5M2UA

The structure of the ycf54 protein from synechocystis sp. pcc6803
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
b'MATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLALEYVLTGEFEAPSDAIPDPLASLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ycf54
publication title Conserved residues in Ycf54 are required for protochlorophyllide formation in Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Photosynthesis
total genus 29
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5m2uA00
5M2RA 5M2PA 3HZEA 3JSRA 5M2UA
chains in the Genus database with same CATH superfamily
2COLA 5CYMB 1U09A 5D78A 4OYOA 2G13A 3MF5A 3OTBA 5GAEI 4C6AA 2F4VJ 4CLTA 1H2TZ 4YR0A 3M6VA 5LOQA 1HHTP 3GIRA 5KFDA 4PXDA 3I6PA 3BGUA 1NKCA 5CD4H 3WX8A 3RBDA 4C9DA 3C6TA 3DKDA 3ENVA 1V3SA 2BOAA 3HI9A 1FX2A 3D66A 3I55S 5EWFA 4LSLB 2IC3B 4H4MA 3TA2A 1IKVA 2HVEA 1U0SA 3N6LA 2B4VA 4J9SA 4X84A 1WC6A 4YEAA 4DS5A 1P6TA 5HMXA 3OSPA 1X4AA 1S6PB 5KT6A 5BYSA 3R1LA 3JSMA 3DRRA 1T9UA 3W64A 5CA5A 1AZSA 2Y1IA 1RLDA 3CCJS 3W2WB 2JVOA 2W1BA 4DSEA 1VC0A 1FVSA 1SL0A 2N4CA 4LF6J 4Y2AA 4K4XA 3ISZA 2RRAA 2XBPA 3PKMA 1UZHA 2MLXA 1R8PA 2LDIA 4GRSA 3BO3A 1VRTA 1PYSB 2DGSA 1T9YA 2MQMA 3IWLA 5D0HA 5B0FA 1PJ5A 1TUVA 2QMWA 2Q66A 4YB1P 1A9NB 3BR8A 4DR1F 1N5TA 1CJTA 4V1Ak 1QTMA 2XLIA 4KGZB 4OJ3A 3IRXA 1H7WA 1JMTA 4RU9A 3IO1A 4ILLA 2OSQA 1FKPB 2HNZB 3H2VE 2JH3A 1BLUA 4Y34A 3H5UA 5E7OB 2V67A 1FRIA 1YZ7A 2DK2A 1EETB 4NA1A 2DYAA 4OJGA 2HS0A 4KV8B 5CXTA 1VC6A 1W7WA 4KY3A 1U8SA 4OV1A 3D1HA 2OPQA 2MKJA 4TLQA 4DR2J 3ICLA 4XO0A 4N77A 4Q0BB 3KLVA 2EVZA 1Q78A 2CADA 2FZKB 1CQMA 4J7CA 1FNOA 2Q6BA 1TKTB 5LMUF 4I2PB 1WUUA 5ETMA 4ECZA 2UUWA 1JX4A 5K8MA 1SQGA 4CRJA 2RS2A 2BBEA 1E6YA 2LXIA 1SH0A 2ZOMA 2J7WA 4Z37A 2F8EX 4EZ9A 4P73A 4DPOA 4X65J 1Q0NA 4NYOA 3HZGA 4AL6A 1NMEB 4A46A 2UXCJ 3ENQA 2AX1A 4J9LA 1N5QA 1KOOA 3H4BA 1RYSA 3LUYA 2Z8QA 3RB3A 4FYWB 2DEJA 3PEJA 3PYFA 3VQTA 2DGXA 1FD2A 1FRLA 1TAUA 5IT4A 1RT6B 2G1DA 1UJ6A 1DLOA 3UR3C 4PG4A 1HWIA 2CPZA 4H4OA 1F6TA 4QYZK 3NWGA 2DCUB 2R2UA 1Y5IB 2R42A 2V6AA 1P1TA 3LPYA 3RB6A 2DKOB 2R7WA 3I9ZA 5D15A 4Y2KA 2IVFB 1TL1B 1U7LA 5C25A 4HHJA 3CDWA 2AEMA 4UZCA 1ZPVA 5ADZA 5B0GA 3D6MB 3MR5A 2FGOA 4Z7YA 2JZ5A 3CNQP 3M30B 2C42A 1DARA 3V6KA 2YNHA 3UR0A 1CG2A 5GVQA 2KXHA 4IRDA 1UEUA 5F9NA 2IIHA 4NYPA 3G4SS 3OR2B 3W63A 4ZMMA 4P74A 3U27A 1LKZA 2M8DB 3D0GE 3OL7A 1K9MT 1CJKA 4X64F 4ECQA 4RLEA 4LRAA 3SV4A 4PWDA 4JYAJ 3A8IA 3ULHA 1VBYA 4M5HA 3HXMA 4J91A 1JLQA 1YJRA 4PYDA 3CJ3A 5SUHA 1GNKA 2XS5A 2PMHA 5HQMA 2RH3A 1TL5A 2NSBA 1BQNA 1RT1B 3BV8A 5H9FJ 4JP8A 1RWVB 4CLUA 1VC5A 2DITA 3W1YC 3PR5B 4FVCA 2VHGA 4QYRA 3A12A 3OXGA 4O4GB 2ZC3A 4B3MJ 3GSIA 4C8ZA 4N76A 5BYRA 5ETNA 2AEFA 3HT3A 4OHVA 1URNA 3Q23A 3QJPA 4GO5X 1UEVA 5KFGA 1S1XA 1WF1A 4QU6A 5I4MA 2ZH5A 1TELA 5DDOC 3KJFB 4CLYA 2NCKL 5J1NA 1HARA 5A76A 2BJ8A 4AXIA 2JHEA 2HYIB 2HVHA 3HSGA 3LA0A 2V8DA 1ZAXA 2EFOA 4U95A 2HVZA 1N8RT 2VG6B 1NKBA 1U6BA 1DQ9A 2D3OR 4UOHA 4O3SA 2HZVA 3SSRA 4CYUA 4C4WA 1A7GE 4FS2A 2CWKA 1FXLA 3CT9A 3WDOA 2E1PA 3CEDA 3QFHA 3C16B 4NLOA 3R5JB 1YQHA 1RSCA 3UCGA 2XZDB 2DHGA 3PW0A 3OFHA 2WSFC 2VD3A 2X1BA 5E5NA 4FYVB 3CE8A 4CLWA 1XMQF 1SC3B 2B9YA 4NLSA 2B8QA 1ZZNA 1ZZFA 1HIYA 1RWNB 1JK9B 2VASA 4Y00A 1P9QC 1HR0F 1IR2A 2V4RA 4J9NA 3T5JA 3UQSA 2MHEA 1RAFB 5EGYA 1RAOA 5IV3A 4OHXA 3UDVA 5J1EB 3KMQA 3HSDA 2RNEA 3KHLA 1N33F 1EKRA 4LBHA 3JTNA 1R43A 1UWAA 4KPCA 4RBUA 1SVDA 2UUTA 2DXDA 1ZTWA 1T03B 2VFSA 3KLGB 3M8WA 4DV7J 5I3QA 1B7FA 1S9GA 4IH6A 1SJ3P 4IQXA 1WKKA 2DEIA 4RO0A 3BSOA 2QA1A 3QIPA 3LAMA 3NAHA 4OX9F 1OSDA 2DNYA 3GP9A 1ZAWA 2E5LJ 4K0KJ 3KJVB 4UT4A 1RTIB 3MECA 3HMJG 4F0HA 2BJDA 3JSBA 2M52A 4DZDA 2VBXA 1N48A 3TX8A 2ZITA 1SC4B 5DO2A 2UV8G 2CPIA 4YS2A 3HHNB 1BXNA 2AJQA 1T05A 4IG3B 2HHSA 4MTPA 4RW4B 3DRYA 5E3QA 2UUBJ 2A6MA 4IG0B 3KLIB 5KFBA 1YDLA 5F3TA 4RNHA 3Q8RB 4LRDA 3QT8A 3LWMA 4QW8A 4F02A 3R1HA 2MPUA 3LOUA 1R7IA 5E33A 2UXDF 4X4SA 2WOMB 3EDQB 2DIVA 4F50A 4B3TJ 3RR8A 2ZOGA 3SQGA 2R8HA 2HS4A 1BUXA 4LF8J 5IM0A 1C0UA 1Y7PA 2VDIA 3MI7X 5DZ6A 3C46A 4GKJF 2NXJA 3GMGA 3SZ2A 3QAUA 4B9VA 2NUHA 3O44A 4TN2A 3KOAA 4OYZA 3E51A 1N34J 3RB0A 5HQ8A 2YKMB 3WIUA 2K7KA 1YRXA 2RS8A 3M9NB 2LQ9A 3HFVA 4EO8A 1RTDA 3PHTA 3MMCB 3OFEA 4J9KA 3PM9A 3GTYX 1HI8A 2HRUA 2E1MC 1LEOA 3IBCB 2EC0A 1F0XA 4DQRA 1N4LA 3MMJA 1U1OA 1IBCB 4JI6J 5IWAF 5D4LA 3MTJA 2AEJA 1NK7A 3FFIA 1TMJA 1T95A 1NRKA 2BE9B 4DSKA 2AIRB 2V2QA 3I32A 4OIXA 1OYEA 5AXNA 4JBCA 3P49B 4K50A 2NXNA 2IAJA 1HFEL 4HHUA 2ZEJA 1IQTA 4ILRA 5CCLA 2RRBA 4USIA 3AD9C 5BYQA 4L3KA 3D9BA 1DTTB 3GJTB 2N7YA 1VQ6S 5ETQA 2Z30B 2BUNA 5B0CA 3UFCX 3G2XA 4LSNB 1VQMS 3PCOB 2PDAA 1KD1T 2WONB 4YUDA 2K1RB 1Q7LB 2HNDB 4KE5A 2H5IB 5DLFA 3G8SA 3OVBA 1FXDA 1HQUA 3VALA 3EPGA 2I2YA 2NUUG 5KT7A 5DRKA 4QJVA 5I3UA 2EBGA 1SC6A 1GH8A 1KNZA 4YQWA 1UETA 4DSJA 2R8KA 2CPXA 5DG7A 1PGZA 2V50A 1FNMA 5DLGA 3ETMA 5G4DA 4CO2A 3PHEA 3GR1A 3KWMA 2X1AA 1S48A 2M4MA 5KFQA 2BOPA 1QAYA 2VONA 1RQ0A 2KVQE 3D2WA 2H3EB 4OZNA 4NEYA 2UV8A 1KVIA 4AT1B 2UXBF 1TQLA 3CCZA 3IC1A 2RJZA 4JI0J 2EFPA 2XMMA 3HFZB 5HO4A 1N52B 2MZJA 1NPKA 2ASYA 1WC4A 3BO4A 