5M5DA

Structure of the gh99 endo-alpha-mannanase from bacteroides xylanisolvens in complex with mannose-alpha-1,3-d-glucal
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
347
structure length
347
Chain Sequence
LGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of Shape and Charge to the Inhibition of a Family GH99 endo-alpha-1,2-Mannanase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens xb1a
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 71
total genus 131
structure length 347
sequence length 347
ec nomenclature
pdb deposition date 2016-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 5m5dA00
4EK7A 4HZ8A 1JZ5A 3WY1A 1KFWA 3AQUA 5FCZA 1M01A 5A1AA 3VDBA 1VEPA 1D3CA 3PZ9A 2XGIA 4U5IA 3WIJA 4AEEA 4D6CA 3ARUA 1VFUA 4LX4A 2V38A 2Y2WA 3WF4A 2PBOA 2WHJA 3K8KA 3ZOAA 1HT6A 4UQCA 4ACZB 3OZPA 1R7AA 1EQPA 1OT2A 3GXMA 5HNNA 1CLVA 2J25A 2YIHA 1CYGA 2J7CA 2WMFA 5AC5A 3T0DA 4GZIA 3AIVA 1J12A 4J3VA 2VRJA 4CD5A 4D1JA 3II1A 1K9TA 1G94A 3BMVA 1HJSA 2W62A 1D7FA 2E8YA 3W37A 2V3FA 3ZJ7A 3L4ZA 3AMGA 4V28A 2WCAA 1G9HA 2OWCA 4BQ2A 4B15A 4CU8A 1QPKA 2WXDM 3TA9A 4MPKA 1K9FA 4PMDA 1NWSA 1M04A 2VMFA 1WZLA 2X05A 2WM0A 3AIUA 1FH7A 5A6AA 1MQRA 1DTUA 3J7HA 1AQ0A 2OYKA 1PIFA 4UNIA 1C7SA 4DWSA 5AYIA 3S6TA 3WH5A 4H7VA 4CVWA 2G3NA 4MB4A 4PMXA 5BCAA 1HXJA 1OBAA 1V3KA 2GDVA 1JI2A 1L8NA 2CESA 2D0FA 1MXDA 3B9DA 2A3AA 2XUCA 3GBDA 4M82A 1H5VA 1W32A 5M3WA 1CGYA 3U5YA 4TTUA 1LL6A 3QR3A 4J3WA 1KGXA 4AZBA 3EDFA 9CGTA 2GFTA 4MB5A 4AD3A 3RO8A 6CGTA 1XH2A 2XSBA 4GZEA 3AHVA 3CHDA 1EO7A 4AXNA 1BG9A 4KRTA 3TP4A 2VX6A 2DQXA 1A47A 2W92A 3F5KA 5D9OA 4IUGA 5HPCA 3CO4A 1MW2A 1XH1A 1I1WA 2OYMA 3CPUA 3ARWA 5FKYA 4LXFA 1HF6A 1V6XA 1VF8A 3NUKA 1KCLA 1PZ2A 2YA1A 1J10A 1TG7A 2D20A 1G01A 3DHUA 3NIYA 3WQ6A 2NT1A 3MKKA 1V0NA 3AZSA 3CHCA 1S46A 3U5UA 4WKFA 1CIUA 4JL2A 3VD5A 3TONA 5JIPA 4ATLA 2W5FA 5I78A 2D1ZA 3GXFA 4N0RA 3WH8A 1QOXA 1P6WA 1TA3A 1KR1A 4W8BA 1GHSA 1VIWA 4PMOA 3AS0A 4PMQA 2Z1KA 4OUEA 2VZSA 1G5AA 3A47A 3CZKA 3K8LA 3I3DA 2ZXBA 4FF5A 4HZ6A 3PHAA 2EBNA 3D3AA 3IJ7A 2BY1A 4FLQA 1ISZA 3RM4A 1H41A 2UWFA 3FW6A 1QW9A 1UHVA 4TVDA 3CLWA 4TXEA 1JF6A 4M1RA 1AQMA 1EA9C 1UKQA 4JFUA 3GBEA 3W0KA 2E9LA 1JDDA 3AXXA 3BAIA 2J78A 4UZUA 2WBKA 2YA0A 4HU8A 6A3HA 3FHAA 3KL5A 1C90A 3UERA 4MNJA 2AMGA 3F5JA 4AD0A 2CERA 3M6DA 2IXUA 2J47A 1UWIA 4MDPA 3W27A 3GNRA 1JNDA 4AD5A 4HMCA 1PIGA 1WPCA 3WFLA 1CGTA 2BHYA 4F79A 4AMCA 3BC9A 1Q4NX 1W1VA 3KWXA 5A8NA 4PBGA 1XSKA 3SCRA 1V6WA 4PYSA 1FFRA 3RCNA 5JBEA 2WYSA 1GVYA 3MUIA 5LA2A 4JHOA 2Z1SA 1B3WA 1E0VA 2UY5A 1JYVA 2VQTA 2WC3A 5ABFB 1VBRA 1LWHA 5CJ5A 1E43A 3MMDA 2VRQA 1A3HA 1JZ3A 2YL6A 1UQYA 4UQEA 3QOMA 2XWEA 3ALFA 2GJXA 2JFEX 1WCGA 4P7OA 7A3HA 1US3A 1E55A 4FLSA 3VILA 2FHCA 4KRUA 2WMGA 1E56A 3N17A 1F4HA 3K4AA 3IANA 3ZJKA 4AZ6A 5E9AA 3L4YA 4OJYA 1JFXA 4W7UA 1QNOA 1OB0A 4RE3A 1JFHA 1H09A 2YL9A 1G0CA 4WLCA 1KQZA 1UD6A 4PTMA 1HJXA 5FL0A 1HKMA 5JBFA 2O9TA 4CD6A 1PEZA 1BSIA 1WZAA 4UR9A 3VNYA 3WSUA 5BXRA 2W63A 3THCA 1K9EA 1H4PA 4D6IA 2WKLA 3F5LA 4QDMA 2J7DA 4W87A 1DP0A 2DIJA 3BCFA 1CXEA 1GJUA 3T2PA 4UOQA 3VMNA 4B3LA 4B9ZA 1UWUA 1SMAA 2J7FA 5E70A 1QNQA 2WMKA 3MUY1 1CENA 1V08A 3PZNA 1MW0A 1E4MM 5BXPA 2XIIA 3AZRA 3OBAA 4AIOA 1KWGA 2CBVA 4H2CA 1DWFM 4V2XA 4C7GA 3RDKA 1J11A 3WF2A 1ECEA 3OG2A 5EFFA 5CSUA 4V27A 1JXJA 2WVVB 3AHXA 1B3XA 4TTGA 5E6ZA 2ZX5A 1IV8A 1QHPA 1XGZA 2ZIDA 4KGJA 3HU7A 3PZTA 1W1YA 4CN4A 2W61A 3BLKA 2E9MA 4NF7A 2NSXA 4AYSA 5A2CA 1CGUA 4JKMA 4XZWA 4KGLA 2VCBA 4DUVA 1C7TA 2J75A 5I77A 4B16A 3W4RA 2UY3A 1ODUA 3MV11 1R7OA 4PTWA 1EH9A 1OWQA 3AS1A 4D1IA 2PWHA 1E6ZA 2XHYA 3WUGA 1WZKA 4UOJA 1MYRA 4MTVA 3GNPA 1LLOA 1ISVA 4ZFMA 1CXKA 1WNOA 4OKDA 1RD6A 4ML4A 4K68A 3GNOA 5A94A 3U7VA 3BMWA 1UH4A 1NP0A 3WDRA 2G3JA 1KXVA 1E40A 3SCVA 5AYBA 3BCDA 1KGUA 5A95A 2YKKA 4L4OA 2XYLA 1V6VA 3WF1A 3UEQA 2F8QA 4NSBA 5BROA 3W53A 4S3JA 4QAWA 1UUQA 3AIWA 5I0DA 2YLLA 1HP4A 3WL1A 1ESWA 1XSJA 1WO2A 1H0GA 5D4YA 3N11A 3OB8A 4QLJA 5ABEA 3WNKA 1VEOA 3RJYA 3WQ8A 1VFOA 3ARQA 1UWQA 3VIJA 4JZ5A 3CZJA 4UOZA 1GCYA 1MFUA 4TUFA 4WKAA 3VIOA 1VAHA 3VIMA 2OWXA 4JFVA 3L4TA 3VOCA 1ZJBA 2WVSA 5HPOA 1UWSA 3CUHA 1ISYA 2VI0A 4NI3A 2ZX8A 4CCDA 4UCFA 3FN9A 1GOQA 2UY4A 3LPGA 1TFVA 4CKQA 3SCWA 2O9PA 1OIMA 3OLDA 1J0ZA 1GOWA 4QP0A 5A2BA 1V3LA 3DYMA 2WKGA 3QHNA 3POCA 3THDA 1NOWA 1TA3B 3L4XA 3VIPA 2J7GA 