5M2QA

Structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
244
structure length
228
Chain Sequence
APRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTFQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational Change of a Tryptophan Residue in BtuF Facilitates Binding and Transport of Cobinamide by the Vitamin B12 Transporter BtuCD-F.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Outer membrane protein A,Vitamin B12-binding protein
total genus 79
structure length 228
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m2qA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 5m2qA02
3AEUA 1M34A 1QH8B 4FILA 1PSZA 2QI9F 4MDYA 5CX1B 5BVHA 5KOHB 3HH8A 3MINA 3AETB 3EIXA 3HJTA 4OXRA 3AERA 4MO9A 1TOAA 3U7QA 1KARA 3AETA 5GGXA 5JOQA 2WHYA 2XQVA 3ZK9A 1G20B 1L5HB 4TKVA 3AESB 1N4AA 3ZK7A 2XDQA 5M29A 1N2ZA 3TNYA 3UJPA 1G21A 1KAHA 2X4LA 2PHZA 4FNAA 3TEFA 3CX3A 3ZKAA 5BVGB 4GICA 4HN9A 2Q8PA 4H59A 2XUZA 1K7SN 3GI1A 1MIOB 4LJSA 5GGYA 5KOJA 4XPIB 2MINA 2PRSA 4HMOA 4UDNA 2WI8A 1K75A 4TKUA 4DBLE 3AEQB 1QH1B 2OV3A 2R7AA 5I4KA 5KOJB 4ND8B 4XPIA 1K2VN 3AEKA 3BE5A 1KAEA 1ESZA 4K3VA 4ND8A 2M6KA 5B58T 1QGUA 3EIWA 2PS9A 2YNMD 4WZAB 2AFHB 2RG7A 5KOHA 1QGUB 4OXQA 4UTOA 3MWFA 4WZAA 2AFIB 2ETVA 1MIOA 2XV1A 2Q8QA 1M1NA 3AEUB 4INOA 3ZK8A 4UDOA 1G20A 1L5HA 5HX7A 1FP4A 3BE6A 2YNMC 3AEQA 3MWGA 1G21B 3HXPA 2AFHA 3U7QB 3AERB 5HDQA 2XH8A 3PSAA 3PDIB 4WN9B 3K1AA 4G07A 3LHSA 1M34B 4MX8A 3R5SA 1H1LB 3AESA 1QH8A 5BVHB 1M1NB 1M1YB 4PAGA 5M2QA 5M34A 4WN9A 5CR9A 3K1AB 4WZBA 4NNPA 4UTPA 4INPA 4WESA 2XY4A 2PS0A 2OGWA 2MINB 2R79A 3PSHA 4MLZA 1K0FA 3MFQA 4WZBB 5CX1A 3MINB 4BBPA 3LI2A 2XDQB 4IRMA 1H1LA 4LS3A 3G9QA 3AEKB 4WNAA 4TKVB 2AFIA 1N2CA 4HMQA 4N01A 5FLYA 5AFSA 4CL2A 4FKMA 5BVGA 3PDIA 4M7OA 4WESB 2OSVA 1N2CB 5M3BA 3NU1A 4WNAB 3MD9A 2OV1A 2M6LA 1M1YA 4H0FA 5JG7A 5JPDA 5KHLB 1EFDN 2O1EA 4HMPA 4OVKA 1QH1A 4TKUB 4B8YA 4PM4A 3TLKA 1FP4B 1N4DA 3R5TA 4NNOA 4G09A 1PQ4A 2PS3A 5JJ5A 3ZTTA 1XVLA 4FI3F
chains in the Genus database with same CATH superfamily
4N0EA 2HR1A 4FKZA 2QE7D 4KPGA 1H2WA 4B7XA 2CFTA 5K0SA 2Z04A 3PU6A 1RYHA 1I5EA 1K5PA 2QTAA 2FEOA 4COOA 2JEOA 3UF0A 2QVYX 2D5IA 3RO7A 3M9WA 4F92B 1HEIA 2QORA 4I4TA 1B16A 5ITZB 3AESB 4QOIA 3PE4A 1VP3A 4PC2A 2Q1WA 1M0WA 2H6EA 1SIBE 2XR1A 3KQVA 3MRVA 4IHJF 2XE6A 1JEEA 1V9CA 1WL8A 2UZIR 4UPDA 2XZOA 3DTVA 3I5AA 4BKOA 1P0QA 1FFDA 4FHFA 1YZYA 3A7EA 4D9EA 1N77A 1MO2A 1ZD1A 2IPOA 1M75A 4OAOA 3X44A 3K53A 5JS2A 5DGDA 1L7NA 5E3JA 5ALPA 3QYPA 3NIGB 1M83A 4LYGA 4U8GA 3VYTB 4N5HX 1ORVA 3WL8A 4BE7B 2R6JA 4C4YA 5JAIA 4JJ6A 4IV0A 3T1NA 4CL3A 2VKTA 1ISMA 1JHYA 1XDZA 4ZU1X 4H6VA 5LOVB 5KZMB 1B3RA 4FFMA 1RAAA 1U9ZA 4CYMA 1V41E 1Y9ZA 5DYIA 3T1TA 1GNVA 2JEYA 3M82A 2V7PA 1M6VB 5JDCA 3A26A 5HGJA 1EINA 5CLLA 5DM70 1K97A 4G2TA 3IE1A 1M2HA 3NDIA 2ZUSA 1CUVA 3MOGA 1NF8A 1TZMA 4R8LA 4ZQCB 4OYYA 1I3LA 1U6KA 2X19A 4DLZA 3PHCA 2EJTA 1EEHA 3FWYA 4Q1VA 5ALHA 2WINI 4YRPA 1LC0A 1ENPA 3IDZA 4DG9A 1UJBA 2O2HA 3JWHA 4P38A 5AK6A 2HBRA 5C8ZA 5I9LA 4HCJA 1T1EA 1QGOA 1JEJA 1YRQA 1JG6A 2Y1CA 1W25A 1ZH8A 3TW8B 3PUKA 4ZYTA 3FBWA 2IKSA 2A0XA 1R16A 1I6LA 2ILVA 4H2DA 1RWMA 1GSAA 4FR5A 4LZOA 4PXYA 1LZKA 3R7BA 2G3YA 2XSZD 2BFDB 1FJXA 2W6ZA 4ZEOA 3RT9A 2I55A 1CZRA 1SUDA 3I4CA 2DXIA 2PRZA 5AKLA 5KDLA 5I9NA 3CW2A 4U5XA 4M8SA 1ZN9A 2VNHA 3TTYA 2XNSA 1DADA 4C4OA 4WLNA 4OV6B 3U17A 3DUWA 3C8DA 2J5QA 1DDGA 1GXSB 3CA8A 4J0FA 3OIWA 3ETJA 2PH5A 3RVSA 4LF4B 4F2GA 1UBOS 2YHAA 2W58A 4EGJA 1NR1A 2RGNA 3SYMA 2FGKA 4Q4CA 3NMUF 1WRBA 2BR5A 2GJAA 4JR0A 2COKA 4RULA 1FLVA 3TX6A 2ZR0A 1GKLA 1QE0A 1D2GA 1G7CA 4D44A 3CVXA 2ACEA 1C4XA 1E7RA 1RAEA 1UK7A 3CZ9A 3FBGA 1EP9A 2J4CA 2C95A 5ADHA 2PZEA 1RRCA 5JNSA 3U7IA 3OX3A 4DIUA 2BM0A 1E2NA 4Z99A 1ZJYA 1U0BB 1CW2B 2PR2A 3QBDA 5EJ6A 4MQFA 3IAS6 4Y18A 3WAKA 2MR5A 1LC3A 3CUTA 3K9NA 4AS3A 4V1CA 4KDFA 1AA9A 3MC1A 1FFCA 1GKKA 3QSGA 2CNOA 2HIAA 3PUHA 2C5EA 3K4QA 2HWKA 2RHHA 3KZCA 4GBMA 5LUAA 1M34E 1RLJA 3C6QA 3IP6A 1VRVA 3RV3A 3HYLA 1KDVA 1W46A 3WFIA 1RYDA 4QGSA 3AY6A 4P0QB 4QXOA 4R16A 4C7MA 1YD7A 1AF4A 2D5LA 4P7KA 3ZU4A 3DOOA 3O4IA 3EHDA 3GRKA 4JJKA 4ZEXA 4BQRA 5CFRA 1XMPA 2QUZA 4CU2A 5JE8A 3BHMA 4FOSA 1NFQA 4XOIA 3LNCA 3L18A 1Z62A 3S99A 2FSHA 3K09C 1E1QA 4MUKA 1G55A 1P6QA 4Q1AA 3MWKA 3E1SA 1Z29A 3WRYA 5EE1A 4D42A 1BA3A 2DPGA 3CSSA 1COWA 2VP9A 3T3EA 1F5SA 5SZIA 4K0KB 4ZVOA 1DAFA 2OORA 3PXBA 3FCUB 1O4VA 5BVGB 3FCAA 1K6MA 3QG1A 3KQSA 1ZL0A 3KOOA 5KOYA 3HI6A 5DIFA 3D5TA 2J9FB 2D5CA 4YVFA 3M3DA 1FIUA 2RKOA 3T1YB 5F4BA 2ZJ3A 4A0QA 2JFXA 2H08A 1D5WA 4H27A 3EY9A 5FBHA 3K70B 2BFOA 3T5CA 2N42A 3TVTA 3RAFC 2VRBA 1ADFA 4EY7A 2C3PA 3ZBQA 2FEAA 1MNAA 1RM3A 3K6SA 1EVYA 2YUTA 1V7PC 5LU9A 5CB4F 4ZA2A 1U6JA 1NYQA 3EVEA 3P0HA 1O2DA 3KCNA 1V8FA 3C5HA 5DJ5A 4EI2A 4M9ZA 4CFZA 2FQYA 2X6RA 1ACMA 3N53A 3MMZA 1KVSA 3LQFA 4ZIRB 4KQEA 4EJ2A 2VQFB 1LA2A 2WTMA 1B43A 3NM6B 3E7XA 4MQ5A 1P7PA 4N40A 3JS5A 3PQ5A 4LVUA 3S29A 2CMKA 5FYQA 5KTOA 4LFAB 1J7KA 2IDJA 3PCTA 3U9LA 4EEXA 1B4DA 2W6JD 3UMFA 1EWRA 4XQ9A 1OTHA 4OM8A 3WWCA 5EIBD 5BQ5A 4RVSA 3BWDD 1VBNA 2H92A 3DHVA 1ONOA 4RXMA 1ISRA 