1WSWA 3L77A 4TSFD 1R64A 2Q5EA 1LV8A 4KMMA 4R8KA 1JHMA 5ETJA 3KC2A 1A9YA 1EWYA 1T8WA 1XXLA 3IMGA 4XVQA 1BTOA 1U7WA 2HJVA 1CZNA 4EEXA 1PWZA 1N7IA 4EHHA 3JQFC 4YV2A 2ZYHA 2WAOA 1KK1A 1Y42X 1P5JA 2P9GA 3TQIA 4JLSA 2ZJ2A 1BVUA 5AM4A 5CVUA 3EQ8A 3V1NA 3V7NA 4BWVA 1Z35A 2O1SA 3GLHB 2QZ9A 5IT4A 3BQMB 3HJTA 3IMCA 5FRDA 1JHZA 2BFCA 2DLCX 4D92A 3LWZA 4LTDA 5SICE 2HFKA 3KKPA 5JSHA 2Q5JA 3HJRA 1A72A 3PUYA 3ZZ0A 5ADWA 3HDTA 2QVYX 2QD3A 2I3AA 4GI7A 2Z8YA 3W9BA 5LIRA 2ETVA 1PD1A 5C2JB 3P26A 2DFTA 2OZKA 5J5AA 3T9FA 1K7FB 3WLMA 3SBOA 1HDOA 1OFGA 4MO2A 1GDHA 4B3IA 1DBVO 3OZ7A 3A05A 4DQLA 1VJ1A 4FBGA 3DTTA 1X1TA 4FOTA 4ZP1A 3R9IA 4XCXA 4UATA 2JAOA 1IPFA 4EX6A 1VCNA 2VO1A 2QZPA 4BRUA 3V8RA 3ZTWA 2J41A 5HF8A 5DN9A 1RWVA 1X80B 1CE8A 1U2SA 3DT8A 3GV0A 3QFCA 2NIPA 3QVVA 2ZJFA 2AXPA 5CB4B 5C4IA 4KOAA 4ESOA 2OG1A 1UWCA 1C41A 4QT4A 4ZTUB 5BYBA 4MVJH 3IIEA 1YCDA 4E09A 2CEKA 5B53A 1UFKA 1S3FA 3OLZA 4RADA 2RHHA 1FTNA 3WLFA 3A1NA 3K31A 4AF8A 3KEGA 4MQUA 2FRDC 4MV7A 3ITEA 5LXTF 3F2IA 3H1AA 4JCOA 1E1DA 4HDKB 5JWOA 5JARA 2O4UX 5L45A 1JBQA 1HY3A 1W2WB 3DAHA 4ZANA 1M8FA 3RUFA 2YHAA 1ORTA 5ALHA 4JHXA 1QCYA 5FL3A 2Y8EA 4FNGA 3U7QB 5JQGF 1P7PA 2EKBA 4F6RA 4GMFA 3VR1A 4AJJA 1ND5A 2QVCA 3TOVA 1BE0A 1EUCA 3PNOA 2PKEA 4XIFA 2IS4A 2WM2A 4G4SP 1DELA 2V7PA 3MWLA 3FPEA 2PLWA 3E4DA 2J6IA 1Y8RB 3G6KA 3GP3A 1QO7A 3KD2A 3VO1A 1ZJZA 3MUFA 1Q3TA 2NU9B 4L73A 5IJXA 4QBKA 1JZTA 2Q6VA 4RA9B 4Q4CA 2WJIA 1F06A 4CHTA 3QWHA 1ADYA 4CM8B 5KYWA 2H1VA 2G17A 3A04A 4YGXB 1Z5ZA 3ILVA 4TXJA 3WHLA 4ZIRA 5BN5A 3HVRA 4J1TA 5EJEA 4LI3X 2ZZKA 2QAGC 3BFJA 1KAHA 3Q88A 4HN4B 4JS0A 1VDZA 1XCGB 3RC8A 3NANA 4DGSA 2VTEA 5F3DA 4OKNA 3ZYZA 2CCGA 3RHTA 5C7YA 5CB0A 4OVKA 1XTPA 3HMKA 5IJWA 1L7RA 1EI9A 4IM7A 4FDLA 1P4HA 3CUYA 1G9TA 4L9WA 4O4JF 4R8MA 4AU1A 4HLUC 5L3RA 3RSLA 4IHQA 4Y0VA 2Y68A 4G26A 3T15A 3N0VA 1U2DA 1VL0A 4R1SA 4F8EA 4F85A 1MCZA 4HQ0A 1OPXA 1X6VA 4TT3A 2I67A 2X8LA 3X2EA 1E69A 1BFDA 1PJSA 1R50A 2A1IA 2WMYA 3IELA 1JA0A 1HZJA 2G6TA 3BTOA 1NQVA 3KU4A 3FKSA 3RG2A 1Z26A 1N0VC 4FSHA 1RBZA 3Q3GE 4ZI7F 3MTIA 1GNLA 3PR3A 1KH1A 5DF1A 4NJEB 2XDQA 4QATA 1DXHA 1N0IA 2FAXA 4GLOA 4NOJA 4QLAA 3WL3A 4YV0A 5KWVA 4DV3B 2XUDA 4HT3B 2GWHA 2VT3A 1WZUA 2OGSA 2UDPA 1IEXA 3KQVA 4DWOA 5AJUA 2IOFK 1BJRE 1PR1A 2R7NA 5BYJA 3UY4A 3ZHYA 4HZUA 1Q84A 4M1MA 4ARSA 3FZQA 1V47A 3ZQUA 4XWTA 3ZCSA 4BEVA 4P31A 1A4RA 4AWXA 1UBLS 3PVSA 2PY6A 2G40A 4FFLA 4BAZA 5MGNA 4ESVA 3HKDB 4WI1A 4BVGA 5JT1A 2GZSA 2Y99A 1TQ2A 3MTDA 2O8BB 1D8TA 1SAYA 3DUFA 3SIPA 4CEJB 3WSWA 4RCYA 3W2TA 3E7FA 1MIOB 1VHJA 3URMA 3DTVD 3JQCA 1XTVA 3PKZA 4ALNA 4CLOB 1Y6RA 3BCRA 1CQWA 4I1OA 3FTQA 3BWEA 4I4TF 4LWZA 4BKRA 4F3YA 3EQ7A 3ZE7A 4AP6A 