1V3ZA 4HH1A 4ZPAA 4OYPA 1HWKA 2ZJPQ 1N0UA 4K4UA 1U1KA 4J9QA 2LXUA 3QGHA 1VQ4S 1NPRA 2W01A 4LF9F 1HI0P 1NJXA 1ELOA 4OI1A 2CJ9A 4KGVB 1J5EJ 8ATCB 4B9MA 4C8YA 1XC9A 4ERDA 4Y2MA 2HAIA 2F1FA 2GQQA 2AMCB 1IJFB 1RXOB 1X4FA 1HHSA 2DHSA 1RBAA 5GAHU 5D77A 2CPEA 3VWSA 2EFNA 3TEHB 4MH8A 4ED8A 2EW9A 3LALA 2V8HA 4AUKA 4NCAA 1SH3A 4J9PA 3DN9A 4PABA 2AGOA 3KK2A 2HS3A 3LH2S 4YB7A 4DXLA 2C2DA 2GZOA 1EHWA 4QBUA 1U6FA 3FK4A 2RDJA 1R3NA 4O3RA 2DNGA 1IKXA 1HNXJ 1YITS 3D3BJ 2XZTB 4U67Q 4WU2A 1FWKA 4ZVEA 3M2RB 4WK3A 3W62A 4Q43A 2L9DA 5HVHA 4F0MA 4QOTA 3OLAA 3M1VB 2H65B 4DUZJ 1UAWA 2EFQA 2XG8A 2LQBA 4Q45A 1H74A 3K5LA 2FQQB 2A18A 4X2BA 2Y0SD 4LF5F 1U1RA 2KHCA 3DGVA 3M6WA 1VQ7S 4I7FA 2HSEB 4CI0B 2VG7A 3PFEA 1TR0A 3PG9A 1S1UA 1AW0A 3C6UA 3W8PA 3DLKB 1CJUA 5DGBA 1JJ4A 3BBCA 4ECTA 2IMWP 3OQ2A 3VVTA 1MU2B 3NAIA 4OZ2A 2QA2A 3I4HX 3MAQA 1NDPA 5D0RA 3W61A 2QIFA 5CH7B 1Q16B 2RT3A 3Q22A 2JJ4D 1NJWA 1CS4A 1RBLA 2A3JA 3DLEA 4ANCA 1S9EA 4ED4A 2Z58B 1AFIA 3JS9A 3TUPA 4ENOA 2NLWA 2CPDA 2QRRA 1JXEA 4M5NA 3I87A 1YJWS 3J81Y 1VR6A 5AXLA 4ZVGA 1UWBB 3M05A 3K57A 2O3DA 4F3OA 4IYQA 2JX2A 4P2MA 4P9SA 2CPJA 1JLGB 1GT8A 2F9DA 1OY8A 1N36J 3GIMA 5KG0A 2CZVC 1XJWB 2MDAA 1IWGA 1FVQA 4Q8FA 2JLGA 4MIAA 1KTQA 3HZEA 4ES1A 4ID8A 1GTHA 3GB0A 1BGXT 3PRVA 3HPOA 1HW8A 4X66F 1KLMB 1XN9A 1FD8A 5DQHA 1FRMA 2HHWA 4L3NA 5KFVA 2C22A 4QWAA 2QX0A 2YNGB 4NLWA 3BYRA 5E3PA 1DRZA 2DNRA 5HK4A 3KLHB 5G0RB 4B3SF 4ANDA 4M63A 3OL8A 4JI8J 4OQJA 3Q0AA 5IS2A 3H42A 2BANB 3P5BP 1RWMB 1CPZA 4OZJA 4LSLA 2DHHA 3OTEA 4XPCA 3JB9k 1WG5A 3PKYA 5J2PB 4ZDNA 1FTCA 4OYMA 2G0JA 4N7TA 2AF6A 2R2SA 3B4DA 4O23A 1S6PA 3P3DA 4ZCKA 2B5JA 3O1LA 3HULA 3TR5A 2PI5A 4W92B 2CKWA 4DV0J 2BVZA 1TK8A 1QJHA 2XMVA 1YG0A 1QSLA 1VQYA 3AJDA 5F8JA 1SBRA 4ELVA 2BZ2A 3DDKA 1HWUA 3OHBA 4J90A 1YLXA 2D69A 3UDCA 5CYQB 2VKRA 3GYXB 5EUHA 3EZ5A 1RBOB 4QWEA 3ZZUA 2F5GA 6AT1B 2UUCF 4DR6F 2LQJA 5AE2A 1EARA 3ILOA 1H3DA 1KDNA 4DX7A 1CVJA 2V4JB 3G71S 1IM4A 1YJNS 3QJLA 2XI2A 3OL9A 4ZLPA 2QJ3A 3MTKA 1FO1A 1GFWB 1RAEB 5L9NA 2FHMA 5LSRA 2AYMA 2CNOB 1Q1KA 5EX0A 5B0EA 2W7PA 3VGTA 3LP2A 4OI6A 3RW6A 2DH9A 4HDHA 2E1RA 4DPUA 1K0TA 3KK1B 3RUBL 5IC6B 4I1TA 1JKHB 3QO9B 1FNXH 2CJKA 4DFKA 2QN6B 1HWLA 1FFWB 4NI2B 2WBRA 1SJ4P 2DJWA 3EPIA 4TYAA 3BS9A 5KOWA 4NLRA 2BJ9A 2DXEA 1PJ7A 3BGOP 3V81A 4ZPVR 4DV2F 2HQDA 5KT3A 4M5LA 4C11A 2XHCA 5HLFB 1A0OB 1RHQB 1WTBA 4WXOA 4OZ0A 3RAQA 2HBYB 1PC5A 1U48A 1CULB 1D8ZA 1S5ZA 4J9RA 2E9TA 3U1LA 4KJIA 3ZNJ1 1HMVB 1Q4RA 3ETOA 2KXFA 2OD6A 1Q8LA 2BACA 1LWCA 2I5JB 1E6VA 3IS9B 3C19A 4ZVQB 2KT5A 4B02A 2FLNA 2HZCA 2OI2A 5DM7Q 2B6AB 3U1MA 2YNIB 5EWEA 1ZTTA 4RNFA 4G1PA 1UA1A 4EYIB 1WNEA 4DV3F 1RT6A 2M9KA 1F2GA 2XEXA 2E9RX 2HHUA 4L72B 3M8SA 4CIOA 3HHLA 1RLCL 3D6HB 2ZVIA 4ELTA 1KSPA 2P9CA 4Y6IA 3BH6B 4J37A 1Y3JA 1S79A 3K5NA 3KMSA 4QYZJ 2OAUA 5C42B 2XSJA 4O3NA 1SJRA 4O3OA 3TO8A 3OJSA 1TL4A 1U49A 3DFEA 1S0OA 4TNOA 3L4BC 1XMQJ 2NXUA 5K14A 4OYBA 2RQMA 1M1GA 1XIQA 3W2VB 3PW7A 2IHR1 3HFKA 3JSYA 4RWWA 3F44A 1NSQA 4OJHA 5CCMA 1ZETA 4DR3F 3KFWX 2I6WA 3JTOA 1KR4A 3CVKA 4U7CA 5AXKA 5A8WB 4OYWA 1DHMA 1VLYA 1QUVA 3JYTB 4QIEA 1N33J 2J9EA 3HHLD 4EBCA 2YH1A 2OFGX 2QLJB 3MR7A 3HVRA 1KS2A 1S4FA 3I0RB 1LFWA 2OJ3A 1W2BR 3VVUA 3R3TA 1ZBTA 2Z2MA 2HGLA 2FJEB 3Q83A 2R8IA 3GR0A 2Z0GA 4DF8A 2ILYA 2J6SA 4M5KA 4HTJA 4YHHF 3AD8C 2H4WB 2YKNB 4OYIA 4C0HA 4MKVA 3WX4A 3MM7A 4TKTA 4RBTA 3J7Z5 2EEYA 1C1BB 3GQCA 1S7HA 3TAQA 3H25A 3U1NA 1CBKA 1N56A 1R89A 2VC1A 4BHQA 3POTB 2X7IA 2HQIA 5GMKa 3A3NB 2BJEA 1LK7A 1AB8A 1M5PC 1HQEA 3AJ1A 1HA1A 4Q8EA 2K7JA 2XGQA 4JI1F 2YNFB 2JRSA 3C16A 3KNAA 3WIVA 1RYRA 4DF4A 2UXDJ 4CZCA 4DFPA 5DG8A 4AL5A 4O0NA 2C1EB 3H5YA 1PCAA 4DQSA 4N5SA 3ZTOA 3F0NA 5A2QU 3MD3A 4OFZA 2VDHA 2HVIA 2ZUGA 1PYTA 2IA6A 2VJVA 2E44A 3W5XA 3FZBA 1N5VA 3DRSA 1T02A 2DY1A 3K8WA 4WK1A 3V6DB 4GKJJ 2F8MA 3VTIA 1UTAA 2QFJA 2KXNB 3EGVA 1Y4ZB 2QMXA 2BKOA 3EUNA 3GV8B 1SV5B 2J6UA 2ROGA 1GK8A 1UZDA 2QL5B 3CJSA 4DSFA 3A8KA 2RVJA 5J2NA 1VI7A 2XY6A 5BR8J 3EWGA 3PDNA 1OYDA 3EICA 5IWAJ 3KLGA 3CCRS 3M32B 3T9ZA 1PC4A 4RWXA 3UVJB 2WCXA 4ECXA 3JAMU 4PXBA 1BY9A 3PX4A 4NASA 2QEXS 4X4VA 2IM3A 3OTOJ 2DNZA 4I6WA 4LF6F 1RTIA 3AJ2A 4I56A 3ELHA 3U7JA 4ED2A 5J2QA 3CSKA 3MCOA 2G0CA 4DLEA 4ID5A 2WB4A 1DJ0A 4LQ3A 3CJKA 3P45B 1S0MA 2WVEA 3QRRA 4U7UK 1M1KT 2KHDA 2XMKA 3T6JA 1D9AA 3R5CA 2V0NA 5L1JA 4RZRA 2KO1A 3F73A 3N9UC 1QLNA 2BM0A 4IG3A 5CHCB 2ZE2B 4XIUA 1HNIB 1XQIA 2XZWA 4JUZA 3CJ4A 2XS7A 2XMJA 1X9MA 3HKWA 2V8VA 1G3OA 1S6OA 1T9TA 1MROB 3DGPB 2YQ1A 3HCXA 3BKFA 3IWXA 3LP1A 4MIWA 2WVBA 3CULA 2RE1A 5ETPA 1JXLA 3CCSS 4HHHA 3NBPB 1XR5A 1JQGA 5HROB 4KHMA 3M2UA 1WDDA 1RTJB 3MMAB 1HNZF 1RTZA 2GMLA 2C3UA 2OP5A 3IFEA 4YFUA 4ZP6A 4WFNQ 3HVAA 4QIFA 2HWTA 2DGUA 2ALYB 2G9OA 4G3IA 4ETXA 3CO0P 3VAIA 3VAHA 2BE7D 1PILA 4RPFA 2AU0A 4WFBQ 3UNYA 1TZ0A 4LRCA 2HWIA 5H9EJ 3OJUA 1IBMJ 4BCAA 4V19X 1M5SA 3PW5A 2E7VA 4ZPDA 1UVKA 1R8BA 3VGUA 4X65F 1RT3A 1KTVA 3AODA 1UW4A 1RP5A 1RT7A 4A8XA 2UXCF 2DNPA 2OPPB 2N3OA 2KRRA 2GIRA 2HFSA 4RW6A 2HIYA 4YP3A 1S1TB 1I3OB 3G82B 4JI4J 2ZNZA 4RNOA 4EYHB 1OY9A 4CLLA 1UFLA 3OUYB 1RA6A 3N4WA 3TZZA 5CAAA 1XMOJ 2ZFHA 1C0TA 