5M2UA

The structure of the ycf54 protein from synechocystis sp. pcc6803
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
106
Chain Sequence
MATYYYALASQKFLLEEEPFEEVLKERRRDYGEKNKEIDFWQVIQPAFLNAPELAEAKAKAPEKNVAIVSTNKSFIVWVKLALEYVLTGEFEAPSDAIPDPLASLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved residues in Ycf54 are required for protochlorophyllide formation in Synechocystis sp. PCC 6803.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Photosynthesis
molecule keywords Ycf54
total genus 29
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10674 Ycf54 Protein of unknown function (DUF2488)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1860 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5m2uA00
3HZEA 5M2UA 3JSRA 5M2PA 5M2RA
chains in the Genus database with same CATH superfamily
2AJ4A 3TJ9A 1XC9A 1FJEB 4JV0A 4RKUC 1WEZA 3EYZA 4LSLA 2RKIA 1QAYA 1RT1A 2M52A 3JTNA 4LF1A 4I67A 3CEDA 4PXCA 4DLEA 3V6DB 2VDIA 2ZVSA 3KMSA 3QT7A 4ZPBA 3PIOQ 1S48A 1X9WA 1N36J 3MMBA 3QJPA 3HD2A 3KK1A 4WTYA 1Y4ZB 4KGXB 1LW2B 1HMVB 2HQFA 2ASYA 4NXNJ 4PPDA 2V67A 5HP1B 3AFGA 1WC0A 2B9EA 2IDEA 2BM0A 5HATA 2DNHA 5GADU 4H4MB 4PABA 2E5IA 1WOSA 3C14A 1KQKA 2F3JA 2Y1JA 1NJWA 3PRVA 2E9TA 3H5SA 5K20B 1UVJA 3J80U 5I3UB 2DB1A 4HLBA 4UQTA 2EI5A 3KHLA 4JV1A 2P9CA 4MK8A 4E2FB 3SV3A 3CCRS 4TKTA 1T9TA 1G4CA 3ADAC 2GW8A 2G4BA 4ZVEA 3H4DA 3MUTP 1OYDA 2GIRA 3IRXA 1CJUB 4H4KA 2CQ1A 5GADI 1DLOB 1KVJA 3OVBA 1KDNA 1QUPA 1RHRB 2FVRA 4WBFA 2DXDA 2JWNA 4CLLA 1FEHA 2H51B 2M2BA 2V2ZA 4KO0B 4M5DA 5K14B 3BZQA 3FSYA 4S0MA 4JI2F 2J0QD 3QJLA 2YNGB 5H9EK 4YS2A 3RAMA 2IYIA 1HBOB 3FVYA 3HVRA 2XLIA 2UUCJ 2H5IB 2AJ2A 5B09A 4EBDA 1X9MA 4AL5A 3QO9B 2PN6A 2FTRA 1FRXA 2V50A 5DDPC 2JEFA 2NREA 1JJHA 1U2RA 2M5YA 5IT9U 2XLJA 4RU9A 1RISA 2XEXA 1WG1A 2EEYA 3EJMA 5HL7Q 1PYOB 3V6JA 2CJAA 3KG0A 4N8NA 4B08A 1WC1A 4F0KA 1NK0A 2DGTA 2FLNA 1D9FA 1BY9A 1VBKA 2LYVA 2RQMA 4ECTA 1GTHA 4OZ5A 1L3KA 1S1VB 1Y9OA 3E01B 2XSJB 4DR1F 4OI0A 3ZTSA 2VOPA 1PJ6A 5DGAA 1FTRA 1NAQA 4RUAA 1KLMB 3EGWB 5HVHA 3VV2B 4DLGA 2I6WA 3T6BA 1U24A 3G86A 2JX2A 1Q5VA 3Q89A 4KGVB 2PD1A 4OI2A 2RDDA 3CCES 3BSAA 3PZPA 1WC6A 2IA6A 3C6TA 4IG0A 4BWMA 4OX6A 1EKSA 2V8HA 5KFLA 4OZJA 4JYAJ 1RHKB 4G6VB 1KBRA 4KPYA 2C2OB 2HK3A 3HJVA 5AXLA 5AE3A 2R2TA 4DR6J 5BYQA 1AT1B 3SCLE 1WHWA 1ZOTA 2RNEA 4PQUB 3RB3A 4CDIA 1IM4A 2OPRA 3MAQA 3OVAA 3BR8A 2KJVA 1HWLA 3UN2A 2YXLA 3Q8YA 4CO1A 2NYHA 3CJ3A 1XBWA 3GSIA 3JTPA 2HRTA 4NA1A 3FGVA 5ETPA 3ZO7A 4ZN1A 5DG8A 3QBCA 4MH8A 2YH1A 4LUBA 1TKXB 1UP1A 1R8AA 1S9EB 3MR7A 5A0YB 2XULA 2FHOB 1VISA 2IIHA 3D67A 3UDEA 4CM0A 2ASDA 1UA0A 3QRRA 4K4UA 1YJVA 1S9GB 2ZOFA 5HVFA 2FJEB 1VHFA 2VFSA 4QW8A 2R9LA 2NPIA 1H7WA 1R27B 3HO1A 3R27A 3KK3A 1HQEB 4L3NA 3MD1A 1W2IA 4EWTA 5IZHA 1WF1A 2J8SA 1OS5A 2W2QP 4UOFA 4KH1B 3J81U 4ELTA 1U0HA 2LDIA 3GFHA 2FJDB 5HJYA 4JI4F 3BN7A 5K8NA 2HVHA 2DJWA 5F8LA 1X5PA 4OI3A 3Q23A 2EBGA 1M1GA 3SFGA 2GQQA 2PIIA 4ALZA 1WI8A 4F4ZA 4EFAC 5B08A 3L9ZA 3UCZP 1GXTA 2ZDOA 2FJAB 1TL5A 5KTQA 4HTIA 2DR6A 4CLZA 2HZVA 1JLCA 3JQKA 1CULB 3NGRA 2QV6A 2KDOA 1PAUB 4DL6A 5H1SV 1J27A 2AMCB 2K06A 2HEKA 3G6YA 1T03A 4JI3F 3NMAA 1X8DA 1M90T 2HVZA 1UJ4A 2R7XA 3HT0A 1YVFA 4DV2J 5KFHA 1YG0A 2H48B 3O5TB 3KYLA 1ZH5A 1S72S 2ROEA 3VGUA 1B0TA 1Q79A 1RCXB 2MQNA 3R5AA 4NYZA 3OUYB 1VBYA 2RUSA 2DNOA 5IQQA 2OAUA 5FLXY 2CPYA 4Y65A 1H38A 2HIYA 4O3QA 1B3TA 2IY5B 2FY8A 1NKBA 3KDNA 2GHPA 4WU2A 4FPIA 2ZC4A 2HWHA 3GV8B 2GJ2A 4RW8B 3P96A 5KT5A 5L1JA 4F3QA 4PRFA 4LRDA 1OQ3A 1IKVA 4DZDA 4A48A 1DQAA 2V6AA 5GAEI 3VAGA 1ZTWA 2OEMA 1JXEA 1XERA 3HFZB 2R7WA 4ILMA 2H54B 2AHOB 5AT1B 3HMJG 1XMBA 4QPTA 1F9FA 4U9RA 3F56A 5IM0A 1R8HA 1YWXA 5A76A 5F9LA 4USMA 3CCMS 4B9MA 1UVIA 1WC4A 2HS4A 3IBCB 3NOGA 2QZ8A 4K4TA 1H0HB 2L9WA 1UZHA 2ILYA 1XN9A 1LWFB 4DX5A 3HLUA 1TL3B 3HVTA 4TXSA 5LSLA 2GAHC 4YB5A 1HNZJ 1H74A 2UXCF 3MM9B 3BKTA 5I3PA 1PC5A 5DGBA 3KHGA 3QIDA 1S6PB 4R0EA 1SUQB 4D3HA 3KUGA 2W2OP 4HKQA 3FBCA 2DNLA 4O4GA 5B0AA 4NMXA 4AUKA 2HAIA 1RDRA 1XIQA 1N33F 1FVQA 1JLBA 5L38A 4PUOB 3LF0A 4LRBA 1FWKA 1TKXA 3AT1B 1JLCB 3D3CJ 2COLA 3MOJB 4DR7F 3J7ZT 2R4FA 1K9MT 4NLDA 1DLOA 4NLOA 5B0BA 4ZJOA 4AL6A 1B7FA 2QSWA 3FQKA 3W2VA 2HW3A 2GHVC 1GEHA 1MWYA 1OPZA 1K8AT 4K4XA 2PC6A 2KH9A 1OJ4A 1TZ0A 2Q1LA 2M3DA 3LP1B 3IC1A 1PG5B 1B0PA 2EXUA 2J7UA 3GB0A 1REVA 3M05A 4Y2AA 4WCEQ 3G6XA 2F40A 1TL1B 2AX0A 2CJQA 3KLEB 1X9SA 1CS4A 1U0SA 3LTOA 4QYZK 3MFHA 3O1LA 5J2QA 5I42A 3GYGA 4JOUA 2OTLS 2QL5B 2ZBQA 3EX7B 1RI7A 2LEAA 1BQXA 1ZPVA 1S1UA 2ZEJA 5K9FA 5K8PA 5L1KA 1DTQA 1PCAA 3NRBA 2W9CA 2DBBA 4ES3A 1HPZA 1UAWA 4FYVB 4NZ7A 2DNPA 5A6PA 3MR6A 4ED0A 1T03B 1WELA 5MAOA 1DTTB 2HK2A 1FA0A 4NA3A 2UV8A 1D8YA 2CZ4A 3OR1A 4EI2A 4X4OA 2K1RB 3ZNJ1 1AZSB 2F63A 1RWPB 2MZSA 1S1TA 4B3MJ 1VK8A 3R1HA 1IKWB 3MECB 2DGQA 3PRDA 4HH1A 3IRXB 4KRWA 2FHJD 3IRWP 3CMES 1RCOB 5L39A 2DGWA 4WF9Q 2XMKA 3V4IB 2MLXA 2YQ0A 1LWFA 3IFEA 3THTA 1LOUA 3TRGA 2WTFA 2HBQB 3MM9A 3FBFA 3UR3C 4DPTA 2BJ8A 3MM8B 1IBKF 3QZ7A 1GMVA 1IR1A 3RGIA 1XR5A 2IYGA 2VBZA 2RSQA 4DMZA 4J9MA 4JI2J 3HHEA 1GXUA 3DRXA 2GMHA 3E3XA 4TLQA 3H4BA 4DF4A 1S57A 2Q79A 1G2EA 3L3CA 2XG8A 1RAAB 