4IOLA 4IR7A 4QPZA 1Y0BA 1Z8DA 2GM3A 2KBEA 3W9YA 4DG9A 3OFSA 4KFRA 4NG5A 2V3VA 3OE5A 4QOSA 2I34A 2GKOA 1ECFA 3A1VA 4NMWA 3V1LA 1J1ZA 4R0MA 4U7HA 4DSNA 1RXWA 2Q2VA 3CUWA 5CA0F 2IS2A 4KNVA 4E1AA 5AW6A 2C98A 3E9DA 4IKOA 4IVNA 2UUCB 4R9RA 1ZNYA 1MNAA 1F8FA 3O0DA 1RT9A 3LU1A 2G1PA 1V2GA 4EY8A 4UJ3A 3Q9SA 1W2HA 4EUNA 2XUGA 3L8MA 3AL0C 3OWOA 3MFQA 1O95D 2TECE 4UVIA 4WZBA 1EGQA 4M0MA 1JNYA 1R00A 3IVCA 3DFKA 3DP9A 4YV1A 3QG1A 5EIWA 2CXTA 1JDJA 3VR4A 3C97A 4CKCB 1OOEA 2Z98A 2WF6A 1A04A 1LFDB 4ALLA 1GUBA 3UHAA 2R6DA 3L0DA 4HNAA 5EWJB 1ZD5A 5DRYA 3HE3A 2RK4A 2CC2A 2PMEA 4YIHA 4R2JA 3OIUA 1YZNA 5F73A 4LF4B 2PUBA 5JXGA 4OFBA 1DKQA 3T7JA 2CDBA 3OOHA 3D3WA 5C8VA 3BRWD 1VL5A 4BV8A 1YNSA 4YJ2B 2XA1A 4DLPA 5E1MA 1G21A 3A6JA 5E6UB 3BX1A 4Q82A 4R2IA 2ZB4A 2AG1A 1QR6A 3W4IA 1IWBB 3UMVA 4CR6A 5EJ2A 1JEOA 2OK7A 4LFAB 4FDUA 3T7DA 1JHXA 2FK7A 3UJBA 3B9QA 3HB5X 1BXKA 2I4OA 5DE3A 4FYXA 3IDAA 2VL7A 1ZCFA 3BJMA 1ZJYA 3D7KA 3W2EA 1CIVA 4I08A 1GPAA 3ZGXA 1NVVQ 3CO0S 3EZXA 1J70A 2AJCA 3MERA 4UBJA 3REOA 4UHFA 2PLNA 2QWXA 5FA8A 3F7MA 2YC4C 4YFYA 5EEHA 4XQ0A 1UF9A 2A7XA 4PXAA 1IJKA 2HNBA 3OFVA 1CJBA 4UUNA 4G97A 4ZI5A 5J2TA 3UPUA 2E0IA 4DJJA 2X0EA 1Z4OA 3K09A 4S2UA 4NYIR 1UK7A 3GLHE 2VSNA 1X42A 4KGZA 4Q7JB 4BN0A 2I2AA 2ZVPX 2WA2A 2A9FA 3NM4A 5ABPA 4BMSA 1S01A 4N4AA 4ZZ2A 2FKAA 5IXYA 2ZYAA 3NFYA 5CK5A 1ZWLA 1C14A 4QTUB 4RE5A 2PUGA 4GDMA 4RS4A 2ACEA 4B3CA 3QE2A 3PFWO 4FCTA 4QBTA 1I4DD 1VIMA 4U9UA 2FQWA 2VZ8A 4XX0A 1Q5PA 1H22A 2ODBA 2YCLA 3RAJA 3HPRA 3AZQA 4N3AA 3WYDA 5ERXA 3EEFA 3WLOA 4YAIA 1AT1A 2FI1A 1Y4UA 4LWOA 3SF8A 1EFPA 2V1XA 2QS9A 3PCXA 3SR3A 1VG8A 2ID8A 2CMDA 4HMQA 3U3ZA 1Q95A 4F71A 5HK9A 3OFNA 1TT5A 1HYQA 4RTMA 1VSQA 3LVQE 4R2HA 3QF4A 2IV7A 2V9ZA 4X3PA 3TVDA 4N3GA 3HUFA 3Q6IA 2MU1A 1MG5A 4FFOA 2OV2A 2A67A 1Z88A 4M55A 3G9TA 1TUEA 1U7UA 1PEDA 1ICIA 1S4MA 3AM5A 3PXUA 1ZN9A 1QU2A 3UMRA 1RQPA 2CKDA 4AZVA 4D3DA 2XCRB 3HKBA 1BVHA 3JZIA 2Q7DA 4AD8A 4XUGB 3ELWA 1I4TD 3U7FB 1W29A 3BBLA 2QVXX 4NBTA 5I9BA 1CJCA 2PBRA 1PIWA 1WL8A 2WZCA 1UOEA 4Q4HA 4MKRA 2BAGA 4PNHA 2GAJA 1TX4B 3HI4A 4WK4B 1BCRA 2WP8J 3B3JA 2OKCA 4ZC1A 3PF8A 3GCGA 4IOJA 4W8HA 4ZVRA 2JIOA 2PIAA 2CXPA 1R0ZA 4L16A 4GI2A 1JQLB 1ZD8A 1GV1A 1EX6A 3UV3A 2BGMA 3ZWNA 1KQFA 1L5SA 3EEBA 4KLRA 3VHXA 2WFMA 4J1QA 4A92A 2CXHA 2Z8YM 4TSFA 2OCPA 1FTYA 1QDEA 3NKLA 4WDQA 2WQ6A 4RTPA 4KX3A 4RZSA 1N7JA 4TQAA 1TTQB 1FBTA 3VHLB 5INTA 1FUIA 1W2GA 3U0BA 3LT4A 3MBKA 2GA9A 2BFFB 3W5VA 4C7OA 1QRSA 5EHQA 3W5HA 3L0SA 3ITKA 1C1XA 1FU4A 3UQZA 1JDSA 4CIVA 5KVCA 4DMUB 2XKKA 3B52X 4YWHA 4O2AF 5CFOA 2O5VA 3GXBA 1SWVA 3I5AA 3ZN2A 3D7MA 2JGMA 5C5DA 2OAP1 2PZMA 1W85B 3DD5A 4HF7A 1O96A 3NWOA 1NDQA 2D5LA 4DLAA 