5M2UA

The structure of the ycf54 protein from synechocystis sp. pcc6803
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
MATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLALEYVLTGEFEAPSDAIPDPLASLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ycf54
publication title Conserved residues in Ycf54 are required for protochlorophyllide formation in Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Photosynthesis
total genus 29
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5m2uA00
5M2PA 5M2UA 3JSRA 5M2RA 3HZEA
chains in the Genus database with same CATH superfamily
2VC0A 4RX6A 4K4YA 1MG7A 4DR3F 1UWBA 1VS3A 2R9LA 3T5KA 2QL5B 4TY9A 1U1QA 2V0NA 1GMUA 2VJUA 3CJ2A 3MUVP 4DV3F 5LJ3Y 4DR4F 3HVAA 2MEWA 4RUBA 4ES3A 4B9UA 3FBFA 4NE9C 4IQXA 4C0HA 1BC6A 5CCLA 1BGXT 4PG7A 5M2RA 3RYLA 5KFAA 3E01A 5KFBA 3PJXA 3TWZA 1HWUA 4PR6A 1H2TZ 2N4CA 3MM7B 5EWEA 2MXYA 3M8SA 1T03A 2N82B 3NAIA 4KR0B 3H4BA 1WNEA 3GCWP 3MPWA 2F8HA 5JUMA 3TYTA 1L3VA 5RUBA 2JWNA 1T3NA 5CCMA 3L09A 5I3QA 1UPPA 2OPSA 5DGBA 4B3OA 1JJHA 4CO1A 5CYJA 4LJMA 4WK3A 2H5EA 2OO4A 1GX5A 2KXHA 3KLFB 2ATLA 5FLXU 2JFDA 5J2NA 1SV5A 3C3LA 3UD3P 5JMNA 2NXEA 4FPIA 4CO4A 3SFGA 1NPKA 2E1RA 3UCUP 2BV3A 2QYGA 4LR9A 4F4YA 1O6XA 1YRUA 1NDPA 4M8LA 4ZJOA 2ZUGA 5LL6d 3F0NA 2XLJA 1U45A 4OI6A 2POKA 3PKYA 2ATCB 3TAMA 1N36F 4ED0A 3Q2TC 2FB0A 5HROA 1ULRA 1KN6A 3K57A 1WEYA 1XMOJ 2NSCA 1FWPA 4ANEA 2AWZA 5KG3A 1SJFA 2G2YA 1WI8A 3DNCA 2E1PA 1V9OA 2NXJA 5L1LA 3Q24A 5GAHU 4OJHA 2KM8C 4B02A 2KFYA 3BSCA 1U1PA 2AZ3A 2WVBA 4ES2A 4JI2F 2AKWB 3MUMP 1AFJA 3PR4A 1ZS6A 2X1FA 4A8XA 2F8EX 2UXCJ 1PC4A 3F41A 1LWFA 1OY6A 4NX9A 4ZOSA 2C2NA 3L9ZA 5FJ4A 1IKVB 1VQ8S 3PACA 2KJWA 5J2QA 2I1RA 3IGVA 3ULHA 4X4QA 3UE2A 3VHQA 2V2ZA 9ATCB 1U09A 3UCGA 5D0EA 2F4VF 5IT0A 1X4CA 4C4WA 4F0KA 4C8ZA 1V5VA 2JZ5A 2QGFB 4TY8A 2DHHA 2GAHC 2H54B 4GVLA 1QAJA 3VQSA 3PFOA 1MMNA 3TOQA 5EX3A 2CPEA 2GHVC 3KFWX 1K1QA 4ENOA 5HMXA 4IRCA 2WTFA 4ANCA 5HMWA 3HFZB 2YNFA 3MUTP 4W90B 1WEZA 4AXJA 3KNAA 3BS9A 1DARA 2UXBJ 3HHLB 4ZVOB 1JWWA 2DTJA 3AXKA 1CQMA 5IV4A 2XHCA 1GT8A 2FGOA 5F8LA 3BSOA 1O5JA 3L95X 2WW4A 3W63A 2VFSA 3OJSA 1N32F 3O2IA 4RNHA 4DR3J 1K8AT 3IM9A 3A4TA 2KU7A 4OLPA 4J9OA 1JIHA 1S4EA 3A8IA 2AW0A 4DV3J 4DR4J 3PDNA 1RTDA 1BE4A 2MJNA 4O44A 4QWCA 4OHWA 3HPOA 2GIRA 5A8WB 4LVNP 3SDEB 3M32A 3E51A 1SKWA 1QDUB 3PJWA 3KWMA 1FFGB 1G6BA 2UVVA 3OFEA 2ZUAA 3CO0P 2HQIA 2B56A 1R0AA 4F26A 2VIHA 4GMKA 2ZDPA 3TVKA 2FDNA 2RHSB 4L73A 4RW9A 4QWBA 1R8PA 1X4DA 4B9MA 3ITHB 3RU0A 4F36A 2RDIA 2J8SA 4P7VA 3L7PA 4TYBA 1C0UA 1UJ6A 3RBXA 2JVOA 1FKAF 2KYZA 3HT0A 2I2YA 3A8KA 1QSSA 2DNLA 2HK3A 3RBZA 1RTHB 2ZBQA 4WP9A 3M8PB 5C42A 1YZ7A 1KHWA 3AXMA 1VR6A 1PBAA 2DKOB 2KKHA 3MMCB 2DJWA 1E6YB 2H51B 1NDLA 4CO5A 1W25A 3SFUA 2ZD1A 2R8IA 1WHXA 2Z8QA 2V8PA 3CCZA 4ZLNA 1LWCA 2LDYA 5AXKA 2XMKA 4CH7A 5KFZA 4TQRA 3CD6S 4RUHA 1HI0P 1N36J 3MEEA 1KRPA 3MAQA 1JKHB 3RZAA 1CSJA 3AH6A 3PW0A 4KHPJ 4IQMA 4ZK7M 3FFIB 3LGHA 3L7UA 1ZH5A 1OSDA 2JFKA 5F8HA 1EQMA 3AOAA 1OQ3A 3KMSA 2XMMA 1KS2A 1RHRB 2B5JA 3B82A 3BM7A 5D4OA 4Q2LA 5HMYA 3C6UA 2VU5A 3OVAA 2W9CB 1NAQA 1SC1B 2V2KA 3C6TB 2C3MA 3UNYA 3NEKA 2DR8A 2JHEA 4NYZA 2HNZA 4OX7A 5IZHA 3KLGA 4DQIA 2BANA 2CQ4A 4I2PA 2DGOA 2HRTA 1F5BA 3D54A 3PRBA 2Y1LB 1Y5LB 2HS0A 3JQJA 1HR0F 2F4VJ 3D6FB 4X2BA 1N5TA 3LH2S 4KRWA 4G6VB 1N33F 2ZH3A 4ICLB 1WC6A 1MU2A 3LQVA 4FBUA 1X5OA 2VDIA 4P2MA 4YQWA 1S6QA 2VA3A 3AOCA 1WOSA 1XC9A 4Y34A 2V8HA 4N76A 4RO0A 2MQLA 4XO0A 4MK8A 4NA2A 1TL3A 2DYAA 1NHVA 2JX2A 4K50A 4RBTA 2C28A 2OEMA 5DGAA 3B78A 2WBRA 4QW9A 5J2PA 1H0HB 1X8DA 2ZOGA 2V69A 1N32J 2WB4A 2CPIA 3ILIA 1QSLA 3O44A 3ZZTA 3EGVA 4OYAA 2KG1A 3UVJA 4JV5F 2ILZA 3W66A 4Y0FA 1KNZA 4P6QA 3DRYA 1RI7A 4WFAQ 1TV6A 1XR6A 5BYRA 2W8KA 1Q1KA 1SJ3P 2QLWA 3D68A 3GFXA 5DZ7A 4J9QA 2DISA 2HZCA 1RA7A 2CZ9A 2ILYA 3NWRA 3LUYA 4EUVA 4F2SA 2YH0A 5DM7Q 1H3DA 3S7RA 4CLPA 5DG8A 3OSPA 4A4JA 1G7CB 2HHHF 1NSQA 4OQJA 4ID5B 3DMJB 2HMIB 3SCLE 2KG0A 1B7YB 1MROA 2ASYA 3QGHA 3MD1A 1ZBTA 2M9KA 1IR2A 3W61A 3C8YA 2FIUA 1YJ9S 2DEIA 4AQYF 2XULA 3OR2A 3CCQS 3IG1B 2QN6B 3OTDA 3H5UA 4MKBA 3AJDA 4MIAA 2XNRA 1LKZA 3CCJS 3TAQA 2J6SA 2FPHX 3UN2A 2JEFA 1NJWA 2FJXA 1RT7A 3J7ZT 3ET6B 2CJBA 4TU8A 1N5YB 4CO2A 2VPZB 1PJ7A 3G86A 4KE5A 1FKPA 2DNZA 1Y10A 3GTYX 3J7AN 4KYZA 2ZJRQ 2V2VA 4OL8A 2QL7B 4LF5F 4ZMMA 2OPRA 4Y6IA 2P9EA 3OTEA 2KT3A 1CC8A 1EZZB 1U1MA 1O8BA 1JK9B 5KFQA 2Y9HA 4DEZA 1HMVA 1B3TA 5SZTA 4ELVA 2HRYA 3FQKA 3DLKB 2Z30B 2GGPA 1VFJA 3RB4A 3JAMY 2OUGA 3POTA 3DOLA 4YOEA 5AJ3J 3UR3C 2WVDA 2KDOA 3R5AA 3GQCA 1HBMB 2NREA 1BWVA 3ENVA 1S1UB 2JSXA 5BR8J 4YR0A 3DXBA 5HATA 2AYGA 1RTIA 4AL5A 1QE1B 3HI9A 2D9OA 4LRAA 1NPPA 3SMZA 2YPZA 5LMNF 3M4XA 1PCAA 3FMBA 1BWEA 6AT1B 2R7WA 5KFFA 4P72A 4A8YA 3TAPA 1VIOA 2AEMA 4LBHA 5J1EB 3WIUA 1N33J 3H98A 1RWPB 3C14B 3AFGA 1UMJA 3ENWA 3V81B 3MR6A 4KB7A 5DETA 3O1LA 2ACMA 5DDPC 1TKZB 4IRDA 2UP1A 4K59A 1FRKA 4NA3A 2HHQA 2WSCC 3KHRA 3CSKA 3T5JA 1FJCA 3K8WA 4C3MA 3VF0B 3TEGA 3KK2A 1BQMB 2XO6A 3HD2A 2RKIA 3KG1A 4A8SA 2GJFA 5KFMA 2IC3B 3HZGA 3OFGA 4JV5J 1BXNA 1F2GA 2ZBIA 3WBZA 2AIRB 1RT1A 5HANA 2C3OA 3OUYB 4ED6A 