2BXYA 4DWSD 1CECA 2GJPA 3ZT5A 2GSJA 1E6NA 5A6BA 3NYDA 4HMEA 2PF0A 4TX6A 3WUFA 3A4XA 2VJXA 3WEOA 4D6JA 4Q22A 3WDHA 2DSWA 3WMSA 5FIPA 3MMWA 1RP8A 4LYPA 1HJQA 3MV01 4UZSA 1C3FA 1W9BM 2Q8XA 2ZE0A 2WW5A 4UQDA 4U33A 2C0HA 4HOWA 2X8RA 2G3IA 8CGTA 1UKTA 2BY2A 1CEOA 4GQRA 2ZUMA 2PB1A 4AC1X 4AD4A 2EO7A 2CCRA 2V3DA 3WMCA 2DPEA 3HJEA 1UH2A 2WMJA 4M24A 4AZHA 1EGZA 3EBVA 1SMDA 3RM9A 2JEPA 2QPSA 2VO5A 2WZEA 5GPRA 3ZMRA 2J77A 5E0CA 3WBEA 2WHKA 1GNXA 2X0HA 3A4AA 4P8UA 1GQLA 3GH4A 3ECQA 3AHTA 1XCXA 4LPCA 4CD8A 1CBGA 1FOBA 2WVVA 2XTKA 4QLLA 4HP5A 5BXSA 1F4AA 4ATWA 2FHFA 2PWFA 5FOOA 4P7LA 2O9OA 2WHMA 2YDSA 2CNCA 1PZ3A 1J0HA 3ZR5A 5HBFA 3AS3A 2F61A 3PZGA 1E3ZA 4JFSA 1Y7VA 3N15A 4XUYA 3VPLA 3IAPA 1KCKA 2ZX6A 5M17A 3FXYA 3RILA 3K8MA 3ZM8A 4CGTA 4PCTA 3T2QA 1JZ6A 3FAWA 2J7EA 1CZ1A 5D9MA 4JAWA 4FK9A 1HVXA 3QGVA 4EE9A 2WVUA 1VEMA 3UG3A 1CTNA 1V3JA 2VRKA 3CUJA 5C70A 4UQBA 1W3LA 3NDYA 4MB3A 1J9YA 3PZOA 3CUGA 2VC9A 1KWKA 2D3NA 5DO8A 2J8FA 1HL9A 2XM2A 3WQ4A 2V3EA 2TAAA 1W2PA 4JIEA 5D9PA 1BHGA 1TE1A 3OZOA 1NQ6A 2XVPA 2PWDA 3TOPA 5AC4A 4UQAA 1HKIA 5A2AA 2X0YA 3RIKA 4AISA 3WNPA 1EQCA 3POHA 3SCQA 4ACZA 2D0GA 4R27A 4OBRA 1DWGM 3CZ8A 2QPUA 2CBJA 3O2LA 5ABFA 2W67A 3BSHA 4J28A 4WK9A 4RL3A 5CQ1A 2DSZA 1UD8A 4PTVA 3B8SA 3VIIA 1E5NA 1QI5A 4EAMA 1UKPA 3AXIA 3EMCA 1JGIA 1OT1A 3AJ7A 1DWAM 4E4PA 3GH7A 2X2YA 1FP8A 4UFHA 1PBGA 2X09A 2YLAA 3DHPA 3N12A 2Y8VA 5IFPA 3CMJA 1LJYA 1WZMA 1GONA 5JIWA 3GTNA 3BXWA 1JI1A 3PZVA 3VD9A 3DYPA 3BAWA 4RE2A 1E3XA 3VMPA 4MAVA 4YHGA 4NRRA 3SUUA 3LPPA 3WBAA 2VR4A 4PSRA 5D9NA 1SFSA 4OOZA 2EPMX 3F4VA 2XM1A 2EPOA 1CXFA 3NCOA 4TVCA 4MNMA 3KE0A 3MUAA 2XJ7A 4IISA 3WD2A 2OLHA 3AICA 1E70M 3OGSA 2YL5A 2IUZA 3BGAA 1XC6A 4AZIA 2E40A 1E6QM 2ZUSA 1D2KA 1EDGA 4Z2KA 1AMYA 3OLGA 3PTQA 3NSXA 2EEXA 4MNLA 1KBBA 3ALGA 4FLOA 4BQ5A 5A8OA 2Y24A 3VDHA 4P7QA 5CLWA 3VGFA 3AMLA 3UG4A 3FY1A 1FH9A 1EOKA 2WMHA 1E6RA 4IPNB 1LG2A 4UFLA 5BXTA 1XCWA 1QNSA 2J7HA 5CPQA 1HJUA 3RM8A 4UQ9A 5FD0A 4DWSC 1JYNA 3ARZA 1KXQA 2WC4A 3D5HA 1WDPA 3T0AA 4M56A 4MB1A 3VM5A 1K9DA 2YBTA 2WPGA 4JCMA 4AWEA 2J4GA 4D72A 3WDPP 2VOTA 1NOFA 1CGXA 5I5RA 3SIMA 3T0BA 2VZOA 1DEDA 2VT0A 4GKLA 2WAGA 1PX3A 5A6BD 2J62A 4QFUA 2RGMA 2FGZA 2W66A 1X6LA 3W28A 4TX8A 4P8XA 2JIEA 3MMUA 4F8XA 4UFIA 1H11A 3WD3A 1GOKA 3GDBA 1R87A 2F2HA 3N04A 1GQJA 5A6KA 4KWUA 3ARRA 3CIVA 1IT0A 1UR2A 3VX0A 3BSGA 3LPOA 2JF6A 1GJWA 3NDZA 1EHNA 4XB3A 4CN6A 3VGBA 5CXPA 1B3ZA 2J79A 3SEPA 1V02A 1HJWA 3APGA 3O9NA 3EMZA 1UD4A 1W9XA 4D6DA 3IJ8A 3KL0A 1QHZA 2ZUWA 1UH3A 3MSGA 5CGTA 1HX0A 2QLYA 2WHLA 1QNPA 4QCFA 3OA5A 5AY7A 2QV4A 3M07A 1MFVA 1Q6EA 1TUXA 1E9LA 3BLPX 2VL4A 4IPLA 1V3MA 3VKKA 5FL1A 3A4WA 1CLXA 2WLYA 3ZSSA 3M46A 1EIBA 1E6PA 1AQHA 3WD0A 3ZSTA 2A3BA 4WSKA 1PJ9A 5I24A 1Z32X 1CWYA 1E15A 2WLZA 1OD8A 2VNCA 2EJ1A 4W93A 3VIFA 2XFYA 3PZIA 3I3EA 4W5UA 3AHZA 2VX7A 3WF0A 4PTXA 3DECA 4W86A 5EBAA 4D71A 5LA0A 1W1PA 1JG9A 3BH4A 4WKHA 3CMGA 3WF3A 3W24A 3EDJA 2G41A 3AS2A 3CHEA 4X0VA 4Z2IA 1U2YA 1UYQA 4JKLA 1W2VA 1UA7A 2EPKX 2MANA 1B2YA 3W6LA 4ATDA 4AW7A 1OSEA 2XVLA 2WWCA 1MVYA 4HA4A 2E4TA 1GOIA 2D3LA 3SUTA 1ZBWA 3ARXA 3WNMA 3LMYA 1HJVA 3WUBA 1JZ2A 1WKYA 1OGSA 5DFAA 4W8LA 4WJXA 3VDCA 4HOZA 2WCSA 2CHOA 2WBGA 5ECUA 2WZIA 1TVPA 1YHTA 3GZAA 6TAAA 1M7XA 4QCEA 3VTRA 2O9RA 3SCUA 4MNKA 1BAGA 1XH0A 1ZBCA 2DSKA 2E8ZA 4CN1A 1WDSA 1QI3A 2G4FA 3L4VA 5HDRA 3WD4A 1XRVA 3WMBA 2J7BA 2VURA 1XD1A 2BHUA 3NSNA 1GUVA 2Y4SA 4YHEA 3OGVA 5I3DA 4ZE5A 3VGGA 3K1DA 2E3ZA 2C8NA 2WCGA 5D8WA 1HN1A 3AROA 4W7VA 1EHAA 2XWDA 2Y5EA 3SUSA 5KZ6A 4C7FA 4BQ4A 1E6XM 4LQ1A 4PMNA 2D2OA 3M7SA 3IJ9A 1TCMA 5KEZA 3AMCA 1ZL1A 5DT5A 4HOXA 2WK2A 5DT7A 2ZX7A 5I2UA 3QOKA 1CDGA 4X0NA 1E1EA 3MUZ1 1VBUA 4R5EA 4GO8A 2QMKA 2EQDA 3AYRA 1W9VA 3N1AA 4U3CA 1W9UA 3ZR6A 1V0LA 4OBSA 4GQQA 4GI6A 4WF7A 2GJRA 4CD4A 4YN5A 3DC0A 4XX6A 3OLEA 3AXHA 2DT3A 1V0MA 2D23A 1EOMA 1DHKA 4Z2GA 1V6YA 4J3UA 3S2CA 3VD4A 4NZCA 2DSVA 1H1NA 1BLIA 4DWSB 2DDXA 5EFDA 1E4LA 1W9PA 2JF7A 1ISXA 1Q6DA 3AISA 3VVGA 2ZXDA 2XVNA 1MW3A 3CH9A 1B31A 3ARSA 1US2A 2XFRA 4W8AA 1J0JA 1IZJA 1H0IA 1N82A 4D6HA 1LF1A 1UZ1A 5LYRA 1JDAA 2ZXQA 1KR0A 1PX4A 1YQ2A 2V5DA 2CKSA 4W5ZA 3VM7A 1NH6A 2D24A 1W91A 5HXMA 3VUPA 4HTYA 1UWTA 1BTCA 4Y7EA 2WC7A 2VVSA 2CEQA 1JAEA 1OIFA 1X1NA 2VZTA 3WH9A 1O6IA 2PBGA 2XVGA 1J0YA 1JD9A 4HA1A 1B0IA 1MW1A 2CPUA 2YJQA 4U2YA 1IZKA 4Z2JA 2B31A 