4Z4CA 3EWAA 1TM3E 3FPFA 3WTCA 3LFUA 4RKEA 2IHZA 1Z6QA 1MEEA 3H5TA 4AFNA 2AYYA 3PICA 4UBMA 3FHCB 1E3EA 1MC4A 4HY3A 3CEMA 4HH0A 1NDHA 3OCZA 4DM7A 1GG9A 4UXJA 1OVMA 2W8BB 2X7JA 3MWYW 1GZDA 5KYXB 2P6RA 1CDOA 3E0XA 3FPCA 4LYAA 4E6PA 3ZCXA 1XG5A 3RV3A 3EDOA 3JXEA 2BGWA 4XCVA 1YTLA 1HDCA 3IEMA 3P2EA 2OCAA 2ZSBA 2YWJA 4MPJA 3IDQA 2VP5A 3SHFA 1ISPA 3HY4A 1WF3A 2NZUG 4HL6A 2W70A 3FUXA 5ITSA 1YS6A 2NXWA 1I7SB 1Q2UA 1KJIA 3DE4X 3PFCA 5CP8A 3IKJA 5CT8A 2C9MA 3U4IA 4CCYA 1E5TA 3M34A 4WSOA 3GHYA 1CU1A 2JA1A 1DXQA 1YSCA 4ABYA 1PG0A 5I9IA 4ATNA 1I24A 1Z9BA 2G5PA 3OQJA 3ABIA 3C8UA 3WL7A 3KZKA 3CTMA 4WCFA 1XVIA 4YX9A 4JX8A 1T8SA 3RC3A 2X4DA 3G0IA 4BC0A 1KP3A 5B7NA 3FPGA 2XA9A 4BO5A 2DPMA 3A4IA 5DHSA 4MO9A 2HBYA 1RYDA 3B8EA 5KWJA 4WLOA 1G16A 2D06A 4RGQA 3FGZA 5LZ2A 1KR5A 4WZ6A 4MJ7A 5COBA 5E95A 1T2NA 1AXEA 2C97A 4B3TB 1X74A 4K9LA 4ZCLA 1SR8A 3ZYCA 4NCKA 3EPPA 4FMPA 1C3EA 1Q0LA 3R2JA 2QQFA 4UU8A 2M1ZA 3OZSA 4EY6A 2F6RA 4DDUA 4YMVA 2J9ZB 2C3PA 3DYIA 3HHPA 3AF3A 2AK3A 3A3YA 3HUEA 4JJ6A 1R10A 4ZI7B 3EFBA 5EE3A 3E2IA 5U4XA 2LE0A 1U5AA 3VR0A 2XVAA 4E4RA 2W2KB 4X6XA 4D8TA 2I54A 4BRSA 2XADA 4U6NA 4RFSA 2VHZA 2PG3A 3MT8A 1TZBA 1N8TA 1QLHA 1BZYA 2X5KO 3U1TA 1IOVA 5ECYA 4DC0A 1R0BA 3O8NA 2IZOA 1UBCA 4NJOA 3H84A 1U8CB 4DBVO 2VHVA 4DLZA 3SDSA 2VZ0A 2IZ6A 1Z5WA 3HN6A 3MLBA 4HV4A 4HUQA 2HU5A 3M6VA 4H9GA 3QE3A 5A9SA 3CKLA 4MS1A 2V4MA 4M8SA 3M3PA 1DKLA 2C99A 3WDKA 1HE2A 1W19A 1U8EA 4HWGA 2HT1A 2VN8A 1KO8A 3B1WA 2R1TB 2VHTA 2X2EA 1HORA 1FRVA 2H0RA 4D9CA 2E55A 3KSZO 3RS0A 5I4CA 2O2CA 1AV7A 3AONB 3F3YA 3HUUA 4I4TB 3RJMA 3QXGA 5T3YA 2HJ9A 3DBLB 3NC4A 1W88B 3SC3A 4LWQA 3K6SA 4MDFA 3EEYA 4UTRA 3AJ9A 3TRDA 1BW9A 1L7NA 2B5VA 3H1PA 2DP4E 2DMRA 3FFXA 3KJQA 5TVGA 4BQNA 1NU8A 5BOSA 1J7KA 4OQQA 1QAMA 5L7WA 3CVXA 1NX9A 1RJEA 2J9XB 2QTZA 2WAAA 1J0BA 1T3LA 4FPXA 5GZ6A 3DVLA 3GMDA 3UJCA 4LYGA 1NVKA 2JFYA 4UKDA 5L4SA 1FP6A 2F90A 4PSAA 5FUYA 3X1DA 4CKWA 5SY6A 3ZE1B 4XWKA 2ZVJA 4M4SA 2WUGA 3BH6A 5TQ2A 4C3VA 4KR2A 1Y1SA 3IESA 1E2EA 2IW3A 3QHQA 5DWQA 2RAUA 1NMZA 2X4LA 4TVOA 5IARA 1NF3A 1JHUA 4DDKA 5JNSA 2DPLA 2PLAA 1RVV1 2VJMA 1X7ZB 5F2KA 3TL6A 1ODFA 4LN1A 4JZKA 1PZEA 4KR9A 1OR8A 3ILYA 3MSCA 5CK4A 2YHBA 5IBPA 4C1NA 1K86A 3DTVA 5F23A 3M6LA 4C5CA 4YQFA 3EDRA 4YRCA 5ALJA 2QTFA 2YIVX 5LQMA 4BO3A 4ZQEA 3IA7A 1SXIA 5LFAA 4P5EA 3PKJA 1G6Q1 4KLNA 3QPCA 5ALOA 2WT4A 1I2AA 1GQQA 3D5EA 3IXLA 4JP8A 2JLBA 1UOPA 3A2MA 5T8KC 4WBXC 1A8HA 1QH9A 3DOEA 3M6FA 2CL5A 2FPGA 4YT5A 5TF4A 4D8WA 3BN3A 2FPIB 4ADSG 3NHLA 5BYAA 1QHHA 1L8LA 2FR8A 2J3IA 2IC5A 1E3LA 4RVOA 3CCBA 4M7OA 2D2XA 3HYLA 2NZVG 2X0RA 4PPQA 3UGTA 3W2FA 4Q3DA 1ZAYA 1N5KA 4F8YA 3BF7A 1IK6A 2Q28A 2WOJA 5GOZA 3QNWA 