1GQEA 1HNZJ 1HBOB 2VF3A 4C11B 2NXNA 1QY7A 1CJKA 1DY3A 2UUAF 5C5JA 4YY3F 1NCLA 5KOXA 4MJKA 4F0HA 3NGRA 2HQCA 1HNWJ 2OP5A 3E8OA 1PIEA 1UEUA 1U8WA 2VPWB 3TEHB 1F9HA 2HHHJ 1APSA 4X4TA 3RAXA 1A0OB 2B7CB 3N6MA 4NMLA 3UD5A 1UVJA 2DGTA 5BYQA 4DQSA 4CTAA 1MNEA 2FYXA 3MM5B 3R8YA 1S1WB 4DR1F 2RVJA 4H4OA 4AQYJ 4JI0F 4NLWA 2PE8A 5E2QA 2DGSA 2B4OA 1YRTA 2R7TA 3V6HA 1Y4ZB 2IA0A 4BDPA 4DFJA 4IOCQ 2DNNA 4URGA 5HBMB 2JEJA 1P8GA 3NRBA 1D9DA 2FJWA 4YEAA 4USJC 4MYUA 2DHAA 2MQPA 5GADI 3I5CA 4O3PA 2HVEA 4EBEA 2HWHA 4LF8F 2FHKA 2NZCA 1KTVA 2OH2A 2NUHA 4LF5J 1X31C 3EVOA 5ETLA 3V2UC 3KXDA 2CWXA 2MGZA 1HI8A 4C2MA 3CXCR 5IM0B 2DCLA 2GJ2A 2FC9A 4Z2XA 2J7UA 2D1CA 4NZ7A 4ZITA 1F60B 2A2DA 3U7JA 3D0HE 4M5DB 2XG8A 2R42A 4GVBA 2HFUA 3UNGC 1WC3A 4UOFA 5IQ6A 3TANA 2PEBA 3LO3A 1HBNB 4G1QA 3RRGA 2YKAA 2EI5A 1ZZFA 4X64F 2YXLA 1RT6A 3BR9A 1LK7A 3I0SA 1AFIA 3Q8YA 1MMDA 2CWKA 4UT4A 1TR0A 1OJ4A 2O01C 3LP2B 3IRXA 3M9NB 3GMGA 2YH1A 5KFYA 4DZDA 2CAJA 5K14B 4X66J 3DOMB 1Q78A 1PC5A 3CD5A 2IVFB 1KONA 2HVZA 1KBRA 2Z2YB 1GK8A 4L75A 5A0YB 1C1CB 3ISND 1PKUA 1YI2S 4C3LA 3ELHA 3M6VA 4IDKA 5LMNJ 3GV7B 1R7IA 2K7JA 3FMWA 3M6XA 1RWUA 4HTJA 3OXFA 1F3VA 2VICA 2VH7A 4DV5F 3KLIB 2C2MB 3D3CJ 1S97A 4KFBB 1TVRB 1VHIA 2J9DA 4IOAQ 4XDDA 4X65F 3HSZA 1LWEB 5ETPA 3ZO7A 4Q0BA 3T1HJ 3UN5A 1FDBA 2BEFA 4LRDA 1SCJB 2BBEA 3MR2A 2FLOA 1SL0A 4C8MA 1FVSA 3HHEA 1NRKA 4ZIVA 2XZWA 4JV1A 5L46A 3BBBA 2IIHA 1VBYA 3QSIA 5E41A 1R89A 1ZOTA 5F8NA 2FHJA 2AX1A 3CNQP 5H9EJ 2ASDA 2W2PP 3VR1A 2HHXA 2KYXA 1OPIA 3D6HB 4OJ1A 4RNOA 4WPAA 4NLOA 2HVDA 2E5JA 1VCTA 5GAEI 3JSMB 1QVGR 1YBTA 4RW8B 3J81Y 1UVKA 2HHTA 4YY3J 1T9UA 1EHWA 1M5KC 5K9FA 2JL9A 3BGUA 2H65B 3MR7A 2FY1A 3UFCX 1WSRA 2OSQA 1YJRA 4AFFA 5F8MA 4YB6A 1IN0A 1FERA 3RTVA 2GO9A 1FE4A 1OY9A 3FUYA 3T1YF 1TUWA 2DVIA 4B08A 3KLEB 1Q4RA 4DR1J 5IFMA 5CYMB 4JI0J 2UVWA 3EGWB 1O51A 1WHYA 3BSAA 4ETZA 2MY7A 2PI4A 2HNYB 3QZ8A 2PD1A 1NHKL 3P5TL 2N3OA 3N6LA 1D09B 1FK9B 3M9OB 2VL1A 1IBKF 3KLFA 4PEOA 2KM8B 3R5GA 1YKWA 5GAHI 1UJ4A 1VQSA 4I7FB 3PY8A 4P74A 3HO1A 2WONB 3SSSA 1XQIA 1S6PB 3ZTSA 4LF8J 2BOPA 5KTQA 3FZBA 5IWAJ 2CZ4A 3PR5B 3H4DA 2BJDA 2EBGA 4J90A 1M5SA 1YIJS 3BO3A 2B4VA 2GJIA 2VFRA 1U1NA 2MKHA 4QIEA 1A7GE 3QBCA 4ES1A 2DBBA 5DQIA 2FJEB 3K89A 4ZIWA 1KP6A 4QIWD 3QRPA 4LMZA 5HO4A 3FGVA 2N4DA 1HIYA 1JQGA 4RL1A 2C2EA 4USKA 4OJGA 2LP4A 2YWFA 1T02A 1WACA 4O3OA 2J7KA 4F0MA 2OPSB 3CB4A 4M5LA 5CAAA 4DQRA 2FJBB 4PWUA 4X64J 3DDKA 3HMJG 1XN9A 1TU0B 4DCPB 1RWNB 3KK1B 2IJNA 3BR8A 4ZVQB 5DO2A 4ZCMA 3TZZA 4P10A 4EBCA 3Q8PB 4P52A 2DR5A 2Z57B 2F65A 4LRBA 4OZ3A 4QR2A 4OZNA 3TA2A 2XI3A 1RTZA 3I4PA 2J0QD 2XTJP 2R7RA 1S0VA 1NBEB 2ZKTA 3QPIA 1IKVA 2CQIA 3CF5Q 5KT4A 2B7BB 1X4FA 3D6MB 1KQKA 2HHUA 1I1GA 4JYAJ 4YS2A 2ASJA 3PYFA 3BKFA 3NOCA 4PXBA 2C2ZB 1RAHB 1SIWB 4X65J 1OQ6A 3DYAB 2J76E 3EXCX 2QYCA 2QG9B 3HK2A 2BE2B 2WVEA 4DV0J 3NNAA 3LPYA 4J91A 4K4ZA 1KEKA 2XS2A 1HQ2A 1F9FA 3BBCA 3EUNA 2VHGA 1C0TB 1N48A 3HHLA 2N3LA 4RLEA 3HHKA 5HJYA 4DSIA 4DV7J 1UKUA 3MMJA 3GB0A 3VGSA 4RKUC 4DX6A 3TZXA 4LFBF 4MIBA 3GSIA 5D6GA 4RWWA 3FEYB 3MR3A 2J9EA 3PW4A 2BRLA 2MLZA 4LF9J 2HIYA 2J0WA 2QT7A 4P2FA 1FDNA 3BJYA 3RG6A 2HWTA 2ZEJA 1RHUB 4CLSA 4LF2A 3I56S 4RPFA 4URQU 3MCSA 4NRTA 2MKJA 1S0NA 3S1TA 2EEYA 1RT2B 2Z56B 4CT8A 2UUBF 2D9PA 3TX8A 3IMQJ 2QA2A 2CKWA 5CXTA 5C7PA 2VBYA 2G9OA 4ZKAA 2AZ1A 3PVXA 5A8WA 4NLDA 3SDEA 4U6PA 3NMRA 2QJ3A 2QZ8A 4EWTA 2CYYA 3EYZA 3US5A 4UOGA 2YQ0A 3TX0A 3T1YJ 1U24A 4ZPCA 2NXCA 2IM1A 2D7SA 2F40A 4JI1J 3BEGB 2LXFA 5DG7A 2J0XA 4OYXA 3ITHA 1UETA 2LLZA 3MMAB 5J1NA 1VQ6S 3CJ4A 4U8VA 2DCUB 4CNZA 1SH3A 4C0BA 1AZSB 1CVJA 4ED1A 4CO3A 2CPDA 3QFHA 1IBKJ 1SC3B 2CNNB 3G6XA 1V3RA 3PYEA 1RTHA 4TXSA 1VQPS 3U1LA 3M8PA 4IOBA 3B4DA 2XS7A 2W2QP 4I6YA 1FT8A 3MMCA 3W9IA 4G1PA 1YJUA 2IM0A 1SL2A 2E9ZA 2ZBRA 4U7UK 3G82B 2CFXA 2AJ0A 1D3WA 2GFFA 1RU2A 3Q83A 3MPVA 1JLEB 3TARA 4K4XA 3GFHA 4F50A 3VQTA 3CMES 1JKHA 3KJNB 3LALA 1ZPWX 4CH0S 1DTTB 3FFIA 3Q86A 3ZZOA 1FJGF 2RQ4A 2C1EB 2Y0BB 3M6UA 1PYOB 2ZVSA 5D0HA 1NK0A 2K2PA 3WIVA 1HD1A 1N0UA 5D3GB 1Y5IB 3GJQB 2RILA 5E3PA 3RR7A 2W9CA 3G6ES 3C6TA 1OSCA 5A8RB 3PRDA 4FXWA 4F3MA 1VGYA 3EDQB 4NWBA 2B9YA 4MK9A 3M8WA 2HLTA 4L6V3 1UAWA 3W8PA 4ED7A 2GVZB 3GFYA 3L3CA 2OAUA 2ZD1B 3DLBA 3TVZA 1X60A 2Y1IA 2OHDA 1DQ8A 2EFPA 3P8BB 5L9NA 1NKEA 4D3HA 2H9ZA 3JXOA 1Z2LA 2VOOA 2BABA 3O8WA 3CJ5A 5KT2A 2Z4PA 3ZNJ1 3OLBA 4ICLA 1KD1T 1I5OB 2GHPA 2WSFC 3NOGA 3NCRA 3V5RA 2MQQA 2LMIA 3W1YC 1PILA 5ITHA 4PCQA 3KKFA 1P27B 3BSNA 2A10A 1J2VA 1I94F 4IKAA 2ZJPQ 4KQZA 2HQGA 2BVZA 1S79A 4ZPTR 1EKRA 5DQHA 1XR5A 2V68A 2FVQA 4N77A 3RB6A 3G2XA 2BJ9A 4QWDA 1WEXA 4LFBJ 2YVSA 3CJ8A 3GIKA 2M8DB 1BQNB 3R1LA 3HFVA 2HGMA 2YQ3A 4P71A 1T9XA 1S6OA 1TKXA 2AJ4A 1LQ9A 2FHJD 4CM2A 3IWXA 1HL6A 1SL1A 1GX6A 5A8KB 2FVPA 4E8UA 2DRDA 3L7OA 3N0VA 2NYIA 1U2CA 2DGWA 4LREA 5F3TA 3GFZA 2R3VA 2FLLA 4DFKA 2DNKA 1CJVB 1KOHA 5IT9Y 4FN5A 3IBWA 1S7IA 4QIGA 3NGDA 4ID5A 1K73T 4JV2A 3DMJA 2HMIA 2R4FA 4F7VA 4YHHJ 2YNHB 1XTZA 3KYLA 2MYFA 3K7RA 3JQMA 1FHTA 4CI0B 1FESA 3O3LA 2RS2A 1U2RA 1GH8A 2OI2A 4CRJA 4A8FA 3IG1A 3C66A 2RE1A 1SI9A 2RQCA 4ECSA 1S72S 1Q0NA 2FVSA 3RR8A 