2DH2A 1QW8A 1W3KA 1Q6GA 1G1YA 3WN6A 4HPHA 3WNLA 3OIHA 1I1XA 3AOFA 4MADA 3QHMA 1BQCA 2DT1A 3VIKA 5A3HA 4OOUA 1V02E 1BVNP 1HKJA 4J3XA 5EMYA 4PMVA 5GQBA 1GVIA 1TR1A 1GOMA 4Q7NA 4B3KA 1GQKA 4HA3A 1JNEA 4P8VA 3UESA 4AZ7A 1JDCA 1LWJA 4W84A 1UR1A 3PBGA 1EXPA 3KL3A 4JFWA 4CD7A 2WVTA 3GH5A 4CU6A 4AEFA 2EPLX 2GK1A 2GVYA 3TTYA 2ZOXA 4FLRA 4JFTA 1UOKA 3CHFA 2CIPA 2VCCA 4MAZA 1GQIA 2DT2A 1DWJM 3E1F1 1NM9A 3TTOA 2D0HA 3DYOA 1JL8A 4GO9A 1FHLA 5CGMA 4CUCA 2GJXB 4GZJA 4J3SA 2W91A 2XSAA 2VTFA 1B1YA 1B3YA 4H41A 3PTMA 3GXDA 3WH7A 3VDAA 1MXGA 1JXKA 3A3HA 4MJ2A 4ACYA 4ZXOA 4KH2A 1KQYA 2CYGA 5I23A 1E0XA 1V3HA 1C93A 1OCQA 3VMOA 1J01A 1E6SM 2WSPA 3VD3A 3WDIA 1W9DM 2DH3A 3VU2A 2BFGA 2DGAA 3CZGA 2BVTA 3SURA 3WNNA 4MDOA 4PMRA 2VX4A 1XYFA 3W25A 1QNRA 1XV8A 3NSMA 1GOOA 3FAXA 2G3MA 3B9AA 4BZYA 4ZXLA 1UR4A 1XD0A 4U31A 3W81A 5JBDA 3EDDA 3HN3A 1ZBKA 3AIRA 2CBUA 3RMEA 2WB5A 4W89A 1UG6A 3EYPA 2BVDA 3G6MA 2VQUA 5A6LA 1CPUA 3VX1A 4JKKA 1E73M 1K6AA 1JZ4A 5ABGA 2C7FA 4P8WA 1JZ7A 1X6NA 3ZT7A 4URIA 1C91A 2YDRA 1UD5A 2VCAA 3ARPA 1ISWA 1ZB5A 2BNJA 1FA2A 3L2LA 4EANA 4OZOA 2E9BA 2WSKA 3UR7A 1UD2A 1VRXA 2HVMA 1ITXA 3EMQA 1W1TA 3G6LA 2QMJA 1NWTA 4GI8A 3OLIA 2RGLA 4CCEA 1FHDA 3O6AA 1Q6FA 1UR8A 2WZHA 3VO0A 3AMDA 1LL4A 4ZENA 1CXHA 5TD4A 4X9YA 2OYLA 5GNYA 4UFKA 1M03A 4M8UA 3WEMA 1C8QA 3PTKA 4KMQA 2HISA 1FH8A 4J27A 1B30A 1UR0A 4XZBA 2ZUNA 1CXIA 4WIWA 2YL8A 3ARYA 4A3HA 5CZKA 1MQPA 3I3BA 3VGEA 4D6EA 2E0PA 5DMYA 4AD2A 1SR0A 3CGTA 1JZ8A 5A8QA 2ZICA 3AIEA 1NWRA 5C8BB 4DUWA 1U30A 4Z2HA 1CNVA 2A3EA 3MS8A 5IXEA 4PN2A 4W88A 1M53A 4PEEA 4J7RA 4PCSA 5A6SA 1TVNA 1ZJAA 4U5KA 3WL0A 1GHRA 4M29A 3CZLA 1QI2A 1UWRA 1EO5A 4PUDA 5IHRA 2DSUA 4TOQA 4W7WA 4UFMA 4HMDA 2AOSA 2EPNA 4F9JA 2CETA 3ARTA 3WENA 2PI6A 1DWHM 2CBIA 2EXOA 3EDKA 2FH6A 5CPTA 1BPLB 1WB0A 4DUXA 1JD7A 1KGWA 3CTTA 1Q6CA 3CUFA 1CGWA 5GNXA 3PZUA 3W26A 3U57A 1BVZA 3VINA 4GIAA 1E0WA 3VD7A 3SCNA 4PMZA 2G8ZA 4BS0A 3JUGA 5C71A 3HMCA 5IHSA 4RE4A 1L0PA 3WFZA 5BYWA 5A6MA 5F7UA 3L4WA 1QI4A 3B9EA 1GW1A 4D6GA 1J18A 3ZQ9A 1W3JA 2DT0A 4JCLA 3WUEA 1UD3A 4F66A 3SUWA 1ITCA 1V3IA 3RJXA 1QVBA 1RPKA 3WKZA 4P7RA 4GI9A 1KXHA 2YA2A 5EB8A 1BYAA 1XSIA 2GUYA 1J0KA 3QHOA 4AZGA 1NARA 3ZO9A 1UKSA 1UA3A 1V6UA 3AIBA 1NP2A 4WSJA 5M5DA 1OINA 4J3TA 3GYCA 2Y8KA 7TAAA 2WMIA 5CLTA 3VGHA 4CVUA 3ZJ8A 4MJ4A 4L4PA 1E4NA 3AFBA 2CXGA 1HNYA 3VIHA 1GPFA 1O7AA 3MU7A 3N18A 1VENA 2D22A 1PX8A 3W38A 4BA0A 2DIEA 3PZMA 3WQ5A 5A6JA 3CBWA 2JIWA 4U2ZA 3NJ3A 3MANA 4BQ3A 2VR5A 5D8ZA 4Z2LA 4E8DA 1TMQA 3PN8A 5E09A 1WDQA 1SYTA 4CU7A 4N42A 2VVNA 2OWWA 1QBBA 1QBAA 1WP6A 2DEPA 8A3HA 3RPMA 2PC8A 1WDRA 4TVUA 3L2MA 2J74A 2IXVA 1VFFA 1LG1A 4NRSA 1OGGA 2FH8A 1JIBA 1VJSA 1U33A 3EDEA 2FHBA 4H8UA 4DM1A 1PAMA 2A3CA 1QI0A 1OD0A 3IK2A 1FP9A 4HZ7A 1I75A 5BRPA 1RP9A 4ZEPA 3UCQA 1HVQA 2QF8A 2PWGA 2WNWA 2ZWZA 4YPJA 2WMIB 3BAKA 3W29A 5E6YA 4AZCB 2NT0A 2YDQA 1LQ0A 1BYCA 1J0IA 3KEHA 3ZT6A 3U7BA 2BXZA 2GDUA 3WNOA 2VZVA 3UR8A 1RH9A 2O92A 1C8YA 3WQWA 2CKRA 2NW0A 3IAQA 2YOCA 2JE8A 3GXIA 4A4AA 1HIZA 3WDJA 3OGRA 3WDQA 3A6OA 2ZXAA 2JEQA 4PRWA 3SCPA 4A3YA 2BY0A 2ZX9A 5IDIA 1JYWA 4ZE4A 1BFNA 2BVYA 2XPKA 1MQQA 5DF0A 1HKKA 1E71M 1CGVA 2OSXA 3ZJ6A 7CGTA 2ZUUA 1BGAA 1E5JA 1VFMA 2VX5A 3BAYA 2ZUTA 1V03A 3VGDA 2OSYA 1GORA 1HL8A 2BS9A 3K46A 3T09A 4S3KA 4B9YA 2XVKA 2UY2A 5I79A 1CXLA 4F9DA 5DEZA 2GK1B 1UZ4A 4FMVA 3PZQA 4LYQA 1H2JA 4M80A 1OGBA 4H04A 5E0FA 4OIFA 1KB3A 3CZEA 5CSYA 4AIEA 1ZS2A 2XG9A 4DM2A 2XIBA 5JUVA 2VUYA 2FDMA 1KBKA 1JAKA 4UTFA 3N13A 1HP5A 4EKJA 3KZSA 3AYSA 3W6MA 5GNZA 1DWIM 3WH6A 1BYBA 1UQZA 4PSPA 4AZCA 4PMUA 1OM0A 4H8HA 1E72M 4D6FA 1BG4A 3FHQA 1H49A 1E4IA 4HPGA 3AZTA 3SCSA 1B3VA 1UR9A 4JHZA 1FFQA 1C92A 3CUIA 4P7NA 3UG5A 4CCCA 1XYZA 1B90A 4E2OA 5CG0A 4AZ5A 4PUEA 1JYXA 3T08A 3WD1A 2BY3A 2OSWA 1R86A 4C7DA 2XGBA 1JF5A 4JL1A 1BYDA 4BCEA 5A69A 2V5CA 5LA1A 3UETA 3SUVA 4HU0A 2ZWYA 3N9KA 5BRQA 2AAAA 4M81A 3BAJA 3GM8A 1QHOA 3LPFA 1BF2A 4QLKA 2V3GA 2JALA 2A3HA 2J8GA 1WE5A 1E1FA 4UFJA 3SCOA 2ESCA 1VB9A 3W82A 1MWOA 1PPIA 1KXTA 4GINA 3VNZA 1EDTA 1W3HA 2VZUA 2YBUA 5A8PA 4IM4A 4LGXA 1UKOA 5I6SA 1ZU8A 5HOSA 3K4DA 4AIUA 4H8VA 2CHNA 5CPSA 3FNDA 2BV9A 1ODZA 2WWDA 3WEZA 5A8MA 5BWFA 1ZBVA 4U3AA 3TTQA 4LYRA 1V0KA 2XFFA 3MO4A 1R85A 2BHZA 2PWEA 3WELA 3ZIZA 3WQVA 3AMKA 1R8LA 1TZ7A 3ARVA 1NOUA 1B9ZA 2X1IA 5ABHA 3AI0A 3SCTA 1C8XA 4PMYA 3BAXA 3T2OA 3L4UA 3VIGA 1WAWA 4E8CA 4BF7A 1XHGA 4AD1A 5M03A 1NWUA 3AIQA 2CITA 2FGLA 2ZUVA 1EDQA 1VJZA 2WANA 4XV0A 4W85A 4GPNA 3MSDA 3TTSA 1AVAA 2W4XA 3AHYA 4GXPA 1GZJA 4AY1A 2QHAA 1BGGA 1LL7A 1H3GA 5IFTA