4EAQA 1ILWA 2GPJA 3LYUA 1VA5A 2W0MA 1BDIA 2DHDA 1Z0KA 3D6TB 3WGZA 2WTMA 5DNEA 1HT0A 1Q1AA 5GONF 4EHLA 1FLNA 1OMOA 4M46A 5IKEA 4MKXA 2B78A 3S40A 2YXBA 1PS8A 2CJXA 5ER9A 4BBJA 4C5BA 4EG6A 3LO8A 4QVKA 3L6BA 5IYZA 1J20A 1K4KA 4EB0A 3LHSA 5BV2P 3S8EA 1JEJA 4HZGA 5D7NA 4RKQA 1PD0A 4MW0A 3TG8A 3AJRA 2XZDA 1MA3A 1AF7A 1H1LB 2CSXA 2JJ2D 3OSUA 2QRVB 5KCMA 4LMBA 4IPTA 1W36C 1EE2A 1R88A 2WAMA 4QL3A 3NHMA 3BRWA 2OP1A 3H2GA 1PBTA 2IZ1A 1XCJA 2QPTA 3T5DA 4X64B 4F2GA 4IRXA 3JATA 3Q7QA 1N25A 5TB5A 3K0AB 1U8ZA 1OAAA 4FR5A 5EIAA 3C7AA 3GJXC 4O4HA 2CNOA 2V6GA 2CFSA 4MDYA 5IUKC 4AECA 1G98A 4ARBA 3LHDA 4LPSA 2FFRA 3PEWA 2HA6A 2QTWB 4RTLA 1WMDA 4IGAA 2G72A 1BA3A 1YDEA 5B7QA 1XZHA 1P0MA 1YE8A 3BILA 4JJFA 2AHRA 5CUQA 5TPZD 3WK5A 1KEEB 1J2EA 2AB0A 3DNFA 3SQNA 3OHPA 2FMUA 3QA9A 4TWAA 3N7UA 3KU1A 3SE0A 3OD1A 4KV7A 3VKHA 2GNPA 3IAXA 1ZOSA 3L8DA 4CG2A 1YULA 5IAEA 2Q27A 2GN6A 2LWIA 5IWCA 1BGVA 3WQHA 2ZJOA 3NHFA 2QRZA 3QUCA 2IYRA 1XJCA 1VRVA 3B1FA 2ZREA 4W1SA 4DN6A 2QT9A 1EBUA 1QBGA 1ZSVA 1OH5A 2QTNA 3WNZA 2AC2A 4OXIA 4PYOA 3NHPA 4MUNA 3TM5A 3NBFA 2CFTA 4INOA 2QRMA 2UUPA 2NSYA 2WM3A 1QMPA 2APJA 2ID7A 3PU6A 4KQ2A 3KR9A 2VDNB 4EP1A 3V00A 4DR4B 1XN4A 3F0TA 3GGGA 1YU6A 3FPJA 3RC2A 3LLMA 2J1LA 2FZEA 3GLHA 1YQTA 3ZTYA 1JZQA 2FW1A 3H13A 3BBPA 3ZU2A 1XZPA 3WRYA 4B3XA 5JMTA 3NUZA 3PGKA 4TZ6A 1IUPA 1A9SA 2ZBVA 4P7FA 2QRNA 1U31A 1JIQA 1ODLA 2NLOA 3FDZB 4IFTA 1GA1A 1OXKB 3PPVA 2P4HX 4JOQA 4OI1A 3L0OA 5DM60 5J2UF 4WEOA 4NCBA 1MVOA 1Y3AA 2HNKA 2VJKA 4CEIB 4G2NA 2OYCA 4ZZ3A 2GFHA 4BE7B 1YJ5A 3EAQA 1Q2XA 2DF8A 2FJPA 2BYTA 2O2GA 4ZAYA 2J32A 1Z74A 1PL6A 4O2AB 3AQIA 2HAEA 1L3IA 1PDVA 2XLBA 4B3SB 2HT6A 3IHWA 5LWQA 4Q34A 2PL3A 1M6VA 1X80A 3AEZA 3BFKA 2HF2A 2UZ4A 4ZKDA 4LZAA 5IVKA 1FMFA 1BE8A 3Q87B 5TSDA 3NV7A 5CB4A 3CRMA 2O7NA 2WVAA 1H9BA 3GRZA 3MWKA 3T9AA 2N3ZA 4I14A 5IJ0B 2F1KA 3IAAA 1QG0A 1TQDA 1LJUA 2F62A 3HADA 1NN5A 3WE7A 5K0GA 2B6NA 4G4JA 2DKNA 3S27A 4DQUA 1NULA 1QFJA 5IG2A 3Q5GA 2G36A 4UREA 1CY6A 1DPFA 2OBBA 2YTZA 4MQMA 5HIMA 2PL9A 4CU5A 1P6XA 5I9LA 4JC0A 1OH6A 1QIFA 3HCNA 1JSZA 1W87A 4HDKA 3W5JA 1WPRA 3G23A 3C7CB 1XZEA 1SELA 3PHGA 1FP4B 2BTOA 3VQTA 1SUAA 3FZYA 1XEFA 4P4LA 3WLQA 2C9ZA 2NN3C 3DTYA 3K09C 4XTRA 5CRIA 3N0XA 2OXFA 4WA7A 3T41A 2OCXA 3LX6A 1YIOA 3UJ3X 2H1WA 1YASA 2VIIA 5K8VA 3NU1A 4CGZA 1EFRD 5JBIA 5EVJA 3IRUA 4LE2A 4WLEA 4IKPA 3HKEB 5DX0A 2WNIA 3DYVA 5F76A 5TVKA 5M29A 1PJLA 3C1UA 4KQFA 1AUOA 3RVNA 4Z1MD 3BIOA 5FNVF 3C5EA 4D0NA 6GPBA 1Y8RA 1WMFA 1DV1A 3KKOA 3PWTA 4NKRA 3SFVA 4AJKA 4D9JA 4KFCA 4II2A 4B7UA 1VE5A 3E2MA 3ETEA 2NU9A 4AROA 3KR2A 3MJHA 4RA9A 4X85A 1UEIA 4E3ZA 4UM9B 3E15A 2IITA 4GE0A 1F7VA 1YA8A 1C3LA 1I5EA 2Y6VA 