1U02A 4FNIA 4X62F 1SJ4P 4HVZA 1RBAA 3FCVA 4WJBA 3PG9A 3G9CA 2GQ2A 1MWYA 1VLOA 4CLFA 2YPYA 1B0PA 2XWXA 3ET6A 3VVUA 4KSEB 1Q86T 3ETOA 1N5YA 2A2CA 3B4MA 2EC2A 2OMOA 1EQ0A 1S59A 3TW0A 2R8HA 1X7VA 3QJLA 3AJ2A 4LSNB 4BC7A 3ENQA 3KDOA 1N34F 2CJKA 3BKUA 5L1KA 2ZH6A 5CD4H 2HVIA 3JSRA 4I69A 3I9ZA 1QJHA 2R7OA 4DV1F 2PGCA 1S9FA 2AP6A 1NK8A 2DH8A 3JSBA 4NLQA 2R2SA 3CCWA 1S12A 4F4WA 3DLKA 4ILRA 5KFLA 2LEBA 1Z1ZA 1JXLA 2HFZA 2M8HA 2CPYA 1XIQA 3RGIA 1XMQF 4YMEA 5B09A 1H38A 2NQPA 2DGVA 1HBMA 4TU7A 3DU6A 3T1AA 4MYTA 3ZZZA 3UWTA 2B51A 2LFVA 1S1UA 2VFTA 1B7FA 5CYQB 4ZN1A 1QAYA 1AYEA 2V67A 1J27A 2MZSA 2RU9A 4OLOA 5HVHA 1AUSL 2BM1A 3KJFB 1QE1A 3TZWA 1SPBP 1CQNA 3I55S 3JTPA 5KFDA 4KO0B 5DJBA 3V4IB 1WDTA 1UP1A 2CPJA 4J9UE 3UI3A 2W1BA 1VC5A 2M70A 2JVRA 2VPXB 3E2EA 3C14A 4Q7AA 2GIQA 1J5OA 1BY9A 1NDCA 3V81A 4AXIA 1B99A 3W8GA 2CNLB 1GMWA 4PXEA 1LW0B 1TKZA 2QA4S 1VBXA 2CQPA 4L76A 4ZVHA 3AAWB 1ACMB 1I94J 4DI6A 5HVGA 3KUHA 3P3DA 1PGZA 5AT1B 3BV8A 1IWAA 2J7WA 2HQDA 5A2QU 4ANDA 1WORA 1WHVA 2ACYA 4JI6J 5DZ6A 2G13A 3NGUA 2HBRB 2WSEC 5I3UB 4CZCA 4ED2A 4DL7A 1RWXB 2IC3A 2PMZD 3TQ1A 4N8OA 5AXNA 4Q45A 2F4FA 2F8MA 2IDEA 1QVFR 3THVA 4YN3B 2RD5C 1HBOA 3HHLD 5KFEA 4C11A 3HP6A 2PFDA 1UFWA 2RU3A 3DHWC 3H59A 4U95A 5ETRA 2XNQA 2FY8A 2PSZA 2QSFA 4CYUB 4LT6A 3JTNA 1FXRA 4HH1A 2YWKA 3G87A 2YY3A 1Q81T 4CQ1A 4EI2A 4E2FB 1HARA 5IQQA 3CJQA 4DR7F 1EX8A 2G2OA 3MM5A 1S1WA 2VQFF 4OI1A 2WVFA 3OL9A 4Y2CA 3OVSA 2R7SA 2DNHA 4ZS6A 3VALA 2IY5B 4X62J 2L41A 4K5SA 1T3OA 2PIIA 3H25A 2GHWA 4FKXA 4EYHB 2K3KA 2QSWA 4I1TA 1WKJA 4RNNA 3KLHB 1RABB 4YUDA 1NJZA 3PW5A 2OTJS 1N34J 2IRXA 2VV5A 2IJRA 4DXLA 2IM2A 4P2XA 4USMA 4BLGA 2ZH1A 2MKSA 3DRSB 2Y8YA 5IM0A 4PZVA 1OIAA 1NJIT 1G3OA 3MEGB 5GAGU 4M5DA 3OFHA 2OLWA 4I2QB 1WF1A 2DRAA 4H4OB 1RE1B 1F0XA 3HXMA 1X0PA 3SQOP 1XMQJ 4OZ0A 1HLWA 1HBNA 2VBWA 3D67A 2AYBA 3T9ZA 4F4AA 5C24B 2UXDF 2FHOB 4U7CA 4B3MJ 4XPCA 1ITPA 5JVHQ 3LP2A 1OYDA 3WDOA 2HK2A 1CPZA 4HT7A 3K5NA 3KDNA 1TKDA 5K14A 3DOMA 2XSFA 4UZBA 1KSPA 5DLGA 2XGPA 1T0TV 2ZH9A 5A0YA 1C1CA 2AF6A 3HLUA 2HFSA 4K4WA 1IKXB 1QUPA 3CDAA 4IFYB 5IV3A 4RW6B 3T6JA 3KLIA 3CJTA 4AL7A 4UY85 1WSVA 4J9RA 4IR9A 3M8YA 2OD4A 2UVRA 1TVRA 5EWFA 4DR6F 2CA9A 2EKNA 4DUZF 5C25B 2CNOB 4DX7A 1LWEA 3D1OA 5FIIA 3GE9A 2E5GA 2IM3A 4TQSA 1XERA 1KVKA 1JJCB 3OPKA 5HK4A 2MQOA 3PX4A 1VIXA 1RTJB 3W2VB 5K8MA 1R8CA 3KLVA 3MM8B 3MPUB 2DY9A 3D28A 1FRXA 2MSSA 1DQAA 3OJUA 3E3XA 1T9VA 2RRNA 1LW2B 1IUJA 3QIPB 2PA8D 2EG1A 3FEXB 4A8KA 3H40A 2BJ1A 4DSJA 2ZVIA 2UXCF 2YNGA 2V4QA 1K9MT 3W5YA 2X3DA 1U0HB 2ZKUA 5L1IA 1U6BA 4QCLA 2BX6A 4IDKB 2DIUA 4CLKA 2MZTA 2XZTB 3C16B 3MAHA 4HTIA 1U6FA 3CE8A 1FE0A 4ZPVR 3JSMA 3CIZA 3RAMA 4UOHA 4ZVTB 4ZVSB 2MHNA 1VQKS 3MM9B 3CDWA 5KFXA 1LK5A 3OSNA 2QLJB 3M9MB 3Q8VA 3CCUS 1KLMB 2D69A 2OPPB 1KKHA 4I64A 4P2SA 4Q0BB 3K5PA 3ZZUA 4ZA1A 2EG2A 4C8YA 2NPFA 4DR7J 4PYDA 5LSLA 1UFKA 3HDSA 4DU8A 1T9TA 2UXBF 4FZVA 5CYMA 3HJFA 3S01A 3MCMA 2VQFJ 1M90T 4NXNF 1OO0B 3ZZ0A 5ETVA 2MKIA 1EB0A 2J6UA 2HNYA 2VASA 3FSYA 4LSLB 4X84A 4ZPDA 1RU1A 1I3OB 1Q8BA 4FYDA 5CD4A 1FK9A 4OYMA 4UQGA 2ZZTA 4DV4F 2QLXA 4CO0A 4USVA 2ZH7A 2ROGA 2X1AA 4ZPBA 3HT3A 2W01A 4I7FA 2WONA 1S6PA 2YKOA 4P9SA 1FD8A 5HQMA 1F9EB 1B0VA 1JLFB 3HD1A 4BCAA 2OEJA 1NK7A 1L3TA 4JB8B 1RWWB 3CC7S 2ZFHA 3MAAB 1TAQA 2LQ5A 3QZ7A 3HSDA 1SB6A 2HHWA 4K4VA 4UW2A 1FDDA 2B9WA 2JC0A 1NK9A 1VQLS 4OJ3A 3CJ0A 2WRMA 4NL5A 1FD2A 4M5NA 3HKZD 4OZ5A 4WZQA 3IWLA 2CPZA 2FZKB 1VK8A 1F1BB 5F8IA 4NPOA 4TN2A 3P49B 3D66A 4C8OA 1S0OA 4YR2A 1NO8A 5BYSA 2O1PA 3WX4A 2UXDJ 3KK1A 1S57A 1T11A 1UFLA 1H7XA 1H2UX 4NLRA 4AD6A 1VC0A 2HZVA 4C8LA 2ABYA 4ILMA 1HW8A 1NSPA 4X4PA 3I32A 1OPZA 1RB0A 1GFWB 2CJAA 2CUYA 2DRBA 1KR4A 1REVB 2MZQA 3UDEA 5H9EK 3VCDA 1NB2A 1RLDA 3H5YA 1D8ZA 4YDDB 1U1KA 4NLYA 4B3SF 3Q8RB 2J6TA 2CJQA 3BQ0A 2HGLA 1YJ7A 3FBCA 4N8NA 4USWA 2OGUA 1Y3JA 3IR5B 3QJJA 4GKJF 5KFHA 4KAIA 2JLEA 4DR6J 2KXNB 4ITSA 2A18A 2CQ3A 4ATNA 3H2VE 2DH9A 4DUZJ 1KQSR 4KHPF 2A6MA 3DYAA 5H9FJ 1RXOB 5HQ8A 3DLEB 3M6WA 4ED5A 3DDNA 4R0JA 2BE2A 1XEZA 2H48B 1Y7PA 3MOZA 1GTHA 2ZZMA 5L38A 3GJRB 4X4VA 3DKDA 3MM6B 3HF5A 3P45B 1CULB 2N7YA 5M2UA 4X4UA 4GC6A 2B9XA 1C0TA 1B0TA 1RADB 1QM9A 1AT1B 2VG5B 1KLNA 1BQXA 4N7TA 4ZCIA 2V94A 3K5OA 2VPYB 3W7BA 1GMWD 3J7YI 1UZDA 4YDXA 2RHQB 2M2BA 4LR8A 2BDPA 4OYIA 3CDUA 3GCXP 1JB0C 1WOPA 4LQ3A 5JJBA 3PX0A 4CLUA 1RAOA 3CCVS 4K0KF 3PNIA 1FKOB 4ZCKA 4DOZA 2D41A 1RT2A 2HFNA 4OX6A 1XMBA 4P7TA 2QC3A 2NR0A 2AYEA 4Y00A 1X0FA 5T41A 2EKYA 1CLFA 1V5IB 4ECRA 3VAIA 2AV5A 4NCBA 3HM9A 4OYPA 3TZYA 1T7PA 5B0EA 2AD9A 4X4OA 3J80Y 4QYRA 2HBZB 1SKUB 1RWKB 5SUHA 1KWMA 1IM6A 3FSXA 4D3GA 1VQ4S 1R6YA 1QAXA 3D1QA 3WHIA 2VDHA 2GMHA 1NKCA 1RWMB 2GIFA 2H1YA 1FXDA 4QYZJ 4LF4F 2X1GA 3QAEA 4KHMA 4NXNJ 3D5MA 4KV8B 3MMAA 1D0EA 4FYWB 3HHNB 2IMWP 2MKYA 5KFGA 2C3UA 5MLCV 2XMVA 1B4SA 3M8RA 3M7VA 1AZSA 3D3BJ 1RZMA 1N88A 2QLFB 1IBCB 3R2DJ 4DV4J 3M2VB 1FTCA 1KDNA 2UU9J 3W64A 9RUBA 2YKPA 4C98A 4QBUA 2VONA 1E6VB 3KHLA 2CDRB 2XZDB 1TUGB 3T3FA 1M1GA 4WKYA 1RWOB 2IRUA 4KH1B 3R27A 3KG0A 1NLKL 3G82A 3CO9A 3MI7X 4LRCA 3VTIA 2NYHA 3HZEA 1JLEA 2PN6A 1K47A 1FRMA 1FRIA 4PQAA 