chains in the Genus database with same CATH superfamily
4O1DA 4HZ8A 5DMMA 1A50A 1EGMA 4KERA 3HG5A 3CMFA 3A23A 3LSBA 3WIJA 3L68A 3ARUA 4LX4A 3B8VA 4J2MA 1RPXA 2WNNA 3EXSA 1HT6A 3WJYA 1IXPA 3Q45A 3QXBA 1LUCB 4GVIA 1OT2A 3GXMA 4Q8TA 1EP2A 1CLVA 3ITYA 3ONCA 3GAKA 2GWNA 4M5PA 4LU0A 2R24A 3T0DA 3AIVA 4GYJA 3WJWA 1F6KA 4NQ1A 1GWJA 4PR4A 1XLAA 3OTRA 1OFBA 2E8YA 3CUXA 3W37A 3LXAA 3TWBA 1K1DA 3PNZA 4V28A 4KWSA 1JEZA 4IQEA 3LDVA 2C0AA 3TA9A 1K9FA 1NWSA 2GUUA 3PWAA 1K77A 2R8WA 2Q3OA 4QGCA 2X05A 2HJPA 2WM0A 3AIUA 3H24A 1JQXA 3BVJA 1MQRA 2E1WA 3J7HA 2NX3A 1XLMA 4NZ5A 4DWSA 5AYIA 4MFDA 3KUMA 1KTCA 1OJXA 2PE4A 4GVHA 1OBAA 3B3DA 4WRHA 2E7FA 4DZHA 3QR0A 1CX9A 5DBUA 3CL7A 1FBAA 3R4IA 1MXDA 3V4BA 4XAFA 2FLIA 3GBDA 1H5VA 1W32A 8XIMA 1A5CA 4PZVA 3QR3A 4J3WA 3IV8A 5D37A 1I0BA 4MB5A 3RO8A 1XH2A 1V77A 3ERPA 5K2ZA 1A47A 5D9OA 3K13A 1MW2A 3NL6A 2OYMA 3KM8A 3VDGA 4Q3MA 1VF8A 4NAEA 1KCLA 5LKYA 1PZ2A 4HPNA 1ZNNA 5D2TA 3DHFA 1PDYA 3M4HA 3DHUA 1GKQA 2CZ5A 4C6CA 2FB3A 4I3GA 1DKWA 4GGBA 4A35A 3CQJA 2HK1A 1S46A 3MCOA 3SJ3A 1RA0A 4YCPA 1CIUA 3IJ6A 5JIPA 2OELA 4WDUA 4ATLA 3E9AA 1VFTA 5C9XA 2BB0A 4YTQA 4GABA 2ZRUA 4KFPA 5I78A 4LUYA 2B4GA 3FVDA 3N73A 1P6WA 2ZVIA 3R79A 4W8BA 3LMZA 1K7XA 2CWXA 3S9ZA 3P6LA 4IP4A 2NQ9A 4OUEA 3DBNA 3GYEA 3QMRA 1YNQA 4OUIA 3BQ5A 3I3DA 2H9AB 5I3IA 2DVTA 3PHAA 3E0VA 2EBNA 1M5WA 3IJ7A 3SY1A 4B2DA 4UIOA 3NVDA 3RM4A 5REQA 4JQAA 1K8ZA 3W7QA 1QW9A 4TVDA 2A4AA 3W1UA 3H7UA 3HF3A 4R7WA 4ADTA 1A3WA 5FEZA 3ME3A 4JIPA 4HVXA 2AL2A 4DO4A 1EF3A 5G4HC 3BAIA 1DV7A 3DEQA 3UERA 1X98A 3GG0A 4GK8A 4RNJA 1Z42A 2J47A 4MDPA 3W27A 1S5TA 1JGMA 1BKSA 3W83A 2O4MA 2PSNA 2EG8A 1Q4NX 3KWXA 3SB0A 4DXVA 5A8NA 3SRFA 3RXZA 2VC6A 2KZHA 3RRXA 4C65A 1V6WA 1SFLA 2Z1VA 3MUIA 1B3WA 1E0VA 2PTDA 4U28A 4N2YA 2UY5A 2G4JA 2O4QA 1VBRA 4INFA 3OVRA 3IVSA 4J2PA 5FJTA 2VGIA 1IEQA 2YL6A 4RW5A 4TR9A 4L1GA 3A5VA 2R94A 2CFFA 3N17A 2R9RA 2G96A 1F4HA 2I9UA 1WV2A 1B4EA 3E74A 1BRLA 3N4AA 4IIGA 3RITA 1QNOA 3APYA 3ABZA 2J6XA 1OB0A 1H09A 2WNZA 5HMDA 1KQZA 2R1PA 2Z7KA 5DBTA 4PTMA 5JBFA 4CD6A 1BSIA 2W63A 3THCA 4F4RA 1H4PA 4ICNA 5B80A 2WKLA 2XINA 1PKMA 2J7DA 2Q6ZA 1W5OA 1GJUA 1Q2SA 1YXYA 4E8GA 3BUVA 2J7FA 4GNJA 2WMKA 1CENA 1V08A 3PZNA 3QW4B 1E4MM 3M0XA 3NURA 3XIMA 1P6CA 4KEUA 5BXPA 1TV5A 3WLLA 4GC4A 3OBAA 4ROQA 3W7OA 1U5HA 1J11A 3W1QA 4V27A 3AHXA 1B3XA 4AH7A 1IV8A 1TTJA 4PE8A 2RJHA 1SQ7A 1QHPA 1EF2A 3BLKA 4NF7A 1CGUA 4XZWA 4B5SA 2VCBA 4DUVA 1C7TA 1XKJA 2QVNA 2UY3A 3MV11 6XIMA 1VCFA 1BXNA 3RFAA 2YXOA 1VFSA 1SO6A 2W0UA 2PWHA 3B03A 1K3UA 4S38A 1UMYA 4UOJA 1MYRA 1H60A 1R2SA 3CO8A 1ISVA 5CZTA 4ROPA 3MT1A 2V63A 3KBSA 2PWVA 4ADUA 3NQ8A 3P93A 1XICA 3WDRA 1A4LA 1KXVA 5AYBA 3S47A 3PM6A 1KGUA 4DF1A 1O60A 2P8CA 2PDWA 4NSBA 1QFEA 3W53A 1ALDA 3ZLHA 4GHRA 3JZEA 4QAWA 5I0DA 1SW0A 3UPMA 2FJKA 4LT9A 1R47A 3M0LA 3N11A 1UUMA 4ZB0A 5ABEA 3HV9A 1VEOA 1GVEA 2W3ZA 4LH8A 3WQ8A 4ZA0A 3DFOA 4LUJA 3CZJA 3QH2A 3CHVA 4TUFA 2BXVA 1EP3A 3LCIA 1ADSA 3KDOA 4JFVA 1MUWA 2WVSA 1IWPA 4A22A 1UWSA 3ZVIA 4K38A 2ZX8A 3FN9A 3RCMA 1TFVA 2BLEA 3SCWA 1AL8A 1Q7QA 3LLFA 3NOYA 3QSTA 4Z17A 1WX0A 3E0IA 3POCA 3QPYA 3U9IA 3FEQA 3U0HA 4LAMA 1NOWA 3L4XA 3VIPA 2I5QA 4UTMA 2RDTA 1OADA 4AVOA 2GJPA 5DANA 1IEVA 2GSJA 3NYDA 4HMEA 3A24A 1OVDA 4GQBA 3WDHA 3ZVHA 2NQ5A 1NDYA 2X30A 4FNSA 3CV6A 4TX9A 5G4WA 4UZSA 3RYSA 4L4MA 1ITUA 5TQLA 3PS7A 3KTSA 2WJDA 3DGRA 1UKTA 3KWSA 4GQRA 4GUHA 3CNYA 3EAUA 4DN1A 3E2VA 1F8MA 2VYOA 4BR1A 2CCRA 2V3DA 3CUZA 3WMCA 2WMJA 3C2FA 3W7DA 1Z41A 4LYKA 1SMDA 1R5YA 2PTZA 1MO0A 1PCKA 2HRWA 3NQVA 2XH2A 3RGTA 2R82A 2J77A 3W23A 3WBEA 4P8UA 4HHMA 1GQLA 4LRTA 3TQPA 1RBLA 4CD8A 1CBGA 4QDWA 3W7NA 3CAQA 1JULA 3OYZA 2ISWA 4K36A 3OOQA 2IPGA 4HP5A 2DP3A 2PU1A 2CLHA 3UY8A 2PWFA 3THAA 1I45A 5D03A 1RLCL 5HWJA 4MWAE 2O9OA 4PB5A 1GYLA 2WSYA 3IIZA 5HBFA 2F61A 4JNMA 1A5SA 3BOLA 3RILA 4AF0A 2OEJA 3TNOA 4CGTA 3T2QA 4MWAA 3FAWA 2PDQA 5F2IA 2J7EA 5AC6A 1HVXA 5E9XA 1CTNA 1V3JA 1XBYA 3M9YA 3TYDA 3W7JA 4KEZA 4MB3A 3PZOA 1KWKA 1BRLB 4IICA 2AKZA 4Y6GA 2O7QA 4GYFA 2X1UA 3WQ4A 4JIEA 2PODA 4GG9A 1LQAA 3VZYA 3FFSA 4QNWA 3TA6A 3WNPA 3FA3A 4ACZA 4QS6A 4OBRA 3FKRA 3EKLA 4O1CA 2Y85A 2W67A 