2WB2A 2AA3A 4YP6A 4YP1A 1G0OA 4G5OA 5CMLA 3S6JA 2WK1A 1J9EA 3LDGA 3ZCPA 4QPDA 1DEKA 3EXG1 4TRRA 1NDUA 3O8NA 5AHOA 2E9SA 1QVZA 1I5OA 1VIDA 1DQPA 3Q7IA 4TMXA 4G6ZA 2V4ZA 1Z63A 3WB0A 3R0ZA 3ABIA 3HKEA 2GKSA 4KX3A 4RFLA 1WM1A 3OCXA 1RWPA 4QU8A 1EMDA 3UT5B 4PLZA 1GPAA 1B93A 3DMDA 3FYDA 4L78A 5K8IA 3FMGA 1KSJA 2FW6A 2ZRIA 3AV3A 3JD2A 3TLAA 4JWTA 3GLTA 3GMTA 3O26A 2ZSDA 2HXYA 5HJEA 4EDHA 4BIIA 3EXEA 4J3NA 4V0QA 1XZMA 4F4DA 5C37A 3KQKA 1RAIA 2Y0EA 2WJGA 5K8UA 1WABA 4ZVKA 1YBMA 3CFYA 1TT5B 1VLZA 1E8MA 4NRDA 2E2WA 1C3VA 2PWYA 2IYFA 3PDCA 4LYHA 5KVSA 1X0XA 2CW5A 3SYRA 1BROA 3EFHA 3AKEA 4W5TA 3MMSA 4Q7QA 1E9RA 2ATXA 2YN4A 3GLKA 1T6XA 3LZCA 3Q6NA 4B3MB 1SC6A 1L0BA 2MSNA 3T3HA 2IHNA 4TQGA 5I3ZA 2AF3C 5KTKA 4ZVNA 1L8LA 5DV9A 2PSDA 1G8MA 2ZCJA 3UH0A 1FTWA 3WYBA 3B70A 4Q6WA 5H82A 3FPGA 3GEIA 3K6JA 2HMTA 4ZAYA 4CMAA 1ZAYA 4E94A 3SPXA 3RF6A 3JXEA 4HXGA 3M3HA 4ZRMA 3WHKA 1WHTA 1JYEA 4H59A 2A3RA 3CUEF 3KYCB 5FHRA 2E4WA 2H5IA 2WM8A 3R0IA 2WYOA 2Z2IA 4P54A 1ISIA 2QIPA 3LKVA 4M22A 4AKHA 2R1ZA 1ONPA 2RBEA 2IGTA 3DBLA 3FPFA 4HGRA 5CEJA 4E5UA 1E3MA 3NT2A 3GD7A 4IS3A 3DE5X 4ZP1A 3T1OA 1O0BA 4L8LA 3ABRB 1W2WB 1O54A 1A96A 2BKUA 3I9MA 2FNAA 4JEIA 5K9ZA 4BE9A 4PG7A 1R6BX 3ORSA 3HJBA 4R3WA 1JVNA 2W2LD 2XCRB 2CJWA 2XF2A 1OZGA 1A4RA 4ZOAA 1UADA 3AM1A 4A27A 2H2HA 2VTEA 3DV0B 3JVEA 4ESHA 1LLCA 2A5YB 3IUSA 3PDWA 2GRAA 2O57A 4RIGA 5EMLA 4S35A 2A4MA 4F60A 2OFWA 4O4JB 1ZYUA 4RSMA 3DM9B 3PVCA 1JLKA 2Q21A 1QFXA 4HOYA 4ENVA 5JLJA 3D5QA 1SIOA 2P2CA 1C9DB 1DVRA 1YZLA 4D9IA 5CNMA 1MTZA 3GUUA 1TADA 3N28A 4GVXA 2V7VA 4MLCA 2MJLA 2IP4A 3IUMA 4TSFD 5G0VA 4AY3A 5J43A 3OZFA 4NBWA 3HYNA 1ZN7A 3BWXA 2VPPA 4FR2A 5H3HA 1JIJA 2V7XA 2WQZA 4S1VA 4C9BA 4CMEA 4PAGA 2BGRA 4ZO7A 1NJ1A 3EH2A 1KS2A 1WY5A 2WJ3A 5LMNB 4TWIA 2FK7A 1XZEA 5IABA 2RGYA 4QXAA 2DWQA 2QZ9A 2K6GA 2YIJA 5CTJA 2DEUA 1TRKA 2B1IA 3AF3A 1EUZA 4UTVA 4D3YA 1J22A 5K8CA 3JQCA 4A2PA 1Z34A 3O31A 4RVUA 1HORA 1GL7A 4P3PA 3F5FA 4TYMA 2P5UA 4U7FA 3W9BA 1JHMA 4KR3A 3KLNA 1EFTA 3BRWD 5AIBA 1YFZA 1YE3A 1ZAKA 3ZDZB 4NESA 2QTGA 4GPBA 2RGBA 1S01A 1BHJA 2PRIA 4U02A 1SOAA 2NQ2C 5CFLA 3K9GA 4BFVA 1RC1A 3JX9A 4WK2B 1U9YA 3NV9A 5EAIA 3S5UA 4P83A 4Y1RA 3VR0A 1N2XA 4BKPA 3FBTA 3O8LA 1PWHA 3GFBA 4IO1A 2OXIA 2D2XA 3SC3A 1SHUX 4Y1RB 5CFOA 1PO7A 3MD0A 1PFGA 2YJ6A 1KNXA 2QUIA 4HFNA 4Y7CA 3I76A 3RAGA 3UCEA 4BMYA 3STTA 5HYVA 3AGPA 3K2QA 1RQXA 5F52A 2A94A 4MKRA 3PPIA 4ZCIA 3ZBUA 2IQ5A 1K7YA 4RM3A 1FS5A 3JQRA 1HE8B 2D5BA 4XB2A 5DULA 4F1JA 2OWEA 4A0RA 4DR3B 2AXNA 4DXHA 2PT5A 1V6AA 4LY3A 5BURA 3H8VA 3LGSA 5DI3B 3WRXA 1P7YA 4TS9A 4K1XA 1SXPA 4LPKA 4MO9A 3WSVA 4ZVVA 3VFDA 1GNRA 2OB2A 3MB8A 4NG5A 2A9KA 1N1DA 1ULTA 4X41A 2C7QA 3BC1A 4JP2A 2FMTA 3ND7A 1OXBB 1WUHS 2D4AA 3AI7A 1I4TD 2VDQB 3DL4A 2WJVA 4OSPA 4L6AA 4UHJA 2ZI7A 5EWLA 4DR2B 1LPPA 4ARZB 2O1XA 3EZ2A 4QYWA 1QQ7A 1J90A 5A6SB 3QOYA 3QBVA 1F06A 1AF7A 2IUEA 1CLUA 2CHQA 4QHSA 3DLHA 2QG6A 3OZCA 2GN4A 4KI7A 2HRCA 4L51A 1CPYA 3EQ6A 4MGIR 3ZDDA 2O8DA 4CCAA 1SU8A 3AF0A 4JEUA 4KXUA 4RF4A 4ZT5A 3JQAD 1YDHA 2SKCA 3W05A 2OXRA 2QN8A 3DDHA 1T6BY 4X85A 2HADA 3ZDCA 3RRNA 4O4IB 5A2QA 3OLQA 2W42A 2VP4A 3UPDA 4EJ6A 3Q88A 1Z17A 4D0RA 4DLVA 3DYIA 5GTDA 1GJRA 4LMRA 3OPNA 2CL0X 3PXEA 4IIBA 1DIBA 3RK4A 4MULA 1HXHA 5LQNA 3UK7A 3H1FA 1UJCA 4NCXA 1GPH1 3KK0A 1XQWA 4OI2A 2QP9X 2ZJ1A 1G2PA 3OZXA 3DAOA 3ZW9A 2RBKA 1DRJA 3GGCA 4AZTA 5IK2A 1JDBB 1WS6A 5ECWA 5FPTA 2P9TA 3RRJA 1VBFA 4CBVA 3R3WA 2MMGA 4ECAA 2ZZKA 2R2GA 2PX5A 3O8RA 3CZRA 3GEDA 3F97A 1WCXA 2JVIA 3EMKA 3GLUA 3TTVA 2FI1A 4CVNA 4HGQA 1D3AA 2XA1A 4LK3A 1XDUA 5CG1A 5TC4A 4RTQA 4V0OA 4IGAA 5GONA 4D9MA 5EY5B 1A4XA 4IGFA 5HCIA 4PGMA 1K1EA 2YMLA 3L0YA 4A0FA 2GJ9A 3I52A 3MOSA 2GS9A 3QLUA 4TM7A 5GONB 2V6BA 4CMGA 4OX9Y 2WTNA 1W59A 1YQTA 2JBWA 4U3JB 3AUXA 4QTTB 5EQJB 4RPIA 5FR2A 4BQIA 1FA9A 1NNEA 1U7PA 4A7PA 2OBLA 5F1KA 4P84A 5H70A 4BOYA 4EMUA 3OJFA 3OI7A 3WL3A 2DTXA 4YCLA 4QUHA 4P4SB 2HMSA 4OATA 3A0RB 2QMEA 3D31A 4C6HA 3R7WB 5A03A 2IYSA 4QUAA 1CRWG 1LFAA 3O4GA 1SCIA 4B6OA 2ZR8A 3U40A 2NUPB 4GP7A 5T4EA 2PX2A 3ONEA 3KQLA 5HM8A 5J2UA 1ECCA 1YJ5A 1MCZA 3D8TA 3SYLA 1P9NA 5F2EA 1JZTA 1OX5A 2P5SA 1FMTA 4JS0A 4MPJA 2J3LA 4X20B 3N86A 4YUVA 3W7AA 3D8RA 1DAPA 4BQNA 3SFVA 2DSTA 5GMOA 1Z8FA 3AW8A 4RA6A 1EH5A 1KK0A 4KUGA 1BCSA 3KKEA 1PJZA 3D2LA 3O84A 3R0VA 4ITUA 1W0JD 1U1EA 2HQ1A 1NNI1 3KV3O 4GMFA 4IGKA 2X2FA 2A59A 1QYCA 4MUNA 4OMFG 3GARA 5EP1A 4B75A 4M7PA 1JFSA 1OC4A 5DGIA 4YB8A 5A02A 5HF8A 1YDGA 1VE3A 4QUDA 2QTVB 3I61A 3LUCA 4LC9A 3DWEX 3JW8A 3WB9A 5AICA 5FOQA 2QQGA 4QA9A 3QX7A 1VI5A 4R83A 3AB7A 2O0MA 3I92A 5TMEA 1CUGA 4F1WA 4RTLA 3VZSA 2AN1A 1P62B 2OZEA 1J8QA 1MAAA 1T3LA 2O8BA 1H2YA 1IEWA 3NDPA 4YP7A 5FUMA 3AF4A 3OLXA 2I3BA 3BRSA 1HLPA 2FCRA 2I71A 4A8PA 4ILKA 1IZ9A 1XSEA 2G6BA 2WJWA 5EXPA 1WMEA 4J43A 2QLMA 3MJEA 3ISVA 1J0AA 4KLCA 5HKKD 1H4SA 1JQBA 5TDHA 4ACAA 3IQIX 3U7FB 1XMXA 4JJEA 4DSNA 4UQOA 3AHGA 3GJ8A 4OHKA 4OHUA 2XTMA 3DOIA 1YZTA 3P96A 4HB2A 2PRSA 1V25A 1BD3A 4IJQA 2R3SA 5A9RA 3FPSA 1YIDA 3U7EB 3GFTA 4W5HA 2PSSA 1P1HA 3GJ6A 4FHCA 4BMOB 3FNIA 4QOGA 3D7LA 3BORA 3GNSA 2WWYA 4O4HB 5EE3A 2GB4A 1II0A 3E5NA 