4NXMF 3AQPA 4ECQA 3GG0A 5EX0A 1H2VZ 2HNDB 1DTTA 1FEHA 3CGIA 1FRLA 5B0CA 2RH3A 3DN9A 4MKVA 4DUYF 3DGVA 1U1LA 1T9WA 3CPWR 5CA5A 2E7WA 5EGYA 3S6EA 2A0FB 5B0AA 2XC9A 4Z37A 4FS1A 2CQGA 2XO7A 2D3UA 4PQUA 4BHQA 3CC4S 3MTJA 5D3GA 2RJZA 3M30B 2VFUA 2J0SD 1S1TA 1QUVA 1NU4A 3IXQA 2B4PA 4USTA 2GO8A 5A8RA 3GJSB 1WUUA 4F4ZA 2VG7B 4IH6A 2GVZA 1JX4A 4H4KC 4B3SJ 2XI2A 1NH7A 1UW9A 3BN7A 2SXLA 1LOUA 2IPOB 3V6KA 3CCSS 3EGZA 1PJ6A 4GKJJ 2BOAA 1VQMS 3JTOA 4IH5A 1D9AA 1PJ5A 4KGMA 2B6AA 2YKNB 2VOPA 4HI1A 2UUWA 2GMJA 2YKQA 1NDKA 2BYCA 2DIVA 3TUZC 3EXYA 1TKTA 3DGPB 2KFNA 3GJTB 5AJ3F 1HFEL 2QV6A 2GQQA 1RYRA 1QLNA 5ETOA 1A6LA 5LXRA 2IAJB 4BBYA 4Y2AA 4DV2F 5KG7A 5B08A 1WELA 2DXEA 1YGYA 5BR8F 2PMWA 2NUUG 3B8HA 3MFHA 3OHBA 3NG8A 4EK2A 2ALZA 2EFQA 4EMDA 1S77D 4LVOP 5HN0A 4O3RA 2W4DA 5KG2A 2DO0A 1RAGB 4DL4A 2KT2A 1UWAA 1BQNA 3CJKB 3JQKA 3RUBL 1UL3A 1Y11A 2MTLA 2C42A 3CD0A 3NGSA 5BJRA 4IH7A 3FKBA 1RA6A 2QMWA 4GO7X 4K0KJ 2WVCA 1VOMA 2UVUA 4L72B 4Q8EA 2A6OA 1VBKA 4UZCA 2PEHA 3RBDA 3H5SA 4ZLLA 5A8KA 4KC5A 3PV8A 1VRUB 4IG0B 1JLQB 2BXJA 5KG0A 4M5JA 1Y5NB 2ADBA 2EK1A 4LF6J 1CJVA 1EETB 5F0WA 3JAMU 1EKSA 2B8QA 2LEPA 3Q8UA 1H6KX 4UF4A 2VA2A 1WI6A 2E1MC 2YNHA 1TL4A 4ZN3A 1NK5A 3Q8QB 1W2IA 1KC8T 2WK4A 1ZETA 3N79A 2FC8A 5D15A 2EFVA 1I6JA 4U8YA 4I6WA 3LAKA 4LF4J 2UUCJ 3OR1B 1RJJA 4X4SA 2CQ0A 5KAKA 2EFOA 3KJVB 4ZP6A 4PG4A 3T19A 4FVMA 3KHGA 5F9LA 2HAFA 3M2RA 4ED3A 5LMUF 2B3TB 2V9KA 2MSTA 5AE2A 1WOOA 3LAMA 4NLUA 1WC1A 5KFSA 1M5HA 4PWWA 2LU2A 4FF2A 4Q44A 4HLBA 1NEEA 4E0DA 5KFUA 2G0IA 3ZTQA 1W26A 2H5IB 2W9BA 1TKXB 4LBPA 1HNZF 2OFHX 3EPGA 2K1RB 4NA1A 2LKZA 3R5BA 2EWHA 4LSNA 2V8VA 2X3GA 4L3KA 2AQ4A 1HNWF 1K1SA 4TKTA 2MMYA 1H72C 3HSGA 3NNCA 2FZCB 2LXUA 4NXMJ 3M1VB 1GNKA 2CXEA 5KOWA 1Q82T 1IR0A 1IKWB 3PTWA 2Q66A 4DL0C 3K8VA 1UCNA 1YJTA 1SUQA 4MT1A 3M2UB 4WFBQ 1WC5A 1CJTA 4DUYJ 2DNGA 3LANA 1MWQA 4YB7A 3DCAA 2ZDOA 5T7LB 2M0GB 2ADCA 3LA0A 4DMZA 1GTEA 4WE1B 2HQFA 2V4JA 3PEJA 5CYQA 2E5LJ 2BMBA 4QWEA 2ZBPA 5HL7Q 4OHXA 1OS5A 4F02A 2D74B 4U7UD 1WF2A 1S7HA 1L5UA 3PW2A 3LOUA 1JLCB 2NSBA 4KO0A 3V4IA 2PMHA 2GA7A 1REGX 4M5HA 1NHUA 1SBRA 4A47A 1D1UA 6FDRA 1KFDA 3FBBA 4R8UB 4FS2A 3JS9A 4IYQA 3NBPB 3K2YA 1Q7YT 4WTOB 3B54A 1H7WA 1MN7A 2RMLA 2E1CA 3VZIA 1DFDA 3VVTA 1SQFA 4H54A 3QRRA 1DBDA 4QW8A 1LW0A 2DO4A 2DR6A 3PRVA 2MDAA 4DV2J 2AGOA 3BQ1A 2XY6A 1HQEA 2VD3A 4N41A 3EX7B 3AA8A 4ZDNA 4WIIA 2CQ2A 2YWWA 3R5CA 3M05A 4RZRA 5I3UA 4F04B 3T6BA 4X66F 1TL7B 5J2MB 3DM2B 4F4XA 3FBEA 5KG5A 2V34A 4MTPA 2HBYB 5CHCB 1VRTB 4O3NA 4B3TF 4LFCF 3KTQA 1Y9OA 2W8LA 1X5PA 1Y3KA 3BGRB 4M95A 4DPUA 3A3PB 3Q23A 2EVZA 4MFBB 1VQYA 1RCOB 2MHEA 3CCTA 4CYUA 4FPRA 3NXZA 3JSYA 5DDOC 1PO6A 1J5OB 1WDDA 1U2FA 2D3ZA 5L9XA 2C2DA 1DLOB 4ELTA 2RQKA 4PAAA 3NCQA 2GW8A 3IRWP 1S4FA 3RB0A 4ZVFA 3T1HF 1M1KT 1T94A 2RRBA 3W5XA 5LJ5Y 2N7CA 2A1BA 3M8QB 3Q89A 2E29A 3Q0AA 4DLGA 3QYYA 1WG4A 4MKAA 4NOHA 1RHQB 3CCES 3U27A 1GXTA 3BPDA 3OL8A 2FLNA 1X4AA 2IHR1 1SJRA 1U4BA 2NPIA 4L3NA 1Q53A 3HVTB 5LMUJ 4GO5X 1RT5B 5GAGI 2W7PA 3MCNA 1BMQB 3UR0A 1WTBA 4J9KA 3MTKA 3A1YG 4C8NA 3THTA 2CNKB 2YNIB 4OV1A 2MQ8A 3DDIA 4JI5F 3K58A 5HLFB 4CH1A 1ZYQA 1SC6A 4OMFG 1DHMA 1NH8A 4DPXA 3KLHA 3LWLA 4MAKA 1HNIB 1IR1A 3KNGA 1K0VA 3IS9B 5B0FA 4IO1A 2F63A 4Y28C 3DRSA 2OPQB 4ECZA 4Y2KA 5KFNA 2IVYA 4USIA 5L8RC 3MEGA 2RAQA 4NCAA 3QNWB 4I2QA 5ETQA 2K7KA 2BE9B 2XHWA 1R43A 3W60A 4WBFA 4OYBA 2XQCA 2FQQB 1RLCL 1U7LA 1NKBA 2FLPA 5C24A 1ZM4A 1Q8LA 1RT3B 3QT6A 2P8IA 1H98A 4M1KA 3GR0A 3RB3A 1HA1A 1R0BG 1H74A 1TK0A 1EAYC 4FBTA 4PG8A 5DM6Q 1FCAA 3K59A 3DLJA 3J81U 2WB1D 1KOOA 3LP1B 2L9NA 1R31A 2MY8A 4OI3A 1IKXA 5IWAF 4DU7A 5J1PA 4OHVA 5D4NA 3RW6A 1JJ2R 4BS2A 1TUVA 4IFYA 3G4SS 3NP5A 2VB6A 1PAUB 2CQ1A 4RW6A 2U2FA 3HVRA 1HNXF 4EBDA 3NWGA 4C97A 2WHOA 4NLVA 4NLPA 1JLGB 1FJ7A 2P6TA 3IR7B 4LFAJ 1NZAA 5C25A 4OZ1A 4KJIA 4DF8A 3I96A 3D6TB 5GAEU 4HACB 1XNRF 5LOQA 5EDWA 2K3IA 1C1BB 1G4CA 4OX8A 1VQOS 1RTJA 2FUG9 2HURA 3W2VA 1FX4A 5KT3A 3EZ5A 1W7WA 3C2PA 3MM8A 1XR7A 1X9SA 2WAQD 4DL6A 3FZ2A 5K8PA 2H3EB 2RDDA 1F3FA 3BDEA 1LW2A 3QIPA 4WYWA 2F5GA 2VFVA 4I4BA 1ZM3A 4RW4B 4JI8F 4KPYA 1U0HA 4B3TJ 4LFCJ 4G1IA 1SH2A 3MCOA 3JYTB 1DTQB 3C16A 3H2UB 1BLUA 4GC7A 2PT0A 3K5MA 4I56A 1SVDA 3JB9k 5F41A 4JYAF 3MM9A 5IS2A 2Z2ZA 4BWMA 4EO8A 4DHVA 4OHZA 2QE5A 1H73A 3FCHA 2F3JA 1TQLA 3OW2R 3SI8A 1UVIA 1P9QC 1WHWA 5B0DA 1KLMA 2B8PA 2OPPA 3PO5A 3J7A1 4WXOA 3K0JA 5HMZA 1EP4B 2DPJA 4B9TA 2KZZA 1FDAA 4DV0F 3CULA 3BB5A 1N5QA 5M2PA 3G8TA 3KMQA 2DH7A 2Q1LA 3SEOA 3RW7A 4M5KA 1UPMB 4PG6A 2DY1A 1HWJA 2FVCA 1JLBA 5E3QA 2BZ2A 4DV7F 4XDCA 3SCKE 4NLXA 2KT5A 3CDBA 4LIRA 4PPDA 3VV2B 4LSLA 3CVKA 2GS8A 4DG1B 2YNGB 3CT9A 2VKRA 4DF4A 4LF9F 4PXCA 2JLGA 2Z0GA 5KFVA 4JI5J 2RB7A 2DT9A 4JI7J 4PPZA 3UO0A 3EZUA 3PM9A 2E7XA 1ZA2B 3QLHB 4EZ9A 2U1AA 5A6WA 4YR3A 4DL5A 5EHHA 4F4KA 2BE7D 2DD8S 2BJ3A 1JLFA 1UZHA 1L3UA 1RHMB 4OZ2A 4OX9J 1KQGB 4U9RA 5E0OA 3EZOA 1HKAA 2F7VA 1S9GB 3LF0A 3MAAA 2RF2B 4IG3B 2I5JA 3CJ3A 2G2ZA 3ILOA 5CH7B 1EIYB 4GKKF 1KVJA 3CDEA 2P6SA 2GCFA 3PX6A 2LCWA 1X5TA 3N6NA 3FJ2A 4HEA9 2XY7A 4JI1F 1HWKA 2R7XA 3IFEA 2EFNA 4QIVA 2W24A 2FJAB 2IFXA 1FNXH 1SQEA 