4K2JA 4W90B 5HMYA 3DLGB 1BWEA 5F9LA 4GVBA 1F3VA 4P2FA 3G96A 1R0AA 5F8GA 1RKIA 5A0YA 3WZ0A 2XM3A 2AYGA 3N6MA 4P6QA 1QVFR 3SQOP 5FLXY 2CVIA 3A8JA 1N5YB 5KFUA 2CJAA 4ZLJA 2YKAA 1GXLA 3GILA 3A13A 4B3RJ 1X5SA 3HD2A 3KYLA 1PAEX 2LU1A 1FF2A 4KO0B 1WWHA 1TK5A 1GXUA 4LF7F 2RDDA 2YWGA 4CQ1A 1S6QA 3FVYA 1LW2B 3M8PA 3BQ1A 3IG1B 2L9NA 4YB6A 1U0HB 1X5TA 4G65A 4H4KA 3QLHB 1HBOB 1CC7A 2OKQA 3N0VA 3TAPA 3FGVA 1YJ7A 2RIJA 4PZVA 4I67A 1KQKA 4ECRA 3MM8B 1HNVB 2JVRA 3PJWA 3GYGA 5MLCV 3L3CA 2X3GA 3NOGA 3LP0A 4O4RA 4JV1A 2P5VA 3KUHA 4B3MF 2P9EA 1YJTA 3RBEA 3W8GA 4ER8A 3LAKA 1IQZA 1RT4B 2E5JA 2QSFA 5KFRA 5HI7A 4C0BA 5LMNJ 1A6LA 3CJRA 5D4OA 4TQRA 3H2UB 3AB4B 1H72C 2BX6A 2L3MA 3WHIA 4DMZA 2VOOA 3VAGA 2P8IA 5KTQA 2Y0BB 1VQKS 4P52A 1WOSA 3CJ5A 3PJXA 3MEDB 4QU7A 1WC0A 3W65A 4CTAA 1FK9A 1NAQA 4KGMA 3SBMA 4JV5J 2VQEJ 2DRDA 2GCFA 3UD4P 1OPZA 5AE3A 2OTLS 2F65A 3NCQA 2VJUA 1LWFB 2HLUA 4FYXB 2N82B 2P2CB 3MEGB 3V6JA 1JLBB 2RILA 4KKOB 3JTPA 4ZN3A 3SDEB 1RGVA 5ETRA 4B3SJ 2J0QD 5FDLB 3GSDA 1YJVA 3ZZYA 5HJXA 2AD9A 4ZJOA 3H4DA 4JV0A 5JMNA 3IN5A 5EDWA 4IR1A 1GTEA 1NBEB 3C14A 3D1OA 4WZMA 4HT5A 1X5OA 1SUQA 4P7TA 2LMIA 2XWXA 2BJ1A 4LBPA 3FSYA 1FT8A 5F8NA 1YGYA 2HG4A 3PNIA 1HW9A 2NREA 2VG5A 1WG1A 4BS2A 2YWWA 2YY3A 4FF4A 4G1QB 2UVWA 2CQGA 2DVIA 3VAKA 3MMBA 4LVOP 5AJ3J 3NOCA 4WTOB 3MM5A 2OH2A 3GFXA 1WEYA 2WB1D 4L74A 4KHRA 2ZJQQ 5E0OA 4DV7F 2DY9A 2FLOA 4O44A 2GGPB 2XMWA 3GFZA 1NM2A 3CJ8A 2MQQA 4TY8B 3BO2A 3JQJA 3GJQB 2OEMA 3BN7A 1EJ7L 2FJBB 2QTWA 3MPYA 2DGWA 4LFCJ 1HBNB 2E5LF 3CCWA 3TVKA 1T11A 3DOMB 2ZNYA 2UUCJ 3BR9A 2DGTA 4DR6J 1T0TV 4I6YA 6FDRA 4MK9A 4NZ6A 5ITHA 2JWNA 4ZLLA 3ITHB 3QSIA 3GJSB 1PJ6A 2W9AA 2FLLA 3DI6B 4NL5A 1WEXA 2OUGA 1ITPA 4M5MA 1HI1A 3PW2A 3K0JA 1K47A 5T7LA 5JXSA 4ED0A 1BWVA 1W26A 3R9LA 4LR7A 1W2IA 2OPSB 4ZJQA 2EPIA 3T5KA 4IKAA 3NS6A 4AXJA 4C7QA 4ZVUB 4A8FA 2LU2A 4ITSA 5J2MB 2X1GA 5CQGA 3IMQJ 2FHKA 2YNGA 3PV8A 1SJFA 4XK8C 2OGUA 2XB2D 4B3TF 3CMAS 3W9HA 4PQAA 3AY0A 4DV5J 2HNYA 3KLHA 3K89A 3MR3A 2KVIA 3PY8A 4Q7AA 2M3DA 3E3XA 2GVZA 4IFYA 4LUBA 3OR1B 4LF8F 3ZTSA 4URGA 4MYTA 4J9UE 2IVYA 4MJKA 5HBMA 2IM1A 2W2PP 3DMJB 2R2RA 1BHNA 1FWLA 4ZP7A 3HO1A 2AX0A 5J2PA 4FVMA 3K8VA 1RTHB 1WJ9A 1LQ9A 2IJFA 2MEWA 1N34F 2XSFA 4X4RA 3GE9A 2MQNA 1VK8A 2W8LA 1GMWA 2D3O1 3PO5A 2QSWA 4DG1B 4EFAC 1SIWB 2FUG9 1MN7A 3C15B 3KK3B 2FVPA 1Y3KA 3FDSA 5C2CA 4JI6F 3DLJA 5K9FA 2C2RA 2VA3A 1Z2ZA 2W9CB 5KFJA 5ETLA 1RISA 1HQ2A 4ZP8A 5M2RA 2R4FA 4ZK7M 1MMDA 1B7YB 2RKIA 3D5MA 1HYSB 3PW4A 3MM6A 2W7AA 3MD1A 2F4FA 1LWEB 5DJBA 3RW7A 3FSIA 5JVGQ 4WZQA 1XK8A 1RWPB 3NGTA 4G1IA 1WACA 2HHHJ 3TUZC 2FVSA 2ZBRA 1GX6A 3QZ8A 1FRJA 2VPYB 4FZVA 1GMWD 1UVNA 4FNHA 2ASLA 2GJFA 1X0FA 5L38A 5GADU 2CQ4A 4B9TA 4PPDA 1MLAA 2AYBA 2VL1A 3CD5A 3GYNA 3NXZA 3G6XA 4CDIA 5DQGA 4R5PB 3I56S 2B4UA 3G6VA 1JKHA 3EDRB 4DPXA 3T1HJ 3ZTRA 1YRTA 4W98A 4IDKA 2XS2A 3SCIE 3R7SB 1AFJA 3GWCA 5F0UA 2NPIA 2PSZA 1EP4A 2VU5A 2CG4A 4MK7A 3DM2A 2ZC4A 5DDQC 3GCXP 3PX6A 2WK4A 3NCPA 1MG7A 3MOZA 4MKAA 1Y0HA 3CWJA 2YWFA 1Y10A 3EX7B 3A4TA 3CCQS 3C6TB 3D0HE 4F4YA 5AE1A 3ZZZA 1T3OA 1QE1B 2FJXA 4M8LA 3CXCR 3J7AN 1HMVA 5HJYA 5IOLA 4H4MB 1IKVB 4WP3A 4ZOSA 1YRUA 2CQDA 5L1KA 5GMDA 3TA0A 3UPFA 2XWYA 3PIOQ 3IP0A 2OSRA 4I4BA 2GAGC 3DDNA 1HPZA 3JSMB 2FC9A 2EFVA 2DNHA 1WC3A 2D41A 2QC3A 1FJGF 4B9SA 4Q5VA 1X4HA 4WFYA 1VBZA 5A6PA 2DPIA 2XGPA 2P9GA 3HHLC 4UZBA 2AJ2A 3OVSA 2UVVA 4DFJA 4XAKA 2XO6A 2CPFA 2ZDOA 4ZA1A 1KFSA 3BPDA 3K5PA 3HM9A 5E3CA 2ZUAA 2VICA 2IDLA 3LW5C 5AT1B 4QWBA 2WBMA 2KYXA 3SCJE 4F2SA 2GHPA 4HKQA 1VK3A 4OX8A 5DG9A 3CIMA 3VZHA 4EK2A 1URRA 1TKZB 5KFWA 1CJTB 3DOLA 2QG9B 2YKQA 1ZPWX 4I69A 2KJVA 3VAJA 1B64A 1OWXA 1VMBA 2VBWA 3W2VA 3DNCA 3MAHA 1SIZA 3WBZA 3IRXB 5KT5A 1W25A 3AQOA 2XY5A 3GFHA 3AB2B 1HNXF 4OHWA 2IM0A 2QA4S 2K3IA 3V2UC 3HKZD 3SI8A 4DPWA 2H51B 3BGFA 3DRPA 3MUTP 3H7HB 3CMQA 2KG1A 1HLWA 2LDYA 1V3RA 4J9MA 3NKYA 3FMBA 4C2MA 1Y9OA 3TAMB 2IJNA 4ZJLA 2PMZD 1RT5B 2OPQB 4OHZA 3QNWB 4OYXA 1S10A 3U02A 1ZA1B 4PKDB 3M2VB 4DUZF 2J76E 4DS4A 2I1RA 3I5AA 4I64A 2J9CA 2DNLA 3DOKA 1XNQJ 2FYXA 1PG5B 1JJCB 4L75A 3DYAA 2C2OB 2HFOA 3BF4A 3IGVA 1RA7A 1YHQS 4FBTA 4WFAQ 2WAQD 3Q8VA 5C5JA 1NCLA 4R8UB 3PYGA 1S1WA 2A2CA 3K7RA 1R6VA 2GS8A 3MR2A 3N79A 3RRHA 3J7YI 2W9BA 5F8IA 2DH8A 3MPVA 2AYEA 1X5PA 1MMLA 4X4OA 1TFYA 3CMES 4DV6F 4E2FB 5KFOA 1KQGB 2CZ9A 2FIUA 3Q2TC 1RT2A 1NJIT 2O67A 1SI9A 4PG6A 1RJJA 2LFVA 3BGRA 4RW8B 3J81j 2XYHB 1DLOB 1N36F 2YNFA 3NNHA 2PC6A 2GIFA 4H4OB 2DR8A 2KL8A 4USJC 4LFAJ 3NWRA 1SKWA 1EAYC 1V5IB 3F56A 2JFDA 2BJ7A 5F8HA 4UW2A 3DLHA 2EK6A 2CJXB 5C25B 1HNZJ 2HHTA 3EGNA 4DQIA 2DRAA 1V9OA 2YWKA 4FKXA 1WG4A 2D7SA 1SCJB 4NA3A 1X0PA 3E01A 2ZHBA 2YNHB 2B0GA 2CQ0A 3TJ8A 3S8SA 1JIHA 1OSCA 1LV5A 3NRBA 4JI8F 1IKWA 2VA2A 2PIIA 4GMKA 4KSEB 4AFFA 1F5CA 1T9VA 5KG5A 4NLUA 2LCWA 1CJKB 1NHVA 3IBFB 3VGVA 4OZ3A 3B78A 4PWDB 2B43A 5DGAA 2OHDA 1JLQB 3CJ2A 3D1QA 4DV0F 1TL3A 2DPJA 3IRWP 3ZTQA 3RG6A 2J0XA 4TQSA 1BQNB 2AJ0A 5RUBA 4M5GA 1UL3A 3ZTPA 2CXEA 3LQVA 4CM0A 2FJDB 3MAAB 4TU7A 1QD1A 2FC8A 5CZXA 5GAGU 3EGZA 3HD1A 1RWWB 1VGYA 2AJFE 4WXWA 4PG5A 1JLEA 1AYEA 1S1XB 4RR5A 3AOCA 4JI2F 3L09A 4GC6A 