2FP3A 3DP9A 1TYBE 3W2TA 4Q7JB 5CFQA 1T9ZA 2YNMD 1G41A 3DCNA 1JALA 4D4GA 1Z2PX 2J3JA 3KQYA 3QVUA 3OJOA 1FSSA 1Q15A 1QRRA 1N3IA 2OBNA 4PWZA 5HJ5A 3ONWA 2NQ8A 5JROA 1VLHA 3WGUA 3VSDA 1MBZA 3VUEA 3CZ4A 3STXA 1LBIA 4EQ6B 3C3CA 1PG5A 2CXSA 4QDXA 2Q1SA 5EXDA 1ZUHA 1H2HA 4ND1A 5HBGA 4CIXA 4BN4A 4Y6LA 2IV3A 1BVYF 1O95C 4EI7A 8ATCA 3H2IA 5T6BA 4G4GA 2K4MA 4Q9LA 3PSAA 3RSFA 3VNQA 5KNDH 3C3JA 3N2IA 2Y0PA 3U4DA 4HN4B 5A3VA 3B8HA 3I9FA 5FPHA 1R0KA 4F46A 5IVPA 3R8FA 2BCEA 2ZT6A 3W5SA 4C05A 4M0CA 1W30A 2GPJA 3LYAA 3RW9A 4IDBA 1DRKA 1SCUB 2ZK7A 1M54A 2HZ7A 2XY4A 4RZ2A 3TPCA 1LTHR 4RFSB 3CLKA 2JF0A 1RXSA 4LZWA 1MW9X 4B31A 3GN2A 3ICCA 3MWYW 4XW2A 2PXHA 3FCEA 4BV2A 3LXUX 3LQRA 1MB3A 2TMKA 2VT3A 3UG7A 2JCXA 2P79A 1VYUA 3H9QA 3HA5A 2G4LA 4IOMA 3K20A 1XPOA 1JZQA 4M7OA 5FI0B 4A5SA 3FFTA 1NX9A 2FOXA 2XKKA 4LTMA 1E6UA 1FUUA 1CJMA 2CLEB 3QTBA 4QGAA 3UJ9A 3ZYZA 1GRRA 4ZVMA 1N0HA 1TVKA 2E4ZA 4NDAA 1ZUNB 3ZVRA 1E7QA 3WKBA 4DIDA 3NAZA 3UATA 5KHLB 1Z06A 5A5DA 4CCYB 4JBYA 3ROZA 1MR3F 1BS1A 1F7VA 1S4QA 4ZRNA 4INZA 4B6QA 3GUCA 3T94A 1YZ3A 1M67A 1NQ5A 1SWVA 1DC8A 3T7CA 1CZOA 1DV1A 3X1KA 5EMJA 5L8VA 3RTDA 2KW5A 1DJPA 4UHDA 1YQXA 3ZI7A 4UNPA 1NQUA 3BMNB 3AHJA 4M60A 3MTAA 3BTVA 3DVLA 2R44A 4EGAA 2BFFB 4OA8A 1J24A 1BA2A 1TM4E 5C1DA 5JH7B 1HOTA 2ZJ6A 4M8IA 2ZREA 1Q16A 1U11A 3PGMA 1H8HA 1NKSA 4GUDA 4AIRA 4RKQA 2RHRA 3LBYA 5EGSA 4ES6A 4QGFA 3EPKA 4YMUA 4P32A 1SBTA 1V1MB 1OOEA 3M6UA 3R5FA 1G16A 5E0KB 1S4MA 5G1PA 3DOJA 3C3XA 4O4JA 4DC9A 3VU8A 1ZNWA 4MAMA 4EJSA 3JQGB 1A97A 1UM9B 1GA6A 5TV2A 4RTSA 1A7UA 5JMOA 1H2FA 5A3QA 4PYOA 4MLPA 4C07A 5BUQA 1E6LA 2FE1A 3N2KB 1Z47A 3GI1A 1DBWA 2DJIA 2IW1A 3PEUA 4WACA 3KKKA 3E8SA 3MIZA 4F8EA 4FUTA 3LPAA 3NV7A 1W6UA 4AJ2A 1XO1A 1H0KA 3DKPA 1ECFA 2ERYA 3ZXIA 1CSEE 1T6NA 2ZUCA 3TJRA 3ZNNA 2R7AA 4JI0B 1TF2A 2QD2A 3I73A 1J1ZA 1EUCA 1VJ5A 4X94A 3O90A 3SZGA 4FDLA 4A5OA 1SRQA 5IFKA 1Y7TA 4C08A 2XVYA 4RV9A 1NGSA 1PKXA 4W8GA 2EBFX 4PGAA 3F6RA 4TTJA 5DT2A 3R7FA 3USCS 5DNYB 4C0AC 3EA5A 4NAVA 1HH4A 5L3SA 1L4EA 2EIHA 4UMVA 5CK4A 4BNUA 1AX9A 4LNHA 4S2UA 2PGXA 1GTRA 4E30A 3FGZA 2BMFA 1R0WA 1N6PA 4JJGA 1NM5A 3BQ9A 3NTRA 1VKOA 1E9VA 5C53B 2O2GA 4H7PA 1H6CA 1R12A 4MJ7A 4YREA 3SSAA 5BYAA 4B6EA 4MB2A 4Q18A 3NHFA 4XVRA 2RGGA 3M9LA 1NW5A 2WFLA 3NKVA 1W0KA 3GZTB 1KYZA 1QG0A 3TXYA 1U9JA 4RMGA 2GGSA 3EBLA 1KK3A 1MRNA 1E9AA 4QO7A 3KKOA 5TEWA 1CIJA 1ECGA 3ND5A 3ZZTA 3WLKX 5F9FA 2AJTA 1G291 2CLIB 3D7SA 3O7WA 2NXWA 3PJRA 1FMJA 2AB0A 3M4JA 2PDAA 2Q6TA 3R23A 3CVVA 3P4XA 5DBOA 4G3XA 3I72A 3HKDB 3R5XA 1YF3A 3F4BA 2HNBA 2G0NA 2PAAA 3BMOB 2C9DA 2BP7B 1Z5OA 4FTWA 3PNKA 3TYXA 4XGQA 2Y68A 3RVLA 2FUG1 1PJTA 2DSNA 1E9BA 3R3ZA 3ZQ6A 5A4KA 4NZOA 2ZI4A 4CM6A 2IYAA 3KSUA 1Y1TA 4PTYA 4PZPA 3DDSA 4OIMA 4RY9A 4E0BA 1MHPA 3OURA 2WNSA 4MB6A 3G1TA 4HXEB 4MKGA 4B76A 5LMUB 2JK1A 1E99A 2I7CA 2IW3A 3KEQA 4K6GA 4K86A 2W2KA 4H0NA 3S4YA 2QUHA 5CYFA 3TLYA 4GM0A 3GRZA 4AJIA 3QYAA 3R5KA 7ABPA 5BW4A 1VBKA 1WW3A 1O9BA 3UXHA 2RGRA 2VQ3A 3FSJX 3V2HA 5T67A 3I9KA 3X0DA 4EHJA 4R6XA 1US8B 3T1QA 4JH0A 3TFQA 5EWMB 4E4TA 1HM5A 1TLFA 1W19A 3MEQA 5E7IA 1QKKA 3TQRA 5BPFA 2G9NA 5ITZA 2QL6A 1ODJA 3JAKA 1P0IA 2HSWA 1MO3A 4GF5A 3NORA 1QG4A 4WN3A 5C4MA 5T7BA 1IXZA 3ZE1B 2J48A 4TQ9A 3C8ZA 4YV7A 4M36A 3L8ZA 3HCBA 4QASA 4NARA 1QAQA 3C7CB 4N7MA 2LCFA 1T3GA 2H9AA 3ZD9A 1YFJA 4OQ4A 1K4KA 2I2CA 4YAKA 5YASA 4RGVA 1GILA 3UJPA 4H15A 3TLZA 3KTAB 1T1GA 5MFPA 3N76A 2O2SA 4HZUB 3AHFA 5DN6D 3JQGA 2AOVA 3P2KA 3KQOA 4L0QA 5EINA 5IKMA 4XUCA 3B6ZA 2WAMA 4JR2A 4C43A 2Z5LA 4G0PA 5LPNA 1IZ0A 1JDJA 2ZM6B 1PNOA 3WYGA 1TPYA 4M54A 5T3YA 1OBHA 3W5CA 4ID9A 2Z98A 1N2JA 3IEVA 1EUDA 1N5DA 2XUQA 3CEAA 3TRFA 2AZMA 2JEZA 2KJQA 2OGUA 4GHWA 4PZLA 5F35A 1GA4A 3L02A 4HKTA 4ZT3A 4MP6A 4KB5A 1W6RA 5K6RA 3EIWA 4A03A 1H4TA 2DQZA 3AI1A 4BNYA 2HFKA 4RTOA 4X91A 3X3HA 2W37A 5IBPA 2AN5A 1PG0A 3WJ1A 4ZIRA 3DZBA 4GNRA 4W99A 4YH1A 1E3SA 2B9EA 5KVVA 3E9EA 3KNZA 2ZKLA 1R37A 3O94A 1FDUA 4E22A 1F6DA 2IP1A 5HOEA 1TM3E 5C46F 1JBQA 3H0KA 3MWGA 4EKDA 1JHRA 2Q7XA 3DBHA 3E2PA 4YAEA 2OQVA 2LXNA 2O5EA 4UEJA 4ARAA 1T8YA 1UC9A 4A8JA 4FX2A 3WL6A 1YI0A 5I47A 4Y30A 5LB4A 2JFNA 2J5XA 3OE7D 4YLEA 3USZA 3L79A 1TEVA 3TEJA 2F90A 5E95A 4HQKA 5DNAA 2HWWA 1MZVA 3DVSX 3DZIA 5CYPA 5DASA 3VOTA 5BPHA 1IOVA 3PQ2A 4ARSA 1MJFA 1PR1A 4F1KA 1UJ2A 1X1EA 2O4UX 1UH5A 2NAFA 5JY1A 4BEWA 3OT1A 3MK31 2JBAB 1ODIA 2PLWA 3R0QA 1M2VB 4K2AA 2PS1A 2YASA 4RD3A 3DDUA 1CJCA 2X0EA 4Q4LA 4RKFA 5K0CA 6ABPA 3SFTA 3VGJA 3SVTA 5AUQA 1QMGA 2VBCA 3TAXA 5DYWA 3LYUA 3PXCX 1DWPA 4DR4B 1OXUA 3CEHA 3M2TA 4HYQA 4QDTA 3ZXSA 1DNPA 3PX3A 1I0IA 2JANA 4FE4A 3KSDO 1ZH2A 1HEUA 3F4KA 4PHGA 2B7CA 5K0LA 1KXZA 1DX9A 1ADBA 1BE8A 1GU7A 4GOJA 3C7TA 4PIPA 4I46A 1L9KA 4NOLA 5KTNA 4EATA 4QM7A 3CRNA 5FTJA 1VE6A 3TLKA 2AG0A 1CX9B 4AJJA 2G17A 2W70A 2C5LA 2WJZB 2UUAB 1PQ4A 2WIBA 3C3YA 4NZYA 3HB9A 5D5PA 3UT6A 3LBHA 2IYUA 1J21A 1XCMA 2N1MA 1T2NA 2CLDX 5C1BA 3U44A 3FDXA 3C1TA 5B30A 1PUIA 3QVTA 2HJGA 4JC8A 1KC3A 4RWZA 4YV0A 1QIGA 2EBUA 1M2NA 3IBCA 3TRHA 4BVGA 5C8XA 3R7SA 3BREA 2BFCB 3OICA 4OXNA 5BSWA 4PSUA 2VHQA 3TTWA 3GVCA 3HDYA 3MTDA 5EERA 4Z4QA 1E4EA 1M0SA 