4P75A 1KFSA 5FLXY 1WD6A 3R7SB 4WFYA 2XWYA 2BQ3A 4K2JA 2LA6A 2LQ9A 1IBLF 3IN5A 1PSDA 2M88A 3OTBA 2HHPA 5KG1A 2NXUA 2JEIA 2CPHA 2ZNZA 3PFEA 5CZXA 2OJ3A 2BKOA 4USUA 3MFIA 2L3MA 4A8WA 2MLXA 3DFEA 5CABA 2MZJA 1REVA 4K2XA 3C15B 4CDIA 4KTQA 3LGNA 3GPAA 3GU0A 2UUTA 1IKYB 1YHQS 2DNYA 3SV4A 4I0WA 1HNXJ 3B6BA 3PZPA 1ZAXA 2HZAA 3WX8A 1YRXA 3VAFA 2JNJA 4CM0A 1UA1A 4WU2A 2XS5A 2GVDA 1R8AA 4ECTA 3MR5A 2K06A 3DLEA 1XNRJ 1TELA 1S9EA 1IXKA 4Q8FA 2M52A 2HGNA 1HBUB 4FYXB 4RBUA 3BGOP 3BYPA 1GXUA 3NAHA 1N56A 3MM6A 1CULA 2M7SA 3MPDA 1B64A 2K8GA 2RQMA 4DN9A 4J9VA 4KGZB 2V9WA 1VJQA 2VG5A 3WZ0A 3I9V9 1CJUA 2BJEA 1VI7A 3BREA 3TRGA 2AX0A 3I5AA 3TJ9A 4JI8J 3DRPA 3OQ2A 1S99A 4FVCA 4N5SA 1X4HA 2CVEA 3CCRS 3R5DA 1IBMF 2W2NP 4I67A 1U25A 1S1VB 1FKOA 1MN9A 3I0RB 2RSQA 2O66A 1CEZA 1V6HA 1FTRA 4CIOA 2YWGA 4J9NA 2C3PA 1SJ1A 2OIHA 5CZVA 2QMUB 4Q43A 1YLXA 1VHFA 1DAXA 1X4BA 1QD1A 4NASA 2PA3A 4ZHRB 4JI2J 2XLKA 3J7Z5 3R3TA 1X4EA 2V50A 4B9LA 1VMBA 2QA1A 1S5ZA 3QGPA 4O4GA 1WKLA 3TUIC 1WC0A 1DJ0A 1OYEA 3G71S 1M1HA 2DGXA 4KV8A 3HFKA 1XJWB 2H4YB 4ILLA 4ZPWR 2CADA 2VJVA 1URRA 1SKRA 2ALYB 4NYOA 2HW3A 1ZM2A 3D1HA 4X4NA 4UUWA 2GZOA 3VWSA 2W2MP 3M2VA 4WU3A 5E5NA 2WOMB 2Y1RI 5D4LA 3HJVA 2XMWA 1E6VA 2KTQA 1ZM9A 2JJ4D 3QWUA 3FK4A 4LF1A 1YWXA 3LP0B 1HHSA 3U1NA 2ZE2A 1RDRA 1WWHA 2E1AA 2M5YA 1YG0A 4EU0A 3ZZPA 3SCIE 4DUTA 2Z58B 1N54B 4OV6A 2YWHA 2IYIA 3ILJA 4HL9A 4C9DA 1VRQC 4DBQA 1LFPA 3H7HB 2Y0SD 2ZITA 3ZNUA 4GKKJ 5DG9A 1HPZB 4YHHF 2HHVA 2LQJA 3A12A 2HNDA 3IP0A 4BWJA 1VQ5S 3GZ7A 5U47A 3P96A 2DNMA 3IWNC 2H4WB 2J9CA 2VG6B 4PABA 3W2WB 4WCEQ 2E5HA 1HYSB 1QSYA 4QU7A 2Z2LA 5H9FK 1AA1B 4ZVUB 2XY5A 2YKMB 2CRLA 1IBLJ 2QL9B 4WWSA 1TL5A 2OSRA 3OFFA 1SC4B 1RWVB 3M30A 2DGUA 1TP7A 5EN1A 2EW9A 1AUDA 5THWA 3RBEA 1NK4A 3H42A 4OYZA 2HSEB 3QT8A 3ISNC 3KK3B 2BQRA 2DXFA 2VG7A 4KH0B 1OY8A 3HULA 3NS5A 3Q22A 1XK8A 3DOKB 2CG8A 5IT9U 2B43A 2MZRA 2ZHOA 5HP1A 3GIRA 4DPYA 2DR9A 2HAIA 1G1XA 4M94A 3N28A 2YKNA 5GVQA 4NLGA 2E66A 4NCGA 3GILA 1UJ5A 3DGPA 3RRKA 4DSLA 2IBKA 5DS7A 2DITA 4ED4A 1M5OC 2ZWPA 3GG1A 1NUEA 3R97A 2IAJA 1ZZNA 4O0IA 4HKQA 2PI5A 5K8OA 3ICLA 4PQUB 1BD6A 4WFZA 2UV8A 2YBVA 5C2GA 5G0RA 2F9JA 4NZ0A 2ZNYA 1L3KA 2KVQE 2QIFA 1S1TB 3X3UA 2J5AA 1I51B 3FDSA 4YB1P 4A8MP 4WFXA 4QYZK 1D9FA 2MQMA 3AD7C 3CJKA 1X5SA 4RW7A 4Y2IA 4OFZA 4B9VA 1KTQA 2E9TA 2BW7A 3SCJE 1IBMJ 3VGUA 4ZVPB 1FRJA 2JEGA 2CVIA 5EUHA 4FF4A 3EM1A 4XK8C 2NS1B 2R7UA 4RNFA 4DPTA 4EZ6A 3EGNA 1VRUA 4IG0A 1JLQA 2AJFE 3DRRB 3DLGB 1LWXA 2B6AB 1HQUB 3NGTA 4H4MA 1S76D 3IGNA 1EETA 1TKTB 1TAUA 3ZTOA 1RQ0A 4KY3A 3RRHA 2RUSA 3DI6B 3N01A 3TP2A 2RNEA 5B7WA 1HHQA 5DDRC 3FQLA 4RR5A 5BXIA 2F1FA 4PWDB 5KFWA 3OR1A 4JI6F 5KFIA 4RU2A 2QRRA 3KJVA 1CC7A 3MECB 5LT5A 3NMAA 2O3DA 2M3DA 2P2CB 2P9CA 1OWXA 3DXSX 3SQGB 2HQ3A 4DX8H 3FVYA 2Q3PA 3TO8A 4WP8A 2XYGB 1GEHA 3UDCA 1Q5YA 1HR0J 1FO1A 3ZTRA 5E33A 3GSDA 3MOJB 4XIUA 1L3SA 5GMKa 2K1RA 3AY0A 3T5HA 3DC2A 1X9WA 5ETTA 4PXDA 2HVHA 3MEDB 3FSIA 1TFYA 4QPTA 4NZ6A 2Z2MA 4AT1B 4KBIA 3NS7B 2XSJB 3AJ1A 4K4UA 2HS4A 4NI2B 2XM3A 2LDIA 3W9JA 2YTCA 5KFRA 8RUCA 4S0MA 1HI1A 2DHSA 4HHHA 3MZIA 2G0JA 3M1VA 1YX2A 2QO3A 1IKWA 3S8SA 1RISA 2CG4A 1T8EA 3P4UB 2HPUA 3OXLA 3CW2C 4DL2A 3M2UA 2OFGX 1IQTA 1IM4A 3EICA 1S1XB 1YJVA 4NMXA 5G4DA 4N56A 4R5PB 4CLYA 4NEZA 3M2RB 3VAJA 4MH8A 5T7LA 1SH0A 7FDRA 3V4MA 2CPFA 2GMLA 4WE1A 2LA4A 4Z7CA 2OD6A 2HLUA 5E3CA 3H5XA 4O23A 2W9BB 1Y00A 1JMTA 3CC2S 4K7QA 2CQCA 2CJYB 4QWAA 4O3QA 2HG4A 5I42B 4R0EA 4DSKA 3LWMA 3BGFA 1JLCA 4CT9A 4RWXA 4RNMA 1JJ4A 5FDLB 4XTTA 2CQHA 1VQNS 1F5CA 3R7NB 1RGVA 4HT5A 2M4MA 5LM7E 4KGVB 2EXUA 4IFVB 3C46A 1CS4B 2ASLA 5ETKA 3O6QA 2NCKL 4HH0A 1RAIB 4PUOB 3W62A 4R8UA 2CJ9A 2C2RA 2XGQA 3NBPA 3ZZRA 4XAKA 1SUQB 1RT4B 3OTCA 1CJTB 2JOQA 4NYPA 1ZPVA 4UOCA 4K4SA 2HEKA 1ZAWA 2J9DE 2EPIA 2DXDA 1P1TA 3PIOQ 3OD2A 2LU1A 2V4JB 4B3MF 3W5ZA 1WF0A 5HSPA 3RAQA 2KH9A 1TL7A 3PYDA 5J2MA 3DM2A 4OZJA 4FXVA 1NZ8A 4CLWA 4M5MA 3H90A 3V6DB 1VRTA 4NRUA 3QO9B 5HJXA 2O5DA 1UVLA 1NM2A 1N6QB 1FX2A 3BGRA 3BKTA 2DNPA 3EMTA 4MFBA 4DR5F 4B9NA 3TJ8A 3H20A 3MMBB 3PW7A 2RUGA 4ZVRB 4ZP7A 4DSFA 3N5BA 1R8BA 1DLOA 5AXLA 1RK8A 1JLAB 5HAOA 4M5IA 2V63A 1TL1B 3R1HA 1URNA 1NNDA 4K5RA 3M8QA 1FNMA 2HFOA 1VJWA 1HQEB 2X1BA 4DLEA 2OMLA 2WZ1A 1Z2ZA 2XMUA 2L9WA 4KKOB 3TJAA 4CP5A 3I4HX 2DNQA 1WG1A 3GIMA 2VBXA 2W25A 2EBEA 4B17A 4ID8A 2OKQA 3HVTA 1UTAA 1TK5A 1RT5A 2OELA 4DFPA 1VDHA 2BJ8A 4CLZA 4DPOA 2ZHBA 3G6VA 2YNIA 2AEJA 1UVNA 1ZTWA 3D7SB 2IBOA 3AA9A 2HBQB 5HLFA 2A3JA 3Q8SB 3NNHA 1IJEB 1K0TA 4Y3CA 4MKYA 1LNQA 2ZH2A 1HNIA 4ZCLA 3DU5A 3KJQB 4DN0A 4RUCA 3IS9A 4K4TA 3N4WA 2KO1A 4U96A 4KGKA 1FA0A 1UW4A 3SZ2A 5D77A 2OPQA 1GAOA 4CLLA 3GYXB 2WW8A 3ISZA 5F3ZA 2V8DA 2AT1B 3IBFB 4QIFA 3HSJA 3A3NB 3WQPA 2E7VA 3BYRA 2CPXA 2KL8A 4A8OA 2W9AA 3KG4A 2GAGC 3SYZA 1T05B 3FRYA 5K8NA 4QQBA 4C7QA 1RHKB 4TYAA 1GXLA 2W4CA 2XCPA 1HNVB 4O4RA 2G0CA 4DDFA 2RIJA 4ZJLA 1TFWA 1P9YA 1RT3A 1YK9A 3PHEA 4WIQA 4FYVB 3QRQA 1V3SA 1TK8A 3TA0A 3PYGA 2DNOA 2UUAJ 1Q8KA 1NXIA 2ZOMA 1HWLA 4C48A 1EARA 2L48A 4UUXA 5HQLA 2AEFA 4AUKA 3HVWA 4HR2A 3LP1A 1X9MA 5ETMA 3ADAC 1CG2A 3EE3A 1VQ9S 1FJEB 2XYHB 4QPXA 4DPWA 