2CVIA 4QIEA 4ANEA 3ZZZA 2MLZA 2C3OA 2HQCA 3QT6A 3U02A 4EU0A 2A1BA 4DX7A 2B4OA 5CZVA 3KHRA 2JL9A 1R0CB 3GJTB 4LRFA 4OV6A 2MSTA 2XB2D 1RQ0A 4IFVA 2YTCA 4EO6A 3D9BA 1NLKL 2PFDA 2YKMA 3I87A 4L76A 4Z7CA 1ZETA 4LSNB 1EP4A 2CJ9A 2F5GA 2MQMA 3MEDA 4YY3F 4A8XA 5HLFB 4RNMA 2K8GA 2ZD1B 3EGZA 5F9NA 3HHKA 3F41A 4BBYA 3KLGB 4C3KA 1HNXJ 2MB0B 2CNOB 2HSEB 4B9SA 2BZ2A 3DOKA 4P75A 3GV5B 4IG0B 4CLKA 5LMUF 1RT6A 2JEJA 3M8YA 3MMBB 5CYQB 1DTQB 2JFKA 4ZPTR 1IBLF 1WEYA 3B4MA 3K5LA 4DF8A 2LQBA 3QGIA 5A8RB 3CCSS 3W9HA 3H7HB 1LW0B 1VQPS 2BKNA 5KFVA 3TO8A 1CLFA 4YB1P 1QTMA 3PHEA 4C8KA 2J9DA 1BQMB 2IA0A 2U2FA 3DRRA 3GG0A 2ZWPA 3LPEA 4IFYB 4F04B 4RUHA 3GONA 4ECSA 1U1KA 2WAQD 1NH7A 1FKAF 2GNKA 1J2VA 1Y5LB 2GV1A 2Q6BA 2AYGA 1VRQC 1SC1B 4OZ0A 3UPFA 3LO3A 2KZMA 5LL6d 2PDAA 2CWKA 1NBEB 4DXLA 4I7FB 2ROPA 1VQNS 1NPKA 1L3SA 1VMBA 1RUSA 1U7LA 4JP8A 3CE8A 1O0PA 1FJGF 1X5OA 2CPJA 2FUG9 2CRLA 2LCWA 4EK2A 5J2PB 2KL8A 3OVSA 3H40A 1U1RA 3RRGA 4ILLA 4OYAA 2YNGA 3I0SB 4G65A 3EICA 2CWXA 1MWQA 2CIMA 3I31A 3CMAS 4NI2A 1R31A 2ZHAA 3R7NB 3GFXA 4EBEA 2R7VA 2P9GA 2DYAA 3ISNC 1RAFB 1UETA 3DDNA 4LBIA 2L48A 1TKDA 5KG4A 3NGSA 4FS2A 4XIUA 3FFIA 2CQ4A 1FKOB 2RIJA 3GWCA 3Q83A 4PG4A 4QZVB 4ID5A 5D4LA 5KAKA 1FVSA 1HQUB 2D9PA 2YNHB 1HNIA 4YY3J 2OMLA 2ZBIA 3A8IA 3O8WA 3V6HA 3CDAA 5J1PA 1S49A 2WOMB 3QIPB 1WNEA 1OY9A 1KP6A 2XLKA 2HHSA 1TKTB 3JS9A 4B3TF 4NEYA 3CPWR 1X4DA 1XK8A 1KLMA 4C3MA 3CCUS 1WTFA 3MMAA 5KG1A 2IRXA 1K44A 1RT6B 3VAIA 1NHUA 3LGHA 3LUYA 2A3JA 3M2VA 4ZPAA 1SIZA 2ZE2A 5SUHA 3POTA 5CCMA 3LGNA 1GX6A 5ITHA 3K5NA 2Z56B 1YI2S 3BQ1A 1UVMA 3QQCD 2M8DB 2AJ1A 1UFKA 3ITHA 4GVBB 4TU7A 2QN6B 4HHJA 4A8YA 4DQPA 2HHQA 1QE1B 3H2LA 4PPZA 3R1LA 5L9NA 1YRUA 4KQZA 3FCHA 7FDRA 4ZVPB 3SXLA 3MEGB 3LH2S 1EP4B 4NXMF 4IFYA 4USVA 2VG6A 4LR8A 3PTWA 1DY3A 4Z37A 1S59A 2OSRA 4ZVGA 2JH3A 2HFNA 3DHWC 2CQDA 1F9HA 3M6XA 1VJQA 3DLBA 1Q8IA 5DS7A 3O3LA 4TU8A 2R8GA 2R2UA 3IA0A 4C6AA 3BH7B 1XMOJ 2EW9A 3CJ2A 4DL0C 3O6QA 3PYFA 2GIFA 1EHWA 1HL6A 2X1FA 3OL7A 2DO0A 3JQJA 2A18A 2CJBA 2DKOB 3VHQA 4Y0FA 2MKYA 5KG2A 2E1MC 1IR0A 1UW4A 4U7UK 4CT9A 1FXLA 4NLYA 2MKJA 1KQFB 3NGDA 2KM8C 3T3FA 3GE9A 3ILOA 1RADB 1N32J 3J81Y 2JFDA 1NMEB 1N33J 2BDPA 4WWSA 3LANA 4LF5J 2RAQA 2VD3A 5EDWA 5D15A 3KK2A 2VA2A 4RW4B 3CC2S 2EVZA 1RAHB 5KFGA 4OIXA 4UZCA 4URQU 2BA9A 2XI3A 1FO1A 3CDWA 5F41A 1UPPA 2WOMA 3QIPA 4NLQA 3OJUA 3ZC4A 1NK6A 1FHTA 3A8JA 1HNVA 2C3MA 1ZZFA 2NXCA 1FK9A 3W64A 4ZLLA 4WTOB 4DV3F 1SL2A 4ZMMA 1LW2A 1JKHB 3CJKB 2CQ0A 2LQ5A 2CPIA 4DPYA 1TL1A 3MF5A 4PR6A 8RUCA 1HD1A 1YKWA 1R8BA 4RNFA 1VQOS 2GX8A 3R2CJ 1S7HA 3TAQA 1TVRA 4FKYA 6FDRA 3CJ0A 1ELOA 1T11A 1TV6B 2GGPB 5AJ3J 4F2RA 2XZWA 3S01A 5GMDA 2W25A 2VBXA 1HPZB 1SJ3P 3JSMB 3AA9A 2VICA 4JI3J 4IQXA 3PNIA 2VC0A 2RQKA 3NS6A 5EGYA 3VAKA 4DSIA 1LXNA 3CIZA 2VOOA 1M5HA 3I32A 2RKIB 1ZZNA 4PWDA 4P2SA 1WC5A 2ZBRA 2W1BA 4J9RA 5C5JA 1UFWA 3D1QA 2V63A 2YWWA 1U0HB 3M8SA 4ZS6A 4NLWA 4A8QA 4DL2A 2MKHA 4CYUB 2FVCA 1T0TV 1NB2A 1IBMF 4WK1A 4RBVA 1SH0A 3IR7B 1WF0A 5CABA 5LOQA 4K4WA 3CCQS 2YVSA 4AFFA 4IRDA 1N32F 1S7IA 1UZDA 2A6MA 3W61A 2R7OA 5H9EJ 3C46A 1TUVA 4F0MA 5C24B 1YGYA 2ZVIA 2ZH5A 4ZJLA 4TNOA 1FNMA 2FLLA 2UVWA 3HHLB 1ZTTA 3A3PB 3CULA 2QGFB 3M32B 2RQCA 3D1OA 4GVLA 4JB8B 5BR8J 1SKUB 1FRIA 3UDLA 3I5CA 2NXJA 3OHAA 1IM6A 2PMWA 3TANA 2BE2A 2XTJP 4Q43A 3CDBA 1IN0A 3UNYA 1VIOA 4UTGA 1X4FA 4WU3A 1RHMB 4ZVOB 5KFAA 4X4SA 1J5OA 3I96A 2GFFA 3B8HA 3ZZRA 1RKIA 4QWEA 2I5JB 1GK8A 1KR4A 2ZNYA 4J9SA 3NS5A 3T1YF 4TU9A 2NZCA 4K2JA 3K0JA 4GKJF 2ZD1A 2YX7A 3KHHA 2D1CA 4F2SA 2MZQA 2GMLA 1RA7A 3GR1A 4XAKA 2HGMA 4FXWA 1VHIA 2EG1A 3HSZA 4KGMA 3KK2B 1BLUA 3JB9k 1I94J 1VQLS 1HYSA 4C2MA 4C8NA 1SJ1A 1OO0B 2M8HA 3PYGA 2HS0A 4UUXA 3PM9A 1N6QB 4QU7A 3IR6B 2BJDA 1Q8KA 4Y3CA 3UE2A 4WFZA 1X4BA 3C66A 1VIXA 4FDFA 4KHMA 3VZIA 4DL7A 1ZYQA 3K58A 1CJTA 4N77A 2C2MB 4NCAA 1RLDA 1VQ9S 3N79A 4ETZA 3KXDA 3DXBA 3E01A 5DDRC 3T1AA 1S1WA 2LA6A 4GC6A 1D0EA 1X4GA 4QCLA 1LFWA 3IR5B 2OFGX 4HVZA 4L73A 4M5JA 3WQPA 4A8OA 3EXYA 2GS8A 4LFCJ 2QO3A 3MEEA 1HQEA 5G4DA 1TAUA 4ELVA 1APSA 2K2PA 1ZS6A 4Q8FA 1MWZA 3V4IA 4DSJA 3C16B 1F2HA 4C98A 5KFZA 3WBZA 1B99A 2QFIA 4CO3A 3VAFA 2DIUA 2OPQA 4I0WA 3ZZ0A 3BDPA 3TW0A 2BVZA 3AJDA 4QJVA 1VJWA 2CPDA 1YHQS 4KGKA 3KJQB 4ED5A 1FRLA 2AYBA 1RABB 3GIRA 3MURP 4N7TA 2ZJPQ 4A8SA 2BRLA 2G9OA 1FE4A 3BKFA 3J7A1 2OTJS 2VG6B 4M94A 1LK5A 1R6VA 3IO1A 2UXBJ 3CCVS 5DDOC 4X4RA 4URSA 1RT2A 3T9ZA 4B9UA 2DR7A 2CQPA 1TK5A 5ETKA 1SI9A 1JJCB 2IPOB 1SQFA 2RDIA 3CCJS 2VV5A 1N48A 4ERDA 5DZ7A 1IQTA 2NPFA 5IV4A 4LFCF 3H5XA 2L08A 3D3BJ 3GFZA 5L1IA 1WACA 2EFOA 4ZPVR 4IOCQ 3PVXA 1SL0A 1BXNA 3NMRA 3SDEB 4C48A 2KHCA 3MZIA 4QOTA 4KV8B 5CQGA 1C0UB 5BJRA 1X0FA 1QTNB 2ZKUA 1E6VB 4ECQA 3MOZA 1R0BG 3KK3B 2QLXA 3R5CA 1CQMA 1YSJA 4WYWA 1WTBA 1QSLA 2PT0A 1D1UA 1UTAA 1HARA 3CDEA 1OSCA 3LAMA 2ZOMA 4AE5A 4DU7A 1HBNA 4DQIA 4ZCIA 1RT3A 1UJ5A 2LXUA 3C3LA 2EBEA 3OTCA 4MMOA 1YJNS 3A12A 5EWEA 4X84A 3B78A 4URGA 4TQRA 3PACA 2ZH7A 3G96A 2XZTB 2IM1A 1FRKA 1WOPA 2C28A 3NL0A 1KQSR 1C1CB 4RX6A 4R8UB 1HWUA 1PBAA 2FJWA 2K7JA 2MJNA 4DV4J 1PYSB 4NRTA 3KLFA 2WB4A 3U27A 1BWEA 2OP5A 4Q2LA 3H5UA 4OJ1A 3W1YC 5K8OA 1RAJA 2JC0A 