3KS9A 4BS9A 4ZCRA 1IWBB 8AT1A 1L1QA 4Y6SA 4UTZA 5KX5B 1QCDA 3WLTA 3TD6A 4DZRA 3AVVA 1PQPA 4OBWA 3V7UA 2UZ1B 3E7DA 2IHVA 2R6FA 2WSSD 4XASA 2FR8C 3OFNA 1HURA 1IQRA 1KFKB 1SQFA 3QY0A 1K8RA 4JBNA 1PW5A 2FZGA 5DEIA 3G9ZA 4LYYA 5E4JA 5DU2A 4YXWA 4KQMA 2W6ID 2ZJBA 3EGVA 4YR7A 1J56A 1U1FA 4J4HA 4MWGA 5GY7A 1U3CA 3FTCA 4E08A 4EPVA 3CV3A 1WUJS 1BDMA 2HEIA 1BXRB 3VR5D 4XCXA 2WFMA 2WI8A 3JQPA 4NONA 4BGUA 1A9RA 2AOWA 2BBWA 3QMVA 2QQ5A 3SBOA 3FMFA 1HYBA 3VO2A 1KPHA 4UBOA 4WXMA 1A71A 4CF5A 1GCGA 2OO5C 3ZE6A 4GPZA 2P1DA 4IPTA 3IFSA 3ZCVA 5EYPA 3VU9B 1ZI6A 2B9VA 4EHLA 2JLUA 4HG2A 2ZPTX 5C1PA 2CXOA 4L50A 3JAWB 1U2GC 3AJAA 3GBPA 4J0EA 1F2TA 4ODIA 2OGZA 2ISCA 1TUEA 5D1HA 5DHPA 2RJOA 4EGQA 4UQLA 2X15A 2MYNA 1E4VA 4H1WA 3PA8A 4NBLA 4ZJYA 5FPKA 3PNLA 2B5VA 1RKXA 4OG2A 1OXXK 1NJ6A 1X7WA 1B23P 5F7ZA 1GEEA 3K2IA 3IPYA 3FTFA 2BZ0A 4F5ZA 3GC6A 3K72B 3H1GA 3IAM6 4GIBA 2Z56A 4ZU3A 4FK8A 2I2WA 5KJ1A 4LWQA 4UDXX 2PXAA 4KOEC 2ZJ2A 1DHTA 3SE0A 4QUEA 3FHJA 1X39A 5AUOB 1EG2A 3ZCTA 1JFFA 1BW9B 4IIJA 1K86A 1PSWA 3P9PA 4B4OA 5GAJA 2F3SA 2R4QA 2V58A 4XCVA 3SJUA 3DUFB 1LWNA 5GZ6A 2BHTA 1KJIA 3R9XA 3FGNA 1U8EA 2L0XA 1Z7WA 4QEKA 1W8IA 4GLFA 3RGWS 4N9WA 1X1SA 1FX0A 2QX8A 1AM4D 3NOQA 3AFIA 4UVHA 4WXPA 3TR6A 4YYZA 4GQIA 3D7KA 3KYDB 4J9UE 3DWGA 3FVRA 2GTHA 3R6DA 3CB4A 5D7NA 4BFWA 4L9WA 3ZVKA 3ZOKA 3NDBB 1M2GA 4JB2A 3NTLA 3QHQA 1SCNE 1EIZA 3G5LA 1CJVC 2Y2VA 2C0CA 4HMPA 4LWZA 3VU0A 2CVHA 2GZ1A 5IT5A 3ZCUA 4P5DA 1KVQA 5JFTA 1W85A 4B5KA 4EG7A 5K8TA 3K4HA 4KGZA 1YVPA 6REQA 4KN9S 3MAGA 1KZ7B 4K87A 3HY3A 1LKZA 2FMIA 2ZI3A 2ZS9A 3UK1A 3WQRA 5JAOA 1Z28A 2X7JA 3NIBA 3ONVA 4M4SA 1RWOA 2BCGY 1J06A 1T25A 2ZIUB 4G2NA 2BFWA 5H9WA 5KJ6A 9MHTA 1YONA 1YNOA 1QK5A 1Z83A 4HBZA 4D8WA 2HL6A 3QVMA 1JKJB 4A8JC 5EHQA 5HEKA 2HZBA 2GK3A 3M49A 5AO9A 1V3TA 1J4AA 4C4TA 1SVNA 3ROEA 2IIVA 3O9VA 4WKGA 3TNYA 3SLRA 2HBYA 2AEEA 2ADMA 3FB1A 3H2HA 4D98A 1N34B 2HW8A 2JH8A 4Q02A 5KC9A 1E5DA 4QTUB 3EUAA 2NMVA 1DIOB 3Q5EA 1Y1LA 4AP9A 4YRNA 5EA2A 1DWQA 2BUBA 4KV9A 2XUJA 3CINA 1J9GA 5KUTA 4AJNA 2EZUA 3UICA 2BEVB 5EOVA 1YWGO 2BEWA 2X8JB 1M0EA 5EJ2A 1PU2A 4ZTBA 3WFJA 2FN8A 2VNKA 4KPUB 2QAJA 5TVKA 4US0R 4PCUA 1LS1A 1V96A 3A6PC 3TDMA 5FPSA 4J7XA 3ZWBA 5JU6A 1U8YA 1XHLA 3NHAA 3OX2A 1XA0A 4MQ6A 1T5LA 4NBVA 4QU9A 5JCXA 1QF6A 1ZOOA 5IVHA 1E0JA 3HY6A 4IG9A 4Q37A 4E1BA 4HDOB 4R8SA 4GPIB 2D1YA 2HQRA 5I8WA 2ZRBA 2IEIA 2BD0A 4IH1A 3IQEA 3SF8A 4A73A 4LGMA 4F12A 1KMHB 1MABA 3EK2A 3GDFA 3TB6A 4CDRA 5EJ4A 3L7DA 3K1TA 3OH8A 4ZKEA 4FOOA 3B1ZA 1Z5UA 1HC7A 3PC8C 4NE2A 5LJIA 1L7BA 4HL6A 4B73A 1TPZA 2WD7A 4PPNA 2HJSA 3I09A 3GXOA 4GQAA 4JFAA 1F2TB 1JPVA 3PG5A 4CIDA 3GUVA 1E18A 1ND5A 3TW4A 1HY3A 4L8GA 3FN4A 3AJDA 3E53A 1QPZA 4FFBB 4XSGA 1J97A 2W11A 1L7XA 4TMZA 2PAFA 1Z5PA 3IDSA 3LJKA 4L5IA 2ZJ4A 2GYVA 1LF0A 4TVKA 5K0BA 4FFWA 4RTKA 1TVMA 1P2BA 2GAIA 3N0XA 4IINA 4DLLA 3CR3C 1MVOA 3NBQA 5AVQA 4IZOA 3BERA 5L4SA 2ORVA 4KVGA 1OX4A 3EYAA 2G09A 1QOQB 4RK7A 1AIPA 4L4YA 3THOA 3WLQA 4HPJB 4US1R 3LI2A 3QXXA 1T9GS 4UM8B 3RSZA 2ZJYA 1T15A 4WADA 2WZBA 3LO8A 3L5KA 3CT4A 3M1YA 1X94A 2NSDA 4JU8A 5J59A 4ARIA 4H3HB 3T3MB 3UJHA 5BYKA 5IF3A 2CNBA 4IR7A 5T8KA 3EWIA 1KAMA 1JFFB 3OCZA 4LJ4A 5REQA 4WLEA 3VYSB 5CP8A 1RYBA 4CV2A 1X1RA 4KXMA 3B1YA 4MWCA 5JSQA 2PT7A 5I7SA 5A9SB 3OZRA 5TARA 2JIBA 3KIPA 3ZU6A 1EXDA 3A32A 3NEAA 5EUMA 4B4VA 2V4UA 2VF4X 3TNFA 4BMXA 3PVZA 4C88A 3D6VA 4MXDA 3JD1A 2V8BA 3LCUA 3FTDA 2RAFA 4HATA 1E1CA 7REQB 2GZHA 3BIJA 2R84A 3C5EA 2QW0X 2KBEA 1PJBA 2J5KA 4GE3A 4BB6A 1YC5A 3B5EA 2V74B 4GKBA 4UFOA 5C5DA 1ADYA 3TZLA 4X71A 3U3OA 4ALKA 1KMCA 2D06A 4DIEA 5LXTF 3G0DA 1QVRA 2ECFA 2W2VA 1RLIA 1K4MA 2IUSA 3NTOA 2H1RA 3ONDA 4MDYA 5J63A 2Q0QA 1U1IA 1AQ6A 3NCTA 4FHGA 2CLHB 5CD1A 4TLBA 2VPQA 3AERA 3EASA 2JHPA 3IOBA 4W1SA 5BR7A 1ULBA 2E5WA 2YJ5A 1XAGA 1WAMA 3DZDA 3ICQB 1O8BA 2BI4A 3BCUA 4PTZA 1NWCA 3TIVA 1PYDA 1VMKA 2WABA 4RJLA 3O4VA 3GLHA 3AUAA 4HAVA 3ZIAD 5CB0A 1KWGA 4PTLA 3OP4A 2DUNA 4JP5A 1TT7A 4OF4A 2PGLA 2G0TA 4KJXA 3B3AA 3W8EA 2DKFA 1CY7A 1GPBA 2YVLA 3JQFC 4B43A 2QAGA 3REQA 3U3MA 2CJXA 4XWTA 4D1YA 4ZYXA 2R8OA 2ZITA 4AS2A 4Z7NB 3Q41A 1T3ZA 3BMQA 3OUZA 3IT3A 3VH3A 2QTHA 3BWEA 4FZRA 1IEVA 4I0WB 1VBMA 4Q39A 1ORHA 1Q2UA 3F8SA 4RVNA 5IAKA 2PYIA 1RMQA 4W5WA 1QH0A 2VT2A 3WTBA 2HCJB 3V8VA 1XTZA 3VKVA 4EO4A 4PC3A 2WFLB 5BV2P 4NEGA 1P7VA 4IVQA 4EVRA 4L02A 5I7VA 4IYRA 2BL4A 3P52A 3TE6A 1SXHA 2HCTA 1YZGA 1NVKA 4MUEA 4HDSB 4A6XA 4G8CA 1JEYB 5BQFA 3REGA 1NNSA 2WF5A 3ODGA 4D0NA 1GUAA 1MU0A 3V4RA 4HWKA 3IKLA 5LBUA 3TGWA 2GA9A 4HSEA 4MW4A 1H1DA 1OSNA 4HGZA 2N9UA 1MZPA 3WLLA 2HUPA 4B2PA 4Y6RA 1XEAA 4OP1A 5EMMA 5LM3A 2VDUE 2NSJA 2FFHA 3EQ2A 2PKQP 2XQGA 1QGED 2RK4A 3MM4A 5FNZA 3CB2A 4J1TC 3DT8A 2Q6KA 8ADHA 3KT3A 4B80A 5ITVA 1ABBA 1BRMA 3JAWA 1GL3A 4WESA 3SXUB 3DMFA 2PL9A 1T8UA 1UAAA 1L8QA 1QYRA 3EBOA 3EXFB 1XWFA 1Q12A 3FTEA 1PNTA 1RQ7A 4TQUS 1VCOA 3MRXA 1Q1EA 3IQHX 3PXGA 1C30B 2VXOA 4D82A 2XOKD 4F4JA 3UKDA 4BPRA 3A6DA 5A4JA 4DN6A 4N48A 1EDDA 3PQFA 2UYOA 4LVCA 3CR8A 1RSZA 4IZ6A 5JAQA 1L7MA 2WDPA 3STUA 2DOKA 2LDXA 3GUHA 3UO8B 2XB4A 1SEPA 1GPNA 2M9MA 3NEPX 2AX3A 1QQ5A 3PX2A 3DBLB 3KKQA 