1FDNA 2ZE2A 4ZKAA 4ECWA 3CJTA 2MGZA 1WTFA 3MEEA 4RNNA 1M5HA 1QSSA 1GAOA 3K5OA 4P2XA 4RNMA 3X1LB 2VOPA 3FEXB 4WU3A 4CYUB 3WC0A 1M5KC 4TU8A 3QZ7A 4LF7J 1WDTA 1OO0B 1P8GA 4C98A 2O01C 1CQNA 4BDPA 5HROA 3BDPA 4IOCQ 2QLWA 3KUGA 2J7UA 5EN1A 4ELUA 2E1AA 4NMXA 3KNGA 1NO8A 3HJVA 3H59A 3OVAA 4ED7A 3THTA 2CIMA 1NK9A 2RQCA 4WFXA 2GIQA 2ZDPA 2CQ1A 5GAEU 1IR1A 1XERA 3SV3A 1KBRA 2W25A 4RUBA 2BRKA 3IAM9 4HEA9 5HL7Q 2AZ3A 5LSOA 3R7NB 3FUYA 3R6LB 3S1TA 2MY8A 2RDIA 5F3ZA 2DT9A 2VODA 3SEOA 1HBUA 1TL7A 1ZYQA 3KLFA 3AXMA 2XULA 3S6EA 3E2EA 3IA0A 1O5JA 2GX8A 2CDQA 4LBIA 2UVRA 2GO9A 1UEKA 2R7UA 1QDUB 2Q43A 3QIPB 1KKHA 3N6NA 4EWTA 1OMSA 1XR6A 4F67A 2V9WA 2RF2A 4NLPA 2O5DA 3ZFVA 2RAQA 3FEZA 4JI5J 5JJBA 1U47A 4IFVA 1S6UA 4MIBA 1J2VA 3OTDA 1FXRA 4HI2A 2E66A 3K58A 3HP6A 1L3UA 1L3KA 1KONA 4K7QA 5L1IA 3UN3A 1OS5A 1DQAA 4Q2LA 4F26A 4C97A 4P7VA 4RW7B 1T05B 1D3WA 1XEZA 1VJQA 4KYZA 3QJJA 1OPIA 2LQ8A 1Y11A 3BYPA 3IAS9 1KLNA 5IZHA 4WKRA 2HGMA 3DXSX 2M88A 5C24B 2ZWOA 2IMOA 2JEFA 2I8EA 3H20A 1IXKA 4HVZA 3M9MB 2MLYA 1DTQA 1TKXB 4EBEA 4RKUC 3DRXA 4ZCLA 2AGPA 4H4KC 4RUHA 2LKZA 1S4EA 3FCWA 3G9CA 3SQGB 4OZ1A 2MKIA 5HSPA 2CNLB 2VUGA 3ZZTA 3SXLA 2WTFA 1C0UB 1NH7A 3QYYA 3RZAA 3MM8A 3ZC4A 1HNVA 1F2HA 1UCNA 2QFIA 4PCQA 4C8LA 4C8NA 5ETSA 2CQHA 4FYYB 4ZCIA 2H1YA 5F8MA 5KFHA 4WTYA 1TVRA 3CCES 1LW0B 2LEBA 4JI3F 2NYHA 1M1HA 3UDEA 3G6YA 5KFYA 1MSWD 1RTDB 1K0VA 1C1CA 1MN9A 4PAAA 1ZOTA 3A8EA 3ENAA 4KHPJ 4YY3J 1KC8T 1K73T 4ZPCA 1LNQA 1RI7A 2MQOA 1T9WA 2JSXA 1U1PA 3HVTB 3SCLE 2ZBPA 3FFIB 2HBZB 1VOMA 1S76D 1NHUA 1N6QA 4GVLA 1J5OA 1QVGR 3MDFA 3GG1A 3GPAA 2E9ZA 4CLFA 2UU9J 3I0SA 3FKBA 3QFWA 4DN9A 3JQKA 5AXMA 2IAJB 2YQ0A 1HNWJ 2VIHA 3MWBA 4KT0C 2CRLA 2FVQA 3CGIA 5A6WA 1VRUB 4WIIA 5FDLA 2BW2A 5DDPC 4NCGA 2OLWA 4KQZA 2CPHA 1JLAA 2F8HA 3TUIC 4WWSA 2E1CA 1Q86T 5H9EK 3UN2A 3PXGa 3PIPQ 1RZMA 2O66A 2V8GA 2BE2A 2YTCA 4USHA 1REVA 4USMA 4R25A 3R2DJ 3TANA 1BQMB 1S0NA 4G1QA 1F9HA 4LIRA 3RU0A 3HHKA 5BR8F 1YKWA 5DZ7A 1NJZA 2OEJA 3SSSA 2W7OA 4M1KA 1GEHA 2MZTA 4CLKA 4XDCA 3CCTA 1L3SA 5I42A 2EK1A 1H0HB 3ZO7A 2DO0A 3OTOF 4ES2A 3D67A 1GMUA 3C66A 3VR1A 3SIPB 4NXNJ 4RU2A 2MJNA 2DHXA 1U45A 1X4GA 5A8KA 3WC2A 4WPAA 2ZH9A 3ILIA 3AAWB 3UI3A 1PYOB 4F4AA 4OI4A 1GX5A 3DI6A 3AFGA 3TQ1A 2W4PA 2IPOB 4DR7J 4P72A 1R8CA 2XYPB 1VQOS 1CEZA 3VAMA 2ZZMA 3B6BA 2R7QA 2DNQA 3DC2A 3I4PA 2NS1B 4DZ6A 5CD4A 4DEZA 2UUAF 3ILJA 2RUGA 1NXIA 2A10A 5DS7A 2UZAA 4ALZA 1VISA 2EG1A 2ZKTA 3D28A 2FPHX 2MZRA 4WFZA 3CJQA 3HSJA 2HMIA 2JEJA 2QZ8A 3OXLA 2EBEA 3KK2B 3UW1A 3R5GA 2DR6A 2WVCA 5HATA 1Q53A 1H6KX 5KFTA 3OR1A 4QQBA 1B0TA 2KFNA 3MPDA 2L08A 1IKXB 3DMJA 1X8DA 2W4CA 2CJBA 2V2KA 4MKBA 1X4EA 4ZITA 2ZWPA 3AH6A 2ZBIA 1UFWA 2G2ZA 1HBMB 4J9OA 4IUFA 4RJVA 2HQGA 3CC2S 3J80U 1IBMF 3GFYA 4RW9A 3HVWA 4ZLNA 3KG1A 3BJYA 1P27B 2V34A 3ISNC 3M8QA 2HFUA 1UJ5A 1FJGJ 3UD3P 4C3KA 2VG7B 2W9CA 4DUYJ 2CZ4A 1S1UB 3J7A1 1BC6A 3C6UB 1U2FA 4D3GA 4JI4F 1CJUB 4ZVOB 2KFYA 1S9FA 1PSDA 1XMOF 3W5YA 2R2TA 1HYSA 2OPRA 1MNEA 1AUSL 3TA1A 3TQEA 1UPPA 3FQKA 3NGKA 4NLXA 1CS4B 3DDIA 3DLEB 3GIJA 4YDXA 4A8YA 5LSLA 3MUMP 3HHDA 3TWZA 4PRFA 4DX5A 3F41A 4E0DA 4Z7CA 4U6PA 3SFUA 1IR0A 1TV6B 2EG2A 2W2NP 2CJYB 4S0MA 3QATA 4USKA 4BWMA 2F63A 4B3RF 4MFBA 5MAOA 4G6VB 3GV5B 1X4CA 3MXHP 5D0EA 4F25A 4DQQA 2NXCA 5IT9U 2E7XA 4HTIA 3Q8YA 2VKZG 3S01A 1RU1A 2YX7A 4OI0A 2J7KA 2QMUB 3R6GB 2DCLA 2E5HA 3B8HA 3RR7A 3ADAC 1FJ7A 4N56A 4FXDA 1XBWA 2IA0A 1T8EA 2YPYA 3CDEA 1K44A 1QE1A 2PE8A 2YWEA 2KTQA 2EXUA 3P4UB 5LL6d 5D4PA 1N32F 2XCPA 1F5BA 1AROP 4DV1J 1X60A 1UVJA 1FWPA 1G2EA 2JLFA 4NE9C 3RJMB 2B5JB 1FKOA 1TKDA 5LMNF 3MCNA 4DV6J 5IXUA 5D0GA 3BKUA 1VFJA 4LMZA 4OZ5A 1RWUA 3EVOA 4RUAA 2G4BA 4OZLA 1U02A 2B51A 1I6JA 3NEKA 4PEOA 3P8BB 4R0EA 2HHXA 4M5IA 3DCAA 4NLVA 4WF9Q 4L73A 3QT5A 3O5TB 4QIWD 4JV5F 2VQEF 4UY8T 1WHWA 4KFBA 4TXSA 2MKKA 1WELA 2HK3A 1FHTA 4ICLB 5CYMA 2BDPA 3CPWR 1VHIA 1NKEA 2HW3A 1TKZA 5ETKA 3H5SA 3M8YA 1TUGB 1I51B 3R8YA 3PR4A 2FHOB 4QIVA 2DHAA 5ETVA 4DV4F 4WE1B 5DM6Q 5KFPA 2HZAA 2G1HA 3Q8PB 3MM9B 2U2FA 3PEHA 1EKSA 5B09A 4DU8A 1FERA 3LP2B 2IC3A 3GIKA 1OY6A 2R7OA 3TAMA 4DOZA 4ECUA 2HWHA 4FBUA 1RT5A 3QBCA 4C48A 4MMOA 3AQPA 2YVSA 2HIQA 1YX2A 4NZ0A 3M2VA 2WW8A 4CT9A 4ETZA 1JLFB 3G6ES 3W2WA 4F3QA 1EZZB 2B4PA 2J8SA 5AJ3F 2C3MA 4R8UA 3V81B 5L39A 1M90T 1JJHA 4UY85 4C11B 2GV1A 1H7XA 1N88A 4Y2IA 4ZHRB 4O3PA 4ECVA 2HEKA 2MY7A 5HAOA 4LFCF 3IWNC 1R31A 3D54A 3OL6A 2XCAA 2ZVSA 3PZPA 4ED6A 1LWCB 1N54B 1QUPA 1E6VB 2MXYA 4JI2J 3M6XA 4KGXB 1WC1A 2BXJA 2LQ5A 3KXDA 1FFSB 4HT7A 4QWCA 1RWKB 2BKNA 2DRBA 2IY5B 1FKPA 2HNZA 3NNCA 3CD7A 1WKJA 3NMRA 3NGUA 4RW8A 2XLKA 2AZ1A 3THVA 3BQ0A 2C2EA 4N41A 2E5GA 1EETA 5THWA 3RTVA 2X1FA 3HHLB 3TZWA 4B3OB 4KV8A 3EE3A 4UOCA 2IM2A 1SJ1A 4PQUB 2HURA 1AA1B 4ED5A 2RQ4A 4Y28C 2YKOA 1IJEB 1R8HA 4Q0BA 3DU5A 3OTCA 1JNZB 1U1QA 2OFHX 3H5XA 3L7OA 2XSJB 2J0WA 1VQ5S 2C2KB 2PA3A 4KRWA 1TKTA 4I2PA 2BABA 1FDBA 3FCVA 4DV5F 1K1QA 5K8NA 5K14B 3EVMA 1BQXA 1M0SA 1RAGB 4C8OA 3M8RA 3K5MA 2HFVA 1M5OC 1NZAA 5KAKA 5HMWA 1I94J 3RRKA 1TK0A 2IBOA 1LXJA 3FSXA 3IBWA 1NUEA 3TUJC 3TZYA 1CSJA 2LA6A 4A47A 2CDRB 1RU2A 2KJWA 4EI2A 1D8YA 