3WC2A 2XMTA 5L1JA 3MM7A 2KHCA 1MLAA 1XNQF 1Q7LB 4V19X 1U48A 2LXIA 2B9EA 5KFTA 1JLGA 2AGPA 3I6PA 3MGJA 3ZC4A 5L39A 1S10A 2ROEA 3ONQA 4HACA 2KB2A 3PHTA 1C1BA 2IYGA 4U67Q 4I68A 3VAGA 3MPYA 3PCOB 1UWBB 4F2RA 3WC0A 2CDQA 1M5PC 1N5SA 3EJMA 4F67A 4ALZA 4C6AA 1YBAA 4OI2A 3OV7A 1U1OA 2VQEF 4DSEA 3A3OB 2HYIB 1WJ9A 1FWKA 2XLIA 2C2KB 1U0SA 1ICEB 4RW4A 2FD2A 4M63A 3PXGa 1N0VC 3E01B 2DPIA 2IA6A 1XBWA 4QU6A 4HYKA 3JYTA 2LEAA 1DTQA 5C2CA 1NJXA 1RUSA 3I31A 4Y65A 4C8KA 2GC8A 1T03B 2VODA 4YFUA 1RAFB 3OT9A 4WZMA 4DR5J 5AE3A 1JNRB 3AODA 3QGGA 2YQ1A 2V6AA 4B3OB 3L4BC 3T5LA 1EP4A 3EDRB 4WK1A 1NB7A 2D3OR 3D4JA 2VZ9A 5IC6B 2J8AA 2MPUA 3QSYB 4ECUA 4M5GA 4V19J 2JRSA 5J2NB 1SV5B 1FRHA 3R6LB 4ZVGA 1CBKA 4RJVA 2W7AA 4JOUA 5KT6A 3AOBA 5ETNA 4DG1A 2ZZNA 1Q5VA 1M0SA 1R3NA 2ZC3A 3MD3A 1Q79A 4AL6A 4DV5J 4ZLPA 1U47A 1MSWD 1BHNA 4OI4A 3G96A 2XBPA 3THPA 2KRRA 3TAMB 3QLHA 2ZJQQ 3GP9A 5E3RA 3BDPA 5HROB 4X4RA 5DRKA 1RBLA 4V1Ak 4WXWA 4BC9A 2QA4G 3ZTPA 4K8RA 1BUXA 2CZVC 4Q5VA 1YBUA 4J9MA 4FF3A 4E98A 3FEZA 1DZ5A 4F3OA 2AHOB 4HHUA 3A13A 3NGKA 1S9GA 5KFJA 2RF2A 4IG3A 2GQCA 5KFPA 4ZLJA 2CQDA 3VZHA 4LQ9A 3HKWA 2CJXB 2ZH4A 3CIMA 1JLBB 3MDFA 1RAAB 3R6GB 1RSCA 1IJFB 5LSOA 1LWFB 3AD9C 3ILLA 3NL0A 1DRZA 4LIWA 3SSQA 2LQ8A 5KT7A 1VC6A 4J9LA 2BA9A 8ATCB 5J2QB 5H1SV 3PKMA 1PYTA 2YWEA 3U02A 4EFAC 5F9NA 2R8GA 2UU9F 3MURP 5LXYA 2FHMA 2HIQA 1FI4A 4DWIA 2RDJA 2ERRA 2X7IA 1C2PA 1R27B 1YJNS 2HFVA 2LQBA 4TY8B 3C15A 1G2EA 5D8HB 3UD4P 2IVMA 4FDFA 3BBFA 2XB2D 1VK3A 1ZA1B 1IKYA 2DK2A 3LGMA 2W7OA 3CUNA 1XNQJ 5F0UA 3J81j 3J80U 5KT5A 2I5JB 4UY8T 1NSKL 4DCOB 2YNFB 1Y0HA 3NY0A 1IVZA 4QOTA 5FD1A 5EWGA 2MKCA 4FF1A 3J7YU 2CQBA 2AGQA 2LYVA 5AXMA 2MJUA 2GX8A 4JV0A 5HI7A 3DHXA 1S48A 3TA1A 1YJWS 4ZPAA 3NCPA 1HBUA 2Q79A 4KIAA 1WC4A 4DL3A 3CTRA 1AB8A 2BJ7A 2FGCA 4TLRA 5DLFA 4WFNQ 1JNZB 3D0IE 2VQEJ 3U1MA 5DDQC 1ELOA 2E9RX 1RTDB 1RKIA 4UQTA 1T9YA 5LSRA 4ERDA 4O3SA 2UV8G 4URSA 1E6YA 4MIWA 4O44B 1M5VC 2JC1A 3GV5B 3PEHA 1P6TA 3QATA 3OHAA 1AXQA 3M32B 2KI2A 5K5MA 4WTYA 1FFSB 3IC1A 5ADZA 5GMEA 3KHHA 3EPIA 3D9BA 5CQGA 2W4PA 3GIJA 1S1VA 3HHLC 1R0AB 2HKEA 4UTGA 3I0RA 4RW9B 1LFWA 2QEXS 4LSZB 1P1LA 1JXEA 2YX7A 2DB1A 3QIDA 4JI4F 2GVDB 4G65A 2KHDA 2DHGA 1U49A 3NLCA 3VGVA 2ZHAA 1S9EB 2B0GA 3HHDA 1C0UB 3AB4B 3QWPA 4P73A 4ZHRA 3IO1A 4ZVEA 2FTRA 4G3IA 2R2UA 4IO9Q 2KRBA 1PBUA 3HCXA 4GRSA 4EYIB 4MMOA 4WKRA 2KJVA 5C42B 1NK6A 3PIPQ 1HD0A 1CJUB 3BO4A 2PDAA 3ETMA 4DFMA 4TLQA 3H8YA 1DQ9A 1R8HA 1IWGA 2P9GA 3DRPB 4KHRA 3OTOF 1VYAA 1K44A 4FNHA 4OZLA 3QFWA 4LUBA 4CWBA 3SV3A 3CJSA 1QAIA 2ROPA 4AYBD 5DQGA 5KFKA 3NKYA 1AROP 4KPCA 2JDJA 1S49A 4ELUA 1LWCB 4JI3F 4W4MA 3UPFA 2BACA 3W9HA 2Q6BA 2WOMA 1RKJA 3MEEB 5KG4A 4EGLA 4FP9A 3LP0A 3EWGA 1R0CB 3A8EA 3IAS9 2ZH5A 3BZQA 2WCXA 1C4CA 5E3AA 4KGXB 2XYPB 2GV1A 5B0BA 2HHSA 3R7BB 4LF6F 2YX4A 2EFGA 5JXSA 3G8SA 1TMMA 4H4KA 4FXDA 1HPZA 2B5JB 4LBIA 4J37A 2H5JB 3GLJA 4HI2A 3GONA 3QJPA 1U26A 4O4GB 1N5VA 3C6UB 1RACB 4J5OA 2I6WA 3CWJA 2UUCF 2VG6A 3W2WA 5JVGQ 3MEKA 4DQPA 4ECYA 1HYSA 3K17A 2HNZB 4EEYA 3KLGB 2BANB 1Q8IA 3EVMA 4I2PB 2XCAA 2IRYA 2YKMA 2C22A 2QX0A 3R2CJ 4RUAA 2X51A 3SIPB 3UDLA 1HWIA 5MAOA 2UUBJ 1LXNA 1S6UA 2EK6A 2FZGB 4ECVA 3KK3A 2ZE2B 4C3KA 1MU2B 4J7CA 2BRKA 1RYSA 4RBVA 2I0XA 2GNKA 1YVFA 3DOKA 1JXVA 3F44A 1S6QB 2HRUA 2DNRA 4ZJQA 1FWLA 5A6PA 1DURA 1TL3B 4J9PA 7FD1A 3W3SA 1YTYA 3UCZP 1N4LA 5F8JA 2R7QA 3TUJC 4ECWA 4LR7A 3UW1A 5J2PB 4HHJA 2ZC4A 3OL7A 2HS3A 1EJ7L 1UVMA 3UVJB 2D3O1 2V2QA 1NSAA 3T41A 3G8QA 1QTMA 3AB2B 4FKYA 1TV6B 4F3QA 1ROFA 4QR0A 3AQOA 4IR1A 4AE5A 1RP5A 2Y8WA 2E5LF 3NS6A 3BN4A 2XMAA 3UQSA 4DS5A 2I9SA 2OTLS 4A48A 3G6YA 5D4PA 2DR7A 1F2HA 1F6TA 3DLHA 2MQNA 3CMQA 2QLBB 3R9LA 2V8GA 2KZMA 3CD7A 4J9SA 4PRFA 3LPEA 4OIXA 3ENAA 4NLTA 1MROB 5HP1B 1AW0A 4YB5A 5D78A 3I5BA 5ETSA 4A8QA 4R25A 2C3YA 3DRRA 1FJGJ 3DLGA 4JI4J 4DR2F 4JP8A 1HQUA 8AT1B 3OR2B 1YQHA 4ZP9A 2LECA 4NCGB 2PFFB 4DCJB 4QZVB 3BO2A 1HHTP 3DRXA 2XEXA 3DI6A 1TZ0A 2BUNA 1RT7B 3SXLA 5KFOA 3ZFVA 3GWCA 4PWDA 5G0RB 1J5EF 3BF4A 1C4AA 1LEOA 3QT7A 1FKPB 3MECA 3TUPA 1SJQA 2I38A 1Z4UA 2CIMA 3IR6B 1UEVA 3OTOJ 5E7OB 3SQGA 4RW7B 1X4GA 2ZM6F 1N8RT 2OPRB 1YDLA 2KFZA 4ZP8A 3UDVA 1Q95G 3TI0A 3MF5A 3I87A 2FJDB 3CMAS 4W92B 4ED8A 1NPRA 4JI3J 3CEDA 2BKPA 5T14A 1WTFA 1WG5A 1ZAVA 3AHPA 5J1EA 3H2LA 5IC4B 1HMVB 4O0NA 3GIIA 3VAHA 1IQZA 4ETXA 2QFIA 3C19A 3VGTA 2E44A 3MEDA 1PAEX 4FYYB 2GGPB 3GR1A 4QJVA 3AT1B 5IT4A 2AYMA 2W2OP 4H4MB 3POTB 2MLYA 3I82A 3CJRA 3DOLB 2XSJA 4CCHA 4NI2A 4OYWA 2PC6A 4N47A 2ZBCA 4I6AA 5A76A 5F8GA 1FXLA 3OBIA 3LW5C 3TVYA 1VBZA 2O67A 1BQMA 3IA0A 1NJYA 2OEKA 4EO6A 3N5FA 3M8ZA 1SXLA 1RTIB 1FF2A 1O0PA 4A46A 3IM8A 4Z7YA 5D0RA 1S1XA 3GYNA 4R5PA 2R7VA 4NLSA 2QMXA 2WBMA 5IOLA 2LVWA 4YP3A 1RHJB 4LF7F 4DV6F 1FEEA 3OUYA 1VISA 1KHVA 3OL6A 3BGLA 2APOA 3VAMA 1WKKA 3FCWA 4Y2MA 3CCMS 4OI0A 3KUGA 2G4BA 1ZTTA 4CLTA 4IUFA 5K20B 1YITS 3CCLS 5I42A 4B3RF 1N52B 1LXJA 2RT3A 1QTNB 1KQFB 5FDLA 1UA0A 2V5HG 4TNOA 4Q2MA 1MWZA 2VC1A 3ZZYA 3LTOA 4IFVA 1CS4A 3OXGA 1RAEB 1SKSA 4PUOA 3D2WA 4WYLA 4W98A 5GMDA 3VAKA 3TNVA 2FJVA 1R6VA 2I8EA 3KK2B 2BKNA 4USHA 1RT4A 1FFWB 4TVAB 2RKIB 