3OCVA 4CM8A 5AW7A 2ZM5A 4JBXA 4BV2A 2I9PA 3V4PB 4ZMSA 1ATZA 5L53A 4GOKA 1SK9A 3RYHB 1JJIA 2J31A 4IHJF 3CG4A 3UAOA 1I3LA 1XCMA 3CNOA 2GHIA 4KWIA 1E2UA 1YS1X 2OBNA 2R8XA 5DISB 5DSTA 3ILHA 1W30A 1BDJA 1JTEA 3SBEA 1Q22A 2RHWA 1ZBQA 3ZWVA 3DDUA 4UVDA 5KQPA 1ZQ9A 2RH8A 4P3YA 2JLCA 4X6YA 3VC2A 1NN1A 4BKMA 2EJTA 3E48A 5U9CA 4KQ9A 4IWYA 1D0SA 1RAEA 2AEJA 2CLOB 4BVFA 2NACA 3LM8A 4FEEA 2BFWA 1OZAA 2IHJA 4V3CA 4E2ZA 4QDJA 2XBMA 4RCZA 1V7QA 3KQOA 1Q57A 5JV5A 2YDXA 5JASA 4AMYA 3OCCA 2X0KA 3WWYA 4FFPA 4NJEA 3P2OA 2IHTA 3K70C 4YJFB 2HGSA 1P80A 1U8XX 1UZMA 1W5SA 1YR6A 2W98A 4K6OA 3QOWA 1ORRA 4QOJA 1A2BA 1OWMA 1YL6A 3SIWA 5P21A 4KI0A 3WLAA 4I9NA 4DEXA 4PGAA 1T5HX 3BORA 3V4SA 1AKRA 1RBQA 3BA1A 5EJIA 4W7IA 3RRMA 2I4MA 3FD8A 2EIXA 3G2MA 3R9KA 4CIYA 1YL7A 2ZULA 5HIKA 3ZS8A 5GY7A 4B1FA 2Y76A 4JYCA 3IAS1 1SXQA 1HKUA 521PA 3HKDA 3GO4A 1OFTA 3DHWC 3GZTB 3K3PA 3A26A 2IOHA 1M1ZA 1MOSA 3QU9A 2A1UB 4CEJA 2O8BA 4FDTA 3JZDA 1NUSA 1Q1GA 3TTSA 2GBFA 1D8AA 1MIOA 1VLZA 2Q2NA 2ZVDA 3KT3A 4EY3A 4F7DA 2GT1A 3S0JA 4CLOA 5K2OA 2JEYA 3DBOB 5H16A 1XTBA 4GMKA 4M60A 1MZPA 3FR8A 1U2GA 3L8FA 5GVSA 1BS1A 1SB8A 2VATA 2E5WA 2H1IA 3P2MA 1R12A 4AX4A 4KRYA 3R5JA 1ZJ6A 3G2PA 1GKIA 1BOOA 1ACJA 2WZDA 3DOJA 3IKVA 1WUKS 1F2DA 1WVGA 2WTEA 2ZAIA 5ESWA 2RAVA 1EP1B 2VDPB 1RKXA 4MYSA 3OF2A 5AXAA 3WLKX 3DEAA 1P9LA 1AXRA 1BHO1 5D87A 2VEDA 4N6NA 4NZPA 1H2XA 2AS0A 2SICE 1NQOA 2BHTA 4AY4A 1E2LA 1GGMA 5AJXA 1NJSA 2GUGA 4DTIA 1JJAA 2GZRA 1BQ4A 1CXZA 2X2FA 3OKAA 3SX2A 8OHMA 1RJGA 2ALJA 3EZLA 4HWRA 3P97A 2DT8A 3JD4A 1C5KA 4D3YA 1UMBB 1G5PA 4W5HA 4H08A 4M1ZA 1USVA 4WCFC 1YONA 1MHPA 2C8LA 4CKCA 4EL5A 2JGEA 4JC5A 4ARZB 1FVFA 3Q6NA 4LJ8A 2AFIB 2XE7A 5EWJA 3RT7A 3I76A 5BSRA 1VP9A 3I0ZA 1TA4A 1A88A 4TWBA 1K5GA 1YUNA 2AZTA 3GWGA 2FW9A 1YF3A 1XTSA 3UKDA 1XHEA 3BQNB 2YIDA 3ECCA 5IDXA 3GPCA 1A69A 5FTNA 3TEMA 1FU7A 1GD1O 5FOWA 2XMCA 3WWCA 3LDFA 5C5EA 3IQZA 5GONB 5FI5A 1NVWQ 2R00C 2HSGA 1V9SA 2JLRA 4YJ2A 1GZ5A 1N3BA 1E2HA 1U65A 1IN7A 1XQWA 2YICA 1JMYA 5E6UA 3AOGA 5T64A 2H1CA 3W2HA 2PUTA 4D8VA 2I2XB 3CW2A 5A5EA 1O6FA 2XDYA 3E9MA 4EABA 1XU7A 1O0BA 1X1BA 4UCXA 4H35A 1Z6TA 2XWBF 3NNSA 3D02A 4ND3A 5DHUA 3T35A 4WZAB 4BPBA 2PSFA 1RAIA 2XCLA 5IP5A 2R7LA 4KQMA 4I19A 1XHFA 2JIQA 1WXHA 3O94A 2R62A 4WLUA 5ALZA 4BMCA 1AO0A 3EIXA 3WK4A 4G5SA 4Y1RB 5C5CA 1A4XA 2OHXA 3PNVA 3MAJA 4FZ3A 4G65A 1SUPA 1YAJA 4U7FA 4HWSA 3VZDA 4TYNA 1J56A 2Q2OA 2ZB8A 3WX0A 2H4JA 1W5FA 4L8WB 1FRQA 5EHGA 3FNIA 1QVAA 4JC8A 1SC1A 3RSQA 5BSVA 1GTZA 2IIPA 2J7KA 3T7EA 1BMTA 3F98A 3SHOA 4JOSA 1F4LA 1XVUA 2LZ0A 2PX5A 3L01A 5D7BA 2GLTA 1UAAA 1KH2A 5GIOE 5A06A 3IR6A 3CWZA 3M4NA 3SKXA 2YFHA 3WYAA 1KFKB 3EY4A 2J6CA 1J99A 1JJVA 