3OVGA 3TYZA 5K9XA 3V5FA 3THUA 3VIIA 1SU5A 3AXIA 1JGIA 2FJUB 4H01A 3UA3A 2H3BA 2IKHA 2BASA 1OYAA 2YLAA 3PUEA 2Y8VA 1LJYA 3FYOA 1KBLA 1WZMA 3T40A 3G1AA 3DYPA 1E3XA 4MAVA 4LF1A 4KWVA 3WK0A 3P84A 4ZODA 5CBIA 4NRRA 3D3FA 3LPPA 4QBXA 1SFSA 2Y1HA 2AL2B 2EPOA 1REQA 1ZCOA 4WOQA 1EBHA 1W5NA 4FHAA 2XISA 3RG6A 1OF8A 4FEZA 2YL5A 2IUZA 1H1YA 3BGAA 4AZIA 1DJNA 4LAKA 4DBDA 1AL7A 1B9BA 4Z2KA 3OLGA 3E0WA 1LTDA 3NSXA 1KBBA 4BQ5A 5A8OA 4RK8A 4P7QA 2H9AA 5G1YA 4ZL1A 4H83A 2ABBA 1JPKA 3PY2A 3U2ZA 1RZMA 1LG2A 4NZJA 1XCWA 4Q8QA 2J7HA 2Y6ZA 5CPQA 3RM8A 4QSHA 2ISDA 2CLOA 4DWSC 1JYNA 1I2PA 2PF8A 4XVEA 1WAUA 3EB4A 3T0AA 4M56A 4MB1A 3GHTA 1K9DA 4KESA 2FPVA 2HQAA 3TJXA 4H6EA 1YYAA 3WDPP 2VOTA 3S46A 1PWLA 5I5RA 1DEDA 4J4KA 4DXXA 2VT0A 2A7PA 3W3OA 1PX3A 2J62A 4LBRA 2W66A 2PDLA 1O68A 2QJMA 2P0OA 3FCPA 1R87A 3VE9A 1SZFA 3N04A 1GQJA 4KW2A 1XLDA 3ARRA 3QLDA 4K1WA 1XKYA 3RPTA 3CIVA 1IT0A 3RLUA 3LPOA 3NDZA 4R9XA 1PHWA 2XN2A 4HSNA 3H21A 3PPCA 4UTKA 1B3ZA 3SEPA 1SZEA 4Q32A 1HJWA 3CH0A 4L9XA 1MZHA 2Y5JA 5HQMA 4IJRA 5CEWA 1BWKA 3MSGA 2W27A 3NQFA 1TZZA 3L21A 2QV4A 5CSSA 1QXLA 1R3SA 2VEKA 3H55A 3RO6A 1OCNA 3VKKA 5FL1A 3A4WA 5G1TA 1CLXA 3M46A 4R9OA 1EIBA 1E6PA 1E0UA 1IE7C 3WD0A 1AQHA 4HNLA 2A3BA 5CJNA 1XIEA 4C60A 3MP4A 4W93A 3M44A 1VZWA 3I3EA 4QJ5B 3SN4A 4AUBA 1EP1A 1B4KA 1W1PA 4LAZA 3BH4A 4K7YA 1Y5VA 4RCXA 3EDJA 1RR2A 3AS2A 3BANA 3CHEA 3URNA 1U2YA 3DHDA 2MANA 5IBXA 3W6LA 4XUGA 1DJIA 4NNBA 3E12A 2XVLA 4MZ8A 2E4TA 3T05A 4KQNA 1ADOA 1GOIA 2D3LA 3GD6A 4M6QA 1ZBWA 4LS2A 3KCJA 4N6FA 2WJZA 3VNJA 1HJVA 1WKYA 1OGSA 2IS7A 2PCEA 5DFAA 3V36A 4HOZA 1PZ1A 4ZSUA 5FF7A 1YHTA 1B54A 5I06A 2YB4A 2WV8A 3SCUA 5FJJA 1Q65A 3WLHA 4CN1A 2DSKA 1HG3A 2V2DA 3LCLA 4UTWC 1RK5A 2G4FA 3FV9A 4MYAA 2OG9A 3QC0A 1T0OA 1TMHA 3WMBA 3NM3A 1OFDA 3OGVA 1OC5A 4O8AA 5I3DA 4MFEA 4ZE5A 2DZAA 2HNEA 2WCGA 1WQ5A 3A3WA 1TV2A 4GUFA 4W7VA 3TC7A 3NTYA 1E6XM 3IJQA 4MUPA 1FDYA 2IKGA 3U8GA 1TCMA 3BPWA 5KEZA 4GQGA 3TJLA 5DT7A 1YADA 3WBWA 3H6OA 3C6CA 4R5EA 3D47A 4GO8A 1G4SA 2EQDA 1W9VA 3N1AA 4CEUC 4DPPA 3ZR6A 2E1DA 3R6IA 4AHQA 1VPXA 1YXCA 4JQ4A 1V0LA 1QASA 3S1GA 4DX3A 3BARA 2GJRA 3BLFA 4R53A 3DC0A 1OZMA 2I56A 3CS2A 1V0MA 3MB9A 1EOMA 5EA9A 1DHKA 3VD4A 4L56A 1XLKA 1S38A 1BLIA 5GJPA 5G5IA 2DDXA 1E4LA 3W7IA 1RVGA 2VD8A 1CT5A 3AISA 3VVGA 1IXOA 3ARSA 1OFAA 5BOFA 1FTXA 3A22A 3UY7A 3EWUA 5EMKA 1XLHA 3F03K 4W8AA 4F2UA 1IZJA 4D6HA 2OOFA 1RHCA 1UZ1A 5LYRA 3L23A 1PX4A 1YQ2A 4W5ZA 3DI1A 4S3EA 3GUGA 1WXJA 3C5QA 3ITXA 3R7MA 2ZRYA 3TSBA 5HQEA 1X7FA 2WC7A 1I6NA 1J8VA 1TPEA 2CEQA 1OIFA 1FDJA 2PBGA 1QATA 1J0YA 5IRPA 1CCWB 3TROA 1FWAC 1WYIA 1ZSXA 2CPUA 3UCCA 2YJQA 3NAVA 3LBCA 3PJWA 2DH2A 1W3KA 1F05A 4G8TA 2C6QA 2DT1A 3GZ3A 3QHMA 1V02E 4PMVA 3I7RA 5U4NA 1GOMA 2ZZ3A 2RHGA 1ONRA 1W0MA 3EB2A 1ZY9A 4RZBA 1JDCA 2Q01A 3WQGA 4JQ1A 3GH5A 3BURA 3IS4A 4H1ZA 2PRHA 3G77A 2ACQA 2ZOXA 3HGSA 4FLRA 4JFTA 1DJYA 3DFNA 1AH4A 3U4FA 3MKVA 1D9EA 4ZO6A 5FJUA 2DT2A 1SO4A 7XIMA 3E1F1 5LIKX 3QMSA 2DW7A 3NQEA 4J3SA 5F1UA 2VTFA 3MZ2A 1B1YA 4IIEA 4H41A 4X22A 4O0ZA 5AYXA 3GXDA 3MVIA 1TZ9A 4ACYA 2JKPA 3RUBL 1KQYA 1TO3A 1U1UA 3UXKA 1GEHA 5BWAA 2CYGA 1E0XA 1O5QA 1XLBA 4DI8A 1YPXA 3DBPA 4QG8A 5CKSA 1GZGA 3VU2A 1TTIA 1QTWA 3I6TA 5JH2A 2DGAA 2HV5A 2BVTA 2BP1A 3INPA 2DZWA 4MDOA 3AUJA 3Q4DA 2AAMA 1XV8A 2ZBTA 4XZHA 4ZOAA 2G97A 3B9AA 4BZYA 3G8EA 4U31A 3T81A 1AZ2A 1YDOA 5JBDA 1XYMA 3EYPA 4O1FA 3LRKA 2VFGA 2VXNA 3ZYZA 3ANUA 1VD6A 2XN1A 3DX5A 3T4CA 1K4HA 4P8WA 5REQB 1JZ7A 1X6NA 1IXNA 3G5EA 4C6FA 3ARPA 5K7JA 3LRLA 2GGEA 3DFHA 3IIOA 3KHJA 3KTXA 4OZOA 1VS1A 4ZMGA 2OLAA 3DFSA 2QAFA 2WSKA 4GY7A 1ITXA 3RR1A 2XZ7A 3MDUA 3C8NA 3IUHA 3KRSA 3COTA 1S2CA 4GI8A 1UOZA 2DQWA 3GHRA 5C9ZA 4GVGA 4LVDA 1UP3A 4CCEA 3AUOA 3LLXA 4CQ8A 1VJIA 5CG7A 3SSJA 2WZHA 3EX3A 3UVIA 3R94A 1LL4A 4O4VA 1CXHA 3KRBA 1E9YB 3TTEA 2OYLA 3W7LA 1OK6A 2WSRA 4XK2A 4UFKA 1A4MA 2HBVA 3QLLA 2VFIA 4I6KA 1B30A 1YTKA 2ZUNA 4ZQNA 3KBNA 3OBKA 4G7FA 2YL8A 1TKKA 3ARYA 4XD6A 5CZKA 4NAEB 4BI5A 3VGEA 2E0PA 3GKFA 4S3AA 5A8QA 5HJYA 3URAA 4DWDA 1U30A 4IGHA 3FJ6A 2OEKA 2QCNA 1W1B1 4NYYA 3GVVA 3W6YA 2I17A 4PEEA 1Q85A 4I9AA 1FXQA 3W22A 1ZJAA 3QTGA 4U5KA 2ASHA 8TIMA 5LHEA 3CZLA 3F2DA 3SECA 5TNVA 3IIPA 3PBYA 1VIZA 2DSUA 3TH6A 3I6EA 4UFMA 2AOSA 4L61A 1MEIA 3C52A 4MHBA 4REQA 2WKJA 5CPTA 3STCA 4DUXA 1JD7A 5DMLA 4I90A 4JICA 1CGWA 3W26A 1BVZA 1KM0A 4BF9A 3VD7A 