2DHXA 3ZXWA 3DLLQ 4DS4A 2VUGA 2HWIA 2B4UA 4TU9A 2KN4A 3H0PA 3OVBA 2ZWOA 4WP3A 5HBMA 4DZ6A 4JBCA 1RT1B 5IXUA 4PYAA 4RU9A 1OMSA 2QTWA 2Y3YA 4HDHA 2VKZG 4F8RA 1CJKB 2KVIA 3GYGA 2BM0A 4LRFA 2IDLA 2JH3A 3V6DA 3QO9A 4DV1J 4ER8A 3T9NA 3K5LA 1N6QA 2Y1JA 3GV8B 2C2OB 3BH7B 1GMVA 4CTAB 2EC0A 1U1RA 3MMBA 5HVFA 3OLAA 2YX1A 2DEJA 5D0GA 1YZ6A 4DR2J 1PG5B 3F56A 4HDGA 4JUZA 2QFJA 3PJ9A 4CNYA 4LFAF 2ZH8A 1JLAA 2G1HA 2R8JA 1SIZA 3O5TB 3QT5A 1F5AA 1TL1A 3QQCD 3EVWA 1W2BR 2JLFA 3MXHP 5A2QY 2FVRA 5B0GA 3D0GE 2XMJA 1J5EJ 4DQQA 3QMQA 3N9UC 1TMJA 4KKOA 3BQ2A 2IJFA 2Q43A 3A8JA 1V3ZA 1A9NB 2ZOFA 2ZM6J 2RRAA 3QAUA 2R8KA 2L9DA 2L08A 2MGZB 3PO4A 3IAM9 4IRKA 4KFBA 1PYSB 1B70B 1S0MA 2MKKA 1YSJA 1XMOF 4GVBB 3P5BP 2BR0A 3R5JB 2MB0B 5AE1A 4G1QB 2Q6CA 1TTHB 3RJMB 3KUEA 1Q16B 2R2RA 5GADU 2IMOA 1RT6B 1VLYA 2AMCB 3I0SB 3FNNA 3IBCB 2F9DA 3TQEA 2P5VA 4WF9Q 3IRXB 3BH6B 3KOAA 5KFCA 3SBMA 2UZAA 1KVIA 3P6YC 1T05A 2G1DA 1LV5A 4MK7A 1HNVA 5I4MA 4XPEA 2MZ1A 3X1LB 2R2TA 4LF7J 4DV6J 2VBZA 4C0OC 3W65A 1XWLA 4OYOA 3TR5A 4DJBA 4RW8A 1RBOB 2RS8A 2PO4A 4PKDB 3HX9A 6FD1A 4JI7F 2BW2A 1T95A 1SQGA 4DX5A 2AJ2A 4PG5A 2NLWA 1VQ7S 1HW9A 3V6JA 4B3RJ 3MWBA 1FVQA 5KG6A 3UN3A 2BQUA 2NZ4A 4KT0C 3FC9A 4OX9F 4B9SA 1FNOA 3FRZA 4QR1A 4NEYA 3MHYA 1RAJA 2AU0A 1D8YA 1MMLA 2DGQA 1MW7A 2KXFA 4F25A 3KLEA 4L74A 2AJ1A 5I3PA 2COLA 1NMEB 3F73A 2E5IA 3Q2SC 2AJQA 4ECXA 1U8SA 7AT1B 3AD8C 3QGIA 4OHYA 1UEKA 3BPSP 1RCXB 2V4RA 1U6ZA 3SSRA
chains in the Genus database with same CATH topology
2VC0A 4RX6A 2NUUG 3B8HA 1P1TA 3GB0A 3OHBA 3MFHA 3PIOQ 4K4YA 4DR3F 4RKUC 4LFBF 1UWBA 3NG8A 2ALZA 4MIBA 2LU1A 2V4JB 5D6GA 2EFQA 4RWWA 1VS3A 4B3MF 2R9LA 3T5KA 3FEYB 3MR3A 1S77D 2J9EA 1WF0A 4TY9A 3PW4A 4LVOP 2BRLA 1U1QA 5HN0A 4O3RA 3RAQA 2V0NA 2W4DA 5KG2A 2J0WA 2DO0A 2QT7A 3CJ2A 2KH9A 4DL4A 2KT2A 1FDNA 1BQNA 3CJKB 3BJYA 2HWTA 3MUVP 4DV3F 1UL3A 5LJ3Y 4DR4F 3HVAA 5J2MA 3DM2A 3I56S 2C42A 4OZJA 3CD0A 4URQU 4FXVA 4ES3A 3MCSA 4B9UA 4NRTA 2MKJA 1S0NA 3S1TA 5BJRA 4IH7A 4IQXA 1RA6A 1RT2B 2QMWA 4GO7X 4C0HA 1BGXT 5CCLA 1BC6A 4PG7A 3V6DB 1VRTA 4NRUA 1VOMA 3QO9B 4CT8A 2UUBF 2O5DA 2UVUA 2D9PA 4L72B 4Q8EA 3TX8A 1UVLA 5M2RA 2QA2A 3RYLA 5KFAA 2CKWA 3E01A 5KFBA 1N6QB 5CXTA 2VBYA 3PJXA 2G9OA 4ZKAA 1HWUA 4PR6A 1H2TZ 2PEHA 3BGRA 3PVXA 3H5SA 3RBDA 2DNPA 5A8WA 4NLDA 3SDEA 4KC5A 5A8KA 3PV8A 2N4CA 1VRUB 3MM7B 1JLQB 4IG0B 4U6PA 3NMRA 4MFBA 2BXJA 5KG0A 5EWEA 2MXYA 3M8SA 1T03A 2N82B 3NAIA 4KR0B 3H4BA 4DR5F 2QZ8A 4B9NA 1WNEA 3H20A 3MMBB 3MPWA 1Y5NB 2F8HA 5JUMA 3TYTA 3PW7A 4XO0A 2ADBA 4EWTA 2CYYA 2EK1A 1L3VA 2RUGA 3EYZA 1EETB 4ZP7A 3US5A 4DSFA 3N5BA 1R8BA 1DLOA 5F0WA 2JWNA 5AXLA 2LEPA 1H6KX 1RK8A 1U24A 1T3NA 1JLAB 5CCMA 2VA2A 4ZPCA 3L09A 1WI6A 5I3QA 2E1MC 2YNHA 1TL4A 1NK5A 2IM1A 2D7SA 2F40A 1TL1B 3R1HA 1URNA 3Q8QB 1W2IA 2OPSA 3BEGB 1NNDA 1KC8T 5DGBA 2LXFA 5DG7A 4B3OA 4K5RA 2J0XA 3M8QA 1JJHA 2WK4A 1ZETA 3ITHA 3N79A 1FNMA 2FC8A 2EFVA 4CO1A 5CYJA 4LJMA 1I6JA 4WK3A 1UETA 2LLZA 4I6WA 2H5EA 3MMAB 2HFOA 1VJWA 2OO4A 3LAKA 5J1NA 1HQEB 1VQ6S 1GX5A 2X1BA 3CJ4A 1RJJA 3OR1B 4X4SA 2DCUB 2CQ0A 5KAKA 2EFOA 4DLEA 2OMLA 3KJVB 4ZP6A 1Z2ZA 2KXHA 4CNZA 4PG4A 2XMUA 3T19A 4FVMA 1SH3A 3KHGA 4C0BA 2L9WA 3KLFB 5F9LA 2ATLA 4KKOB 3M2RA 2JFDA 4ED3A 5J2NA 4ED1A 1SV5A 3I4HX 1CVJA 2DNQA 4CO3A 5LMUF 1WG1A 2B3TB 2CPDA 2V9KA 2MSTA 3GIMA 5AE2A 2VBXA 3LAMA 3UD3P 3C3LA 3G6XA 4NLUA 2W25A 2EBEA 5KFSA 4B17A 1V3RA 4ID8A 2OKQA 3HVTA 1M5HA 1TK5A 1RTHA 1RT5A 2LU2A 4FF2A 4CO4A 4Q44A 4HLBA 3SFGA 4TXSA 1NEEA 4E0DA 4DFPA 5KFUA 1VQPS 3U1LA 3M8PA 4IOBA 3B4DA 2XS7A 2E1RA 3UCUP 4DPOA 2ZHBA 2BV3A 3G6VA 2YNIA 2W9BA 1TKXB 4I6YA 1FT8A 1ZTWA 4F4YA 1UVNA 1HNZF 1YRUA 2OFHX 3EPGA 2IBOA 3AA9A 4M8LA 3MMCA 2K1RB 4NA1A 5HLFA 2A3JA 2ZUGA 2LKZA 5LL6d 4G1PA 3Q8SB 2XLJA 3R5BA 1YJUA 1U45A 3NNHA 2EWHA 2IM0A 1SL2A 4OI6A 2E9ZA 4U7UK 1IJEB 2CFXA 4LSNA 2AJ0A 2POKA 1K0TA 2V8VA 4Y3CA 3PKYA 4MKYA 2X3GA 2ZH2A 1D3WA 2GFFA 2AQ4A 3TAMA 1N36F 1HNWF 4ED0A 1K1SA 1HNIA 3Q2TC 3MPVA 2FB0A 1JLEB 3TARA 4TKTA 4K4XA 4ZCLA 3DU5A 5HROA 1ULRA 1KN6A 2MMYA 3K57A 1WEYA 3GFHA 4F50A 3NNCA 2NSCA 3VQTA 2AWZA 4DN0A 3CMES 4RUCA 1JKHA 2LXUA 3IS9A 5KG3A 3LALA 2R8GA 4K4TA 1SJFA 3N4WA 1ZPWX 2KO1A 4CH0S 3M1VB 1GNKA 1DTTB 1WI8A 5KOWA 1Q82T 4KGKA 1IR0A 3DNCA 1IKWB 1V9OA 3FFIA 1FA0A 1UW4A 3SZ2A 2Q66A 5D77A 5L1LA 2OPQA 3Q24A 1GAOA 3ZZOA 3GYXB 2WW8A 3ISZA 4DL0C 5F3ZA 2V8DA 3K8VA 1FJGF 1YJTA 1SUQA 2RQ4A 3M2UB 4QIFA 4WFBQ 5GAHU 4OJHA 3M6UA 2KM8C 2DNGA 4B02A 2ZVSA 2KFYA 3BSCA 3LANA 1U1PA 1NK0A 4YB7A 4ES2A 2K2PA 4JI2F 2CPXA 4A8OA 2W9AA 1HD1A 3DCAA 3MUMP 1N0UA 3KG4A 2ZDOA 1AFJA 5T7LB 3PR4A 3SYZA 1Y5IB 5D3GB 1T05B 3FRYA 2M0GB 2ADCA 2X1FA 4A8XA 4QQBA 5K8NA 2RILA 4C7QA 4TYAA 5E3PA 3RR7A 2F8EX 1GXLA 2W4CA 2XCPA 4DMZA 1GTEA 1HNVB 1PC4A 4O4RA 4WE1B 2G0CA 2V4JA 3F41A 3PEJA 4DDFA 2RIJA 2W9CA 5CYQA 1LWFA 1TFWA 3G6ES 3C6TA 4NX9A 1RT3A 1OSCA 4ZOSA 5A8RB 3PRDA 4FXWA 4QWEA 4F3MA 1VGYA 3PHEA 4NWBA 5FJ4A 1IKVB 5HL7Q 2B9YA 4MK9A 2HLTA 4OHXA 1OS5A 1V3SA 4L6V3 1TK8A 3TA0A 1VQ8S 3PACA 2DNOA 1UAWA 4ED7A 2ZOMA 1HWLA 2KJWA 4F02A 5J2QA 2D74B 2I1RA 3GFYA 2L48A 3IGVA 3L3CA 4UUXA 2OAUA 1WF2A 1S7HA 2ZD1B 