1XCOA 1X8JA 2CL6X 3JARB 1HR0B 4AAYA 5JNLA 3HY3A 1XMVA 2RCYA 4QEZA 2HQSA 2WDZA 2OAEA 3A2NA 2FMXA 5GP1A 2PK3A 5AW5A 3ZHBA 4DBLE 4F6CA 4H7JA 3TB6A 1N36B 2AEEA 1FMCA 4A4DA 1NVDA 1QYRA 3P9IA 1JU4A 4YRTA 3FHTA 3SSMA 3UMJA 3R0QA 2JS7A 3D6JA 5THKA 3IAHA 1IN6A 2Q3FA 1EVKA 2RGAA 2VWGA 1ZIYA 4IRMA 3P2IA 4WK0B 1GNVA 3AETB 3V2HA 2C57A 3DWFA 3B8HA 5H1YA 4UU7A 2JJ2A 4PR0A 4OB7A 2YRXA 2NTEA 3PYLA 5DTRA 5EPUA 3EIWA 4YRNA 5M5BA 1UQTA 4GKKB 3PQ3A 1Z6PA 3H3JA 1GV0A 4S1NA 3DDHA 3SAJA 3U17A 2BFPA 1L7PA 2ZBDA 2DLNA 4AXBA 3DFIA 2VK8A 1MVLA 4TLAA 2PGJA 4OH7A 2N46A 4H7DA 1DAPA 1DB3A 1SKAA 3TUJC 3W2IA 5BWBA 4B7XA 1TLLA 2LBPA 1V5GA 3N0RA 4OA5A 4QM7A 4AKHA 1TF2A 1FFGA 2P9FA 2YV3A 2D62A 1VPTA 3E61A 1CUXA 3A4LA 1PHRA 3EG5A 3GBVA 5J2UB 1UBNA 3V4FA 4WFJA 4EO7A 1NG9A 1WB5A 4YACA 2ZR8A 3PL1A 3S2SA 1TKBA 1GGJA 4P81A 2GM9A 3H3XA 4ARUA 1UZNA 3FPAA 1OT3A 2QJFA 2Y93A 3THSA 2IUFA 1IB0A 2C4KA 2I6XA 3OIDA 4EA9A 3TMKA 4P38A 2BDEA 2OCKA 3JQ7B 4UNQA 1POWA 2Q0SA 1WR8A 2XMSA 2P9JA 2ZE7A 3DSRA 3DDZX 3LL4A 4HQNA 4PZ9A 3WK9A 4ARZA 4R2MA 1JSLA 5BQPA 4M1KA 1QHGA 1N5OX 3A6ZA 2OFXA 1RWBA 3MRXA 3PDIB 4LHXA 2X1HA 2BFFA 2PSSA 4GP7A 4GIBA 1L4YA 2D13A 1O8CA 3HU2A 1F2UB 3L8YA 4WLNA 5K2MA 3PRJA 1X7YB 2HLDD 2MIIA 1KEVA 4HSEA 1I4OA 2GHTA 2WVHA 4XLLA 4ZTBA 5HS4A 4ZT6A 3TL2A 2BN4A 2QTGA 1JEEA 3J81k 1Q92A 2HUNA 2ACVA 3K16A 1W85A 2AR9A 4HB3A 2Q7XA 4UTOA 4ZGWA 1Z2AA 3GFPA 1ZIDA 1MAAA 2PIDA 4B32A 1GQ2A 1J9GA 1PJCA 1SXGA 1SBZA 2GPYA 2ORYA 1KZYC 2IXBA 2R6FA 4PO8A 1D6JA 2ZTSA 4F4IA 1KI1A 4LDRA 2JIDA 4N0DA 2HHCA 2VRWA 1HLDA 1PSWA 1QZZA 2WJJA 3PS9A 4Q1CA 4IYJA 4UM9D 1B00A 2W8BA 3KUXA 4XGRA 5KYXA 3W3AH 3O5AA 1W0JA 1ZMBA 2DPHA 2WPNA 4FQ5A 4KWHA 1ISMA 4X63A 3L7LA 1GAEO 5LN1A 1AQLA 3ICVA 1RI1A 3OZRA 2FOLA 2PGOA 1O54A 3TTTA 1P29A 1I6WA 1N3IA 5C81A 4CL2A 1PR4A 5JQWA 3C16C 4UNSA 5FNVB 3CXUA 4PXSA 3ZJUA 1I2ZA 1JR4A 2FF7A 1XDZA 4MWCA 3H86A 5GAJA 4P84A 1G8MA 1X8LA 3K6JA 1VE6A 3LUJA 4YJHB 4XE5A 1TKRA 4BMYA 5B2EA 2V97A 3P5SA 2DUJA 5JDCC 3AHHA 1OJ7A 1ZVKA 3PQ2A 2WU4A 1XSEA 4PX5A 4CMCA 4UPVA 2QM7A 5YASA 1NIJA 5REQB 1QSGA 2JBWA 3BTVA 1BX0A 1L2TA 3BXEA 2CDNA 2B35A 3K9NA 1I36A 1SOUA 2Q1YA 2GTPA 3AVOA 4IHJB 4KP7A 5IBCA 5KVQA 5LQKA 2J30A 3LPDA 3OHSX 4QJBA 1E2NA 4Y67A 2VBIA 1AKNA 3GGJA 4HDCA 3U3RA 1CEXA 3UAVA 2V6BA 3T6KA 1RXVA 3PJRA 1TM7E 2FWIA 1U2ZA 3L0CA 3MTEA 1A76A 5CT5A 3ZVKA 1VHWA 3PYXA 3FMGA 2HCFA 3E5MA 3RRZA 1Z2PX 3DNMA 3N8IA 3NASA 4FGUA 4LIPD 4ZOLF 3CLHA 1L8AA 4KHZA 5AO9A 4O63O 2ZAYA 3BD6A 3GGDA 3IT1A 3UXHA 2BLLA 1EFRA 2NV0A 4H7PA 4BP3A 2F43B 4QQ8A 3N2EA 4FDAA 4ZEOA 2HBQA 2X3YA 1D2EA 2R79A 3IP9A 4KTTE 5KDDA 3TYXA 4Z1MA 2CLHB 4RH0A 5E2BA 2W2KA 1U8AA 5DYYA 1DEHA 1Z7WA 3I09A 3KEOA 