2XI2A 3T1HF 1ZM4A 1B7YB 4ZP6A 4I2QB 1AUDA 4RU2A 2KB2A 1R3NA 2IFXA 4DX6A 1VQ5S 4M5NA 3F44A 2HGLA 2J9CA 2E7XA 4ZPCA 1RT5B 3GG1A 4DPWA 3H25A 1S0NA 2AEJA 1RAIB 3FZ2A 4K2XA 4USIA 3QT5A 3RTVA 2QT7A 4M5DB 3DN9A 3MM6A 3CJ8A 8ATCB 5KG0A 4C3LA 3FNNA 4A47A 4B3RJ 1D3WA 3DLGA 5CA5A 2B9YA 2J9DE 3NWGA 1JK9B 3G8TA 3T5LA 3NCQA 3AH6A 3RG6A 2QLJB 2DITA 2YPZA 2DNRA 4RLEA 3DM2A 4FN5A 2LFVA 4DCPB 2EG2A 2KFNA 4DS4A 3ELHA 2R7QA 5DLFA 5CYQA 3JYTA 3V6KA 2HGNA 1CEZA 1WD6A 3AD7C 4KR0B 1RA6A 3HI9A 4J90A 2A6OA 1Y5IB 2KT5A 1T9VA 2P5VA 3C8YA 3LP2A 4HR2A 2IAJA 4BWJA 3OL8A 1W2BR 1QVFR 5FDLA 2BJEA 2DT9A 2RDJA 4ZLJA 1VK3A 2YBVA 2UXDF 2R7UA 1Z2ZA 5GAGI 3OTDA 3OSPA 4OFZA 3TUZC 1RWNB 4RBUA 4J9OA 2F9JA 3SSSA 4P72A 4ZCMA 1RAGB 5E0OA 2B51A 3HM9A 1OQ6A 2E1PA 1HWIA 4QW9A 1IKWA 3MECA 2HNDA 3TVYA 1RK8A 3NWRA 3BSOA 2NLWA 3UCGA 2BYCA 1KVKA 1S79A 2NSBA 2V2QA 2R42A 1HBMB 2YPYA 4TY8B 2QC3A 4WP9A 2Z0GA 3Q0AA 4X2BA 2ZUGA 2VG5B 3OPKA 4E98A 2DGSA 1TP7A 3EVMA 3HFKA 4RWWA 4GO5X 4JI7F 4CLSA 3I0RA 4Y2CA 2CFXA 3NS7B 3SMZA 1N4LA 3W8GA 2MLYA 1T3NA 3OFGA 4DSKA 2HMIA 3JXOA 3RR8A 5I42B 2HHUA 4I56A 2HQIA 3QYYA 4DQRA 1NPPA 3NAHA 4WFBQ 4K8RA 1VQKS 1UCNA 4OZNA 2G0CA 1VRTA 2EFPA 4NLPA 2GZOA 3OR1B 3M9NB 1RTIA 3LQVA 2DNZA 1DTTA 2HRUA 2ROGA 4KB7A 3M32A 1KONA 4LBHA 1NO8A 2M70A 3LW5C 3JSRA 4RW6B 4N56A 3J80Y 4ECXA 1BE4A 1GAOA 1YJUA 2OGUA 2G2YA 1R0AA 2F4VF 4DCJB 1FCAA 1NK4A 4QR2A 1FI4A 3HSJA 4B02A 1YIJS 1P9YA 2HG4A 4ZP8A 4G3IA 3AHPA 3SIPB 1N34J 3DLEA 1MROA 2O1PA 2QJ3A 2W4CA 3DKDA 4F4AA 2HHHJ 4UY85 1H2TZ 1CJVB 5D8HB 5HMWA 1AB8A 1C2PA 1WKLA 3OXGA 2GHWA 2YNFA 5J1EA 2KFYA 1P1TA 5FDLB 2NXNA 3OR2A 2NUUG 2PSZA 4RJVA 3V5RA 2EWHA 1F1BB 4NRUA 5IWAF 3GIMA 4WZQA 4FKXA 4U6PA 5J2QB 4LBPA 3ZFVA 2JNJA 1V5IB 5F8IA 4XK8C 3DLKB 1ACMB 3TEHB 3D4JA 4E0DA 3OL9A 4B3TJ 3AD8C 3MI7X 4B3SJ 4AXJA 4A8MP 5D4NA 3ZNUA 1HHSA 3K8WA 4USKA 3T6JA 3M4XA 1WUUA 4EZ9A 1MNEA 2PA8D 3GJQB 3KLIB 4KO0A 2V8VA 1SXLA 3JTOA 2VIHA 2GVZB 2YX4A 4RW8A 4DFKA 1TFWA 2J7KA 3FDSA 5HP1A 1OY8A 3C19A 3LP2B 2N3LA 4L6V3 5CCLA 1X5TA 5HLFA 4F3OA 1LNQA 3IM8A 4DV0F 4Y00A 4ZVHA 3VVTA 3OLAA 3D6MB 1JQGA 2MZRA 4DV5F 1GX5A 3PX0A 2HMIB 5GVQA 5EWFA 2Z2MA 2RF2A 4M95A 5E2QA 1SJQA 3ILLA 2VQEF 1CPZA 2C2EA 2W2NP 2E1CA 3ILJA 5A8RA 3NNAA 5IFMA 3NBPB 3FJ2A 4DV3J 2PO4A 2JSXA 2NYIA 2MQLA 1RJJA 2Z57B 2G13A 3M2UB 4C8ZA 4I6YA 4PEOA 4H4KC 2YNHA 4ANCA 3A4TA 3LGMA 4IRKA 1TU0B 2DXEA 2MZTA 5KFXA 1Z2LA 5HBMB 4J9LA 2FQQB 4ECRA 1Q4RA 2MY7A 5HAOA 2MQPA 2AYEA 3DYAB 4U95A 3TUJC 1H3DA 4MIBA 2PI4A 2PFFB 4ZDNA 2WSEC 2RT3A 4K4YA 4HI1A 5KFKA 3JAMY 1ZM2A 4MKBA 1ZBTA 2BX6A 3QSYB 4JI0J 4JI4J 2ZZTA 4LR7A 1SJFA 4JV2A 2DGUA 3TVKA 4OLOA 2QYGA 3Q8PB 4LREA 4NCGB 3UNGC 5CYJA 3AB4B 4DPOA 1JLEB 2HVEA 1SB6A 1PJ7A 1XQIA 1RT5A 2XHWA 2FZKB 4KE5A 3N0VA 3I56S 3HP6A 1Y3JA 2GC8A 2KHDA 3BO2A 4DFPA 2IM2A 3FK4A 3MCSA 3K59A 4ED7A 2XMVA 3FZBA 4HACB 2BR0A 3CC7S 1NHKL 5JMNA 2VQFF 2OI2A 1DHMA 2DHAA 5GMKa 4X66J 3D5MA 1FNXH 2DH7A 3OTBA 2DGVA 3U7JA 4DR6F 1B4SA 1KLNA 1U6FA 1HWJA 4ZHRA 3SYZA 1F9EB 4CT8A 1ZM3A 4XPCA 2AEFA 4DUZF 3M8QA 1N5VA 5DO2A 1HQUA 4FVMA 3CMQA 5LJ3Y 3IGNA 3PKYA 1T3OA 4QYRA 3SCJE 2RD5C 4DR4J 2JRSA 2H65B 2Y1RI 4X62J 4O3RA 1WHVA 3Q86A 1NDLA 1SKWA 3DOMB 2X1BA 1VRUB 2KJWA 5HO4A 3GILA 3BDEA 4IUFA 4ED6A 3DU5A 1XMOF 2PA3A 1LWEB 4ES2A 3ZZYA 1U8SA 2KT2A 2QLBB 2M0GB 4DR1J 2NQPA 4A8WA 3QZ8A 5FLXU 2BKPA 5B0GA 4JI5J 1P9QC 3M8PA 3KJFB 4ZVRB 3GMGA 4WXOA 3W60A 1QAXA 2FDNA 4ZLNA 4QWCA 2AD9A 2WHOA 4F4XA 4FF2A 3TVZA 1MMNA 4CO5A 2OD4A 4YB7A 1ROFA 2DTJA 1KWMA 2F65A 4NCBA 2ALYB 3Q8SB 2QMUB 4ED4A 4ECVA 2E44A 3ZTQA 4A4JA 5KFWA 3TP2A 3KLHB 3G71S 5KOXA 2ALZA 2QTWA 3LPYA 4TVAB 2GMJA 1JKHA 4X4VA 2MEWA 2MKKA 3AXKA 1SC3B 2CPFA 4M8LA 4KSEB 1RTHB 5EX3A 1IKXA 1A7GE 2A2DA 4CLPA 1YBAA 2C2KB 2RRBA 5ETNA 3RUBL 4JI7J 1WG4A 1HYSB 1UL3A 1RYSA 4NASA 1RHUB 3D66A 3E8OA 2HBYB 4U8VA 3CJQA 2W8LA 1NDCA 3V4MA 4IOBA 4AD6A 2D3O1 3EM1A 5EWGA 4FNIA 2WVEA 4WIIA 3BPSP 3HXMA 5LMNF 3SQOP 2MGZA 4DL4A 2DPIA 3CSKA 4LMZA 3MEDB 2XYPB 3GFYA 3H5YA 1VDHA 3OBIA 1JLAA 1M1HA 4MKYA 2EKNA 1UEKA 1HKAA 1S1VA 5KFTA 5BXIA 2AWZA 2IC3A 4AT1B 3M8QB 3K5PA 2ZH4A 2HQ3A 2XHCA 3IS9A 4USUA 2HNYB 4M1KA 3TYTA 4CO0A 2KZZA 2A2CA 2V34A 2X1AA 2HFUA 1TAQA 5C25A 2Q66A 5L46A 1YRTA 1S5ZA 3LOUA 1F6TA 4FYWB 4FF3A 1VYAA 1SKRA 2KXFA 3D1HA 4WFXA 8AT1B 3BN4A 1IBMJ 4FYDA 2DR9A 4LF8F 3LALA 3W7BA 2G1HA 3HKZD 4ER8A 1NPRA 4K0KF 2H5JB 1YK9A 3AOBA 3G8QA 5E7OB 1W25A 4KJIA 2BQUA 3NCRA 1YJWS 3GR0A 3J7AN 5J2MB 5JJBA 2JC1A 1AROP 3T9NA 4BDPA 2C2ZB 2HURA 4CI0B 2RUGA 2HHXA 2F1FA 2IVFB 3PJWA 2MKCA 1RB0A 1HI1A 5KFCA 4BC9A 3HX9A 2WBRA 4LF7F 2CQ3A 2DHXA 3FMBA 4DOZA 2KYXA 3KLIA 1XMQJ 5LSOA 5AXMA 1FX4A 1IBLJ 1NDKA 3LP1A 2VZ9A 3QLHB 1PIEA 4UOGA 1DJ0A 1C0UA 1R89A 2ZH6A 3DOLA 3Q8VA 1E6YB 4N8OA 1NNDA 2VC1A 2V68A 3BV8A 1NJIT 4WFAQ 4DSEA 4CCHA 2DY9A 2VF3A 2KFZA 4G1QB 2KKHA 2KYZA 2WRMA 3DM2B 1M5KC 4F67A 4P10A 1Y0HA 2L3MA 2YWKA 1S9FA 1S1UB 3CD5A 1D9DA 1IVZA 5C24A 4DEZA 4DV6F 3MR2A 3NBPA 2VONA 3I82A 3THPA 4F25A 1TKZA 1EJ7L 2XZDB 3PFEA 4LRAA 1S6QB 3SBMA 3VCDA 3CCLS 5F3TA 3PX4A 3DDKA 1YBUA 4ZVFA 3OV7A 3GP9A 3H0PA 3I9ZA 4RNNA 3TUPA 4HHUA 1UEUA 1KNZA 2K1RA 2W7PA 1XMQF 4IR1A 2ZWOA 