1K5DA 4DJDC 3QPAA 5DOZA 4MP8A 4CPDA 1JE1A 3QTTA 4YCMA 2G0AA 4NV3A 4PG4A 1UR5A 2RCYA 2BLLA 1EM6A 1FFXB 1BVUA 1T1RA 2P7HA 2ID4A 5K3CA 2EU8A 2WJAA 4YECA 5TSDA 3M7IA 3JZDA 5FBQB 5JH7A 4B3XA 1TTQB 1ORIA 1HZJA 2IYLD 2WF7A 5M7EA 1PWYE 3G2PA 1X42A 2QX7A 2GN0A 4AX4A 3PKJA 1CDZA 4J75A 4PO3X 4XI9A 4C7JA 3KPVA 4FGSA 1Y3HA 2YVUA 3FDJA 3ZQJA 1CEXA 1D03A 4KCGA 2EERA 3NVDA 3Q1KA 1QYDA 4RELA 5LR6A 3G17A 3WNBA 5EQDA 1ECPA 1EVIA 4LBWA 4OKSA 4BB5A 2HTFA 4J0HA 2WHXA 4M1KA 3GJQA 5SICE 3TG8A 3FZNA 1UKAA 3Q87B 2Q62A 1M33A 4IDEA 3W79A 3ONNA 4HLDA 1Q50A 5E1DA 1QRDA 4NYJQ 1UJ4A 1Y7HA 3RYCA 3KTOA 3ISTA 4I1YA 4LRTB 3QEOA 4ND2A 2GLXA 1DV2A 3CWCA 4CIVA 1YRHA 4GICA 3KL4A 4I50F 5ED4A 5CCEA 4M9XA 1R9GA 2HA2A 2E6KA 2PMKA 3K16A 1KR2A 5H4GA 4RCYA 4UM7A 4ZXFA 1LVGA 4DUZB 3OBIA 5AVWA 1D6MA 3E4DA 2UXCB 2VT7A 1L4HA 2JI8A 1DBVO 2WTBA 5L3SB 2MSWA 3CVYA 3G8CA 4F5YA 4TZKA 1VPEA 1TNDA 4RHFA 3SDZA 1T4CB 4UXHA 4MIKA 1TF7A 2CEKA 2VBFA 3NJ8A 2OORC 3INYA 4OP2A 4ZHQA 2IX9A 2WA2A 3GFSA 2OBMA 4LISA 3UGTA 3D54D 4O4LA 3LP6A 3KYDA 5F1PA 4YIKA 1HDCA 5LA6B 2IY9A 4IAOA 1QGUB 2I03A 4PYKA 2QTBA 3WBBA 3IOCA 4I5EA 3VR5H 5JC1A 3OM0A 3R41A 1WU8A 3ZWOA 2BTOA 2HRQA 3NH9A 4OU4A 2QXYA 1KHTA 1UINA 5IC5A 2P2SA 1O5TA 1KH1A 3HA7A 4FEEA 4QNMA 2G1AA 2GD2A 3RJTA 4ZI3A 1SD1A 3IIMA 1FRFS 1ZN8A 2FG7C 4LRUA 2AIRA 1CUUA 2JI7A 3COVA 3KPYA 1AHHA 1YBAA 4M1QA 3E8XA 3EEYA 3Q3EA 2OG1A 1OYVA 1C1YA 3L8HA 5LYYA 3PKIA 3IO5A 1DRWA 1Z4MA 4LSMA 3WIDA 3F67A 1DWOA 1QP4A 1Z2EA 2DH6A 5JI2E 1YQEA 5THKA 1JA0A 1LXCA 5DBIA 3ACCA 3BFPA 2W2NA 3TIIA 3UAYA 3GN1A 5BR4A 4MPPA 1M8PA 4P6VF 4CGYA 3O2NA 4C21A 1FFEA 3QUSA 4AU1A 2QY6A 4GWKA 2XKJE 2H0AA 3OSUA 4GI1A 4CLDA 4CKEA 3V2GA 5J58A 1NUTA 3OOEA 1L5LA 3T52A 3U7JA 1NRXA 3TSZA 2ZM5A 3MCZA 1U3FA 1TJPB 1BE6A 3ASUA 2CN1A 3BHNA 3QVLA 2NPFA 4CKCB 2DB3A 2UXDB 4IF4A 5ADWA 4TRNA 5KTYA 3BXZA 4EHNA 2ANBA 2VYVA 3QUCA 4K7JA 3QXHA 2HM7A 4WOPA 5EKTA 2J0UB 1XZBA 1TZBA 1YR8A 3U4IA 3WKAA 3UENA 5D3MA 5GONF 1XKXA 2DGDA 4CLHA 2OCIA 4NYIQ 2FPUA 2JCSA 4TGLA 1XZNA 1SIWA 3KZXA 3MBIA 2VFAA 5IJZA 3IERA 2GMWA 1UT8A 2A9RA 3E84A 1PEDA 2XD9A 3ZKWA 5HZGA 4M21A 5KVCA 1SO8A 4J1NA 2AOTB 2DUMA 2C97A 4L5AA 5BV7A 5CIYA 3X1XA 1XR3A 2XA9A 4IWYA 3PPVA 4FBGA 3RDPA 3VQTA 3O4FA 4RTPA 3EFEA 4JENA 4JZYA 4DM7A 1A5TA 3JYQA 3ZXUB 1QO7A 5I7HA 3DG9A 3N0TA 3PFCA 3S40A 4BQOA 2GN8A 4BLTA 1JSXA 7MHTA 5KTTA 3HFRA 1RMTA 5D3QA 3R2JA 3INGA 4QNRA 4GBGA 5HUJA 3IUEA 4PYLA 2BSQA 3QELB 1E8NA 3D3EA 5H16A 4BKRA 2X9NA 1N4AA 5BWCA 3PL5A 1I2DA 2VPWA 3TIXB 4URVR 5HKBA 2HB6A 4HJRA 1ZWLA 3RTCA 3ZJTA 3N59A 2E0IA 4QDUA 4ZEWA 1HX7A 2XUAA 3GP5A 3B13B 1ODLA 1H2AS 1ZRSA 2R8PA 3H4TA 5K0TA 3X2SA 1W73A 4QBGB 4BAZA 4Z51A 2D2EA 2AZXA 2Q1XA 4PYIA 5IUKC 1UFVA 3L04A 5E2BA 3ROTA 3VZCA 3DF7A 2Z2YA 2EQ5A 2UZ4A 2O8CA 4KGXA 2IYVA 2NXJA 2CXTA 1SUWA 3QKRA 4IMIB 1I3NA 4IIFA 3L1JA 1M72A 1LCIA 3G59A 3QKTA 4E3WA 3LA6A 2CKDA 3VJLA 3OM1A 4ENPA 1B00A 2O2DA 1ZUIA 1YDMA 3FMPB 1JEDA 5A0TA 1FDOA 4KE8A 3NHSA 1SIUA 2RIPA 2XTAA 1CZLA 3OIUA 3CZPA 4P4GA 3HRKA 3WLHA 5CM9C 4G8DA 1T4CA 2X3YA 3FSRA 1CUWA 4CG1A 5HR5A 2BC9A 3C3DA 1FU7A 3OE1A 2IPLA 2IYEA 1JIIA 3E48A 4B5LA 4K03A 4F93B 4XEHA 2ZS7A 5AM1A 2KBFA 3B60A 3CRRA 3GJYA 5ED0A 3T3PB 5EJMA 1NHWA 3FJYA 1TJ5A 4RVHA 1QDEA 3IP9A 5B2EA 3OQMA 4IQGA 1NBMA 1HI9A 1QHIA 1T34A 1JQJC 3AKDA 5L9AA 1W48A 2ZYDA 4Q34A 2GO7A 3NCHA 4ALJA 4F9EA 1UPUA 2JIZA 5JI3E 1UBGA 2E4AA 2OD2A 3PQDA 1EQ2A 1XZJA 3LMKA 1BAPA 5LZ8A 1CY0A 1FNBA 3DVAA 3DE0X 3LC1O 4CODB 3IJEB 3ZHVA 3KQQA 1H4QA 1CVRA 1J5PA 1PS9A 4MX8A 4CR8A 1GUYA 1ISSA 3LW7A 3RYHB 1Q20A 2IZ0A 4JXKA 1V1RA 2OPBA 4X8LA 3WBKA 1VA4A 3OZTA 3I04A 4G5SA 1WETA 1JMVA 3QHAA 2NZ8A 3M6FA 1PJQA 3U6BA 2GRUA 4INPA 1S96A 5DGCA 1Z22A 3WX0A 1Y6FA 2DWCA 2QX6A 5EJ5A 5JD4A 1Z5GA 4GX1A 1KP3A 3CNHA 3EVCA 4JQYA 4EYEA 1YI8A 2UYCA 3HJCA 1BS2A 2O2IA 1X80A 3GWZA 3G2HA 5TMDA 4S0XA 1PDOA 4IO0A 1N1MA 2QVZX 2F7SA 3IOYA 3RBZA 1A4IA 4QICA 1FPQA 1MH9A 2CBZA 3BUSA 4Q93A 4B8ZA 1Q0TA 3TOZA 2FV8A 1NKTA 4NK4A 1OD6A 1PAUA 4YRKA 5KVAA 3Q7TA 4OFBA 3TNDA 5BNFA 3E3NA 3ZIUA 2IOHA 4E32A 5JYBA 2FMXA 3PA6A 4FFPA 2BDEA 4QOSA 4MKFA 3WP0A 3H84A 4EFLA 2NUBA 5F12A 2VSQA 2OHFA 1KZ4A 4O2BF 3EXFA 1R0CA 2IPAB 3H1PA 4QUJA 5CT8A 1U0EA 3HZZA 3KD3A 3OWHA 4HDKB 3ZHYA 1CT9A 2AJCA 3JRXA 4AUMA 2W2KB 5C8DA 3DYBA 5KSYA 1XZIA 5LZ2A 2A7XA 2C9MA 1QR6A 1WD7A 4DABA 1FNNA 1NRJB 2Q5CA 2TYSB 5BN4B 5KNDD 4PCAA 3V3KA 4FILA 5LZ5A 4B44A 4KR7A 4J7UA 3P9NA 3MINA 4RHXA 3WLOA 3TRKA 1VJGA 2Y71A 5E6SA 4G84A 2VF7A 4H18A 3VV2A 3MJFA 3Q6MA 3GU3A 3UUGA 4CHGA 2JIQA 1XVIA 5EE5B 4CV0A 4HH3C 4DIFA 1UOEA 4I5FA 4WL0A 1E1RA 1IOLA 1JW9B 3FNQA 1EX1A 4GBJA 3VR6H 4CZ2A 1PZHA 1N2ZA 4Z9AA 5FQNA 3AOEC 3T41A 3FMIA 5B5SA 4B74A 2FZLA 2VDLB 2OA0A 2ZWIA 3MJSA 3SF8B 1JJVA 3OJLA 3ZQUA 1JR2A 2F00A 4EGSA 1QGZA 4LXTA 4DAEA 5HW0A 4HRXA 4DMLA 2B61A 4Z53A 4KQKA 1U7UA 1L2TA 3ETEA 3HV0A 2OK8A 3QX9A 4OHZA 3SM9A 3TO5A 4DW8A 2CVZA 3LP8A 4XUEA 2HA5A 3FOBA 5FNVA 4CKWA 5INTA 5IVDA 3VJRA 3QITA 2B8NA 1XXHE 2CB0A 4IQ4A 4UCWA 2J3EA 4MQEB 1PI3A 1V7CA 5DSXA 4L16A 4UQPA 5BWMA 5K3SA 2Q2VA 3ZZNA 2PVCA 3AB8A 2WSIA 5I7WA 3AVYA 1L7PA 2EDCA 5MN6A 4DF3A 4CTJA 1C9EA 