3VJLA 1AA9A 2NPOA 1S2GA 2V55B 2ZI4A 3KLBA 3GJ7A 2ZSIA 4LDJA 4U2GA 1XIVA 4CTNA 2C2BA 3ESZA 4JB8A 1ONOA 3LQKA 3V1TC 1GQOA 2BI4A 5DX1A 4BO6A 4BNUA 5IK2D 2RHRA 1AKTA 1DTWB 1L7MA 4FCWA 4ALMA 2YWRA 4E5YA 1YB1A 4U8HA 1NPTO 3TLKA 5ENVA 2BMEA 2JFUA 5JDIA 3RD5A 5HWSA 3SJUA 2W6MA 3C6KA 1KSGA 4HUTA 1J0XO 4HBZA 4L0QA 5BRNA 4Q1BA 4RJIA 4AKEA 2WMNB 1OU0A 2G04A 3TIVA 3RADC 4UFPA 2ERXA 3HCBA 4WK2B 1EFDN 1WKCA 2OZVA 2R1TA 3G5MA 1HQYE 3O75A 4UM7A 3V8PA 3W4JA 2CHVA 2G5TA 3P94A 2W6OA 4GYYA 5B1DA 5BXYA 1T35A 1DBQA 2WBLC 4I4TA 2VBGA 3SZLA 4RZIA 3DBLA 1M2VB 4I66A 1W88A 4ILKA 2DERA 2QM3A 2JKZA 4IEIA 1L1EA 4MLPA 5AW2A 2HIMA 1C0IA 3PD0A 4G1CA 4QFMA 3LFTA 4RFVA 2AL7A 2DRIA 4GBMA 4ZO9A 3SQWA 3RSOA 2AH5A 2DHCA 2PEYA 1UKAA 4DS3A 3NAZA 4XYGA 1TU4A 2CV1A 3JZAA 3DF9A 1NTOA 3HBLA 4MQLA 4QX6A 4H3VA 2L19A 4IAOA 4LHZA 3CW9A 3SDBA 3EIHA 3HN2A 5C1OA 4MVJF 4LV5B 2G9RA 1JWBB 1U9CA 4N0EA 4WZAE 3VU0A 2GRUA 1DJLA 1B0ZA 1M0WA 3EG9B 1ESDA 4TMYA 1VIDA 1JLKA 3A6LA 4MCIA 4A8HA 2JDID 3HXTA 5HF5A 4ESEA 2IHNA 3UXEA 1JQBA 1PSZA 1X7ZA 4PO9A 1XU4A 2NW6A 1L5NA 3LW7A 2R5WA 1XNHA 4GD3Q 1ZS9A 2C92A 4DLUA 2HCTA 2ZI6A 3ST7A 5GOTA 1QQBA 2AG8A 3IURA 1WDKA 1RZRD 2AC7A 3NGMA 2AD1A 5EIBD 4F2HA 4GL2A 3VMMA 2D1YA 4Z3OA 1H93A 4MUIA 2YMLA 5F35A 1KOLA 1XHLA 3O8OB 5EKTA 2FP4A 2MYPA 3COSA 3FNQA 1UIRA 4OAPA 4YJGB 1TRHA 1TNDA 2FPIA 3SBXA 4EHJA 4BFCA 2EYQA 4KDEA 4X44A 4ZYLA 2PXAA 2Y1EA 5E9JA 4YMIA 2GCIA 2GPAA 1P44A 4LNAA 3DUWA 4PSUA 3UGQA 4H3KB 2D1TA 4HQFA 5L3QB 2A0KA 1ZW1A 2ZBUA 3CVJA 2VZ9A 3Q7IA 4MQBA 4A36A 2QK4A 4RHCA 2OYRA 5AW8A 4ZREA 3BKWA 2R6JA 2PFGA 4CIAA 1YZTA 1KAEA 4F5YA 4AT1A 2C3OA 1W9MA 1P3JA 2NYVA 4CIXA 4B3RB 1E0JA 3H7AA 1C4XA 2PH7A 1WY5A 3STYA 4DMLA 4LGCA 2F17A 5FUQA 1ZIOA 2J59A 5IMSA 3UK7A 2G70A 3IERA 4M0EA 1XQ1A 4LRTB 5JH7B 3QLUC 1H1LA 4ZYZA 1SCQA 2C4MA 4DLKA 1P17A 2B8WA 4BAUA 2QRVA 4B6EA 1WB6A 2FB9A 3A1CA 5AUQA 1BWRA 3BXZA 3ORQA 1QIJA 4IOMA 4D74A 4IJ5A 4XSHA 5BY2A 1U1GA 3K0AA 2JFFA 4G0YA 4EB8A 4RTQA 1O4VA 1L4FA 4C2AA 1M1NA 3L0PA 3E3AA 3ROZA 2FPRA 2CV0A 2FMTA 3AIIA 1KOGA 4BBAA 1PFKA 4X93A 4QXMA 2O2IA 1AB5A 3D1VA 4RIEA 1D03A 4EM6A 2O57A 4EIWA 4OYYA 3DBHB 4MUGA 4C0JA 1KEEA 1FQKA 1PI3A 2DGDA 3G7SA 4DR2B 2OD2A 3A1TA 1EXNA 3BXHA 4RULA 1U2GC 2OZLB 2X2OA 3R6DA 1N2ZA 4HTFB 3CX4A 3RJ5A 3VOBA 4D8YA 3UKJA 3ZKWB 4EARA 4UEJA 2X22A 4H1UA 2QN2A 3BREA 2XRZA 5KNDH 4Q0MA 4MAFA 3DZGA 1F0KA 1X38A 4CI0B 2J0SA 4OKSA 4BYGA 4ZEMA 2R8YA 3WS7A 1VE3A 2GD1O 5ED4A 5IVPA 4XIJA 4AS1A 2G5GX 3A9CA 3AFHA 1WUHS 4F1KA 1SC9A 2KWIA 4MV9A 3GDWA 4RKRA 3FLMA 3UV6A 1IEVA 4G8BA 1SBCA 1UIMA 4QUKA 2YWGA 3KHKA 1Z5OA 1A0OA 2QAIA 2GO7A 3H3FA 2GTHA 5C1PA 1TEZA 3G0BA 5DTMA 1P0FA 2CNWD 2WUDA 1P45A 3L7AA 