1TMJA 4UUWA 5D0EA 2DNKA 2B5JA 1RTJA 4K4ZA 3MMAB 3FRYA 1H6KX 4RR5A 4ZIVA 1UMJA 2CNNB 4H4OB 3S1TA 3M1VA 1WKJA 1QAJA 2G2ZA 4J9KA 4C97A 4CO4A 3UQSA 1LK7A 2YKQA 2DHGA 4TY8A 2KM8B 2PEHA 1U8WA 2L9DA 1WSRA 5SZTA 2XS5A 4O0NA 1N0UA 1EIYB 4ED8A 2EC0A 1FJ7A 2OPSA 3C6UA 4J9UE 3V81B 1T05B 1WKKA 4PZVA 3GYXB 1S1XA 1IWGA 1XR6A 2B8PA 4OL8A 2N4DA 2VFVA 4DN9A 1U48A 3GYNA 1FDAA 4EO8A 3T19A 4DG1B 2C1EB 1FDDA 1Y5NB 2WVDA 5HVGA 4YDDB 5IT0A 3MUVP 4ZHRB 1S4EA 3PEHA 4WP8A 1FTCA 4C11A 3P49B 1KFDA 5IM0B 1RWKB 2YNIA 3ETOA 2K7KA 3DC2A 2DNGA 3PEJA 3ENQA 3TUIC 2YKOA 3QGGA 5HK4A 4USTA 2LQ8A 1CULA 3HFVA 4F0HA 2DRBA 5KT6A 4H54A 3OTOF 2J6TA 1W26A 1YRXA 4EBCA 2KVQE 4MK7A 3UWTA 2DH8A 2UV8G 4DQSA 3CTRA 2C2DA 1EQMA 2VA3A 3HCXA 4IO1A 3PG9A 3KLGA 1CJKA 2PMHA 5LMNJ 3OW2R 2E7WA 3S6EA 3I55S 2FIUA 2RJZA 1U1MA 1U2CA 5IOLA 1LWEA 1Q7YT 4OX8A 2JZ5A 4ZJQA 3QT8A 4Y6IA 1WJ9A 5DQHA 5D0RA 5ETVA 1HNZF 1JJ2R 1CJUA 2HHTA 1S6QA 1LWXA 3CD7A 1YJ9S 3SQGA 1LW0A 3HZEA 1HFEL 3GJSB 4ICLB 4USHA 4X4QA 4GMKA 4O3PA 3IWLA 2VG7A 1HNVB 3MTJA 3GZ7A 2IVYA 2VH7A 1FXDA 2ILZA 1HBMA 1HBUB 1RWUA 2B7CB 4ETXA 4CH7A 5M2PA 2JEGA 2EK6A 5KFDA 1HBOA 3IP0A 3RRKA 1U45A 1N56A 1NK5A 2XY7A 2XY6A 4BS2A 3L4BC 1U1QA 1YITS 2BMBA 2DHSA 2LMIA 3H59A 3SDEA 1Q78A 5IS2A 4V19X 4DR4F 5GAHU 5LXRA 4A8FA 4ZLPA 4OHXA 1Q1KA 1X60A 4OI1A 1JX4A 1X4CA 3DLJA 2Y0BB 3PJXA 3R5JB 3FUYA 4P2MA 1L5UA 3HHNB 3BKUA 3HHLC 1S6PA 3UD5A 4CWBA 2V4RA 2UP1A 1Q8LA 1NKEA 2W9BA 3TI0A 1RT3B 1VFJA 2NXUA 4NA2A 3IN5A 2RS2A 1SKSA 3W3SA 3GIJA 4J7CA 5GAHI 4CH1A 5F8HA 3MR3A 4F3MA 2IJNA 5HJXA 4O0IA 3FFIB 1V3ZA 5D4OA 4PUOA 4UY8T 3VGTA 1I51B 1QSYA 5IT9Y 3DI6B 1FT8A 1RLCL 2AP6A 4IKAA 4R8UA 1HLWA 3H20A 3GSDA 4IDKA 3D7SB 3M2UA 1GFWB 3AAWB 5KFBA 2GIQA 5DRKA 3KOAA 3M6VA 2ZITA 1SQEA 1NSQA 3GCXP 4DDFA 3QRPA 3OXLA 1KN6A 2QL9B 2AYMA 2OPRB 3A3NB 5KFNA 1VI7A 2JLGA 2Z2ZA 5A2QY 2IHR1 1NB7A 2P2CB 4L74A 3CW2C 4ZCLA 3VGVA 3N9UC 3QMQA 2CG4A 4WE1A 4BCAA 5KOWA 2YNIB 3BBFA 3MTKA 3I5AA 1S9EA 4RW7A 1UA1A 1NHVA 4IR9A 3HSGA 5LSRA 2QA2A 1HBUA 4MAKA 1TQLA 3ENWA 5ADZA 1QM9A 5AXNA 3OFHA 2DGOA 1PILA 4P74A 3JQMA 3L7PA 3ZZOA 2GA7A 3W2WA 1M5PC 2EFGA 3RBXA 1U6BA 2UZAA 3C15A 2RMLA 3W5ZA 2KRBA 4JI0F 3S7RA 2BE9B 1FD8A 4HHHA 2MY8A 2E5LJ 2V8GA 4LSLB 4XDDA 1CVJA 4TQSA 5T14A 1FERA 1A0OB 2OPPB 2QRRA 3N6LA 3DOKB 1FKPB 2CA9A 2QFJA 1VQ7S 2HHWA 4GRSA 2FGOA 1BC6A 3ITHB 3MXHP 2NZ4A 3MPUB 3UVJA 5RUBA 3TNVA 1HIYA 2V4QA 3U1MA 3VQSA 1N5SA 3HZGA 4TLRA 1OIAA 4H4MA 4KC5A 4QIVA 5HMYA 1P6TA 1VRTB 2R7SA 1K73T 1VQ6S 1KHVA 2ZFHA 3BM7A 4YMEA 2CYYA 3D6TB 1N0VC 2R7TA 5H9FK 3MMJA 3K7RA 1WC3A 1Z4UA 2KVIA 1D09B 3KNGA 4DR3F 4DR5J 4R25A 3T5HA 1R0AB 4DV1F 2K3IA 1U47A 3J81j 4O3SA 4F26A 2WW4A 3EUNA 2VFRA 4CNYA 1CQNA 1FRMA 4J9VA 2ZM6J 2PI5A 4WKRA 2GJIA 1B70B 4L72B 1K47A 5A8KA 2XWYA 5K5MA 2Y1IA 1Q86T 4WKYA 2FPHX 2HHHF 2BRKA 4NL5A 4OYWA 5EX0A 5BYSA 4OI4A 1L3VA 4FF4A 3PXGa 3W66A 2R8HA 3WIVA 1SIWB 4DJBA 2DO4A 3CO9A 5E41A 4KY3A 2N82B 3VAHA 1N34F 1MSWD 2UUCF 3R5DA 2G0JA 4OMFG 4YR2A 2XSFA 3IM9A 3SCIE 5KFIA 1PC4A 2GCFA 1RT7B 2IM0A 2UUWA 3NAIA 3QGHA 4M63A 5HMXA 1AFJA 2NSCA 3NNCA 2AF6A 3V2UC 2Y8YA 1FKOA 2V9KA 2DK2A 1VLYA 1Q82T 1SJRA 2P8IA 4DR2F 3T1YJ 4UT4A 2C3PA 4X4NA 4JI8F 5KT3A 5CD4H 1I1GA 2BBEA 2ZBPA 3CCWA 3B82A 2VFUA 2XMJA 3DLEB 4J37A 4EZ6A 3E51A 2QG9B 4ED1A 1RWXB 4ED2A 3W63A 3HHDA 5DETA 3PIPQ 2Y8WA 2FHMA 3J7YU 4ECYA 1TV6A 1WDDA 2GGPA 2C3YA 4LJMA 5C2GA 5CD4A 1X4EA 1S0OA 1NJXA 3LP0A 4I2PA 4B3OB 3JSMA 3MGJA 5F8JA 3CDUA 4DUZJ 2YX1A 5B0CA 3DNCA 1P27B 1CG2A 2VG7B 1DARA 2WSCC 5BR8F 3MEGA 4QYZJ 2CKWA 3IG1A 4ZCKA 3N01A 3W2WB 3MCNA 3MEKA 3NGTA 2ASJA 3T41A 3C15B 4DG1A 3HK2A 2HVIA 3MDFA 2BANB 4LVNP 4KH0B 2ABYA 2AW0A 4NLTA 2I38A 1J5OB 3R9LA 4WFNQ 5J2MA 1O51A 2R2SA 4V19J 2B56A 4Q0BA 3OXFA 1X4AA 2KO1A 4OHYA 3ILIA 4P52A 3FRZA 2CPZA 3IBWA 4ECZA 1AA1B 1JB0C 4OYIA 3DLHA 1JLGB 4LFAF 1Y10A 3VZHA 2N4CA 2VU5A 4LQ9A 2J6UA 2LECA 4HH0A 4PXDA 3PW7A 1ZPWX 4J5OA 1K0VA 2DNNA 4W4MA 2RB7A 5CH7B 4YDXA 4OHVA 5KFFA 2W8KA 1JLAB 1R6YA 3X3UA 2FVSA 3CC4S 2HBRB 3G87A 2C42A 3EDQB 1ITPA 5AE2A 1YQHA 2BE2B 5D78A 3WDOA 4X4TA 3RRHA 4DPUA 2UUBJ 2Y9HA 4Q8EA 1K1QA 2GO9A 4F50A 3EMTA 4RUCA 3I4HX 4M5LA 4LIRA 3KKFA 4LFBF 3AXMA 2O67A 2XYHB 1H7XA 4X65F 2W9AA 4ANDA 1UVNA 3FKBA 1UJ6A 2C22A 1AW0A 2A10A 1FRJA 3VR1A 1SL1A 3G82B 4X62F 2JLFA 4C8LA 2H1YA 5M2RA 3ZTRA 2JHEA 4RO0A 4LSZB 1WWHA 2KXHA 1XR7A 2XM3A 3MPWA 2BJ3A 3OUYA 2BXJA 3TQ1A 2XMAA 5C7PA 2ZH2A 1KHWA 2Z2YB 1TUWA 2CZ9A 3EVOA 2VPZB 4B3OA 4JI1J 3W5XA 1H72C 1RHQB 1MU2B 2YKMB 3QFWA 4OJHA 1SC4B 2VBWA 5DLGA 1PSDA 1CJTB 2OD6A 4DV6J 4BC7A 4LFBJ 2B4PA 4QWDA 5HROA 1LQ9A 3R97A 4C7QA 4IYQA 4EMDA 2E5HA 2XMWA 5AJ3F 3SZ2A 2JJ4D 2ZOGA 3WIUA 5LMUJ 2V94A 2C2RA 3D28A 2MZJA 2RQ4A 3LA0A 4K5SA 4Y34A 2FYXA 1UW9A 2XS7A 2UUTA 2H4YB 2LXIA 3LWLA 3KLVA 3C16A 3W62A 3UI3A 1DFDA 2N7YA 2B8QA 2RRNA 3B54A 3OFEA 3ET6A 2AZ3A 2XYGB 3M6WA 2W7OA 4I6AA 5U47A 4HYKA 3FEXB 4ZA1A 5KT2A 2O66A 5LM7E 3CJKA 2XS2A 1U1OA 3Q2SC 3IG1B 5EHHA 3ENAA 2XSJA 3PW2A 1SV5A 4ZIWA 1RWVB 3I9V9 1RT2B 1IKYA 2J0XA 3KJVA 1MMDA 2YKNB 4O3NA 1LV5A 2IDLA 4MK9A 3MM5A 3LAKA 3ULHA 1RBOB 1HD0A 2Z58B 4CLTA 4QIGA 4B9TA 3D0GE 3W2VB 4FBTA 5MLCV 2H5EA 4ICLA 