2V54A 4EOGA 4Q4HA 4QG3A 1XPJA 1AXRA 4KAXA 1I7DA 2XCUA 3GH1A 4KLAA 1U4NA 2J6BA 1OGIA 2H3HA 2CXQA 1YCGA 1W0KD 1D4ZA 1Y5RA 2PKWA 2EZTA 2QM8A 3DT9A 3ILSA 4LK2A 4QAJA 5E9QA 1ZSYA 3HV2A 1I94B 2VYVD 4JIGA 4JT2A 3UMYA 3DONA 3TBKA 4ZHQF 4TN1A 2VDJA 2C3YA 4K9SA 1X7DA 2C1ZA 3HSYA 4X84A 1P74A 1CF9A 2UVDA 5CT6A 2ZJOA 1A8QA 1BGXT 2C83A 5CLQA 7GPBA 3LCJA 3LU1A 3MOIA 4NZ9A 4NVRA 2GCNA 4NU6A 4KNYA 1I30A 4HSGA 4UFNA 3BDIA 1KQ3A 3T9FA 2XDYA 4DZZA 3DFIA 2QM7A 3MRSA 5JLAA 5KDDA 3JYLA 2Q99A 2HMWA 3LQ4A 4BQPA 3B1VA 3KU1A 1T2UA 1ZW1A 1GRQA 1NDQA 2IYYA 3OZEA 3PQ3A 4GWGA 3OKCA 4KE7A 4HLQB 2BGKA 1WF3A 2GBPA 2QOEA 4IZIA 5DTMA 4OMDA 4MYRA 3NHJA 4N5IX 1WZNA 3F90A 1IXKA 2WYIA 2QBYA 2JAOA 3KWFA 3H75A 2K2WA 1K8QA 3VU1A 5IKXA 1KDOA 1I7NA 1ZGZA 3HUTA 2JD1A 4Y1FA 5IJWA 3WGKA 2OHHA 1G6Q1 2OZVA 3HR4A 3G9QA 4WJLA 1A98A 3RS9A 2QSYA 1P1IA 3O2SB 1ZICA 3QNWA 1HETA 1KO1A 1NJ5A 2AG8A 3A1UA 2R7LA 4A26A 3FHTA 4X1YB 3BD9A 2A1IA 2RC5A 4JA2A 4P0TA 3VVBA 4BJ1A 5JR3A 2CLLB 5KYNA 1Y6GA 1JPUA 4HAXA 3WB2A 2Q27A 2V9PA 3P9IA 3WQBA 2PL3A 3VYWA 1TX4B 2VQDA 3L1VA 8ABPA 3UAZA 1M76A 2K7ZA 1JIQA 2P4HX 1NC1A 4Q3AA 3VKFA 1E7WA 3COYA 3QV1A 4PX2A 3GPLA 1P45A 3ITEA 4CXMA 4ASUA 1D9ZA 2EJWA 2D13A 5DXFA 1YRWA 4C2UA 4ZAVA 3U7GA 3AP2A 1KEPA 3KO8A 4GEGA 5C32A 2HREA 3DQZA 3UIEA 1OHHA 3T4UA 3LHDA 2ODWA 1XVVA 3QWFA 3Q3HA 1IE3A 4F3YA 2J9GA 4CKBA 4YV1A 2HLNA 2WDZA 3GR6A 4GX0A 4M53A 1FYVA 3GLVA 3Q7EA 4AICA 4LV6A 4YUZA 1ZIDA 4F85A 2EFEB 3CEMA 2A6PA 3HKEB 5B58C 4E5DA 5ERYA 1EZ4A 1NJGA 4X90A 2IYOA 3V4LA 4DV7B 3EVDA 3TI9A 4BX8A 1LSOA 4UTNA 1IY0A 2EZ8A 3ZUGA 4JU9A 1JHAA 1NI4B 1U7OA 2BEUB 4R31A 5CRIA 1ZS9A 3SHOA 5EKUA 2AC4A 2H29A 1DOHA 1YB7A 4ZK2A 1Y1QA 4P86A 2V7WA 2GF0A 4GQBA 2CKMA 1XZFA 4R8MA 3U19A 1IATA 1T5IA 1GA1A 3IIKA 5EJGA 1KPIA 3ROKA 2J8ZA 1X7HA 4QPPA 1BDHA 4HMOA 3NP9A 5CLJA 1Q6YA 2C5BA 2CC2A 3L6DA 1GUBA 5H8WA 1GPMA 3A04A 2PX6A 5SY6A 2FUCA 3IVRA 1U8AA 2BN4A 1YKFA 2VJOA 3NHRA 1UQUA 4P80A 4JI3B 3UAGA 3DAYA 1AMOA 4KZPA 1KAEA 4EW3A 5DSTA 4K6HA 1NSTA 3L2OB 2O48X 4KWTA 4LJLA 4JDPA 2V6JA 4ENTA 1P39A 2NSLA 2A78A 1P4JA 3OU7A 3EUEA 1PR3A 2XB8A 3OHMA 3ZE9A 3LC7O 4FYIA 3TXAA 4WZAA 2MU1A 3O8QA 3OF3A 3K9HA 3ZLTA 2VJMB 3E1KA 2OBXA 1X92A 1W9HA 1AZLA 3A31A 4E2FA 3PDUA 1GTL1 4XJXA 4QJIA 2V1XA 3GX1A 4FFBA 3FYUC 4KWHA 4IV5A 4WDQA 3IBFA 1AO3A 4S12A 4OUKX 1BVRA 2PZGA 3E22B 2PR7A 1A88A 1PE0A 1RBZA 3E9MA 1PJAA 2OMKA 1DKPA 2XXJA 2XGJA 4MR8A 3NETA 4QQNA 5JCZA 2GO1A 4ER5A 5TQ2B 5F5NA 2G5CA 1WQ3A 3UJ8A 3LX6A 5LCXA 4Q7KA 1FDVA 1RJ9B 1U1GA 3EWNA 4N4AA 1E66A 3BD6A 3A6ZA 5COBA 2O06A 3Q9LA 1GPJA 2QKYA 2H7YA 3ZHTA 1JIVA 1XZQA 4O08A 1FRVA 4WY2A 3DPUA 3EPRA 1HDYA 3M83A 2CHGA 3ORYA 3ZV3A 2ZAMA 4ROTA 3DLTA 3AVQA 1O9HA 2LKCA 5DCLA 1G98A 2D2IA 3THXA 4ZZ3A 2VJAA 3IE0A 5AKHA 3CCBA 4BY9E 5ALNA 2R4TA 1K4YA 1GGJA 2G28A 2WLTA 2H57A 1Y9EA 2C94A 3WVNA 4MUBA 5JPDA 5LQSA 1EFDN 1KI8A 5JAZA 4MUFA 5DGHA 4QG7A 4OVKA 1KMQA 1L3CA 4LZAA 2ARKA 2I29A 5EZYF 1UP7A 4WXEA 4CEHB 4L0MA 1PJSA 2P4UA 4J1QA 4UVDA 3AL3A 5AW0A 1HR0B 2IHTA 4C78A 5D01A 1IPFA 4BWVA 3B9BA 3T9EA 2GCPA 3SI7A 1KVUA 2AN3A 3W8FA 4LHZA 4PGFA 1Z5ZA 4JJ4A 4EA6A 2QGZA 3FFWA 5A05A 1OBOA 2HBZA 2X2PA 1XF1A 3BWMA 1J09A 3A4YA 4YNBA 1W96A 4K0RA 3TQFA 3JPYA 1WZCA 4C0XA 2GFQA 4D3DA 5PGMA 4NCAA 4JQSA 5KNCA 1YS4A 4F97A 1SVOA 3EVAA 4IVNA 5BSMA 4E6PA 1ILEA 4YT2A 2Z1DA 3DMRA 3P5BA 2Q2QA 3NTXA 4EPTA 4EYKA 3B6MA 3OX4A 2FLKA 4PYQA 1IWPB 4AZ0B 2XADA 1B8OA 2ZAYA 2X0DA 4O4IA 4D5GA 1TQ8A 1VGQA 4C7BA 5B55A 1X7YB 4LX8A 3SMQA 2UU9B 3DQPA 4Q3EA 1CR2A 1ESMA 1XOIA 3D8HA 4YMIA 4J2HA 1K7SN 2GYYA 1H4VB 1ETHA 4PXSA 3L06A 1TO2E 4BUJA 1YVEI 1U9CA 1ZM3A 2E37A 1Y63A 2HA4A 2ZATA 1XAJA 2ZROA 5EXEA 1WSDA 3HRIA 3F9IA 3GLIE 1C9YA 1LJ8A 4FINA 4GW3A 5DMHA 2QJOA 4HQNA 4W7HA 1ZHFA 3NHBA 2AFVA 3DKKA 3DC7A 5KOJB 5KWSA 1Z38A 1XTTA 4DUGD 2VDRB 4II2A 4AY4A 4DNOA 1B26A 3B1FA 2QGNA 3P9CA 2M6KA 4PW0A 3D1LA 3AF2A 1OFUX 5I45A 3UZUA 2I3GA 3OA2A 3VSAA 3RAPR 2H1HA 1ZGAA 1RTKA 1GVHA 2K7FA 1S3SA 4B1FA 1IJKA 2WA1A 1Z16A 3ESQA 1JRLA 4K40A 3ZV4A 3WZ2A 3X43A 1TT5A 1EP1B 2CWWA 4AMZA 2Q4DA 3BH0A 3G6KA 1C8VB 1NVAA 5B1YA 4BVHA 2JDID 1X7ZB 1M1ZA 3K35A 2GJ4A 5K3FA 2WWTA 2X0NA 2JIZD 1UIMA 1GARA 3E9CA 3H5NA 3L6RA 1VDMA 4PANA 2XYQA 4GVPA 2IOYA 2ZJFA 1DL5A 2OXFA 3BHJA 1TJ3A 2BKLA 5TPZA 1EE9A 1NBMD 1AZWA 3BH6A 5L40A 1ZM4A 2P5TB 3F5SA 3DLCA 3IVGA 3R3YA 1JSRA 1VCNA 2ZBFA 5KI6A 3LDUA 3UXMA 3V33A 3MA0A 1G2QA 1S2NA 3WYCA 4C20A 4CIAA 1VHWA 1IZYA 3QPCA 4E5NA 3BJZA 3QK7A 4MJLA 2F3UA 1T5DX 3RHTA 2AQIA 4BMPB 2Y6VA 4HEA1 2ZXUA 4PHTA 3H1AA 2ES4A 1KEKA 2H4ZA 4PE5B 3M1IA 2EGHA 3KB6A 4LHWA 1T9GR 1A72A 2LP4Y 4TXLA 2J09A 1MV5A 1H1LA 5TB5A 4I2VA 1L4BA 1E5TA 4QOJA 3ZEIA 4YRBA 4TKVB 2RB5A 4F3CA 3EMVA 1CTQA 4TV9B 1QYWA 1F8XA 3RRBA 4DVGA 1KI4A 1RPAA 2Q1YA 2NADA 1DRUA 3OQ6A 3TLXA 4EKIA 2Y0DA 3DHEA 1RYFA 1Z39A 3PIDA 3V4SA 1LSSA 4WZBE 2ZIXA 3R6TA 4N5MA 2PVPA 3IHWA 2YYAA 1DAMA 2WZDA 4EF4A 4YT4A 4Q4AA 1UBTS 1ST3A 2IE0A 1MQSA 3NHKA 2FN4A 2Z43A 3L1UA 3MQFA 3U1BA 3HYSA 4WQMA 1XX6A 1TU0A 3QF4B 2QPLA 5FQOA 4NECA 4WX2B 4N3GA 1NVVQ 4BQEA 4GKVA 1LQUA 1ZH4A 3AUUA 3WDKA 1M2EA 1ZM9A 2O8CB 1YKSA 2NX2A 4UBMA 2C2MA 3JALA 