2JFKA 2W24A 2XY7A 1VJWA 3HSZA 3OT9A 3V6HA 5KFIA 4Y2CA 3L95X 1UFKA 1B3TA 1T7PA 1WD6A 2JEIA 4MYUA 4WP8A 2BQUA 2ROPA 1SQFA 4X62F 2NZCA 5KOXA 3OXFA 2DR9A 3MAAA 1RAHB 3Q2SC 2BW7A 3EYZA 2DO4A 2E7WA 1B99A 1NPPA 2H5EA 2Q3PA 3CCMS 3EM1A 4LSZB 2BR0A 2JNJA 3MM7B 5A2QY 2KH9A 2WHOA 1TL1A 3W66A 3LPEA 4K4ZA 1SKUB 3BSAA 3TP2A 1RE1B 4ZVFA 2HFNA 3EXCX 2RU3A 4IRCA 2HHHF 4UUWA 3J7ZT 3C3LA 3M30A 2IDEA 2EI5A 2DIUA 4FN5A 2G2OA 2R7XA 2MB0B 4OI2A 2RSQA 3T3FA 3PX0A 4KPYA 1REGX 3OR2A 4NCBA 1WKLA 1HQEB 4UOGA 2WSEC 2R8GA 2W8KA 1EIYB 1JLCB 1IKYB 1Q8BA 4PPZA 4OLOA 2X3DA 1S97A 1SL2A 1FESA 2ABYA 4B9UA 1WHXA 2C2MB 3T1HF 2FZCB 2DB1A 3T5LA 3JAMY 4XTTA 1VDHA 2XNRA 1SXLA 4ZPTR 3B54A 4CCHA 1RT1A 3LGNA 4TLRA 2VV5A 2BV3A 2I38A 3DRSB 1S0VA 1IN0A 1NDKA 4KTQA 5T14A 1KN6A 2IYIA 2C3PA 2M2BA 4O4GA 4FDFA 5CZVA 2XMAA 4YDDB 4PYAA 1J27A 2GW8A 1Z2LA 4LT6A 2YX4A 3US5A 2OTJS 3PVXA 4JI3J 5J1PA 4LF1A 2LYVA 4ZS6A 4LFBF 2QT7A 1RHJB 3QT7A 5E2QA 5J2NB 3KLEB 2ZM6J 3LGHA 5KFNA 4F36A 2HBQB 3OPKA 1FTRA 3BSNA 4CLZA 5F0WA 5JUMA 5A8RB 3VV2B 2ZH7A 1KHVA 2MKHA 1ZM2A 4CLSA 2VG6A 1H2VZ 1NSAA 4K2XA 3TJAA 2JDJA 5GAHI 4IR9A 5FIIA 3IXQA 4A8MP 2PT0A 1FEHA 1FDAA 4X4UA 4WCEQ 4ZN1A 5J2QB 1RHMB 2Y8YA 3MPUB 1G4CA 4ID5B 4FS1A 4PUOB 3CJKB 2DISA 4LF2A 5ETTA 4H54A 4K4SA 1N5SA 1ROFA 1SPBP 3UNGC 2X51A 1V6HA 4MK8A 4F8RA 2N4DA 3PYEA 1Q81T 3CC4S 3T5HA 4RW7A 2LA4A 2UVUA 3PACA 4ECSA 2BQRA 4CO0A 2R7SA 4NXMJ 4ZPWR 4LR9A 2ZH1A 1HHQA 5C24A 1SKSA 4XPEA 2AV5A 2J9DE 3I82A 5J1EA 2GO8A 4CNYA 3LP1B 3CCVS 1TKXA 3A3PB 1QSYA 3BB5A 4F4WA 4UOFA 1WEZA 4DL7A 4DU7A 2HHVA 2YH0A 1QTNB 1S1VB 1T03A 3M2UB 2XQCA 3CO9A 1YI2S 1DBDA 1XNQF 1B0PA 3S7RA 2XHWA 2XTJP 1RADB 3M7VA 4KBIA 3A1YG 4PG8A 3EMTA 3KJVA 2FVCA 2E29A 4AE5A 3IM8A 1S77D 2HKEA 1LW0A 2P6SA 4X4TA 3VAFA 2ZH8A 4AL7A 1SL1A 5KFMA 2V68A 3NY0A 5K8OA 1EB0A 1NZ8A 1L3TA 2V5HG 4BLGA 1RT3B 5T41A 4USVA 1S59A 2V69A 4URQU 1RT7B 3OBIA 1UJ4A 2VFVA 3G8QA 2QLXA 2I0XA 3HVTA 4RW6B 5KFEA 3IM9A 1YK9A 4RW4A 4ED3A 4DSLA 3FC9A 2V2ZA 3QGPA 4IG0A 2YXLA 3KLIA 2C2ZB 5SZTA 1X31C 4HDGA 2UUAJ 1SJQA 2KFZA 4K4TA 3BH7B 3W5ZA 1RK8A 1C0TB 2P6TA 1QY7A 3N28A 1HKAA 1WI6A 3FEYB 3FBBA 5LT5A 4IO9Q 1S99A 4GVBB 4DPTA 2DD8S 3PO4A 4LFAF 2W2MP 1MWQA 2WOMA 1R0AB 4RL1A 1O8BA 4LRBA 5A0YB 4RBVA 4K5RA 3DLBA 1VRUA 2Y1RI 2ZZNA 1NSKL 4HL9A 4YR3A 3W60A 3LGMA 3SSQA 2VQFJ 3TW0A 2FGCA 2DNMA 3R7BB 1UVLA 1IWAA 2MQ8A 3CDAA 1MWYA 3T19A 3ONQA 4P71A 4YMEA 4ZVRB 2KB2A 5ETOA 3M8ZA 2Z57B 3THPA 3H8YA 3OLBA 2YKMA 1D9FA 1Q95G 4QZVB 3IR6B 2AWZA 1BQMA 4IO1A 1S6QB 5B0DA 2QGFB 3MMCA 3M8PB 1PIEA 1CJVB 4QWDA 2YBVA 2WZ1A 3L7UA 1TFWA 2FY8A 3CW2C 2MKCA 2VBZA 1RCOB 2AJ1A 2QE5A 2GMHA 1IBKJ 5L46A 3HDSA 4DHVA 4DR4J 2GVDB 1VQLS 2ZKUA 2DBBA 4ECYA 4B9NA 3MCMA 3LP0B 2CNKB 5C7PA 4Y0FA 2AP6A 4HACB 4ZCMA 4FF2A 2NXEA 4AQYF 1RWOB 2N7CA 2NQPA 3QPIA 2K06A 4NLDA 3KHRA 4LQ9A 1NK5A 2IJRA 2C28A 1RACB 4LR8A 1DTTA 4HYKA 3AA9A 4WYLA 5D6GA 4LSNA 3ZXWA 2H5JB 2JLEA 5KFCA 1T9XA 4KH1B 3IR7B 3H98A 5KT2A 3MFHA 2WONA 5KFFA 4CTAB 1FK9B 4NLTA 2K1RA 5C2GA 3R2CJ 2HNDA 4A48A 3TVZA 1IBLJ 4ZVSB 1TTHB 5DQIA 1NNDA 1M5VC 7FD1A 4F4ZA 2XO7A 5BXIA 3BZQA 1ZAVA 2F7VA 2PFDA 1KFDA 4GKKF 5HP1B 2Y1JA 4UTGA 2JOQA 3TEGA 1AXQA 2A2DA 3ZZPA 2MJUA 9RUBA 3CJ0A 1RABB 1U1NA 3GIIA 5KFZA 4EBDA 4FF3A 1DQ8A 3GG0A 3SFGA 3MZIA 5HN0A 4K4VA 4ZVTB 2KZZA 3C14B 1N32J 4C8MA 1HBMA 1SUQB 1Q79A 1Y5NB 3KJNB 2BQ3A 5CABA 4TVAB 2B3TB 4UQGA 2V4QA 5HVGA 1X4BA 2VG5B 4F7VA 3WQPA 4M5DB 2V63A 3GCWP 3KDOA 5HQLA 4CO3A 2VH7A 3MMBB 2FTRA 4GC7A 3MM5B 2KRBA 2GJIA 2VF3A 2QL9B 1FKAF 4YB5A 4Q2MA 2EC2A 2OO4A 1XWLA 4O44B 3R97A 2R3VA 4WJBA 2CPYA 2MMYA 3E8OA 3M9OB 2KKHA 3PFOA 4ZVPB 3NS5A 4JB8B 1AUDA 1R8AA 4DL4A 3FZ2A 2QL7B 4YN3B 2JL9A 4JI5F 4DR1J 4O3QA 3AXKA 1R0BG 2PD1A 3FMWA 2VFRA 3G86A 2HHPA 4NLQA 3MHYA 1VQNS 1LWXA 5KG3A 2ZD1B 4DV4J 1TV6A 3BQ2A 2VZ9A 2CQPA 2PN6A 2A0FB 3MEKA 5T7LB 2ZZTA 1G7CB 1KVJA 4PWWA 3QSYB 2ZBCA 5IT0A 3M2RA 2K2PA 2DTJA 2J9DA 2PMWA 2VPXB 2ADBA 1JXVA 1VQ9S 4ANEA 1K8AT 3HF5A 2L9WA 3M1VA 3Q8UA 2GQ2A 3EJMA 1WOOA 4A8OA 2D9OA 2DR5A 3UN5A 5LMUJ 3RAXA 1FDDA 3T41A 3I5CA 2HNYB 2Z2ZA 5KT4A 3DLKA 2GVZB 3AA8A 4IFYB 1KOHA 4NRUA 3H2LA 4DQPA 1SH2A 2NYIA 3R27A 2PI4A 2ADCA 3PRBA 3D0IE 1MU2A 5HBMB 2ZH3A 4JV2A 4LVNP 1NB2A 3T6BA 2HHQA 4K4WA 1XNRF 3TOQA 5IV4A 3JXOA 1T3NA 2FD2A 1U1MA 1YTYA 5IFMA 3I9V9 3UDLA 1H2UX 2RU9A 3M4XA 3V4IB 1UWBA 5B0AA 2D9PA 2OIHA 1YBUA 4MAKA 3FRZA 1KHWA 3D4JA 2JEGA 4KHPF 4YY3F 3QWPA 1JLGA 4U9RA 3T1YF 3P5TL 4ILMA 1DY3A 3O6QA 3BBFA 3UE2A 4EGLA 4OI3A 2J0SD 1L3VA 2M8HA 2KM8C 2RKIB 1FEEA 1U26A 1VQPS 3MM6B 4I2QB 4CP5A 3OSNA 4ICLA 2UU9F 5B7WA 1KLMA 2M5YA 4MT1A 3TX0A 1F3FA 2A1BA 1VIOA 1HNWF 3MGJA 2H9ZA 2PO4A 5KG6A 3PTWA 2NR0A 2C3YA 2Y9HA 5G0RA 2RD5C 4WE1A 3LF0A 1L5UA 3CF5Q 3J81U 1S12A 3QWUA 4DDFA 3MM9A 1C4AA 1PBUA 2BANA 1BE4A 1NSPA 2IVMA 2YQ3A 3KJQB 3RBXA 5D3GB 1QAIA 3OHAA 2HVDA 1G1XA 3TVYA 3N01A 1UA0A 5E3AA 3G87A 1WORA 4X64J 4DR5F 2YX1A 2YKPA 3HX9A 4WYWA 2EFGA 1GQEA 1YVFA 2Y8WA 1ZS6A 1ZM9A 1JLFA 3T9NA 4IDKB 2QYCA 2MSSA 3LANA 2BKPA 4O0IA 1SQEA 3H90A 2CFXA 1JWWA 1EP4B 3NG8A 1FRKA 3DM2B 4FPRA 4J5OA 4X62J 4DCPB 2WVDA 4DN0A 2BA9A 3AT1B 1NJYA 4ZHRA 