4C8YA 5HQLA 2HFSA 1Q95G 4DV4F 1VC0A 2CUYA 2WONA 3F0NA 3GTYX 4TN2A 2HHPA 2M4MA 2QE5A 5ETMA 3TAMA 5C25B 3N6NA 4CLWA 2G2OA 4KV8A 3KLFB 1KSPA 1NDPA 2J8AA 1REVB 5IXUA 5IQ6A 4K4VA 3K2YA 4NLXA 2UUAF 1PAEX 4NLGA 3KUEA 2MQQA 3PFOA 5GAEU 1RTHA 2OPSB 3C6UB 2R2RA 1T05A 3R2DJ 1S1XB 2J76E 2DCLA 1IWAA 2ZKTA 3QGPA 2B9WA 5A8WB 3PW5A 1N88A 4WYLA 3CJ4A 2VB6A 2DRAA 1A6LA 3G9CA 4K5RA 5D6GA 3IAS9 3GIKA 1HW8A 1RXOB 2HRYA 3P5BP 4MYUA 2K3KA 2VPXB 5KFUA 5H9FJ 4P7VA 1NSPA 3BQ2A 2R8JA 1OYEA 4AYBD 5F8GA 1TK8A 3L09A 2GVZA 4NLRA 2WVFA 4USWA 1YDLA 4QR1A 1BQNB 2ERRA 4RW9A 4KYZA 4F4KA 3KUHA 4KFBA 2XQCA 5F3ZA 2QL7B 2V4JA 1WEXA 1YJRA 1IQZA 1U49A 2XMUA 2GAGC 1P1LA 3FSIA 4PAAA 5THWA 1RGVA 3VQTA 4I64A 3CT9A 1ZM9A 1XNQF 3IS9B 1FDNA 1TL7A 1Y7PA 1XNRJ 4B3MF 1RAOA 2LEBA 1RACB 3MEEB 2FZGB 2E5JA 2RU3A 4GVBA 2ZE2B 4P73A 3MAHA 4TYBA 1UKUA 3W65A 2XMMA 4ECWA 2J5AA 4LQ3A 1Y11A 4YHHJ 2CADA 4O4RA 2ZM6F 3EGNA 4O23A 4QR0A 3PR4A 3BGOP 1VQ8S 1TKZB 2VASA 1HNXF 4L3KA 1T7PA 2AEMA 3EZOA 1M5VC 2L41A 1TK0A 3KDOA 4X4PA 3OJSA 1F0XA 3PW0A 3BJYA 1LWCB 1BD6A 2OKQA 1FXRA 3MAAB 3P8BB 2CZVC 4MJKA 4PG5A 4C0OC 4X66F 2FHJA 2B5JB 2HNDB 3M30A 2FLPA 1FJCA 4CO2A 3OD2A 4LSNA 3UR0A 3H2UB 3JSYA 2DEIA 1J5EJ 3DGPA 4KHRA 4UZBA 2FHKA 3SI8A 1N36F 1KKHA 2B6AA 3IGVA 3PY8A 1GMUA 4M5MA 4OHZA 1SVDA 3T1HJ 2VPYB 2I0XA 1UFLA 1T9UA 2RH3A 4JBCA 1PJ5A 4ES1A 2VJVA 5KFPA 1RYRA 3RBDA 2BOAA 1R43A 4OYXA 4IH5A 4NLUA 5D3GB 4AL7A 5DM6Q 2BE7D 3QJJA 4C9DA 1I6JA 4RPFA 4X4UA 1RU1A 4F4WA 2M88A 1PKUA 5AE1A 3BEGB 4YUDA 1RT4A 1NK7A 1VGYA 3IMQJ 2F9DA 4RUBA 5DQGA 1DBDA 1NSAA 4XPEA 1C4AA 2V5HG 1JWWA 1C1CA 4M5KA 3BS9A 1N5QA 3NG8A 2IMOA 2HBZB 5FJ4A 3CJ5A 1SUQA 3FBBA 3P3DA 3EVWA 3TX8A 2KI2A 1H73A 2VL1A 5F8NA 3FCWA 3QAUA 1CJKB 4PKDB 2DD8S 4Q44A 5GAGU 4FXDA 4WZMA 3K17A 2BACA 3M1VB 3M8PB 3N6MA 1JLGA 4WPAA 2LVWA 1EQ0A 5J2PA 1RAEB 1N5YB 5FD1A 3G6VA 1R8CA 1KOHA 4LR9A 4RW7B 2ATLA 2ASLA 1OWXA 4KBIA 4JI1F 2UVRA 1VQSA 4UQGA 4DFMA 3W8PA 4KTQA 4LFAJ 1BQNA 1SPBP 5L1LA 3TQEA 3KLHA 4Q7AA 1VLOA 2EK1A 4B3SF 2SXLA 1CC7A 2E5GA 2AJ0A 3P6YC 2EC2A 3WX4A 2DNMA 2YWFA 2HVDA 4HDHA 4F7VA 2KG0A 1C1BA 2Z4PA 1T9YA 5ETSA 1MROB 4N41A 3QATA 4XTTA 4LRCA 4DSFA 1LFPA 1TL3A 3HVTB 2GVDA 4FPRA 4CQ1A 3AQPA 5KFEA 2D3OR 1MW7A 3L7OA 2RS8A 1XEZA 2HYIB 4WJBA 2W9CB 3GQCA 1NSKL 2DIVA 2Q3PA 3G4SS 3VAMA 1NXIA 3GCWP 3BF4A 1U4BA 3CIMA 2E7VA 4NEZA 3UFCX 1U6ZA 5J2NB 1RTDB 1HWKA 2BM1A 4IQMA 1LWCA 2F8HA 1SH2A 2W01A 2HNZA 2MJUA 3MAAA 4OV1A 3NOCA 2R8KA 1QE1A 2PMZD 1DQ8A 2RVJA 1GT8A 4PWWA 2EFQA 3PW4A 5HN0A 2OJ3A 4F4YA 2IJRA 3OQ2A 4Y28C 5D77A 2I5JA 4PXEA 3DI6A 1QLNA 1TMMA 2BW7A 2ZZNA 4PXBA 1QUVA 2DPJA 1XJWB 2CPHA 2LLZA 4JV5J 1EETA 4CIOA 5JVGQ 3DYAA 1RHJB 1SCJB 4DR2J 3PYEA 1GXLA 1UPMB 2Z8QA 3US5A 3AOCA 3NGKA 4WIQA 5ETRA 5LJ5Y 2CQCA 1Y3KA 2KN4A 3AJ1A 5HI7A 3V6DA 3RBEA 2OH2A 1JXVA 3MMCA 4FYXB 3WC2A 3KNAA 2DRDA 2I1RA 3GIIA 1JLQB 1JLEA 3D6HB 3NXZA 4FZVA 3UO0A 2CVEA 4EGLA 3KK1B 2V2KA 1U1NA 2H9ZA 2NXEA 1X5SA 3DRSA 4MFBB 1WI6A 3H98A 2W9BB 3AJ2A 2BEFA 4P2XA 2IJFA 3EZUA 1U2FA 2HS3A 1K1SA 3C14B 3U1LA 2APOA 3NY0A 2MYFA 2V4JB 3BGRB 3QNWB 1UWAA 3TA2A 2R8IA 4LF4F 1T95A 1URNA 5ETQA 4WP3A 5KFYA 4CTAA 5C42B 3MUMP 5T7LA 4DCOB 2M7SA 4IRCA 1Q16B 3TZYA 4EUVA 2YWGA 4AQYF 4YR3A 1FK9B 3RB6A 2QEXS 2B3TB 1N5YA 4NCGA 1EZZB 1FKPA 2OEJA 2WCXA 1MLAA 3B6BA 4MKAA 1MG7A 4PCQA 5KT7A 3C2PA 1FESA 2I2YA 1F5AA 4PG7A 4QPXA 4I69A 1DURA 3G82A 2KRRA 2KU7A 2MDAA 2X51A 1HQ2A 4KKOA 4P2FA 1T94A 3UVJB 4DZ6A 2LEPA 3OR2B 2JEIA 2FD2A 4ZPWR 3OHBA 2HNZB 1QJHA 1GMWA 4QBUA 2OIHA 1NJZA 3B4DA 3I5BA 3CCTA 3S8SA 3IWNC 1C1BB 4C0HA 3CXCR 1VBXA 5KFJA 1T9WA 2ZC3A 3DRPA 1FJGJ 3M6UA 2MHEA 3BBBA 1S0VA 2ZBCA 3MM7B 4OJ3A 2NUHA 2CNKB 2UVVA 1V9OA 4CP5A 2XO7A 4M5HA 3E2EA 3K8VA 1Y00A 2RRAA 2D7SA 5DQIA 3R7SB 4LF6J 2CG8A 5T41A 4RL1A 2OPPA 1QDUB 2HPUA 1KQGB 3ZZPA 1HA1A 1YZ6A 3CD0A 2OMOA 1GNKA 4PG8A 5A2QU 1URRA 5I4MA 1FFSB 4G1IA 2RHQB 4ILRA 3SEOA 3CGIA 2HZAA 1S6UA 4L75A 5LT5A 4OZ2A 2RF2B 1M0SA 2VQFJ 2HFOA 4C11B 3K5OA 4U67Q 1JLFB 1O6XA 4OYOA 3NNHA 4YHHF 3IAM9 3UN3A 3HPOA 2ADBA 3QAEA 1KC8T 3P45B 1H2UX 4J9PA 3VTIA 2W4PA 3CJSA 4ENOA 3HHLA 2VFTA 3HVWA 3MHYA 3FEZA 4B3RF 3ZXWA 2JVOA 4C8MA 2J0WA 1TKTA 1C4CA 2EFNA 4DUYF 3GLJA 4N76A 1PBUA 5C42A 3NEKA 4M5GA 4DL3A 3X1LB 4YEAA 4A46A 2VDHA 5J1NA 1J5EF 4UOCA 1ZA1B 2B9XA 2GQCA 4DV7F 4GC7A 4LF8J 2R7RA 3D68A 3EPIA 4IG3A 4MFBA 3T5JA 3MD3A 4W90B 3CUNA 4DBQA 1OSDA 3PHTA 2X1GA 3NLCA 5DG7A 4HEA9 1T8EA 2QIFA 4XO0A 4EEYA 3EE3A 3M8WA 4PYAA 4RNOA 2AT1B 3HD1A 3Q24A 1IBKJ 1FDBA 2BQRA 4JI5F 1ULRA 2WZ1A 3WHIA 1IUJA 1YBTA 2JOQA 3CB4A 4Y2MA 2FJBB 1UWBA 4NOHA 4Q2MA 5HQMA 1V5VA 1U02A 1IBCB 2BJ7A 5T7LB 3TA0A 5IT4A 1KD1T 4FBUA 3CD6S 2LQJA 5KT4A 3DMJA 5G0RA 3SFUA 1N6QA 1KTQA 2MMYA 2OEKA 2KXNB 2VQEJ 1XNQJ 3QWUA 4OHWA 4J9NA 2LXFA 1HMVA 1CBKA 2ATCB 2IRYA 2O3DA 3QLHA 4P71A 3THVA 1E6YA 3TAPA 3MM8A 5K8MA 3QRQA 2DHHA 2MZ1A 2V8PA 3OL6A 2DISA 3SSQA 2IAJB 1R7IA 3RW7A 2XO6A 3HHLD 3NKYA 4MIAA 1TL7B 4CZCA 4ELUA 3MFIA 4N47A 4OX9F 2HQDA 4DHVA 5EN1A 2LKZA 2CQBA 2J7WA 1L3UA 1RWOB 1JNRB 4P9SA 1QSSA 3RYLA 2LDYA 4MIWA 1RP5A 3WX8A 1YJTA 3HT3A 2QA4S 4LF5F 1DZ5A 2W2MP 2OPQB 2X3GA 1VCTA 3FQLA 4IH6A 1RWMB 1F5BA 3D0HE 