3RYCB 1EFPB 1PF7E 4BBJA 1IUNA 4P4NA 1C7EA 3HBFA 3GQBA 3AETA 1A9SA 3KJQA 1N2BA 1C3LA 3EQ9A 4V03A 2QD1A 4AY5A 5JXHA 3BQNB 3AOGA 3Q1LA 2CLOB 3MJHA 4R8KA 3W7BA 4NH0A 4EYQA 1PN3A 3S1LA 1F2DA 3NOVA 4A10A 4D4HA 3LFHA 2BFDA 3NUQA 2C4HA 3X1MA 3WGVA 1B0UA 1EFVA 1NNLA 5K03A 2F8MA 1RPJA 5KNBA 4DCJA 4NCKA 2HUNA 2IYPA 3DLAA 1K3FA 4M1YA 1ZITA 2V7EA 1XL1A 2CMDA 1N7IA 3BA6A 4YJFB 2C04A 4PGHA 4Y2UA 4BLRA 5AW3A 3I6MA 4ZK6A 1Q44A 3BWYA 1ZJ4A 4XRGA 1BX1A 2WRZA 1ZRHA 3OEEA 4TUYB 1XPUA 1GIAA 2JC3A 2XUFA 3LL7A 3VSEA 2OV3A 2CVOA 1Z35A 2I1QA 2XEDA 3U0VA 3ICVA 1M2VA 4HWPA 2P5YA 4DRXA 4H77A 4JP8A 2BSAA 1WX1A 4DDWA 3VKGA 3BL5A 3WA7A 4FJ1A 2QLBA 4P22A 3HDJA 2X4DA 1Q1AA 1YUBA 3FUUA 1ZJ6A 3FR7A 4QJBA 4RMNA 5KCZA 1H8EA 5G3ZA 5L3QB 4U2KA 3GVHA 1N7HA 4CJXA 3HCFA 1Z0JA 5TPZD 4M49A 3E3LA 2FPPA 2LVBA 3HPQA 3ONFA 4NX2A 4XSHA 3EVNA 1JTFA 3LX8A 3JTMA 1XU7A 2DFLA 2CFSA 2OZKA 2BUAA 2V98A 1P29A 2DQYA 3ICPA 4KSYA 1SELA 5HILA 3MMNA 4CM9D 5TNXA 1OY1A 1TIBA 3DLBA 3VH1A 2JI9A 1T36B 4CG0A 5LL6P 1D7AA 5AESA 4OYLA 1U04A 2X23A 1P9WA 4HFRA 3QKSB 1XJCA 3VYVA 2YWEA 5JD3A 3IB3A 3CN7A 3OESA 4LDNA 4DCNA 5F23A 2W2LA 5EJIA 4AKSA 1TL7C 4KDEA 4TVSA 4ZDIA 4ZCTA 4QXMA 3EQZA 2OGWA 1UPTA 4MLZA 1W49A 2YY5A 2CLSA 1NJFA 2ZBUA 3LPMA 3JQ9A 3GFOA 2JZNA 1NHGA 2J0UA 4PY2A 1YQUA 1QHXA 1NY6A 5C31A 3OFKA 1PBTA 2JASA 3SJZA 1P4RA 1XIVA 2C20A 3KR0A 3NQ41 2BT4A 4TVBA 1DG9A 2CVQA 4GR5A 5B4TA 1QCCA 5LUBA 4K6MA 3O91A 2HX1A 3HUEA 3ZDBA 3P2IA 2ASEA 2LPMA 3IIEA 4QWMA 2G80A 4EMSA 1XRPA 1E6MA 2KE5A 5C1OA 3PENA 3JQAB 1B2LA 5FI5A 5LXTB 3R6LA 1N5JA 2EP7A 1Z7BA 2XWJI 3C45A 1PZGA 1UBLS 4E4RA 2DLNA 2WEKA 4MK4A 5KQPA 1UBMS 3HKBB 2IQIA 3L07A 3EFOA 3RVQA 1HFKA 2ZUEA 1AOXA 1DPGA 4AF6A 2BBSA 2G9QA 3TS1A 2A0YA 1P2DA 2RG7A 2OYCA 2B99A 1X3SA 2QR5A 4IBOA 4YQFA 3K0BA 3LAWA 5HFJA 4F8YA 3MILA 1Y6RA 2NUAA 2Y1FA 4FVTA 5JJKA 2HEGA 1XP8A 1U80A 4MR7B 1C1XB 3JARA 5F33A 3TJMA 3RABA 2WICA 1BH2A 1QM5A 2JNWA 2DFNA 2WUVA 4ZMRA 2FXIA 3U3RA 2B3DA 3QKRB 2IXDA 3PC7A 5H9VA 4C0JA 4DLSA 5J4YA 4NOKA 3CN9A 1J5XA 4AZSA 1KJ9A 4RQBA 1JI0A 2R8XA 4HAWA 1XK7A 5LZ9A 1NN3A 3VAZA 3VR3A 3QVKA 2AG5A 4FM9A 4BUCA 3OHPA 1LGYA 3LLCA 5HK8A 5AVXA 2OENG 2X42A 3B52X 5JRJA 1P6UA 1FXWF 3T9BA 3ZD6A 3ASYA 4QVKA 5ICGA 3UMMA 1E59A 3SC2B 1UDCA 2AK3A 2VLIA 3ZQKA 3PLAE 1YI1A 2OP0A 4WHMA 1NF3A 4DDKA 4R1LA 4BP1A 2BHRA 1C9KA 1E3WA 2I4MA 4MPRA 3VC2A 3W4KA 1GTZA 2OD7A 2YV3A 3IC5A 2HPAA 5DYTA 5EPUA 1U28C 4W1PA 3W6NA 1FJGB 3EAQA 1WA5A 3CIOA 4XLZA 1E5QA 5KU7A 5BP7A 4JLJA 3VR3D 2QN3A 3HBMA 2YHIA 3KOUA 4NCNA 1ZCZA 4GXNA 2R8EA 1UP6A 3Q4GA 3R20A 3ZH9B 3NC0C 1GQQA 2VH5R 2VP3A 1HBJA 1A5BB 2YWRA 4ZCLA 4ZKDA 3X1DA 4Y2RA 1E6EA 2XUKA 4A82A 5HF5A 4OGWA 5T41A 5EXXA 1J8YF 2P4QA 1MO5A 3GB9A 1ISJA 2G76A 2NYRA 2R2AA 3BMXA 4EP1A 3J7AC 2EJVA 1EPUA 2XHEA 1NUAA 1DBSA 1QTNA 4FWIB 1IXRC 2WAXA 1S2OA 5B12A 5JT1A 2W0SA 3BE6A 3C16C 3HE3A 4WXHA 2IYNA 4GZ5A 1GAEO 3QA9A 5HUQA 3OLYA 5L3QA 1FDWA 4MV1A 4YMGA 4TYNA 5IBRA 1IAVA 1FEZA 1VLMA 2DPMA 2V7UA 3A6FA 3BMOA 3NOOA 4LV5B 4GL2A 3AJ9A 2DCUA 4FPXA 4WKBA 1WVGA 3A2LA 4U6NA 1M3SA 2YIMA 4B4UA 3S2IA 5AOCA 3HZRA 1Z0IA 4I1UA 5JIBA 2JCBA 2YWBA 1ATZA 1SM4A 4DLKA 5IDXA 3L41A 1XEWY 1NXXA 1OLXA 2QN1A 3JQFA 2BGWA 2KLHA 1R4NA 4QJ5A 5ALUA 4BVEA 1BU5A 2QT0A 4B6PA 2A35A 3R3SA 3U39A 3GA5A 4BEVA 4K8RB 4B81A 1H2ZA 2RGXA 2HJ9A 5IN5A 3GFRA 1NY5A 3VJKA 1FTGA 4GM1A 1RW4A 4TWRA 3R7AA 4YRCA 5C34B 3HK2A 4RKRA 1YR1A 1EDEA 3E58A 1PT8A 3ROMA 2VPXA 5IAOA 2OQ2A 3N8KA 5EWMA 2NG1A 4LOKA 1S02A 3FX2A 4X1IB 3SFZA 1C30A 3IVCA 4BNKA 2RFLA 1QQAA 1TVKB 3BGSA 3CW9A 1DJNA 2ZYGA 1NAIA 2ZSKA 4RL4A 5K7SA 4KAAA 1E1QD 1ZXXA 2CCKA 4R1TA 2EFHB 3VI3B 3ZIAA 3H4VA 4CG3A 1U1DA 2BEWB 2NTYC 2VQ6A 4QPZA 4UMEA 4U8HA 4DWVA 4KPFC 1TC1A 3WXMA 2PS3A 1GZ3A 2JFFA 4DHEA 1KC1A 1N6LA 2WAYA 1MJ5A 2IXEA 1KZ6A 3PHHA 3TEMA 2XTJA 3PR2B 2FSIA 1H9BA 2I0FA 2WTXA 3PWTA 4I4TB 4NAHA 4WOJA 3FNEA 3QELA 5CU7A 4CLRB 3LCVB 3TL6A 2HIGA 5I6DA 3GYGA 4DNPA 3S81A 3WYAA 1QYIA 3NKFA 4N0MA 1OIWA 1DIAA 3S70A 4LJ5A 5ALGA 3DKIA 2GESA 3DM5A 4OQPA 5JCJA 4LY9A 1NJ2A 1ZCAA 4CU5A 4F38A 3I5YA 2C78A 2AOUB 1JG2A 4HH4A 3LKDA 3KR1A 3OJXA 2ZCVA 3CPSA 3EIQA 4IHAA 4DLYA 4D80A 1SOWA 2JPDA 2BGTA 2FK8A 5K4AA 1UM9A 1O08A 1T9BA 8MHTA 2VRCA 2XUZA 1CE8A 3OOHA 3OEED 1BWQA 1SG9A 1N2OA 4DHWA 1E5XA 1V8ZA 2GK4A 4AYWA 4C5CA 2JGAA 4C4RA 1JQDA 3F98A 1XAIA 5H1YA 3WRYC 3SIXA 4ETIA 3AVTA 3IEUA 3L7IA 3HJHA 1V35A 4CDMA 3IEPA 1TMGE 4DCSA 1U7HA 1WUIS 1ZISA 3G1UA 2DBYA 1TQ6A 2E87A 3BILA 4I4LA 1E3DA 5DBFA 4M55A 1Z5VA 4FN5A 3QKWA 5JUWA 1CRQA 2DLDA 3DTNA 1J7JA 2YW9A 1UDAA 3PCRB 1AUPA 1UEXC 2ZAGA 3A25A 4WOBA 1NVBA 1BCSB 5JNLA 4TM8A 4MUJA 3DAHA 3IP5A 5BXYA 3FCXA 3PWSA 3EPHA 1KZGB 3D4BA 2HYIC 5IJ9B 1Y8QB 4FNGA 4I50A 5GJVC 2R6HA 2E4YA 1NP3A 2SBTA 2VF8A 3DR3A 4LTDA 1TK2A 4PLPA 5DLQC 5J1TB 5AR1A 4PNEA 3MTGA 5CBKA 2J0QA 4HZIA 3VNRA 3R74A 5KPJA 4B9EA 3ENKA 3U7QB 4ZC8A 3LNTA 3PDIB 4W7IA 1Z6YA 2VDPB 2I87A 2YJTD 4EF5A 1L5YA 1PGJA 3L7OA 5AKKA 3AIMA 3G2LA 1S2LA 1EA5A 1V9LA 4Y2PA 1Y3CE 3WHIA 3DZKA 1J23A 3AEYA 4JD5A 1Y98A 4BL5A 5JNTA 4QBTA 3GQBB 4M98A 3AYXB 5D5QA 1IJFA 4V3BA 4AKEA 3GQVA 3EZNA 1LK0A 2ONJA 4H1HA 3R77A 4Q01A 