3L66A 1XM3A 3FIGA 2FKPA 3HMCA 4RE4A 4FSAA 3WFZA 5DXXA 5BYWA 1QI4A 4MUZA 3HMJG 2PP1A 2OVLA 3MDWA 4HSHA 1GW1A 2RKXA 1JUBA 4G2DA 4D6GA 3QMTA 2DT0A 4JCLA 1UD3A 4G5DA 1GQNA 2ISSA 3HTWA 4HJFA 2QGHA 4TU1A 3S1VA 3SUWA 4AIBA 1EC7A 4FR1A 1EEXA 5EGRA 5FJIA 4P7RA 3R0KA 4GI9A 1GYMA 1TB3A 1VCVA 2FMOA 5EB8A 5HANA 3TSDA 1BYAA 1DQWA 2DZUA 3QHOA 3AWOA 3LCXA 2YGYA 2YW4A 4AZGA 5L9FA 3BLDA 3UJRA 1EJ7L 2WMIA 2ZZ4A 4NHVA 3TQ0A 4DZIA 4L4PA 2TODA 4EPEC 3VA8A 4LTSA 2FPTA 2IPWA 1A5AA 3PPGA 3MU7A 3H8AA 1CI1A 1VENA 2I16A 3PZMA 1QOPA 2PURA 3MY9A 1MDRA 5CPMA 4XAZA 4ZO7A 4KRZA 4OVXA 3PBMA 4XBKA 5CC3A 5FF2A 4EF9A 5E09A 3EWZA 4N42A 2VVNA 3LXCA 1KTBA 4FXJA 1WP6A 8A3HA 5CC5A 4TVUA 5HATA 4ZB5A 2IXVA 1VFFA 3N3TA 2E28A 2V5JA 4R7OA 2D73A 2NX1A 4C6KA 1L6GA 3E2RA 2BSLA 2FHBA 4H8UA 1PZ0A 3CC1A 1PAMA 2YB1A 1QI0A 3LG3A 4HZ7A 4CNPA 1I75A 3E96A 3IGSA 4O0KA 1Q6OA 3UCQA 4YPJA 4NX0A 4AWUA 2PDHA 4AZCB 3UZZA 4FXSA 4YL2A 3E5BA 2CZEA 3U7BA 2GDUA 3HFTA 3GDLA 3UR8A 3O63A 3I4KA 2O92A 2NX9A 2ZRVA 1UP0A 3WQWA 3F2BA 1OFRA 3O15A 4HNCA 3OGRA 3A6OA 2ZXAA 4WY0F 3IUDA 3TFXA 4PRWA 1KC7A 4GZ7A 4ENLA 2BVYA 2GGJA 3VKDA 1MQQA 2Q09A 1XFCA 3ATYA 1XBVA 2OSXA 2QCEA 1F61A 3SQMA 3GFYA 1HL8A 2V5LA 4OQVA 4WDWA 1HO1A 4B9YA 3W1TA 3C0SA 4U10A 4ONVA 4H6RA 5DCBA 4NJGA 4F9DA 5CCZA 2J9YA 1DBTA 4O50A 3TCSA 1SO5A 2QJNA 1OGBA 5E0FA 4OIFA 4DNHA 4A29A 1D8CA 4E2BA 2PRMA 2JQXA 4FOUA 4UTJA 4IQLA 2XIBA 1KBKA 3W9ZA 3KZSA 3AYSA 3FJNA 3AAMA 3KVMA 4Q7IA 1UQZA 1VPYA 1OM0A 4O17A 4H8HA 4F3HA 3M1ZA 2ZTJA 4JTLA 3UP8A 3ES7A 1E4IA 2IQTA 1TSIA 4HPGA 3SCSA 1R2TA 4ZGYA 1UR9A 4JHZA 1AFSA 1B90A 3MKCA 4P61A 4AZ5A 3ANYA 2OLSA 3WD1A 2BTMA 4S3FA 4FX7A 1X8FA 3QQ1A 3F4NA 1IR1A 3GY1A 1ZP4A 2ZYFA 2PPGA 3MWAA 4LVGA 2QV5A 4LB3A 2CW6A 3NGJA 4JN6A 1KA9F 3N9KA 4UTWA 1H5YA 1VKFA 2ADAA 4M81A 2NUYA 3BAJA 3DXIA 2VP8A 2P1FA 5BW6A 1BF2A 1WDDA 3TYBA 5FACA 4C1NA 4FAMA 3GK0A 3H2EA 1VB9A 1MWOA 4S2CA 2YBUA 5A8PA 2UZ9A 4FALA 4IP7A 1WOAA 3BGJA 5IBXC 5TBOA 3IJIA 1T8QA 2JKEA 4H8VA 2BV9A 2FGBA 3WEZA 3EXTA 1KFBA 2DJLA 2HCVA 5BWFA 1ZBVA 3L5MA 4RUBA 4IGMA 4H2HA 2XFFA 2PWEA 3WELA 3DFQA 4QE1A 3LK6A 3MTWA 1A5UA 2GGHA 2GDQA 2D69A 3ARVA 1HZYA 4NUWA 2X1IA 3CPGA 5DX7A 1Y0EA 3APTA 5LIWX 1TJ0A 1C8XA 1ZRQA 3T2OA 3BAXA 2O55A 1WAWA 4JTFA 3VNDA 4BF7A 2CZVA 5JXQA 1XJBA 1EDQA 4IFRA 4OHQA 3TKFA 1NEYA 4IMDA 2C1HA 5I3HA 1XGDA 1A5MC 3MSDA 1AVAA 3IGHX 3NQDA 4UTTC 4O52A 2GOKA 3SADA 4A2RA 2QHAA 5KTLA 1DJWA 2C16A 1H3GA 4EK7A 3AQUA 4Z1BA 1EJWC 4O15A 4YVVA 1VEPA 5FSDC 2DZXA 3G1HA 4FNTA 3PZ9A 3P8IA 4B90A 4S3BA 4D6CA 4MF4A 3TYCA 3GR4A 2V38A 3RLVA 3WF4A 1FRBA 2WHJA 4KF1A 4YNGA 3ZOAA 1IEXA 4NYUA 1P6BA 1R7AA 1EQPA 1BKHA 4OWGA 2TPSA 3S1XA 3P74A 4IX2A 5HNNA 2J25A 2BVWA 3G1DA 2ACRA 3EWYA 2WMFA 5AC5A 3C2EA 1V7AA 4IIFA 3BG3A 1K9TA 4GYPC 4JTSA 1D7FA 4ILSA 2V3FA 5D04C 3ZJ7A 3L4ZA 2X0SA 1M65A 2WCAA 4CU8A 1QPKA 2WXDM 4MPKA 4PMDA 4IFKA 2VMFA 3GC2A 3ZZ1A 1WZLA 3YPIA 4NAFB 3VNKA 3RX3A 3TW6A 3M0MA 5AVNA 4MZ1A 1DTUA 2OYKA 1PIFA 4UNIA 4BWLA 3OP2A 3WBYA 1SW7A 2C18A 3WH5A 2QDGA 4Q4RA 5J5RA 2R6OA 1JCTA 5BCAA 2E67A 3KP0A 3W73A 1QWKA 2CESA 4JQ3A 4UCGA 3IK4A 2A3AA 3LUTA 4FOKA 4GJJA 4FB7A 1PKLA 5M3WA 1CGYA 1MNZA 3AU6A 1KGXA 3BG9A 4AZBA 3B06A 1O5KA 1RJRA 3WLJA 1J93A 4HJWA 3AHVA 1BG9A 1VBJA 4KRTA 3VKJA 4QG6A 2DQXA 3T6CA 3F5KA 1QPNA 2NQHA 4IUGA 3CO4A 4UTLA 1I1WA 3CPUA 3ARWA 1IXQA 5FKYA 3IGUA 2H8XA 2VGBA 1Y8BA 3Q2DA 4LVAA 2FZNA 4ALDA 1PV8A 2DUXA 1TG7A 2J66A 1F6YA 2A21A 2OT0A 3N2BA 4ZQPA 1UC5A 4RE0A 3VD5A 3K1GA 2OZTA 3V35A 1WKEA 1YPFA 1KKRA 3UU0A 3CAVA 3GXFA 2XIJA 1TA3A 4QAIA 2B0MA 4CNOA 1KD0A 2HXTA 1GHSA 1VIWA 3P14A 2HBXA 2BODX 3LN3A 1T6MA 2Z1KA 2RAGA 5BMXA 1G5AA 2OZ3A 5CC7A 2ZXBA 2PDBA 1F2JA 1US0A 1ISZA 4O18A 3EB3A 1H41A 2UWFA 1ZFJA 4A3UA 1YTEA 3M0VA 1EWDA 4X61A 4TXEA 1JF6A 2V81A 4Z08A 4M1RA 4DF0A 4RNFA 1EA9C 4I9MA 1NFBA 4Y9MA 4RNIA 2J78A 3HPXA 1Z6KA 4B3ZA 6A3HA 3F5JA 1Q6LA 2CERA 4A8LA 3M6DA 2IXUA 3I10A 1TRDA 4AD5A 6REQA 3N2CA 4WX2A 1W1VA 3SCRA 4GC3A 1FFRA 2VD9A 3RCNA 1C8VA 3HGJA 4C6MA 4GJIA 1DYSA 2Q3RA 1TWZA 5LA2A 3TUUA 3TCEA 3SM0A 1THFD 3R0DA 2DUZA 4PRRA 4O11A 5CJ5A 2BBFA 3BOXA 1F3XA 4QJ3B 3IARA 3ZS4A 1O12A 4Q8UA 4DQWA 2XWEA 5D05A 3ALFA 3AJXA 2GJXA 5CC6A 1WCGA 1DJXA 3VILA 4KRUA 1E56A 2VFDA 4Z0SA 4AZ6A 4Z1DA 3L4YA 1PWMA 3NL3A 4OJYA 3VNLA 3GTIA 4GWEA 1HW6A 1MUCA 4IPPA 4RE3A 3AXKA 2GSEA 3BK0A 4K3ZA 2PU0A 3WLNA 2PDUA 1UD6A 