4KT0C 4LVOP 2UUAJ 3TZZA 1X31C 5K14A 4JI6F 4DWIA 1RU2A 3W9IA 3DRRB 3P4UB 5HMZA 1FRHA 3HDSA 2B43A 4D3GA 4ED3A 4DS5A 1RTJB 3BGUA 2BANA 1VC5A 5L9XA 1HHQA 2HKEA 5D0HA 3L7UA 4FS1A 3JAMU 3RJMB 4DR7J 2UXDJ 2ZUAA 4NX9A 4NPOA 3M30B 2WK4A 3D54A 4QWAA 2RU9A 1SC6A 4JUZA 3EGVA 3L95X 2DR8A 1AXQA 2O01C 1Q53A 3BGLA 2MXYA 3QPIA 2E66A 4V1Ak 3G8SA 3I0SA 7FD1A 2XNRA 1GMWD 2AZ1A 3BQ0A 5LXYA 5I3UA 1I94F 1CC8A 3KJNB 4RW6A 6FD1A 2MGZB 2FY1A 5HANA 1FWLA 2CDQA 5JUMA 3BSCA 4RW9B 4YQWA 2DH9A 3D6FB 3MCMA 3R5GA 2B4VA 3ETMA 5ETLA 1RBAA 4WFYA 5CHCB 3TJ8A 4NLVA 4DN0A 4B9VA 4LF6F 2BUNA 4LF9F 3DCAA 4X64F 2QX0A 2XY5A 2FGCA 5DJBA 1OY6A 3ENVA 2HNYA 3K5MA 3VALA 4FNHA 4XDCA 1HHTP 2WVCA 4DSLA 4IG3B 3PCOB 2DGXA 1VQYA 1ZAXA 5EUHA 5IV3A 2BQ3A 2HWIA 4HL9A 1I3OB 2EKYA 1G6BA 4QIFA 5HSPA 3EZ5A 3PO4A 5KG5A 1AFIA 1Q8BA 2CQIA 1Z1ZA 2OELA 2M9KA 4J91A 1AYEA 3M2VB 3M9MB 1BMQB 1KS2A 3Q8QB 2IVMA 1UWBB 2QMWA 2ZDPA 3POTB 4I2QA 4ZVTB 4DUYJ 2VKRA 1JLQA 4U7CA 4IO9Q 1FE0A 1B64A 2FJVA 4RBTA 4NZ6A 3BBCA 2B7BB 1U1LA 3BH6B 1F3VA 3MM5B 1KEKA 2RE1A 2QYCA 4IH7A 5A8KB 1HNIB 3DGPB 5A0YA 3BB5A 3DLGB 1O5JA 1SQGA 4ZITA 1U1PA 5HROB 1LKZA 4ZN3A 3TA1A 4C4WA 5KFSA 2BV3A 4DX8H 1RWWB 2FVPA 2D3UA 1X0PA 3FBEA 3TARA 1K0TA 1RT1B 4CYUA 1WSVA 3CO0P 1DAXA 1ZAVA 2V0NA 1Q5YA 4HT7A 4I4BA 2KG1A 3AB2B 1PGZA 4LF7J 3R6LB 2ZZMA 4YN3B 1JIHA 2W4DA 5KG7A 1TUGB 3ZZUA 5D3GA 2GO8A 1HNWF 4Y2IA 3TX0A 1REGX 2PEBA 2G0IA 2MQ8A 4NMLA 4OYBA 3RAQA 2OUGA 4NXMJ 2VBYA 3SQGB 4GKKJ 2MHNA 3UW1A 1DQ9A 3H8YA 2J6SA 5F0WA 3K57A 1GTEA 2AJFE 1T9XA 1YLXA 2L9NA 5E3CA 1F3FA 4CH0S 4CRJA 4O44A 3T5KA 1HR0F 1TL4A 5E3AA 2AU0A 2I9SA 1S1WB 1SV5B 3FC9A 2OSQA 2XNQA 2B4UA 2AX1A 1HI0P 2CXEA 3CJTA 3KWMA 3DFEA 5HBMA 2BJ9A 4FP9A 4PG6A 3SCKE 1VS3A 2E1RA 4YR0A 1NKCA 4Y2KA 3VVUA 1JXLA 1T02A 3HJFA 4IDKB 1NEEA 2BJ1A 2VKZG 3G6ES 3DRYA 2ZH9A 4OLPA 3RB4A 2IMWP 2ADCA 3NGUA 3O44A 4H4OA 4OYPA 1JNZB 2MQOA 3HKWA 4W92B 4K0KJ 1D9AA 2QSFA 1RTZA 3MCOA 4EYHB 2Z30B 2MTLA 3QFHA 1BHNA 4FVCA 5CZXA 5E5NA 3AODA 3I6PA 1BGXT 4HACA 2Q6CA 1RBLA 1S99A 1UVKA 4OQJA 4KHPJ 5A8WA 1YTYA 4I6WA 1TVRB 2ZHBA 1JLFA 1U26A 3RB0A 3TJAA 5IC6B 2JDJA 2WSFC 3BGFA 3N28A 2EPIA 4ID8A 4RNHA 4DI6A 1M5OC 2G1DA 1WORA 4ZVSB 2RILA 1MN7A 3DRSB 3H2VE 4K4SA 3PO5A 1W7WA 2H4WB 3MPYA 3W9JA 4PWDB 3CVKA 2E1AA 2ZH8A 4OJGA 2N7CA 2KTQA 7AT1B 4OX9J 3BPDA 4B17A 3VAJA 1P8GA 4YB6A 4CTAB 3BSNA 4GO7X 2F4VJ 4JV5F 1WHXA 1RSCA 1HBNB 1XWLA 3DDIA 2Z2LA 3VWSA 2UXBF 3ONQA 2ZH3A 2OO4A 1EKRA 1KRPA 3GU0A 2YNFB 5J1EB 5M2UA 1N8RT 1L3TA 2WVBA 1FFWB 1CJVA 1O8BA 3KG1A 3OTEA 4JI6J 3PDNA 2HHVA 2F7VA 4NE9C 2BW2A 2D74B 3ICLA 3IWXA 5B0EA 3AY0A 3HSDA 5BYRA 2PGCA 4HTJA 3ISND 2E29A 2NCKL 4KKOB 4OZ1A 2WB1D 1C0TA 2XC9A 2GJFA 4OX7A 1A9NB 1NUEA 3OFFA 3OSNA 2FC9A 3ISZA 2H3EB 2U1AA 1FX2A 5F0UA 3M8RA 1S0MA 1FF2A 3N5FA 4P6QA 3PR5B 1KOOA 2X7IA 2HFVA 2UVUA 2CNLB 2XMTA 3DMJB 5G0RB 3QO9A 5A6WA 3SSRA 4DPXA 4KIAA 5KG3A 3F73A 3EWGA 3KG4A 1NH8A 3PJ9A 1VBZA 4DR3J 4PQAA 3KMQA 4NYPA 1IKXB 2F8MA 4OZLA 3A8KA 1S9GA 1S4FA 3RR7A 5CXTA 1E6VA 4MYTA 1YJ7A 5FIIA 1MU2A 4E8UA 4MTPA 4ZK7M 2X3DA 2V69A 3PV8A 2DY1A 3TOQA 5ETOA 1FD2A 4TYAA 2ZJRQ 2F4FA 4YP3A 3PKMA 2LA4A 1NM2A 3AOAA 2MSSA 3PX6A 3WZ0A 2DNQA 5E3QA 5B7WA 5DG9A 3CNQP 3KFWX 4K59A 2CJYB 3AQOA 3RZAA 4CNZA 4PYDA 2IC3B 1RT4B 4Z2XA 2FZCB 1S1TB 1VOMA 4QWBA 1FFGB 2W2PP 3DHXA 4NXNF 1U25A 3QWPA 4FXVA 4N5SA 2MKIA 2W24A 1GQEA 2VUGA 3DU6A 3MWBA 4CLYA 4R5PA 2AKWB 3D2WA 3AD9C 2P9EA 2LP4A 2VJUA 1V3SA 4O3OA 3CJRA 3EDRB 4NZ0A 5JXSA 4DV7J 4EYIB 4PWUA 2GVDB 4C8OA 5KFMA 3UDCA 1G7CB 3KLEA 4ZP9A 1N52B 2PE8A 1H98A 4AXIA 4GKJJ 2F8EX 3FEYB 2C3UA 3UD4P 1F5CA 2Y3YA 3R3TA 3R5BA 3A8EA 2FJXA 4ZKAA 4B9LA 4FYYB 2VHGA 1KFSA 4UW2A 5E3PA 1TR0A 5AXKA 3RAXA 2IRUA 4OYZA 2BOPA 2IBKA 4MKVA 1QAIA 4A8KA 1SBRA 3I4PA 4JYAF 1TTHB 3WC0A 4NWBA 2CJXB 3DRPB 2YWEA 4DV1J 1PYTA 3MM6B 4FF1A 1Q7LB 3QSIA 2WONB 3TAMB 2CQGA 3M8ZA 3TEGA 4K50A 1QD1A 2HQGA 1CSJA 2DNYA 2HLUA 4I1TA 2VG5A 2UU9J 3JSBA 4RWXA 4LF4J 4NYOA 3DOLB 4Q0BB 5KG6A 5B0FA 2IBOA 2LQ9A 1UEVA 2AGOA 2V2VA 3LWMA 2MPUA 1VQMS 1RKJA 4BLGA 2XGPA 3BR9A 1H2VZ 5D4PA 4LF2A 2I8EA 3TZWA 2FC8A 4U96A 1HR0J 3R6GB 4ZVQB 2YH0A 5KFQA 3Q22A 4MT1A 1VRUA 1WG5A 4DV0J 3SV4A 3LP0B 2YQ1A 4I2PB 4CM2A 2YWHA 3M7VA 3BO4A 2E9ZA 2AJQA 1WOOA 4USJC 1FNOA 1OMSA 1LXJA 4LT6A 2AQ4A 3FMWA 1IR2A 4KFBB 2HAFA 1QVGR 2P6TA 1M5SA 2LU1A 1Q0NA 3EXCX 3H90A 3NP5A 4P7TA 1RTDA 2MKSA 4YFUA 5DZ6A 3N4WA 4OZ3A 4KGZB 2NR0A 4X65J 2RHSB 2XCAA 3CF5Q 2ZJQQ 1VC6A 6AT1B 2UXCJ 2C2NA 3CCZA 1N54B 2XCPA 4QU6A 2XBPA 3J7YI 2AV5A 4UF4A 2CPXA 3J7Z5 3G2XA 3MR5A 2E9RX 3Q2TC 4AQYJ 4KPCA 4DFJA 4W98A 2QLWA 3OLBA 1S77D 2W7AA 3IXQA 5DDQC 3I0RB 1EETB 5HQ8A 1ZAWA 1XNRF 4IOAQ 4NI2B 2DEJA 3V81A 1WHYA 2HIQA 1M1KT 2UUBF 4LF9J 1RE1B 1WF2A 1GH8A 4CLFA 2D3ZA 3W5YA 5I3QA 4DV5J 3MMCB 3PRBA 4KHPF 3A13A 1FWPA 1OPIA 3GV7B 1EB0A 1VQ4S 2CQ2A 1NZAA 1Q81T 3OTOJ 1RT7A 4CLUA 4DUTA 3HULA 3UDVA 3VF0B 2OLWA 3N5BA 1S10A 4GKKF 2YY3A 1NJYA 2XGQA 4DQQA 3MPDA 4QQBA 1EX8A 2B6AB 3FSXA 2DVIA 5E3RA 2JLEA 1F60B 4U7UD 5IC4B 4ECUA 3UD3P 3RU0A 4Q45A 1HI8A 4C0BA 3BGRA 4I7FA 2CQHA 4O4GB 4ATNA 3TZXA 1EAYC 4JI8J 1ZA2B 2WBMA 2KT3A 2QMXA 5GMEA 1IJEB 2HLTA 1BWVA 3O2IA 4G1PA 