5CYQA 3KHGA 3OW2R 5HVFA 3QIDA 3RB4A 3LO3A 2HQFA 3VF0B 4B9LA 2O1PA 1VHFA 3ET6B 2ZH2A 1CC8A 4N8OA 3D7SB 4NXNF 4ED1A 4CO1A 1F9EB 2Y3YA 1X7VA 4A8KA 2F3JA 2V4JA 1VIXA 1ACMB 1WF2A 2I9SA 2QLBB 2DXFA 4FXVA 4P2SA 1HPZB 3NGSA 2Z2LA 2EKYA 4DR7F 1Q5VA 2QYGA 2PGCA 2XI3A 4WKYA 2FJVA 3W3SA 1APSA 3ISND 4HLBA 4DPYA 4CO4A 4B3OA 4NX9A 4PQUA 2MHNA 2LVWA 2D74B 4BC7A 3KK1A 1X9WA 1I1GA 2E5IA 4LIWA 2HQ3A 1QAXA 2QV6A 2J6TA 3QO9A 2RHQB 1S49A 2ROEA 1WHVA 4BWJA 3K2YA 3RAMA 2D3ZA 3KG0A 1VRQC 2F40A 1PKUA 2CG8A 4I68A 2MSTA 4NI2A 3NGDA 1RWXB 3DOLB 3AD7C 2W2OP 4D3HA 4CNZA 2OELA 2MQPA 4M5JA 3CC7S 3O8WA 5HLFA 1HR0J 4F4KA 2GHVC 4KH0B 4JI7F 1S7IA 1CULA 3MCSA 3TRGA 2CVEA 2DNNA 2GMJA 1B70B 2LP4A 3DRPB 1YBAA 3HK2A 2KT3A 4LFBJ 2LXFA 4NA2A 5D8HB 2MLZA 2L41A 2I5JA 3IS9A 3GLJA 5M2PA 5LM7E 2DGVA 3OFFA 2AQ4A 2B6AA 2HPUA 1YJ9S 1C4CA 2YNIA 3ZZOA 3KHHA 2ZJRQ 3FBFA 4M94A 4R0JA 2B7BB 3DRRB 3DOKB 3BM7A 3KDNA 1AZSB 2ASDA 3BGLA 3W7BA 3DYAB 2XMUA 4RX6A 2EKNA 2HRYA 2KU7A 4OX9J 4DUYF 2UP1A 1RAAB 1NK8A 4U7UD 2GA7A 2B7CB 3B82A 5B0BA 1IUJA 2WSCC 5KFLA 1S1WB 4U8YA 4CH7A 1TAQA 2APOA 1LXNA 4P75A 4I6AA 4LF4F 1SKRA 1RB0A 3NCRA 1VRTB 4U96A 2W9BB 1NK4A 4CT8A 1U1LA 3TYTA 1FJEB 2DGQA 5C42A 3RBZA 1YWXA 3SMZA 1CLFA 1R0CB 4I0WA 3TNVA 3BPSP 1F9FA 4CH0S 4A8WA 4DL5A 1KEKA 4QW9A 2KZMA 4X4NA 1RT2B 2NPFA 5EWGA 5JVHQ 5LJ5Y 3AHPA 2GJ2A 2CQBA 2ASJA 1JLCA 1IKYA 3BGRB 3CCLS 3KUEA 2NZ4A 4N47A 5A8WA 1VQ8S 4TY9A 3JYTA 2RRNA 3KTQA 2HQCA 4ATNA 3H0PA 1UVMA 1DZ5A 1B0VA 4UF4A 1WI8A 2FDNA 3I0RA 3HHEA 1D09B 3L9ZA 4DX8H 3MOJB 2V2VA 3NMAA 4KGKA 3KG4A 4NRTA 4DBQA 3N5FA 2W4DA 4J9VA 2F4VF 1B4SA 1RHUB 2V8PA 1NHKL 2CWXA 3LTOA 4NLYA 3E01B 1R27B 3FJ2A 5BJRA 5U47A 4ZIVA 3VCDA 2FVRA 1IKWB 3GONA 3R5BA 4WIQA 2YKNA 1WSRA 1FJCA 1E6YB 5KG4A 2NSCA 4IOAQ 1C1BA 3KLEA 1UMJA 3FCHA 4EZ6A 5L1LA 4X4PA 3CUNA 1HD0A 3W9JA 4DV1F 4LREA 1V5VA 4IQMA 1H98A 1X4DA 2MTLA 3CDUA 3V4MA 5A8RA 4DI6A 1U2CA 3POTA 1TL3B 3MUVP 2MZSA 3CTRA 4QPXA 1RHKB 1S72S 2ALZA 3G8TA 3NS7B 1UPMB 2GQCA 4FXWA 2G0IA 1NEEA 4DJBA 4FPIA 5E41A 4USTA 2R7RA 2V94A 2GHWA 3I5BA 4PUOA 4YOEA 4ZIWA 2CJQA 4IRKA 3EGWB 5I3PA 1NDCA 2DH7A 1JLEB 2XYGB 4C3LA 2BM1A 1VBXA 1ZM3A 1ULRA 2QO3A 4QR1A 4QCLA 3V6DA 1Z1ZA 2MGZB 3MEEB 2WVFA 4UUXA 2BYCA 1OIAA 2XMTA 1OQ6A 3ZNUA 2CQ2A 1SV5A 2FLPA 2KT2A 4CLPA 5LXYA 1FCAA 5CYJA 4NOHA 4E8UA 3CB4A 4IOBA 5H9FK 2K8GA 4DR2F 3QQCD 4C8KA 2RQKA 2D1CA 1S1VA 4PWUA 3M32A 1O6XA 4X4QA 5HANA 1WSVA 2DNOA 3FBCA 3UVJA 5IQQA 2QA4G 2N3LA 3LWLA 1Y00A 1HWJA 3RYLA 1O51A 2ZHOA 1D9DA 4M95A 2VPZB 1EQMA 1FE0A 1K1SA 1ICEB 3GZ7A 4DX6A 2EWHA 2MZQA 4USUA 4JOUA 4EEYA 3BDEA 2GFFA 1ZH5A 2CAJA 2J8AA 3Q86A 4AQYJ 1GMVA 3N5BA 3L7PA 1Q5YA 2UXBJ 2CA9A 1KWMA 4DUTA 2JC0A 4TU9A 1XMBA 1G6BA 1JJ2R 1RHRB 2IRYA 1GXTA 2PFFB 1KP6A 1HBUB 1TL7B 3BSCA 3NGRA 4FNIA 4DSIA 4AD6A 3KLFB 3BREA 3GJRB 2MZ1A 3P96A 4LF9J 1FRXA 2ACYA 1HNIA 3BBBA 1AT1B 4PXEA 2H48B 4USWA 3T1AA 3M6UA 4EUVA 1MROA 3DGPA 1Q82T 3QT6A 1RAIB 3UO0A 3P6YC 1NLKL 5LXRA 4ZPBA 3SCKE 2PEHA 2RF2B 4ES3A 2OMOA 3NBPA 2HFZA 4IFVB 4GKKJ 2FHJA 3EVWA 2GNKA 2Y1LB 2XC9A 3PRDA 3X3UA 5B08A 2IRXA 2OMLA 3BEGB 1RTJA 2ERRA 3W9IA 3FRYA 3MMAA 2YWHA 8RUCA 2VFUA 3H40A 1RKJA 4F04B 1OJ4A 2JC1A 1NK6A 5L9XA 4C0OC 3A3OB 2B9EA 5IC4B 1HL6A 2MYFA 4BC9A 1D1UA 4NZ7A 1FI4A 4FP9A 3EZUA 1D0EA 2WW4A 4DL6A 1I94F 2BRLA 2QLFB 3UD5A 1U25A 2HLTA 3BN4A 4RUCA 3ILLA 1CJVA 5L8RC 1F60B 1ZA2B 1DTQB 3RRGA 4FF1A 4JYAF 4LF5J 2OPPA 1H38A 4A8SA 2H4YB 4UQTA 1S1TA 5F41A 1NB7A 3AOBA 2AKWB 1SC1B 2FHJD 4W4MA 3G82A 2GVDA 3OUYA 1VBKA 1S9GB 1S57A 3TJ9A 5KFSA 3QRQA 4CO5A 2CUYA 1YIJS 3Q24A 3DLGA 3B4MA 2B56A 3QGGA 3CD0A 4AYBD 2L48A 4HACA 2VB6A 1HD1A 3NNAA 3OFGA 1LK5A 1TVRB 3MECB 4PR6A 5DDRC 4K5SA 4YR2A 2MQLA 4OV6A 3VQSA 4F0KA 1ZM4A 1P9YA 5H1SV 1NH8A 3J7YU 1NU4A 1C1CB 2B9XA 5GADI 4QR2A 1N5YA 2Z4PA 2ATCB 2FB0A 2CYYA 4F4XA 1RAJA 4B08A 1P1LA 2BMBA 3R5DA 1YZ6A 1PAUB 2PEBA 3K59A 1N6QB 3MURP 2ZH6A 4KO0A 1J5OB 4KIAA 3I0SB 1LW2A 4X66J 1PO6A 3RGIA 3IG1A 2M70A 5HP1A 2KYZA 1U0HA 3QAEA 1RUSA 2IBKA 3QLHA 5E3RA 4PXCA 3CD6S 1YJUA 1HBOA 3UWTA 2KI2A 3TI0A 3OD2A 4EU0A 2HAFA 4BBYA 4NCGB 1KRPA 2R7VA 5IM0B 1FRHA 3K17A 5EHHA 2CQIA 2DGOA 1JLAB 5FLXU 2V9KA 4ZP9A 3QMQA 1F1BB 4NWBA 1XNRJ 2BE2B 2CQ3A 1VCTA 1NDLA 5K5MA 1REVB 1KQFB 4QPTA 1UKUA 1RT4A 3Q89A 1C2PA 4IH5A 1RCXB 1BD6A 3PJ9A 3Q8QB 4M5DA 4HI1A 1TUWA 3GV7B 2OEKA 2ZM6F 2H54B 3QGIA 3I96A 4KB7A 1DFDA 5K8PA 5M2UA 3MEDA 3I31A 2ZBQA 3FBEA 1VQSA 2F9JA 1QAJA 3T1YJ 2IYGA 4CWBA 2KDOA 3MPWA 1U6ZA 5I42B 2VBYA 4GO7X 2RB7A 1UVIA 3NLCA 3MR6A 4V19J 1WOPA 4K0KF 2KN4A 4F2RA 1VS3A 3UCUP 1LWFA 4KAIA 5A8KB 1H73A 5DETA 1UP1A 8AT1B 1LOUA 4A4JA 3MEGA 1OQ3A 4DFMA 4OX6A 4CM2A 1SB6A 3PYDA 3CCUS 1JLBA 1U24A 4KKOA 2Q1LA 2ZD1A 3IR5B 3SDEA 1XTZA 3ENWA 5LJ3Y 4OLPA 2WRMA 2U1AA 3DXBA 1IVZA 4FKYA 4EMDA 4K59A 5GMEA 2FJWA 1YBTA 2UUBF 2C2NA 2Q79A 4NMLA 4K4YA 5KFXA 5IQ6A 3J80Y 4DR5J 4NXMF 3HLUA 2FJAB 1EX8A 4DLGA 4NLGA 1HQUB 1RDRA 4F3MA 2HMIB 2XLJA 1XR7A 2VFTA 2RMLA 5KG1A 9ATCB 2HBRB 5I3UB 3AOAA 5KG7A 1DURA 2R7TA 4Z2XA 1MMNA 1Q8IA 2M7SA 4DV2J 2GAHC 2GGPA 1U4BA 5D4NA 4TY8A 4KR0B 2ZH4A 1KVKA 4WP9A 2CNNB 1HBNA 1TP7A 1TMMA 2HGNA 3NL0A 