3P80A 3LENA 5FL0A 3CU2A 2A3LA 1HKMA 1PEZA 1WZAA 4HZMA 1K9EA 3QZ6A 4BI6A 3IUIA 1LT7A 1ME7A 1XBXA 2XDFA 4AQLA 4KT2A 2E5DA 4NZFA 4ES4A 3BCFA 5AHFA 3DFYA 4C1LA 1NDZA 3GDTA 1SMAA 4IPJA 4NG3A 4WXYA 1UBPC 1TPB1 1MW0A 4AIOA 2YCJA 2ZFAA 1KWGA 2INZA 4DYEA 4H2CA 2FQIA 3GC4A 3M7WA 3OG2A 5CSUA 4C5YA 2X7VA 4RZ5A 2WVVB 2QUMA 3ABSA 1XIBA 4HNTA 3WLTA 2ZIDA 3W2JA 2W61A 3MSRA 3EKZA 1LP6A 3MQTA 5I77A 5FAGA 2QW5A 4O0QA 4PTWA 1UC4A 3AS1A 1E6ZA 3WUGA 5HJXA 4GNVA 4MTVA 3GNPA 1LLOA 1OFQA 3GTXA 4K8GA 1LLWA 1Y65A 3MYOA 3GVWA 2QDEA 4ML4A 5A94A 3U7VA 3BMWA 1DVJA 1F73A 1FWDC 2G3JA 4I9TA 2A7RA 1Q3NA 2YCEA 4G56A 3R11A 3WF1A 2F8QA 5BROA 5FEPA 1HQTA 2REQA 2H90A 4IMFA 3AIWA 1OG0A 1HP4A 5C7VA 3WL1A 1ESWA 4KPLA 1WKFA 4JX6A 4QQ3A 5G1MA 1H0GA 3OB8A 1XIHA 3WNKA 2HS6A 2YZRA 3RJYA 3VIJA 4UOZA 4TMCA 3HM7A 2PP3A 1ONEA 1MFUA 4WKAA 1B3OA 2Z4GA 3EA2A 2OWXA 3L4TA 3VOCA 1YNYA 4R85A 1ISYA 1AG1O 3W7MA 4YTTA 3BO9A 1GOQA 2O9PA 2E6FA 3OLDA 1P48A 3SFKA 1GOWA 2HTMA 3NQ7A 1EX5A 1DE5A 4QP0A 3C2RA 5KETA 3UWEA 3ITCA 4EPKA 2J7GA 5EKYA 4XTIA 4XKYA 4MY1A 1SZNA 5F4WA 2CLEA 2PF0A 3ITOA 3WUFA 3EPNA 3A4XA 1QPOA 1XQKA 1TR9A 1OCJA 2DSWA 3PAJA 3WMSA 5FJOA 2BOEX 2DZTA 4O19A 3IPWA 4FNUA 4B5VA 1ZLPA 4JIRA 3MSYA 4F0SA 1B57A 3IJLA 1BSLA 1I2RA 2Q8XA 3HURA 4HOWA 2X8RA 3V0UA 2FDSA 3TX9A 1NY1A 1F9CA 1KRCC 3ZFHA 3T7VA 3TWAA 2EO7A 3DN5A 1L6WA 3UWWA 4JNYA 4M24A 4AZHA 1K8CA 4XG1A 2ZZ2A 2JEPA 1C9DA 4HYWA 4QITA 3TZNA 3WJZA 3ZMRA 2WHKA 3R0UA 1GNXA 4IZGA 3B0XA 4LAUA 3AHTA 5G2IA 2Y61A 1CB2A 4Y9AA 3M41A 4BEUA 4PTDA 1CLKA 1L6YA 1K6WA 4ATWA 3C3UA 4H6KA 4P7LA 4JPGA 2WHMA 2VWTA 2YDSA 1RV8A 3E3HA 3BDKA 2CNCA 1R3VA 4HKPA 1J0HA 3ITLA 5FF0A 5I02A 5HUOA 3VNIA 1Y7VA 4HGXA 3IAPA 1KCKA 5M17A 1PYMA 3G22A 3EPOA 1EX1A 3CT7A 5DXYA 4PCTA 5EPDA 4JAWA 1VEMA 3M5ZA 1IF2A 3R1ZA 5C70A 4UQBA 2POTA 4WXZA 4S3DA 1HL9A 3V1PA 4Q7BA 4NZ3A 3WLRA 1V8EA 2TAAA 1VYPX 4NJIA 2XVPA 1HKIA 1XL9A 3AC0A 3B40A 5BOEA 1RCOB 3H23A 1DJHA 5AECA 1EQCA 3POHA 4MY8A 4RXFA 5AN7A 4NY2A 4ZFCA 5JU6A 3CZ8A 1DPMA 1TJRA 4FOJA 3O2LA 3BSHA 4RL3A 1X1OA 2DSZA 2F38A 4LEQA 4PEKA 1QI5A 4RV3A 1UKPA 3VE7A 4HT3A 2JBMA 1DWAM 3S6DA 2PDPA 2ZRWA 4IIBA 5AC8A 3GH7A 1FP8A 4I7VA 2X09A 3GG8A 3DHPA 4PUNA 5IFPA 3W7HA 2O0TA 1GONA 5JIWA 3LEPA 4L64A 3GTNA 3BXWA 4YTUA 1BTMA 1UMLA 3UZXA 4IF2A 4RE2A 3VMPA 3N6QA 1GJPA 3C61A 2DORA 1MEWA 1XF0A 4OOZA 1NSJA 4EAYA 4TVCA 4UTTA 2VEPA 3MUAA 2XJ7A 4FO4A 3W07A 4IISA 4IL2A 2CU0A 3WD2A 3TK7A 3AICA 3HQOA 2QJGA 1VFHA 4XSLA 3LBMA 4N4PA 3LSCA 2E40A 7REQB 1EDGA 4NP7A 4CCZA 2GGGA 2EEXA 1AD4A 4FLOA 3B8IA 2QZRA 4H7ZA 4DO6A 1PXGA 5CLWA 3OZYA 3VGFA 3SN1A 4BI7A 2PDCA 3FY1A 1XRTA 1FH9A 1EOKA 2WMHA 1E6RA 4UFLA 1A5OC 2PP0A 4UQ9A 5FD0A 3D5HA 1WDPA 5FEWA 1TPFA 4NAFA 3MCMA 3GHUA 2YBTA 2WPGA 3STPA 4JCMA 2P3ZA 4L80A 2ALRA 4AWEA 3JW7A 3EKGA 5LNUA 3GFZA 3V16A 3HG4A 3E02A 3GNDA 3UXLA 2RGMA 1X6LA 3MMUA 4F8XA 1IHIA 4UFIA 4HCHA 3ABQA 4JR5A 4US5A 1H11A 3W2MA 3CQKA 3GU2A 3GDBA 1IIGA 3WG6A 6ENLA 3FXGA 3WLMA 5C2GA 3VX0A 4QSFA 3WK2A 1W31A 1GK8A 2HS8A 3NO5A 4KEVA 1EHNA 3S2MA 4XB3A 4CN6A 3VGBA 1V79A 2PS2A 5KSWA 1V02A 3APGA 1KM4A 3O9NA 3EMZA 2FZBA 4D6DA 4A8NA 4XBSA 1ZAIA 1LCOA 2QLYA 2WHLA 1QNPA 3CM4A 5BU9A 1J79A 3OA5A 4BY3A 1MFVA 2KAUC 3PUDA 3MVTA 2PTYA 1TUXA 1XIDA 4I7WA 1E51A 2VL4A 4IPLA 1V3MA 4XZMX 4GMEA 3EOSA 3ISIX 2GJLA 5C9WA 1RBOB 3HGOA 5I24A 1CWYA 1E15A 1XUUA 3ELFA 2XFYA 1K03A 4ZOEA 2J9ZA 4PTXA 1H7WA 3USZA 1ME9A 3LBOA 4D71A 5CAKA 1RJQA 4OE7A 3WF3A 4B5XA 5T9CE 2TMDA 1I4NA 4X0VA 3RLGA 2E6AA 3RF9A 1UA7A 1PSCA 4GY1A 3TJ4A 1OSEA 4H9ZA 3DH7A 3WYZA 1RUSA 5C7HA 1RA5A 2QULA 4OFCA 1O4UA 3ARXA 3WNMA 2DFAA 3LMYA 3NL5A 4H9VA 2ANUA 3FGCA 1JZ2A 2IKIA 4UTHA 4PCPA 1Q8AA 4W8LA 4WJXA 3LD5A 1PUDA 1FWHC 2CHOA 4R34A 1LBMA 4CNUA 3GZAA 2BG5A 4L6DA 4QCEA 1KM5A 2O9RA 2GQ3A 5F2MA 1BAGA 2E8ZA 1ZBCA 4XQ6A 3T42A 1QI3A 3L4VA 4IIDA 1NDWA 3WD4A 1XRVA 2OZ0A 1H7PA 4MM1A 1GKRA 3UZYA 2VURA 1SGJA 3S5NA 1QRQA 2Y4SA 4YHEA 1M1BA 4A2SA 2QCFA 4J9JA 2VELA 2C8NA 4LBUA 3DKJA 1P1XA 3AROA 2Y5EA 5I7GA 2RDXA 1XG4A 3TYUA 4BQ4A 4WEVX 4ZVJA 4KBXA 3IJ9A 4LB4A 3AMCA 1ZL1A 3G1SA 3KOWA 5AB3A 2DVUA 2ZX7A 1DOSA 1CDGA 1TWWA 4F48A 1X8CA 1E1EA 1VBUA 4N9DA 4OBTA 4LUTA 3RMJA 1W6TA 4U3CA 1W9UA 3UT0A 1G4EA 1EL3A 4HNUA 4GQQA 3UZJA 4DUOA 2LLEA 5LXXA 1L2QA 2WQPA 4XX6A 3QEZA 1H7XA 2DT3A 9XIAA 3S2CA 2OOGA 3PSVA 1TJ2A 1POKA 4FP1A 3A5FA 1YLVA 5AZ1A 1FWBC 