2FLOA 2ACYA 2NS1B 5IWAJ 4K7QA 1MMLA 5CYMA 3JYTB 1S76D 5KFRA 2J9EA 4Z7YA 1N5TA 3HF5A 1JJ4A 1ICEB 2XWXA 4WXWA 4HDGA 1SH3A 1QY7A 4F02A 2Y0SD 4QIWD 1R8PA 1S6OA 1V3RA 3M2RB 3MPVA 2AGPA 1SJ4P 2DR5A 3NCPA 2ACMA 3IBFB 3DLKA 3AA8A 4U8YA 4DR5F 2CJKA 1JMTA 2YKNA 3R7BB 3H42A 1HNWJ 1NZ8A 2D69A 2EFVA 3BO3A 1D8ZA 4ID5B 4Q5VA 2QLFB 1CS4B 3OT9A 4DV2F 9RUBA 2AGQA 4F8RA 3MM7A 5F8MA 1RZMA 1DRZA 4ZP7A 2LU2A 3CWJA 3ZTPA 2CDRB 4IFVB 3DXSX 5KFOA 3KTQA 5CAAA 2GQ2A 3ZTOA 2P6SA 3P5TL 3ET6B 4HT5A 2QA4G 2ZHOA 2DXFA 1X7VA 2JVRA 3HVAA 2YKPA 3D0IE 4ITSA 1TFYA 2V8DA 2WW8A 3UN5A 4I68A 1U09A 5L8RC 4BHQA 4UOHA 1I5OB 3Q8UA 3M9OB 1KVIA 4G1QA 3BYRA 4WK3A 3K89A 4R0JA 3UCUP 5DM7Q 3R8YA 3A3OB 4HI2A 1IJFB 4ZPDA 2UU9F 3EPGA 2O5DA 1AZSA 1WDTA 1X4HA 1IXKA 1IKYB 3KJVB 4NLSA 1F2GA 1NK8A 1NK9A 3PYDA 3RBZA 1MN9A 1S97A 1G1XA 4OI6A 1PO6A 4RW4A 5E33A 3TR5A 4B9NA 3VGSA 2BKOA 2N3OA 1NCLA 1C0TB 4KAIA 3TWZA 4R5PB 4RZRA 1VR6A 2YQ3A 2AIRB 2Y1LB 2FB0A 2YKAA 3BYPA 3GPAA 1FEEA 1BQMA 4O44B 5D0GA 3ZZTA 2QA1A 2FVQA 2HFZA 3DOMA 2CPEA 3U1NA 5C2CA 2Q43A 5ETTA 1XTZA 2VPWB 1UVLA 4TY9A 2D41A 2DCUB 4F36A 4ZVUB 3Q8RB 2IM3A 1B0VA 4M5IA 3A1YG 1AUSL 1NU4A 2ZH1A 5J2NA 1EARA 1NRKA 4OYMA 2HZCA 4WE1B 5JVHQ 3DGVA 2POKA 2ZNZA 5CYMB 2BABA 3GJRB 4J9QA 2J0SD 1S12A 2OFHX 3C6TB 1JLBB 1YX2A 1G3OA 2A0FB 4LIWA 1BUXA 4ZOSA 2B0GA 1V6HA 4DU8A 1LEOA 1HW9A 3M2RA 1TELA 3DLLQ 2CAJA 1IKVB 1YZ7A 5B0DA 3FCVA 4X64J 3RW6A 4YOEA 2D9OA 2R3VA 9ATCB 2V9WA 1KTVA 2OHDA 4PQUA 3BREA 1RTIB 4DL5A 2VODA 2E5LF 2HWTA
chains in the Genus database with same CATH topology
2AJ4A 1XC9A 1FJEB 4JV0A 4RKUC 1WEZA 3EYZA 4LSLA 2RKIA 1QAYA 1RT1A 2M52A 3JTNA 4I67A 3CEDA 4PXCA 4DLEA 3V6DB 2ZVSA 3KMSA 3PIOQ 4ZPBA 1S48A 1X9WA 3MMBA 3QJPA 3KK1A 4WTYA 1Y4ZB 1LW2B 1HMVB 2ASYA 4PPDA 5HP1B 2BM0A 2DNHA 5GADU 4H4MB 2E5IA 1KQKA 1NJWA 2F3JA 2E9TA 3H5SA 1UVJA 5I3UB 2DB1A 4HLBA 4UQTA 2EI5A 3KHLA 4JV1A 2P9CA 4MK8A 3SV3A 3CCRS 4TKTA 2G4BA 2GW8A 4ZVEA 3H4DA 2GIRA 3IRXA 4H4KA 5GADI 2CQ1A 1KVJA 1DLOB 3OVBA 1QUPA 2FVRA 2JWNA 1FEHA 2M2BA 4KO0B 4M5DA 4JI2F 5K14B 1NKEA 3BZQA 3FSYA 2J0QD 3QJLA 2YNGB 3RAMA 2IYIA 1HBOB 3FVYA 3HVRA 2XLIA 5B09A 4EBDA 1X9MA 4AL5A 3QO9B 2PN6A 2FTRA 1FRXA 5DDPC 2NREA 2JEFA 1JJHA 1U2RA 2M5YA 2XLJA 4RU9A 1RISA 2XEXA 1WG1A 5HL7Q 3V6JA 2CJAA 3KG0A 4N8NA 4B08A 1NK0A 2DGTA 2FLNA 1D9FA 1BY9A 2LYVA 2RQMA 4ECTA 1GTHA 4OZ5A 1L3KA 1S1VB 1Y9OA 3E01B 2XSJB 4DR1F 4OI0A 2VOPA 5DGAA 1FTRA 1NAQA 4RUAA 1KLMB 3EGWB 4DLGA 3T6BA 1U24A 3G86A 2JX2A 4OI2A 3CCES 2PD1A 3PZPA 3BSAA 2IA6A 3C6TA 4IG0A 4BWMA 4OX6A 5KFLA 2V8HA 4OZJA 4G6VB 4KPYA 5AXLA 5AE3A 2R2TA 5BYQA 3SCLE 1WHWA 1ZOTA 2RNEA 4PQUB 3RB3A 1IM4A 2OPRA 3MAQA 3OVAA 3BR8A 2KJVA 1HWLA 4CO1A 4J9QA 3JTPA 3CJ3A 1XBWA 4NA1A 3FGVA 5DG8A 4MH8A 2YH1A 4LUBA 1TKXB 1UP1A 1R8AA 1S9EB 5A0YB 2XULA 2FHOB 2ASDA 4K4UA 1UA0A 1YJVA 1S9GB 2ZOFA 4QW8A 2FJEB 1VHFA 2VFSA 2R9LA 2NPIA 1H7WA 1R27B 3HO1A 3R27A 3KK3A 1HQEB 4L3NA 3MD1A 1W2IA 4EWTA 5IZHA 1WF1A 1OS5A 4ELTA 2LDIA 3GFHA 2FJDB 4JI4F 3BN7A 5K8NA 2HVHA 2DJWA 5F8LA 1X5PA 4OI3A 3Q23A 2EBGA 3SFGA 2GQQA 2PIIA 4ALZA 1WI8A 4F4ZA 4EFAC 5B08A 3UCZP 1GXTA 2ZDOA 2FJAB 1TL5A 5KTQA 4HTIA 1JLCA 2QV6A 2KDOA 4DL6A 5H1SV 1T03A 3G6YA 4JI3F 3NMAA 1X8DA 1M90T 2HVZA 1UJ4A 2R7XA 1YVFA 5KFHA 1YG0A 3O5TB 3KYLA 1ZH5A 1S72S 2ROEA 1B0TA 1Q79A 3R5AA 2MQNA 3OUYB 4NYZA 1VBYA 2DNOA 5IQQA 2OAUA 5FLXY 2CPYA 4Y65A 1H38A 4O3QA 1NKBA 2GHPA 4WU2A 3GV8B 2ZC4A 2HWHA 2GJ2A 4RW8B 3P96A 5KT5A 5L1JA 4F3QA 4PRFA 1OQ3A 1IKVA 4A48A 1DQAA 5GAEI 3VAGA 1ZTWA 1JXEA 1XERA 2R7WA 4ILMA 3HMJG 1XMBA 4QPTA 1F9FA 4U9RA 3F56A 5IM0A 1R8HA 1YWXA 3CCMS 5F9LA 4B9MA 2HS4A 2QZ8A 4K4TA 1H0HB 2L9WA 2ILYA 1XN9A 1LWFB 3HLUA 1TL3B 3HVTA 4TXSA 5LSLA 4YB5A 2UXCF 3MM9B 5DGBA 5I3PA 1PC5A 3KHGA 3QIDA 1S6PB 4R0EA 1SUQB 4D3HA 4HKQA 5B0AA 2DNLA 4O4GA 4AUKA 2HAIA 1RDRA 1N33F 1FVQA 1JLBA 5L38A 4PUOB 3LF0A 1TKXA 3MOJB 4DR7F 1JLCB 2COLA 3J7ZT 2R4FA 1K9MT 4NLDA 1DLOA 4NLOA 5B0BA 4AL6A 1B7FA 2QSWA 3FQKA 3W2VA 2HW3A 2GHVC 1MWYA 1OPZA 1K8AT 4K4XA 2PC6A 2KH9A 1TZ0A 2Q1LA 2M3DA 3LP1B 3IC1A 4Y2AA 1B0PA 2J7UA 3GB0A 3G6XA 1REVA 3M05A 4WCEQ 2F40A 1TL1B 2AX0A 2CJQA 3KLEB 1X9SA 3MFHA 3O1LA 5I42A 4JOUA 3EX7B 1RI7A 2LEAA 1BQXA 1ZPVA 1S1UA 5K8PA 5K9FA 1DTQA 3NRBA 2W9CA 2DBBA 4ES3A 1HPZA 1UAWA 4NZ7A 5A6PA 2DNPA 3MR6A 4ED0A 1T03B 1WELA 5MAOA 1DTTB 1FA0A 4NA3A 2UV8A 1D8YA 2CZ4A 3OR1A 4X4OA 2K1RB 2MZSA 1S1TA 1VK8A 3R1HA 1IKWB 3MECB 2DGQA 3PRDA 4HH1A 3IRXB 4KRWA 2FHJD 3IRWP 3CMES 5L39A 2DGWA 4WF9Q 2XMKA 3V4IB 1LWFA 3IFEA 3THTA 1LOUA 3TRGA 2WTFA 3MM9A 3UR3C 3MM8B 1IBKF 3QZ7A 1XR5A 2IYGA 2VBZA 2RSQA 4DMZA 4J9MA 3HHEA 1GXUA 3DRXA 2GMHA 3E3XA 4TLQA 3H4BA 4DF4A 2Q79A 1G2EA 3L3CA 2XG8A 2CVIA 4QIEA 3ZZZA 3U02A 2C3OA 4EU0A 2A1BA 2B4OA 5CZVA 3KHRA 2JL9A 2XB2D 2MSTA 1RQ0A 4IFVA 2YTCA 4EO6A 2YKMA 3I87A 1ZETA 4LSNB 1EP4A 2CJ9A 2MQMA 3MEDA 4YY3F 4A8XA 5HLFB 4RNMA 2K8GA 2ZD1B 3EGZA 5F9NA 3HHKA 3F41A 4BBYA 3KLGB 4C3KA 2MB0B 4B9SA 2BZ2A 3DOKA 3GV5B 4IG0B 5LMUF 1RT6A 2JEJA 3MMBB 5CYQB 1DTQB 2JFKA 4ZPTR 1IBLF 3B4MA 1WEYA 3K5LA 4DF8A 2LQBA 3QGIA 5A8RB 3CCSS 1VQPS 1LW0B 5KFVA 1CLFA 3TO8A 4YB1P 1QTMA 3PHEA 4C8KA 2J9DA 1BQMB 2IA0A 2U2FA 