3ULHA 3HVWA 3TVZA 4AUKA 4X4QA 3PW2A 1L5UA 3UE2A 3DLBA 2Y1IA 3LOUA 1JLCB 2NSBA 1U09A 3UCGA 4KO0A 3V4IA 3LP1A 1DQ8A 2F4VF 5IT0A 1X4CA 1X9MA 4C4WA 2EFPA 4C8ZA 5L9NA 2PMHA 2GA7A 1NKEA 4D3HA 1CG2A 2H9ZA 2JZ5A 1VQ9S 1FJEB 4QPXA 1NHUA 4TY8A 1SBRA 3WC2A 2XMTA 1Z2LA 5L1JA 4A47A 1D1UA 3MM7A 6FDRA 2VOOA 2BABA 3O8WA 3CJ5A 1QAJA 5KT2A 2Z4PA 3VQSA 2KHCA 1KFDA 3OLBA 3PFOA 4R8UB 4ICLA 1MMNA 1XNQF 3TOQA 1KD1T 5EX3A 4FS2A 1Q7LB 4IYQA 2WSFC 2CPEA 2GHPA 3NBPB 4V19X 1U48A 2GHVC 3KFWX 3K2YA 3NCRA 3V5RA 2MQQA 1Q7YT 1K1QA 2LMIA 2LXIA 5HMXA 1H7WA 1PILA 5KFTA 5ITHA 4PCQA 4IRCA 3KKFA 2WTFA 1JLGA 2RMLA 2E1CA 3VZIA 5HMWA 1DFDA 2AGPA 1P27B 3BSNA 2A10A 3I6PA 4H54A 2YNFA 4W90B 1J2VA 1DBDA 3MUTP 1WEZA 4QW8A 1LW0A 2DO4A 3MGJA 4IKAA 4AXJA 2ZJPQ 1I94F 3BS9A 3ZC4A 1DARA 4KQZA 3KNAA 3HHLB 5L39A 2BVZA 1S10A 1S79A 4ZPTR 1JWWA 2DTJA 2MDAA 1CQMA 2ROEA 3ONQA 2AGOA 5DQHA 1XR5A 3BQ1A 2XY6A 2KB2A 1HQEA 1C1BA 2IYGA 1GT8A 4U67Q 2FGOA 2VD3A 4I68A 5F8LA 2FVQA 3VAGA 3BSOA 4N41A 1O5JA 4N77A 3EX7B 3MPYA 3AA8A 3L95X 1UWBB 3RB6A 4F2RA 3WC0A 2CDQA 4ZDNA 1M5PC 4QWDA 4WIIA 1N5SA 2VFSA 3OJSA 2CQ2A 1N32F 3O2IA 4RNHA 4F67A 1K8AT 1WEXA 3R5CA 4ALZA 1YBAA 3M05A 2YVSA 4OI2A 4RZRA 3OV7A 1U1OA 3GIKA 5I3UA 2M8DB 2KU7A 1BQNB 4OLPA 3T6BA 2VQEF 3R1LA 4J9OA 4X66F 4DSEA 2HYIB 5J2MB 3DM2B 1JIHA 2XLIA 4F4XA 5KG5A 2AW0A 2HGMA 2YQ3A 4MTPA 3PDNA 5CHCB 1RTDA 1S6OA 1TKXA 4RW4A 1VRTB 4O3NA 4B3TF 2AJ4A 1LQ9A 2FD2A 2MJNA 4LFCF 4M63A 3PXGa 1N0VC 3KTQA 4O44A 4QWCA 3E01B 4OHWA 2DPIA 1Y9OA 3HPOA 2W8LA 1XBWA 1X5PA 2IA6A 1Y3KA 4QU6A 2FHJD 3IWXA 2GIRA 3BGRB 4M95A 4HYKA 1HL6A 3JYTA 1GX6A 2LEAA 1SL1A 1DTQA 4LVNP 5A8WB 3SDEB 5A8KB 2FVPA 4E8UA 1NJXA 3L7OA 3M32A 3N0VA 3Q23A 2NYIA 2EVZA 3I31A 4Y65A 4C8KA 4MFBB 2GC8A 1VQYA 3E51A 1SKWA 1T03B 3PJWA 2DGWA 3KWMA 1G6BA 5F3TA 2UVVA 2VODA 2MHEA 3CCTA 4YFUA 3OFEA 3GFZA 4FPRA 2FLLA 4WZMA 4DFKA 3JSYA 2DNKA 5DDOC 1PO6A 1KOHA 1J5OB 2HQIA 2B56A 5IT9Y 1U2FA 2D3ZA 5L9XA 4FN5A 2C2DA 4F26A 3IBWA 1R0AA 4QIGA 4GMKA 3NGDA 1DLOB 2ZDPA 4ID5A 4ELTA 2RQKA 3TVKA 1K73T 3NCQA 4JV2A 2GW8A 3IRWP 3DMJA 2FDNA 5AE3A 1JNRB 1S4FA 2HMIA 2R4FA 2YNHB 3QGGA 1XTZA 4RW9A 3RB0A 4ZVFA 3T1HF 3KYLA 1M1KT 2MYFA 3K7RA 1T94A 4QWBA 1R8PA 2RRBA 4B3OB 5LJ5Y 2N7CA 2A1BA 1FHTA 3M8QB 3T5LA 1EP4A 1X4DA 4WK1A 1NB7A 4B9MA 2E29A 3ITHB 1FESA 4CI0B 2D3OR 3RU0A 3Q0AA 3O3LA 2RDIA 2RS2A 1U2RA 2VZ9A 4DLGA 2J8AA 3QYYA 1GH8A 2MPUA 4P7VA 3L7PA 4ECUA 1WG4A 4TYBA 4MKAA 4NOHA 1C0UA 3CCES 3U27A 1GXTA 1UJ6A 3OL8A 2FLNA 4A8FA 4V19J 2JRSA 3IG1A 1X4AA 3C66A 5J2NB 1SV5B 2JVOA 1FKAF 2KYZA 2RE1A 1SI9A 2RQCA 2IHR1 4ECSA 1S72S 2I2YA 1SJRA 1U4BA 2FVSA 3RR8A 2NPIA 4FNIA 1FRHA 4X62F 4L3NA 1QSSA 1Q53A 2DNLA 3HVTB 1SJ4P 1RTHB 4GO5X 4HVZA 1RT5B 4ZVGA 5GAGI 2W7PA 4WJBA 3G9CA 2GQ2A 1MWYA 2W7AA 4JOUA 1B0PA 3UR0A 1WTBA 4J9KA 2XWXA 5KT6A 3MTKA 3M8PB 3A1YG 4KSEB 4C8NA 5C42A 1Q86T 3THTA 2YNIB 4OV1A 3ETOA 1N5YA 2A2CA 1KHWA 4DG1A 2ZZNA 3B4MA 2KKHA 4JI5F 2OMOA 3MMCB 2DJWA 1E6YB 3K58A 5HLFB 4CO5A 3TW0A 2R8HA 1M0SA 1R3NA 2ZC3A 1X7VA 1Q79A 3MD3A 4CH1A 4AL6A 1ZYQA 1W25A 4ZLPA 1SC6A 3SFUA 2ZD1A 1U47A 3QJLA 4OMFG 1DHMA 2R8IA 1MSWD 3AJ2A 1WHXA 4LSNB 4BC7A 2Z8QA 3ENQA 4OI4A 1NH8A 3G96A 3CCZA 2XBPA 3THPA 1N34F 2CJKA 5L1KA 2KRRA 3KLHA 3LWLA 1LWCA 4MAKA 2LDYA 3TAMB 2ZH6A 5AXKA 3QLHA 1HNIB 5CD4H 2XMKA 2HVIA 4CH7A 2ZJQQ 5E3RA 5KFZA 4TQRA 3BDPA 5HROB 3CD6S 4X4RA 3JSRA 3KNGA 4RUHA 4I69A 1HI0P 5DRKA 3I9ZA 1QJHA 2R7OA 3MEEA 4WXWA 1K0VA 4DV1F 1KRPA 4BC9A 2PGCA 1S9FA 3MAQA 1JKHB 3IS9B 3RZAA 2AP6A 2QA4G 1NK8A 2DH8A 5B0FA 3JSBA 1CSJA 3AH6A 3PW0A 4IO1A 2CZVC 4IQMA 4Q5VA 4ZK7M 3FFIB 4Y28C 3DRSA 4J9MA 4NLQA 4FF3A 2OPQB 4E98A 3FEZA 2R2SA 3CCWA 1DZ5A 4ECZA 4F3OA 4Y2KA 1ZH5A 1OSDA 3NGKA 4F4WA 1S9GA 2JFKA 3DLKA 5KFJA 5KFNA 2RF2A 2IVYA 4ILRA 4IG3A 5F8HA 2GQCA 5KFPA 5KFLA 2LEBA 2CQDA 3VZHA 4USIA 1Z1ZA 5L8RC 3MEGA 4NCAA 1OQ3A 3KMSA 1JXLA 2HFZA 2M8HA 4I2QA 4LQ9A 2K7KA 2CPYA 2XHWA 1XMQF 2XMMA 1KS2A 4YMEA 5B09A 2B5JA 1H38A 2NQPA 1R43A 3HKWA 2DGVA 1HBMA 3B82A 3BM7A 5D4OA 4TU7A 3DU6A 3K59A 4Q2LA 3T1AA 2ZH4A 3CIMA 4MYTA 3ZZZA 3UWTA 1JLBB 3MDFA 2B51A 5HMYA 1S1UA 1U7LA 3C6UA 1IJFB 1NKBA 2FLPA 2VFTA 5LSOA 3OVAA 5C24A 2W9CB 5CYQB 1LWFB 1NAQA 1B7FA 1QAYA 1ZM4A 1Q8LA 2V2KA 3C6TB 1RT3B 3NL0A 1DRZA 2MZSA 2C3MA 2RU9A 4OLOA 4LIWA 1H98A 2DR8A 2JHEA 4NYZA 3SSQA 2HNZA 5KT7A 4M1KA 4OX7A 1VC6A 5IZHA 4J9LA 3GR0A 2BM1A 3RB3A 1QE1A 1HA1A 2BA9A 3KLGA 5J2QB 4DQIA 5H1SV 2BANA 3PKMA 2CQ4A 2YWEA 3U02A 4EFAC 5F9NA 1TK0A 4I2PA 4FBTA 4PG8A 5DM6Q 1FCAA 3DLJA 1CQNA 2DGOA 3JTPA 3I55S 1F5BA 2WB1D 3D54A 3MURP 5KFDA 2UU9F 5LXYA 4KO0B 3PRBA 5DJBA 3V4IB 2FHMA 1KOOA 3LP1B 1Y5LB 1UP1A 2L9NA 1R31A 2HIQA 2HS0A 2MY8A 4OI3A 4DWIA 2RDJA 2ERRA 1HR0F 1C2PA 1IKXA 2CPJA 5IWAF 5J1PA 1R27B 1YJNS 4X2BA 4OHVA 2LQBA 5D4NA 4TY8B 3UI3A 1N5TA 3RW6A 1JJ2R 4BS2A 1TUVA 4IFYA 1G2EA 3LH2S 5D8HB 4KRWA 3UD4P 3G4SS 2IVMA 1VC5A 4G6VB 1N33F 2ZH3A 2M70A 3NP5A 4ICLB 2VB6A 2JVRA 2CQ1A 2XB2D 2VPXB 1VK3A 4RW6A 1MU2A 3LQVA 2U2FA 3HVRA 1IKYA 2DK2A 3LGMA 4EBDA 1HNXF 1X5OA 4FBUA 2W7OA 3NWGA 4Q7AA 3E2EA 2GIQA 3CUNA 1J5OA 4C97A 5F0UA 2WHOA 1BY9A 4NLVA 4NLPA 4YQWA 1S6QA 1JLGB 3V81