4JQZA 3V97A 4O4LF 4UNNA 1Y7PA 4ZVQA 2HNKA 3Q7QA 1NULA 2AZ4A 2YC4C 4E2YA 2QVGA 3EJ6A 5A4MS 1A0OA 2ODQA 2PWPA 3QVVA 5FOVA 2QB5A 5EIAA 4DA7A 1OI7A 3K0AA 2P6OA 3UJDA 4RLHA 4KEAA 6ADHA 2PT9A 2CD7A 3R75A 3SD7A 3NX4A 1FRNA 1A27A 2GZMA 2RBGA 1A50B 1EBFA 1VB3A 4L73A 4U7JA 3B1WA 1Y1SA 4X97A 3RREA 2COEA 4FB4A 2BIFA 1OZHA 4J0CA 5LKRA 3SYKA 5EI5A 1BKSB 2W2XA 1Z5NA 3IAUA 3UV3A 1I3KA 2FWIA 5K01A 4KYIB 1N6OA 4F4FA 3HM9A 4ALLA 5ICEA 1MFPA 4WTOA 4D81A 1IBCA 5JD5A 3H2GA 3P45A 2JIDA 1FFHA 3EWSA 1XN1A 5B1EA 4DLPA 3OPQA 2VJBA 4L5CA 4ZCSA 1AE1A 3B1JA 2V45A 3WK4A 5AK4A 4JUAA 1QLHA 2AWOA 2G77B 2BDTA 3U7HB 1I14A 1K6JA 3UJCA 2BISA 1BZYA 5GGXA 4DDVA 1VZ3A 3G7UA 2CHFA 2GR9A 3GGJA 2P62A 4JITA 1D7OA 4M8KA 1C0LA 2BFNA 2XYRA 1AKRA 2O8EB 3F5MA 1ZXBA 2O14A 2KQUA 4BWFB 1K89A 2Z3ZA 1TIKA 1ACJA 1HG1A 1SCUA 3DYVA 4DUGA 4R3NA 1ZH0A 2QMYA 4F11A 2Y4NA 3KXLA 4CN9A 1SURA 4RH1A 1RHRA 1UMBB 4NE7A 1N33B 1TAGA 2MMCA 2P35A 3PFFA 4MVCA 1CNEA 2IZ1A 2VP5A 2HRZA 4TSFA 4NR0A 4ZAGA 5KNLA 4TMYA 4EYSA 3QXJA 2LIPA 5KCMA 1GZSA 1JHUA 3DXYA 1JHPA 3H11A 4MW2A 4DSOA 1CJUC 5CAEB 1XWWA 4N8SA 3ZHZA 3U80A 4G5YA 4Z2AA 1XQ6A 2DPHA 4D8VA 1OAKA 4MV7A 4N7JA 2AJLI 2G5PA 1NDHA 2BCJQ 1N2GA 4X5OA 1PZXA 1IB6A 2Y8EA 4BRSA 1JEQB 1RRPA 1VJ1A 2GT1A 3FYUB 5KNCD 3DWIA 3OQBA 3EEOA 1F38A 1AKQA 2P3LA 4LPSA 2GDZA 3PNQA 4FEYA 1QE5A 1MTOA 4OHFA 1J0CA 1RC0A 1UXHA 2BFEB 3BXEA 3EEFA 4B2LA 1P7WA 3I6QA 2VF5X 2XUHA 4DILA 5AKZA 4BB9A 1HKUA 5B6PA 1L5GB 4ESVA 1ORTA 1CUZA 3CUUA 4K9OA 4XAQA 3IRVA 4F2DA 2AFHA 2IYTA 2FGJA 1BO6A 2XUDA 5JARA 3F78A 2PEYA 1ZNXA 3LQKA 5EL0A 1VRWA 1QB7A 3QZUA 4JR1A 4TT8A 3A05A 1MFZA 4Q1FA 3K0CA 3A10A 2HJRA 1NASA 3OM8A 4UE3S 5AUNB 3AM3A 3MJVA 2RH8A 4IX9A 1U0TA 2QZZA 3CH7A 2ENWA 1HDEA 3OVMA 4QODA 4C2TA 2I7DA 5FNVB 3KOMA 2R6DA 1IWOA 2WW8A 4GRAA 2RJNA 4TTTS 5HSGA 3T35A 3I12A 4CF6A 3F7NA 3LPCA 4GZ6A 3TLMA 3N75A 3DZCA 4G0YA 1OH5A 5B7QA 1D1QA 1XKLA 4F96A 1CVLA 2VP2A 5A5VA 3UUFA 4MMYB 3R0JA 4B4DA 3N9IA 3HCCA 2ZPAA 3BQMB 4B34A 4FCTA 2LW7A 2W98A 2X7HA 2AR9A 2EJCA 5U1PA 4FFVA 3RSGA 3F2IA 3X2FA 1FUKA 2YWHA 3FYCA 1K7CA 4IXTA 2HU2A 1RNLA 2O1EA 4F5DA 1AXEA 1Y37A 3MG9A 5ESWA 3ZDRA 2PPVA 3ECSA 3G3EA 4KQ2A 2CE7A 2IC5A 3PI6A 1UWLA 4M1MA 4DIMA 1JG3A 1IU9A 2Q28A 4WK0B 1TZ2A 2OM6A 2Z95A 3CLRD 3NBUA 4XM1A 4Z1MD 3G5AA 3PUJA 4Z7QB 5JVDA 3GLGA 2VR1A 3N3AC 1NNUA 4HQ6A 3NRBA 1BQ4A 3PQ8A 5BVHA 1USIA 2CE2X 3HH8A 3NBMA 3DEIA 2CLFB 4N8DA 1ZJ5A 3WWYA 6GPBA 2FHSA 1AV7A 2J07A 3OUTA 2E82A 2EFCB 5I51A 1DC4A 3PBKA 2AD1A 1L5HB 3EXHB 4WXYB 5DXJA 2WP0A 4M1SA 2ODEA 3GJZA 3I0MA 2I6XA 3PX7A 5TQ0A 3M70A 3RS3A 1ODCA 5IM5A 1J2YA 1JQAA 3HEAA 2D1TA 3GAZA 3DMGA 2XRYA 4KPUA 4JV5B 2AE2A 1G7RA 4RY8A 1W36B 1QQTA 3MCTA 1T35A 2JBHA 3WDLA 2HBQA 3EVTA 4ZDKA 2WAOA 4LJSA 2B98A 1DMRA 2JLYA 2O07A 1A8PA 1QQBA 4C89A 1R6XA 1D2AA 4WT7A 2JJYA 1GRCA 2J4DA 2BI7A 3CF0A 3CONA 3EVZA 4FU0A 4OUDB 3UUWA 1IVSA 1IHXA 1BXRA 4ZOLF 2PZFA 4ZQFA 1R1DA 5AW9A 5HTOA 4MITA 5K4HA 3GFVA 3BJEA 2O0KA 3M4XA 4LBVA 3W8RA 1V2HE 2AOXA 5F5XA 2C4VA 2EBHX 3KQMA 4O1IA 1O6BA 1XA3A 2AW3A 1EHIA 2W8BB 3BRCA 1CY6A 4ND3A 1H5NA 4KR0A 1GITA 5ADVA 1HDXA 5HKOA 2I6FA 5CNIA 3KETA 3EPJA 1SVKA 4QFBA 1PS8A 1PZFA 3N05A 5AXDA 1IJBA 1SBYA 5D86A 1UDRA 2B82A 3D0KA 2REXB 3QNMA 1EB8A 1C7JA 1X8KA 1N3LA 3DVQX 5DWVA 5T57A 4EZBA 2YZ2A 4ZGGA 1A2BA 1BGVA 4NFLA 3T7EA 1MX1A 5FNVF 3GJXC 3V1NA 4P98A 1FU4A 3EN0A 2XMRA 5GVSA 4KQIA 4ZO8A 4HO1X 3P4UA 3IT2A 3Q5GA 1K8YB 2HY7A 2QLLA 4A9AA 4Q3BA 5LNK6 3SWWA 1SGWA 5CX4A 3RJZA 2XB2A 4YQZA 3UAWA 1W35A 4R2WA 1YHYA 2OFFA 4FLMA 2MINB 3KT6A 2ECPA 5I9IA 1BW9A 1X87A 1FU8A 2V9ZA 3CF4A 5TF4A 3PUXA 3IUPA 4BC1A 4HYTA 2IF0A 4GO1A 1OWLA 4I4IA 1F4LA 1QIHA 4NBTA 4OJTA 1EK2A 3DL2A 2AI1A 3ULKA 3DGEC 3GLFE 2IH2A 1CUJA 1JT2A 2AYXA 2WYWA 2QNRA 3D4NA 3FSGD 4HZUA 1N2CA 1WZIA 3JQ7A 4RF3A 1GZHB 5CUQA 1GZ4A 3HNRA 2F3QA 5J23A 4R54A 4IDCA 3ILVA 4MR7A 1WP9A 1KWKA 1EFLA 1EA7A 1YOVA 1TK9A 4KRXA 5IK2D 3CUYA 4MP3A 3HN6A 2YOHA 4HI0E 2R8BA 3Q2OA 1SKQA 3SZLA 1RPZA 3RYFA 3HACA 3CLTC 5BR1A 3DGFC 1H8ED 2H1CA 1XRLA 5ALDA 2P3QA 5IDVA 4UE6A 1EVKA 2Q4BA 3MT8A 4UU7A 3RRZA 4UATA 3NDRA 1RU3A 4KWCA 3O73A 4MDEA 1XNJA 4XDHA 2JZCA 3BSWA 3RRYA 4PLTA 2V55B 2ZGVA 3TCKA 1XYGA 4LQ4A 5IJAA 1CB0A 5K5EA 2ET6A 1G42A 4GECA 1B0ZA 4RS4A 2HPZA 1YS1X 5TQJA 2FFBA 1OJLA 1FYWA 1U5CA 3ZTYA 3P26A 121PA 2J7PA 3V7NA 3FFAA 4Q9NA 4QYMA 1G5HA 4GOXA 4JGIA 2H11A 4Y98A 5AOAA 1U8CB 4CHTA 2AX4A 1T4BA 3HVRA 2HHJA 3L8GA 1Y4DE 5ESRA 3RS2A 1V8DA 4AMUA 4ABTA 2XDAA 4F91B 3A1VA 3LOPA 5A0VA 5BUSA 4K9LA 4XJSA 4EA7A 1FSFA 3AK4A 3NAQA 1USGA 1KI1A 1KNQA 4OJMX 3IB6A 5BOSA 4NJMA 3MWDA 4L27A 4WKCA 1A7AA 2FEXA 2Q6VA 2QVCA 2WIJA 4MS4B 1CDDA 2ZJZA 3CTPA 2B25A 2IHBA 2R60A 3HU1A 3WK9A 3QEBZ 4F3RA 3AF5A 1VL6A 1L5RA 2W90A 1UT5A 5T8KC 3H4IA 1C8LA 4NNJA 3SSNA 2HQBA 3WWDA 3R5HA 4NBNA 4CEIB 2OKCA 3V8PA 3K5PA 3LCRA 1ADCA 2FCAA 4EL0A 4BRWA 1T2DA 1TYCA 5EZSA 3MJDA 3CUVA 3AUFA 4Z5XA 2QJTA 2J31A 3GLHE 2FPXA 1GO2A 5KTRA 1RBMA 2P9FA 1WKBA 4LXUA 1MJGA 3L1HA 4Z0PA 5BMOA 1CC1S 3GCWA 4RHTA 3RU9A 1X2BA 4HUQA 5AM3A 1F48A 2O5RA 4RQUA 3B3GA 1X7GA 3I64A 5K20A 5KC8A 1N5IA 1Q17A 2QRKA 3B3QA 5CDFE 4HNUA 1G19A 2QZ4A