3DRRA 3GG0A 4IFYB 4RUHA 4ECSA 1U1KA 2WAQD 1NH7A 1FKAF 2GNKA 1J2VA 1Y5LB 2GV1A 2Q6BA 2AYGA 3UPFA 4OZ0A 3LO3A 2KZMA 5LL6d 2PDAA 4I7FB 2ROPA 1VQNS 1L3SA 1VMBA 1U7LA 3CE8A 1O0PA 1FJGF 1X5OA 2CPJA 2FUG9 2CRLA 2LCWA 5J2PB 3OVSA 3H40A 1U1RA 3RRGA 4ILLA 2YNGA 3I0SB 3CMAS 2CIMA 3I31A 4EBEA 2R7VA 1R31A 2ZHAA 3GFXA 2P9GA 3ISNC 1UETA 3DDNA 2L48A 1TKDA 5KG4A 4FS2A 4XIUA 3FFIA 2CQ4A 1FKOB 2RIJA 3GWCA 4PG4A 4QZVB 5D4LA 4ID5A 2Y1JA 5KAKA 1FVSA 1HQUB 2D9PA 2YNHB 1HNIA 3V6HA 2OMLA 2ZBIA 3O8WA 3CDAA 5J1PA 1S49A 2WOMB 3QIPB 1WNEA 2XLKA 2HHSA 1TKTB 4B3TF 3CPWR 1X4DA 1XK8A 1KLMA 4C3MA 3CCUS 1WTFA 3MMAA 5KG1A 2IRXA 3VAIA 1RT6B 1NHUA 3M2VA 3LUYA 2A3JA 4ZPAA 5SUHA 1SIZA 2ZE2A 5CCMA 3POTA 5ITHA 3LGNA 1GX6A 3K5NA 1YI2S 1NJZA 3BQ1A 1UVMA 2M8DB 2AJ1A 3ITHA 4TU7A 4HHJA 4A8YA 4DQPA 2HHQA 1QE1B 3H2LA 4PPZA 3R1LA 5L9NA 1YRUA 4KQZA 3FCHA 7FDRA 3SXLA 3MEGB 3LH2S 1EP4B 4NXMF 4IFYA 2VG6A 4Z37A 2OSRA 4ZVGA 2JH3A 2HFNA 3DHWC 2CQDA 3M6XA 3DLBA 1Q8IA 5DS7A 3O3LA 4TU8A 2R2UA 3IA0A 2EW9A 3CJ2A 4DL0C 3O6QA 1HL6A 2X1FA 3OL7A 2DO0A 2A18A 2CJBA 4Y0FA 5KG2A 2E1MC 1IR0A 1UW4A 4U7UK 4CT9A 1FXLA 4NLYA 2MKJA 1KQFB 3NGDA 2KM8C 3T3FA 3GE9A 3J81Y 2JFDA 2BDPA 3LANA 2VD3A 5EDWA 3KK2A 2VA2A 4RW4B 3CC2S 2EVZA 5KFGA 4OIXA 4URQU 2BA9A 2XI3A 1FO1A 3CDWA 5F41A 2WOMA 3QIPA 4NLQA 3OJUA 3ZC4A 1NK6A 1FHTA 1HNVA 2C3MA 1ZZFA 1FK9A 4DV3F 1SL2A 4ZMMA 1LW2A 1JKHB 3CJKB 2CQ0A 2LQ5A 2CPIA 1TL1A 3MF5A 4PR6A 1HD1A 1R8BA 4RNFA 1VQOS 2GX8A 1S7HA 3TAQA 1TVRA 6FDRA 3CJ0A 1ELOA 1TV6B 2GGPB 4F2RA 2XZWA 3S01A 2W25A 2VBXA 1HPZB 1SJ3P 3JSMB 3AA9A 4IQXA 3PNIA 2VC0A 2RQKA 3NS6A 5EGYA 3VAKA 4DSIA 1LXNA 3CIZA 2VOOA 1M5HA 3I32A 2RKIB 1ZZNA 4PWDA 4P2SA 4J9RA 5C5JA 1UFWA 3D1QA 3M8SA 4ZS6A 4NLWA 4A8QA 4DL2A 2MKHA 2FVCA 1IBMF 4WK1A 4RBVA 1SH0A 3IR7B 1WF0A 4K4WA 3CCQS 2YVSA 4AFFA 4IRDA 1N32F 5H9EJ 3C46A 2R7OA 1TUVA 5C24B 1YGYA 2ZH5A 4TNOA 1FNMA 2FLLA 2UVWA 3HHLB 1ZTTA 3CULA 3M32B 2RQCA 3D1OA 2R8GA 1FRIA 3UDLA 3I5CA 3OHAA 3TANA 2BE2A 4DQSA 4Q43A 3CDBA 1IN0A 1VIOA 5KFAA 1X4FA 4WU3A 4X4SA 1J5OA 3I96A 2GFFA 3B8HA 3ZZRA 1RKIA 4QWEA 2I5JB 2ZNYA 1KR4A 4J9SA 3T1YF 3NS5A 4FF2A 4TU9A 3K0JA 4GKJF 2ZD1A 2YX7A 3KHHA 2D1CA 4F2SA 2MZQA 2GMLA 1RA7A 3GR1A 4XAKA 2HGMA 4FXWA 2EG1A 4KGMA 3KK2B 1VQLS 1BLUA 3JB9k 1HYSA 4C2MA 4C8NA 1SJ1A 1OO0B 2M8HA 2HS0A 4UUXA 3PM9A 1N6QB 4QU7A 3IR6B 2BJDA 4Y3CA 3UE2A 4WFZA 1X4BA 3C66A 1VIXA 4KHMA 3VZIA 4DL7A 1ZYQA 3K58A 4N77A 4NCAA 1VQ9S 3N79A 4ETZA 3DXBA 3E01A 5DDRC 3T1AA 1S1WA 2LA6A 1D0EA 1X4GA 4QCLA 1LFWA 3IR5B 2OFGX 4HVZA 4A8OA 3EXYA 2QO3A 3MEEA 1HQEA 5G4DA 1TAUA 4ELVA 1APSA 2K2PA 4Q8FA 1MWZA 3V4IA 4DSJA 4C98A 5KFZA 3WBZA 4CO3A 2DIUA 2OPQA 4I0WA 3ZZ0A 3BDPA 3TW0A 2BVZA 4ED5A 4QJVA 1VJWA 2CPDA 1YHQS 4KGKA 1FRLA 2AYBA 3MURP 2ZJPQ 2BRLA 2G9OA 1FE4A 3J7A1 2OTJS 2VG6B 4M94A 1LK5A 3IO1A 3CCVS 5DDOC 4X4RA 4URSA 1RT2A 3T9ZA 4B9UA 2DR7A 2CQPA 1TK5A 1SI9A 2RDIA 3CCJS 2VV5A 1N48A 4ERDA 1IQTA 2NPFA 4LFCF 3H5XA 2L08A 3GFZA 5L1IA 1WACA 2EFOA 4ZPVR 4IOCQ 3PVXA 1SL0A 3NMRA 3SDEB 2KHCA 3MZIA 4QOTA 4KV8B 5CQGA 1C0UB 5BJRA 1X0FA 2ZKUA 1E6VB 4ECQA 3MOZA 3KK3B 2QLXA 3R5CA 1CQMA 1YSJA 4WYWA 1WTBA 1QSLA 2PT0A 1D1UA 3CDEA 1HARA 3LAMA 1OSCA 4AE5A 2ZOMA 1HBNA 4DQIA 4ZCIA 1RT3A 1UJ5A 2LXUA 3C3LA 2EBEA 3OTCA 4MMOA 1YJNS 5EWEA 4X84A 3B78A 4URGA 4TQRA 3PACA 2ZH7A 3G96A 2IM1A 1FRKA 2C28A 3NL0A 1KQSR 1C1CB 4RX6A 4R8UB 1HWUA 2FJWA 2K7JA 2MJNA 3KLFA 4NRTA 2WB4A 3U27A 1BWEA 2OP5A 4Q2LA 3H5UA 4OJ1A 5K8OA 1RAJA 2JC0A 2XI2A 3T1HF 1ZM4A 4ZP6A 4I2QB 1AUDA 4RU2A 2KB2A 1R3NA 2IFXA 3F44A 2HGLA 2J9CA 2E7XA 4ZPCA 1RT5B 3GG1A 3H25A 1S0NA 3FZ2A 4K2XA 4USIA 3RTVA 2QT7A 4M5DB 3DN9A 3MM6A 5KG0A 4C3LA 3FNNA 4A47A 1D3WA 3DLGA 5CA5A 2B9YA 2J9DE 3NWGA 1JK9B 3G8TA 3T5LA 3NCQA 3AH6A 2DITA 2DNRA 4RLEA 3DM2A 4FN5A 2EG2A 2KFNA 4DS4A 2R7QA 5DLFA 5CYQA 3JYTA 3V6KA 2HGNA 1CEZA 1WD6A 4KR0B 1RA6A 3HI9A 1Y5IB 2KT5A 3C8YA 2P5VA 3LP2A 4BWJA 3OL8A 2IAJA 1QVFR 1W2BR 5FDLA 2BJEA 2DT9A 2RDJA 1VK3A 2UXDF 2R7UA 1Z2ZA 5GAGI 3OTDA 3OSPA 4OFZA 3TUZC 4RBUA 4J9OA 2F9JA 3SSSA 4ZCMA 5E0OA 2B51A 3HM9A 1OQ6A 1HWIA 4QW9A 1IKWA 3MECA 2HNDA 3TVYA 1RK8A 3BSOA 2NLWA 3UCGA 2BYCA 4TY8B 1S79A 2NSBA 1HBMB 3Q0AA 4X2BA 2Z0GA 2ZUGA 2VG5B 3OPKA 4E98A 2DGSA 1TP7A 3HFKA 4RWWA 4GO5X 4JI7F 3I0RA 4Y2CA 2CFXA 3SMZA 1N4LA 4DSKA 1T3NA 3OFGA 2HMIA 3RR8A 5I42B 2HHUA 4I56A 2HQIA 3QYYA 4DQRA 3NAHA 4WFBQ 4OZNA 2G0CA 1VRTA 2EFPA 4NLPA 3OR1B 3M9NB 1RTIA 3LQVA 2DNZA 1DTTA 2HRUA 2ROGA 4KB7A 3M32A 1KONA 4ECXA 1NO8A 2M70A 3LW5C 3JSRA 4RW6B 4N56A 3J80Y 1R0AA 1YJUA 1GAOA 1VQKS 2F4VF 1FCAA 1NK4A 4QR2A 4B02A 1YIJS 2HG4A 4ZP8A 4G3IA 3AHPA 3DLEA 1MROA 2O1PA 2W4CA 4UY85 1H2TZ 5D8HB 5HMWA 3OXGA 1C2PA 2GHWA 2YNFA 5J1EA 2KFYA 1P1TA 5FDLB 3OR2A 3GIMA 2NUUG 2PSZA 3V5RA 5IWAF 2EWHA 4NRUA 4WZQA 4U6PA 5J2QB 3ZFVA 5F8IA 4XK8C 3DLKB 3OL9A 4E0DA 3MI7X 4AXJA 4A8MP 5D4NA 1HHSA 3K8WA 3T6JA 3M4XA 4EZ9A 1MNEA 2PA8D 3KLIB 4KO0A 2V8VA 1SXLA 3JTOA 1TFWA 2YX4A 4RW8A 4DFKA 2J7KA 3FDSA 5HP1A 3LP2B 2N3LA 4L6V3 5CCLA 1X5TA 5HLFA 4F3OA 4DV0F 4Y00A 4ZVHA 3OLAA 4DV5F 2MZRA 1GX5A 3PX0A 2HMIB 5GVQA 5EWFA 2Z2MA 2RF2A 4M95A 5E2QA 1SJQA 2VQEF 1CPZA 2C2EA 2E1CA 5A8RA 3NNAA 5IFMA 3NBPB </