3DOMA 3DHWC 2YPZA 4K8RA 2IRUA 5KFKA 2MKSA 4OJ1A 3HJFA 4U8VA 3DU6A 3QRPA 3ITHA 4RW9B 4XDDA 2B9WA 2FY1A 3V4IA 4DWIA 2RHSB 1N0VC 2R9LA 2KG0A 1VLOA 3V5RA 3M8QB 1F5AA 2RUSA 2IFXA 2AJ4A 4HR2A 3D3CJ 3D68A 4DV3J 3O2IA 3D6TB 1O0PA 2LEAA 4Y65A 4DCOB 1VYAA 1YSJA 2DNKA 2SXLA 1Q7YT 2LECA 1Q8KA 2OPSA 1I5OB 2Z2YB 2PA8D 3ZZ0A 2Q6CA 1FE4A 2OPRB 4DCJB 4I2QA 2AT1B 1EQ0A 1FA0A 3OV7A 3IGNA 3JSRA 1WC5A 4OX7A 5IT9Y 4OMFG 5J2MA 3C8YA 1MWZA 4L6V3 2ATLA 2A6OA 1R6YA 1QM9A 4NPOA 2AGQA 1WHYA 4B17A 1BMQB 5EX3A 1U2RA 2ILZA 5KG2A 5FJ4A 2VPWB 4OHYA 1JNRB 7FDRA 3TZXA 3JQMA 2VQFF 1KQSR 3CDBA 2M0GB 5KFAA 4JI7J 5D3GA 4DR3J 1Z4UA 2LLZA 2OD4A 1JB0C 3VZIA 3HT0A 2B4OA 4NYZA 2VC0A 4NEZA 5HMZA 2CQCA 1FX4A 2R8JA 2J5AA 1RTHA 2ZOFA 2BJ3A 1UW9A 4C3MA 2K3KA 4WBFA 4QR0A 3DHXA 4MFBB 1NK0A 4MKYA 2D3UA 4QIGA 3FQLA 2W2QP 3D6FB 5FD1A 2AW0A 3EZOA 2POKA 2AHOB 1DAXA 3C2PA 2FZGB 4DG1A 3GU0A 3C15A 4IH7A 3KK3A 2G2YA 3KKFA 4HH0A 4KC5A 4CH1A 1T94A 2C3OA 1IM6A 2XNQA 4I7FB 4DL0C 4L76A 4N8NA 4FYDA 4P10A 5GAGI 1IBKF 3UCZP 4DR4F 3TARA 1FFGB 6FD1A 4YHHJ 4DL2A 4LJMA 2HK2A 2LEPA 3O3LA 3ET6A 2BEFA 1LFPA 4LF4J 3NP5A 1LWEA 2MKYA 4TYBA 2ACMA 4A8QA 4ZVHA 1Y5LB 4PG7A 4LRFA 1S9EB 5F8LA 2DR7A 3EXYA 1PBAA 1FKOB 2B8PA 4JI0F 5K20B 3DLLQ 3ZZRA 4EO6A 4Y3CA 3VGSA 2Z56B 4E98A 4Q44A 1WF0A 1TU0B 3BKTA 3Q8SB 3CIZA 3FNNA 1X9SA 4JI1J 7AT1B 4OL8A 1J5EF 4OYAA 1MW7A 4DL3A 3R5AA 4URSA 1U8WA 4R5PA 2KM8B 2ZHAA 2HRTA 1IBLF 3VHQA 4KFBB 3SYZA 2GC8A 3MFIA
chains in the Genus database with same CATH topology
2COLA 2FTRA 2YKNB 1OPIA 4GC7A 5CYMB 3MM5B 1U09A 5D78A 4C0HA 2KRBA 3WX4A 2G13A 2GJIA 3MM7A 3MF5A 3OTBA 4TKTA 4RBTA 5GAEI 3IAS9 1KLNA 1FKAF 4YB5A 3J7Z5 5IZHA 4WKRA 1H2TZ 4YR0A 2HGMA 3M6VA 4Q2MA 1C1BB 3GQCA 3DXSX 2M88A 1S7HA 2OO4A 5C24B 1HNXF 1HHTP 5KFDA 4PXDA 1XWLA 4O44B 3I6PA 3BGUA 2IMOA 3TAQA 3H25A 1NKCA 3U1NA 2JEFA 2I8EA 4WJBA 1R89A 3H20A 5CD4H 2CPYA 1N56A 2MMYA 1IXKA 3E8OA 4HVZA 2VC1A 3RBDA 4C9DA 4BHQA 3C6TA 3M9MB 3M9OB 1DTQA 2KKHA 3PFOA 1TKXB 3ENVA 4EBEA 1V3SA 3NS5A 3POTB 3HI9A 4RKUC 3DRXA 1AUDA 1R8AA 2HQIA 4ZCLA 4DL4A 2AGPA 3I55S 5GMKa 3FZ2A 4H4KC 4RUHA 5EWFA 2LKZA 2BJEA 2JL9A 4JI5F 1LK7A 1M5PC 1HQEA 2IC3B 4H4MA 4LSLB 4O3QA 3TA2A 3G9CA 3AJ1A 3SQGB 1IKVA 4OZ1A 2MKIA 1HA1A 2PD1A 2VUGA 3ZZTA 4Q8EA 3FMWA 2B4VA 2VFRA 3G86A 3N6LA 3SXLA 4J9SA 2WTFA 1C0UB 1NH7A 2HHPA 2K7JA 3MM8A 3QYYA 4X84A 4YEAA 3RZAA 3ZC4A 1HNVA 2XGQA 4DS5A 4JI1F 1P6TA 4NLQA 3MHYA 5HMXA 1VQNS 2YNFB 2JRSA 3OSPA 1X4AA 4PCQA 4C8LA 4C8NA 3KNAA 1S6PB 5KT6A 1RYRA 5KG3A 2ZD1B 4CZCA 4DF4A 2CQHA 4DFPA 5DG8A 4AL5A 1TV6A 5BYSA 3BQ2A 2VZ9A 2CQPA 4ZCIA 3H5YA 3R1LA 3JSMA 3DRRA 2PN6A 5F8MA 5KFHA 3MEKA 4WTYA 5T7LB 1G7CB 5CA5A 1TVRA 1KVJA 3CCES 1LW0B 4DQSA 2Y1IA 4N5SA 2LEBA 3CCJS 2ZBCA 3W2WB 4JI3F 5IT0A 3M2RA 2JVOA 3MD3A 4OFZA 2K2PA 2DTJA 2J9DA 2HVIA 4DSEA 2ZUGA 2VPXB 2ADBA 1VC0A 3G6YA 1FVSA 5KFYA 2IA6A 1VQ9S 1MSWD 1SL0A 2E44A 2N4CA 1RTDB 4Y2AA 3FZBA 1N5VA 1K0VA 1K8AT 1C1CA 3ISZA 4K4XA 3HF5A 3DRSA 1T02A 3K8WA 2RRAA 4WK1A 2XBPA 2L9WA 3M1VA 2GQ2A 1ZOTA 3PKMA 3V6DB 2F8MA 3VTIA 3A8EA 4A8OA 2QFJA 1KC8T 1R8PA 2LDIA 1K73T 2KXNB 2D9OA 1Y4ZB 4ZPCA 2QMXA 3BO3A 1VRTA 1RI7A 2MQOA 2JSXA 2DGSA 1U1PA 3HVTB 3EUNA 2DR5A 3GV8B 2MQMA 3SCLE 3IWLA 5B0FA 1TUVA 2QMWA 1SV5B 2Q66A 3RAXA 1FDDA 2ROGA 2J6UA 4YB1P 1A9NB 3I5CA 3FFIB 3BR8A 2HNYB 1VOMA 4DR1F 1N5TA 5KT4A 1S76D 1NHUA 1N6QA 3DLKA 3AA8A 4IFYB 1J5OA 1QVGR 4DSFA 1KOHA 3MDFA 2RVJA 1QTMA 5J2NA 3GG1A 4NRUA 2XLIA 3H2LA 1VI7A 4DQPA 1SH2A 2E9ZA 4OJ3A 2NYIA 3R27A 2XY6A 2PI4A 2ADCA 3I0SA 3PRBA 3D0IE 1MU2A 3IRXA 5HBMB 4DN9A 1H7WA 3PDNA 1JMTA 4RU9A 2ZH3A 4JV2A 5AXMA 3IO1A 4ILLA 2OSQA 2IAJB 4LVNP 3KLGA 3T6BA 3M32B 1FKPB 3CCRS 2HNZB 3T9ZA 2HHQA 3H2VE 2JH3A 1PC4A 4K4WA 1BLUA 4Y34A 4RWXA 1XNRF 3H5UA 5E7OB 3MWBA 4KT0C 1FRIA 2CRLA 2DK2A 2WCXA 4ECXA 2FVQA 1EETB 3CGIA 5A6WA 3TOQA 4PXBA 1VRUB 4NA1A 1BY9A 3PX4A 4WIIA 1T3NA 5FDLA 4OJGA 2QEXS 2FD2A 2HS0A 4KV8B 5CXTA 2BW2A 5DDPC 1U1MA 2IM3A 4X4VA 4NCGA 2OLWA 1YTYA 2DNZA 4KQZA 3I9V9 5IFMA 4I6WA 1VC6A 3UDLA 1U8SA 1H2UX 2RU9A 3D1HA 4OV1A 2OPQA 3M4XA 4LF6F 2MKJA 3V4IB 1RTIA 1UWBA 2CPHA 3AJ2A 1JLAA 2F8HA 4TLQA 5B0AA 4I56A 3TUIC 3U7JA 2D9PA 3ICLA 4XO0A 2E1CA 1Q86T 4N77A 2OIHA 4Q0BB 4MAKA 3KLVA 3FRZA 3PXGa 4ED2A 3PIPQ 3CSKA 5J2QA 1KHWA 2G0CA 4DLEA 2JEGA 2EVZA 4KHPF 1Q78A 4ID5A 3QWPA 4YY3F 2O66A 2WB4A 1DJ0A 2V8GA 2BE2A 4LQ3A 1JLGA 2YTCA 1CQMA 4USHA 4U9RA 3CJKA 1REVA 3T1YF 3P5TL 1S0MA 4ILMA 1FNOA 2Q6BA 1TKTB 4R25A 5LMUF 3O6QA 4I2PB 4U7UK 3UE2A 2KHDA 1M1KT 4EGLA 2XMKA 3T6JA 4ECZA 4OI3A 3TANA 2UUWA 1D9AA 2J0SD 3R5CA 2V0NA 1BQMB 1L3VA 2M8HA 5L1JA 2KM8C 4RZRA 2KO1A 2RKIB 1FEEA 1U26A 3F73A 3N9UC 4G1QA 1S0NA 1QLNA 2BM0A 1VQPS 3MM6B 4LIRA 1JX4A 4I2QB 4IG3A 5CHCB 5K8MA 3OSNA 2ZE2B 3RU0A 3HHKA 2RS2A 4ICLA 5BR8F 2UU9F 1NJZA 4XIUA 2BBEA 5B7WA 1KLMA 1E6YA 2LXIA 1HNIB 1SH0A 2XZWA 2ZOMA 4JUZA 2J7WA 4Z37A 3SSSA 3CJ4A 2XS7A 2XMJA 1X9MA 2F8EX 2W7OA 3HKWA 2M5YA 4M1KA 4EZ9A 4DPOA 2A1BA 2MZTA 2V8VA 1G3OA 1VIOA 1S6OA 4XDCA 1HNWF 3CCTA 1L3SA 1MROB 3MGJA 4NYOA 3HZGA 2H9ZA 2PO4A 4AL6A 5KG6A 5I42A 4A46A 2NR0A 3IWXA 2EK1A 2C3YA 3LP1A 1H0HB 5G0RA 2RD5C 4WE1A 