2GARA 3CRZA 1QKJA 2NPFA 1NF8A 4IDGA 5G53C 3C0KA 1T0JB 1SKYE 1J8YF 2QIOA 4JGIA 4DMGA 1FYEA 1TGVA 1JLMA 2G07A 2M6KA 3AXTA 2RK3A 2VJCA 3FDZA 5JWRA 5AVXA 3B78A 4R1OA 3HUTA 2QRUA 2DJIA 4J3FA 2IIVA 4G36A 1D9ZA 1E79D 2AFVA 3T1HB 1LU9A 1VBMA 1C3OA 1J49A 1H2WA 3R1IA 4LHEA 2KLHA 5KHAA 4EG3A 2Q6IA 3B5EA 1RYMA 1V95A 2VH5R 4O2AA 3MJDA 3FOAA 3LUGA 3EGVA 3NJ8A 2HPVA 2M6LA 3KTDA 4QLOA 1ZM3A 1NTRA 2H7CA 1J8FA 3AI1A 1O2DA 5H3CA 4EVRA 5CFPA 5LMUB 3MK31 4KFSA 3JD2A 3QVXA 1JXAA 3IQIX 5JAPA 3Q8KA 3LQRA 2F67A 5FO1A 1WQ3A 1YRHA 4FB5A 2QLMA 4IZOA 4BFLA 2C8VA 2E2WA 3W7VA 3UH1A 1G8SA 3VNRA 3PGJA 5IJ0A 1L5VA 1VKRA 2C9BA 2NVBA 3UTDA 2XGMA 3ILSA 2ZYIA 3PQDA 4EI2A 3NTVA 4IGKA 4IIBA 1RR6A 2YCBA 1EYZA 4IIXA 4GBGA 3T38A 4Q7QA 5J23A 3O0TA 1O7JA 3C4VA 3P32A 1U2PA 4N8EA 4QAJA 3VAAA 1NF9A 3CTPA 4DV0B 4BNLA 4YRMA 1M1YB 4Y2SA 4Z7OB 2WHEA 1QP4A 3V3KA 3CZ9A 4CMBA 4X66B 1VLHA 3HRIA 1XQ9A 1NPYA 4Q3AA 5ITZB 2YZ2A 1L7AA 5FKJA 1FP4A 2PZJA 3EW9A 5ALEA 3OT1B 2XUIA 2E1RA 5LZ8A 4OUDB 1YR8A 2JFHA 1QTQA 4BZZA 3BGDA 3BGWA 1IY8A 2HLDA 2J07A 4B46A 4F4CA 1Z4JA 2G1UA 1XQYA 5CAEB 2PM8A 4GG1A 4B31A 3HKEA 2XUQA 4NBUA 2IA5A 2KW5A 3U3MA 1Z75A 2DBZA 2JH8A 2XB8A 4X1KA 1XL0A 5IWAB 4Y2QA 5GADl 5KNBD 3H9JA 4ENWA 1G41A 1WM1A 3E1SA 3BWDD 1ZM9A 2VQSA 4ZOLB 3ZQJA 2BV3A 3PGVA 4MRVA 3S2UA 4AZSA 3G0HA 1OFUA 1CIPA 4LSZA 3PXEA 3VZQA 5TV2A 3RYHA 1I3OA 2OV6A 4AMZA 5JO9A 3WFIA 2IBMA 1YVPA 4GVPA 4K9SA 2VF7A 2ADMA 2PR2A 4LTMA 2JD2A 4UTPA 4K3UA 1R5JA 3T34A 1GA6A 4LY9A 4R98A 4Q39A 1UK8A 2X5XA 2P6PA 4JU8A 1MENA 1T9GR 2HDHA 3H1EA 4HGQA 3ZCRA 5L3SB 3EHDA 2QMUA 1IAQA 1PVDA 3AJDA 1T4BA 1A77A 2VLIA 2BRUA 2VZEA 4DEYA 2W6NA 5AW1A 1FFEA 1EHIA 3EGCA 4ONEA 2QG6A 4NXMB 2YWDA 3I1IA 1K8YB 1NC3A 1L5QA 3CIFA 1JKFA 1K6IA 1OREA 4QFDA 4JUIA 4OAQA 4BIIA 4Y9UA 1RLIA 3TL3A 2YASA 2B2XA 1V26A 2AJTA 2JJ1D 2V7UA 3CLRC 4HTAA 3TLJA 4F5ZA 2XRYA 4YJFA 1BXGB 4LHVA 4UHBA 5TDHA 4R41A 1NVAA 1U6KA 2ACWA 5IFLA 3KB8A 3IP3A 1G5RA 3BWBA 4CDGA 4LC1A 2O3TA 2PZ8A 3LC2O 3NAMA 1XCLA 3IV9A 4RJTA 4P33A 2CNKA 4FI3F 2VPYA 4EGFA 3G5UA 1STOA 1WUJS 5ALFA 2AMLA 1JIKA 1XEWY 3ONDA 3SSOA 3HY6A 2WQ7A 4JLMA 4TMXA 4TKLA 2WT8A 4P3NA 4OQ4A 4XQCA 3CUKA 3KS9A 5I8ZA 2A1UA 1T0UA 5F1KA 1YZFA 3IX7A 3QFRA 4KSBA 4DSUA 4TL6A 2I6TA 3GH3A 3WGMA 3RSGA 5DI3A 4E5SA 4NABA 1PP4A 1YD7A 1BNCA 2V5VA 2YYYA 1MTOA 3FJYA 4NESA 1O94D 4G8JA 5FORA 5IK2A 1NRWA 1YR9A 2FSFA 2PUEA 1K3UB 1ZITA 1K5HA 4QDZA 4FXOA 2R96A 2DBVO 4K9NA 3M4YA 1VPVA 2Z4SA 4H6VA 4YAJA 1MDBA 2W6CX 1MAHA 2JLAA 1JHYA 4UTNA 4N0MA 3CRQA 3DFZA 1DQRA 2AFRA 3K8ZA 5J59A 1U5BB 1Y3DE 4AF7A 4URXR 3EVDA 4N5DA 4OLFA 4M1YA 1SEVA 2RG1A 4Q93A 1IZ8A 4FGKA 4P4SB 1DKMA 2EFHB 3LDUA 1JR3E 3IBYA 1R6TA 4NH0A 4IZHA