3LF0A 3ENQA 2AX1A 4J9LA 1L5UA 4MIWA 2DO0A 3CF5Q 3CULA 3OTOF 1N5QA 4ES2A 2RE1A 1JXLA 3QWUA 3CCSS 4DDFA 1KOOA 3H4BA 3NBPB 3C66A 3VR1A 1XR5A 1C4AA 3MM9A 1RYSA 2BANA 5HROB 4RU2A 2MJNA 2IVMA 2YQ3A 2DHXA 5D3GB 1QAIA 3OHAA 3LUYA 4KHMA 2Z8QA 3RB3A 1U45A 1X4GA 3PEJA 5A8KA 3VQTA 3M2UA 1G1XA 1RTJB 3TVYA 3WC2A 3N01A 1UA0A 5E3AA 2DGXA 2ZH9A 1FD2A 1FRLA 3MMAB 1HNZF 1TAUA 5IT4A 1RT6B 2G1DA 3AAWB 1UJ6A 2GMLA 4DR5F 3UI3A 2YX1A 2C3UA 1DLOA 2YKPA 2OP5A 3HX9A 3UR3C 4WYWA 3IFEA 4YFUA 4ZP6A 2EFGA 4PG4A 1HWIA 4OI4A 4WFNQ 1GX5A 2CPZA 3DI6A 4H4OA 1GQEA 3HVAA 4QIFA 3NWGA 3TQ1A 2HWTA 2DGUA 2W4PA 2G9OA 1YVFA 4G3IA 2DCUB 2R2UA 4ETXA 1R8CA 1Y5IB 1ZM9A 1JLFA 3VAIA 1VQOS 3T9NA 4IDKB 1P1TA 1CEZA 2QYCA 3LPYA 3VAMA 3VAHA 2ZZMA 2MSSA 3LANA 3RB6A 1PILA 2R7WA 3I9ZA 4O0IA 4Y2KA 2AU0A 1SQEA 4WFBQ 2CFXA 1JWWA 1EP4B 3NG8A 1TZ0A 2R7QA 2IVFB 1TL1B 2DNQA 1U7LA 2HWIA 5H9EJ 1FRKA 3DC2A 3OJUA 3DM2B 3I4PA 4BCAA 2NS1B 4FPRA 4HHJA 5C25A 4V19X 1M5SA 3CDWA 4J5OA 3PW5A 4DEZA 2UUAF 4ZPDA 2RUGA 1UVKA 1R8BA 1ZPVA 5ADZA 2A10A 5DS7A 2UZAA 5B0GA 4X65F 3MR5A 4DN0A 2FGOA 4ALZA 2BA9A 2JZ5A 3M30B 2EG1A 1NJYA 2C42A 2ZKTA 4ZHRA 1RT3A 5CYQA 3KHGA 3D28A 1DARA 1KTVA 3V6KA 3OW2R 1UW4A 2FPHX 1RP5A 2YNHA 3UR0A 2MZRA 3QIDA 1RT7A 4A8XA 4WFZA 3RB4A 2DNPA 2OPPB 2UXCF 1CG2A 3LO3A 5GVQA 2N3OA 2KXHA 3VF0B 4B9LA 4IRDA 2KRRA 2HMIA 1UEUA 2GIRA 2O1PA 5F9NA 4RW6A 1VHFA 2ZH2A 4NYPA 2JEJA 4YP3A 1S1TB 3G4SS 2QZ8A 3OR2B 1CC8A 3OXLA 2EBEA 4N8OA 3KK2B 3UW1A 4ZMMA 4NXNF 4ED1A 2ZNZA 4RNOA 4EYHB 1UFLA 3OUYB 4CO1A 1Q53A 1RA6A 1H6KX 3U27A 3N4WA 1LKZA 5KFTA 1X7VA 2M8DB 3D0GE 3OR1A 2ZFHA 4A8KA 2F3JA 2V4JA 1VIXA 3OL7A 1C0TA 1WF2A 1K9MT 4QQBA 4X64F 2I9SA 1B0TA 4RLEA 4ECQA 2KFNA 5HMYA 4W90B 4FXVA 3DLGB 1BWEA 2L08A 4P2SA 1IKXB 5F9LA 3SV4A 4PWDA 1HPZB 3ULHA 1VBYA 3DMJA 1X8DA 2W4CA 2Z2LA 2CJBA 2EKYA 3HXMA 2V2KA 4DR7F 1JLQA 1YJRA 4MKBA 3CJ3A 3G96A 5SUHA 1GNKA 1X4EA 1R0AA 5F8GA 2XS5A 2PMHA 2PGCA 1RKIA 2XI3A 5A0YA 4WKYA 3AH6A 2RH3A 2FJVA 3WZ0A 2ZBIA 2AYGA 1TL5A 3W3SA 1APSA 2NSBA 3ISND 1BQNA 1UFWA 4HLBA 1RT1B 1HBMB 4J9OA 5H9FJ 4IUFA 3N6MA 4P6QA 4CO4A 4B3OA 4NX9A 1QVFR 3CC2S 1IBMF 4PQUA 1VC5A 2DITA 3GFYA 3PR5B 4RW9A 5FLXY 2CVIA 2MHNA 4FVCA 2LVWA 3HVWA 2D74B 4QYRA 1N5YB 3KG1A 5KFUA 4BC7A 3KK1A 3OXGA 4O4GB 1X9WA 1I1GA 3BJYA 2CJAA 2ZC3A 2E5IA 4LIWA 2HQ3A 4C8ZA 1P27B 1QAXA 2YKAA 2QV6A 3ISNC 2J6TA 3M8QA 3QO9A 4N76A 5BYRA 1S49A 1UJ5A 3HT3A 3UD3P 2ROEA 1WHVA 4BWJA 3K2YA 3RAMA 2D3ZA 3KG0A 4C3KA 1GXLA 4OHVA 2VG7B 3GILA 2F40A 2W9CA 1X5SA 2CZ4A 1S1UB 3KYLA 3J7A1 1BC6A 1URNA 4I68A 2MSTA 3C6UB 3Q23A 3QJPA 1U2FA 2LU1A 3NGDA 4GO5X 1UEVA 5KFGA 4D3GA 4JI4F 1S1XA 2KFYA 1FF2A 3DOLB 1WWHA 4KO0B 1S9FA 1PSDA 1GXUA 1TK5A 4LF7F 2YWGA 4D3HA 4CQ1A 4CNZA 1WF1A 1XMOF 4QU6A 5I4MA 2ZH5A 2R2TA 1S6QA 3FVYA 5DDOC 1HYSA 2OPRA 1LW2B 3M8PA 2MQPA 1MNEA 3BQ1A 3CC7S 3O8WA 5J1NA 5HLFA 1HARA 3IG1B 2L9NA 2GHVC 4F4KA 4YB6A 3TA1A 4JI7F 4AXIA 2JHEA 2HYIB 1X5TA 2HVHA 3FQKA 3MCSA 2CVEA 3TRGA 2V8DA 1ZAXA 3NGKA 4H4KA 4NLXA 2DNNA 2EFOA 3QLHB 2GMJA 2HVZA 3DLEB 1HBOB 1N8RT 1CC7A 2VG6B 1YBAA 2OKQA 3DRPB 3GIJA 1NKBA 1U6BA 3N0VA 4YDXA 3HK2A 1DQ9A 3TAPA 2D3OR 2KT3A 4A8YA 4O3SA 2LXFA 4NA2A 3FGVA 5D8HB 5LSLA 3MUMP 3SSRA 4C4WA 3HHDA 2L41A 4PRFA 1A7GE 2I5JA 4FS2A 2RIJA 3IS9A 1FXLA 5M2PA 3CT9A 3WDOA 3F41A 4I67A 4E0DA 1KQKA 4ECRA 3MM8B 2DGVA 3OFFA 3CEDA 1HNVB 2AQ4A 2JVRA 4U6PA 2B6AA 3PJWA 2HPUA 5MLCV 3L3CA 2X3GA 4NLOA 3SFUA 1YJ9S 1C4CA 2YNIA 3LP0A 1YQHA 4O4RA 1IR0A 1TV6B 3ZZOA 3KHHA 2EG2A 4JV1A 2P5VA 2ZJRQ 4B3MF 2P9EA 4R0JA 2B7BB 4M94A 3DRRB 3DOKB 3UCGA 2DHGA 1YJTA 3RBEA 3BM7A 3LAKA 2ASDA 3BGLA 3W7BA 3PW0A 1IQZA 3DYAB 3OFHA 1RT4B 2XMUA 4RX6A 2E5JA 2HRYA 2QSFA 4BWMA 2WSFC 2KU7A 2VD3A 5HI7A 5KFRA 4C0BA 4DUYF 4B3RF 2UP1A 2X1BA 1A6LA 5E5NA 1NK8A 4MFBA 3CE8A 2GA7A 5D4OA 4TQRA 3H2UB 1XMQF 3AB4B 2B7CB 2L3MA 3B82A 5B0BA 1IUJA 4DMZA 2B9YA 5MAOA 4G6VB 2WSCC 5KFLA 3GV5B 1S1WB 2VOOA 3VAGA 4CH7A 1X4CA 4NLSA 5KTQA 3MXHP 1ZZNA 1TAQA 1ZZFA 2APOA 1LXNA 1VQKS 4F25A 1JK9B 4DQQA 2VASA 4I6AA 4Y00A 4LF4F 3CJ5A 1P9QC 3PJXA 1SKRA 3MEDB 1HR0F 4QU7A 3NCRA 2E7XA 1VRTB 2V4RA 4J9NA 3T5JA 2W9BB 4HTIA 3UQSA 1NK4A 2MHEA 4CT8A 1U1LA 3TYTA 2VKZG 1FJEB 4CTAA 2DGQA 5C42A 1FK9A 3S01A 1NAQA 5EGYA 1YWXA 4KGMA 3SMZA 2YX7A 4OI0A 1CLFA 4OHXA 5J1EB 2J7KA 4I0WA 3KMQA 2RNEA 2DCLA 3KHLA 3TNVA 1N33F 1F9FA 2E5HA 4CH0S 3B8HA 3RR7A 4A8WA 4DL5A 1FJ7A 3JTNA 4N56A 4FXDA 1R43A 2GCFA 3UD4P 1OPZA 1XBWA 2IA0A 1T8EA 5AE3A 2OTLS 3CDEA 1KEKA 4RBUA 1QE1A 4QW9A 2PE8A 2KZMA 2YWEA 2KTQA 4X4NA 1RT2B 3NCQA 2UUTA 2NPFA 1LWFB 2HLUA 5EWGA 1ZTWA 5JVHQ 2N82B 2VFSA 5LJ5Y 1T03B 5LL6d 3AHPA 5D4PA 3KLGB 3MEGB 1N32F 2XCPA 2GJ2A 2CQBA 2ASJA 1JLCA 5I3QA 1F5BA 1B7FA 3V6JA 1IKYA 3BGRB 3CCLS 1AROP 1JLBB 1S9GA 4IH6A 2NZ4A 1SJ3P 4N47A 4IQXA 2RILA 4KKOB 1UVJA 5A8WA 1G2EA 1VQ8S 2JLFA 3JTPA 3BSOA 2QA1A 2B5JB 3QIPA 4TY9A 3LAMA 3SDEB 1RGVA 3NAHA 3JYTA 2RRNA 1FKOA 4OX9F 1OSDA 1TKDA 5FDLB 3GSDA 2J0QD 3KTQA 2DNYA 1YJVA 3ZZYA 5LMNF 1ZAWA 2AD9A 5IXUA 4ATNA 1UVMA 1VFJA 1DZ5A 4LMZA 4OZ5A 1RWUA 3KJVB 1RTIB 1B0VA 1WI8A 3MECA 3HMJG 4RUAA 2BJDA 2FDNA 2G4BA 3I0RA 3H4DA 3HHEA 4OZLA 4JV0A 3JSBA