4LBSA 4L6OA 2JF7A 5MHBA 4H3DA 2XVNA 1B31A 4WY0B 3PFMA 3H2MA 1J0JA 1LF1A 1QJWA 1JDAA 1W5QA 3M16A 1FWSA 3QYQA 2V8ZA 3S1UA 3P8JA 3KVKA 2Z28A 1OF6A 3LI0A 4HTYA 1DQUA 1UWTA 3UJSA 4FS9A 4UB9A 1OABA 1P1MA 1JAEA 1X1NA 2VZTA 2QDHA 3B8DA 2DZPA 4JDBA 4QX4A 3LLDA 3CEPA 3KCOA 2GLKA 4BFAA 4HHPA 1GTEA 2DU2A 4JTTA 3B0VC 1VBGA 1IT8A 3ITTA 4U2YA 1IZKA 2DZVA 1Q6GA 3WN6A 1DJQA 3WNLA 3C2VA 1YMYA 5CZSA 1AJ0A 3AOFA 1BQCA 3TC6A 3GU1A 4H9TA 5A3HA 4OOUA 1BVNP 1HKJA 1OCBA 5GQBA 3PANA 3PBWA 1FWIC 3P62A 4HA3A 1V51A 3VOIA 1XS2A 4P8VA 4HHHA 3S2JA 3TN4A 3USBA 4H9UA 1UR1A 1J6OA 3PBGA 1KV5A 4Q8PA 1OHLA 3KL3A 4JFWA 3KBJA 2WVTA 3SAZA 3VUSA 4WCJA 1Q4WA 4C5ZA 1UOKA 3CHFA 4TV6A 4JY9A 4MAZA 5FF4A 2A1YA 3MJMA 1DWJM 3G0UA 1NM9A 3C0QA 4JOMA 3TTOA 2D0HA 3DYOA 1SVDA 3ABXA 4GO9A 2CHRA 2W91A 2XSAA 4AU0A 2E6DA 3NPVA 5ECVA 5FF3A 3DC8A 2HXUA 3LHYA 5M1TA 1MXGA 4MJ2A 2Y89A 3TN6A 1H7NA 4PGLA 4OV4A 2QNEA 1V3HA 1C93A 3N4EA 3VMOA 3EWDA 2WSPA 3VD3A 1OQFA 5JVLA 3V18A 3VI2A 2CLKA 3FJLA 2C71A 3LI1A 3LXBA 3WNNA 2VX4A 3IIVA 4F0KA 2F6KA 3FAXA 5C0QA 3CB3A 4ZXLA 4REQB 3W81A 1Q6QA 2Z2UA 2GVLA 2CBUA 3UF9A 3KOZA 1EUAA 5HINA 4A3RA 5EYWA 2BVDA 1R3RA 3G6MA 5CGQA 2VQUA 5A6LA 1CPUA 3VX1A 4JKKA 1E73M 2C7FA 4GJ1A 4URIA 3PBVA 1MMFA 5EMMA 1VGAA 1UD5A 1ZB5A 1YDNA 4XAYA 1LT8A 5LSMA 3VCNA 3QQWA 3UR7A 3VAVA 3A13A 3F4DA 1TV4A 3PWIA 1W1TA 3G6LA 3SRHA 3N19B 1NWTA 4XO7A 4EXQA 4ZENA 1BEUA 1TQXA 1S3HA 3LRMA 2OXNA 4F0HA 2OO6A 2NQJA 2IW0A 1M6JA 3SGZA 4Y9OA 4ERGA 4J27A 4GIEA 1CXIA 3FJ4A 2VEMA 6PTDA 2QVHA 4K37A 4A3HA 4RDVA 3FYPA 2C14A 3W00A 1JZ8A 3CPRA 2PDFA 5D32A 3L5LA 5GJNA 1E1CA 1OFOA 2Z2AA 2GQAA 1NWRA 5C8BB 4DUWA 4UMBA 3NDOA 4Z2HA 2A3EA 1YW1A 4PN2A 3MP3A 5DELA 4J7RA 2HVOA 1TVNA 3BE7A 5DRIA 3LHTA 4LUIA 3PSWA 4M29A 2PCQA 2HSAA 1QI2A 1EO5A 2RH9A 4TOQA 5J04A 4W7WA 1F3TA 1WDWA 3VK5A 2CETA 3ARTA 5BU6A 3EOLA 2PI6A 1DWHM 4JBRA 3WENA 3UWYA 2CBIA 5MF5A 2EXOA 3NZPA 2E77A 2UBPC 4L65A 1BPLB 4B92A 1WB0A 2R91A 3G2GA 5H6HA 4PUWA 2Z27A 4KFNA 1Q6CA 4WY0A 2XFWA 4Q4SA 2Z1WA 2QCMA 3U57A 4PODA 4GIAA 3BL3A 3NQCA 3HBLA 2Z2BA 4LNCA 4PMZA 2G8ZA 5C71A 3N14A 1TRIA 3IVTA 4H7CA 3BZGA 1XX1A 3NQGA 1L0PA 3A64A 2P76A 3JU2A 4QEEA 1WA3A 4ZSTA 1QDSA 1QCWA 4EPDC 4FX6M 1ITCA 3RJXA 2C79A 3S8HA 1RPKA 5HNUA 3WKZA 3LZ5A 2WPBA 4D2JA 2YA2A 3GS6A 4O54A 5HA7A 2OQYA 2HPIA 3EZ4A 1A0DA 1NARA 4BK9A 3ZO9A 1NP2A 4WSJA 3GC5A 4AMAA 3BG5A 4CVUA 1UZHA 2PD5A 3AFBA 2CXGA 1HNYA 4IJCA 1YBQA 5FSEC 1GPFA 3N18A 3TLQA 2OU4A 1S1RA 3R25A 4V15A 4KWWA 3VFLA 3M5XA 1PDZA 5A6JA 2AGTA 1MI3A 5TIMA 3U2CA 3PG8A 3PN8A 4RJEA 2B7QA 3EX1A 1QBBA 1XUZA 4JTGA 3RPMA 3LGEA 2PC8A 1WDRA 3UNTA 3L2MA 2J74A 1WXYA 2HDJA 3R10A 4AG0A 5E93A 4NRSA 2QCLA 4NL1A 3W2NA 3T1GA 1U33A 4UC5A 3EDEA 4M19A 4A6GA 2A3CA 5A8GA 1OD0A 3IK2A 3FGCB 2NWRA 4ZBCA 2PWGA 2V2CA 3EWCA 4LUSA 4KIEA 3BQ6A 3BAKA 2NT0A 3QYSA 1BYCA 3KEHA 3VZZA 2Z6JA 3PVFA 3SY5A 2VZVA 4YCOA 4WQ6A 1RH9A 3MUCA 1XRSA 2OB3A 3LCGA 1JCMP 2NW0A 3IAQA 5HK4A 3T55A 1NQKA 3GXIA 4A4AA 1HIZA 3WDJA 2ZA1A 3WDQA 3UR2A 2ZZ7A 4A3YA 4ZE4A 2I14A 1E9ZB 1CGVA 3SZ8A 3ZJ6A 1F7BA 1BGAA 1E5JA 3BAYA 3VGDA 5RUBA 3GXTA 2BS9A 3C8FA 3T09A 4S3KA 1GEQA 3RNDA 4KWOA 3RPDA 4JYFA 2VDGA 3VOGA 3KLLA 2UY2A 3OVQA 3QV9A 2I5GA 5I79A 1CXLA 3O06A 1UBSA 4I5UA 2GK1B 1UZ4A 3IACA 4IT1A 3LV6A 1H2JA 3OYXA 3PWGA 4PFMA 1HKVA 5CSYA 1F74A 3QY7A 4DM2A 3KW3A 2VUYA 2FDMA 2QR6A 1JAKA 4ZOCA 5CPLA 1GT8A 2FYMA 4Y96A 3TIMA 4PSPA 4AZCA 4PMUA 4ZQRA 4LS1A 4UR7A 4D6FA 2YXGA 3TEVA 3FHQA 3W2UA 3AZTA 1B3VA 1QPRA 1FFQA 1C92A 3CUIA 4E2OA 1PYFA 2EPHA 1W8SA 5CG0A 4PUEA 1JYXA 2BY3A 3PJTA 3HIJA 1FX6A 1R86A 4C7DA 2NLIA 1KKOA 2IMRA 1JF5A 4JL1A 2JGYA 4BCEA 1M7PA 1FWJC 3GVRA 3UETA 2QGYA 2FVMA 3SW6A 3FYYA 3NZQA 4QG9A 5BRQA 3RLHA 3KXQA 2J24A 4B5NA 1XIFA 1H51A 4BWLC 1Z44A 1QHOA 1R3YA 3GU9A 2J8GA 4LAOA 1XP3A 3O0FA 4DBWA 4DELA 2Y7GA 1DE6A 2EKCA 3NEVA 3W82A 4QQUA 4GINA 3IV3A 1W3HA 2VZUA 1ONWA 4LGXA 1UKOA 5I6SA 3K4DA 2PLCA 3NO3A 2ZZ1A 3FNDA 4QROA 4YTSA 3JR2A 3STEA 2HVNA 2XN0A 1RALA 4KCTA 1UUOA 3MO4A 1F76A 3N2OA 3BSMA 4H4IA 3VKCA 1R8LA 1TZ7A 5XINA 3LTSA 3CWNA 1NOUA 5F2LA 1ZENA 1FWNA 3V5OA 4O1BA 2E25A 3DDMA 2WZTA 3W1MA 3BW4A 3GNNA 3VIGA 3MMTA 4E8CA 3IEBA 2R1NA 1QMLA 1KBJA 2C13A 5AHNA 2FGLA 2PTWA 1UCWA 2WANA 2IPFA 4DJDD 3M0HA 4M6PA 4O14A 4PUJA 4CQ9A 2W4XA 3CQHA 3RX4A 1JZ5A 3WY1A 3T9PA 4MSSA 3UWQA 2YDAA 5A1AA 2VEGA 4F0RA 3VDBA 1UIPA 4AEEA 3UCDA 1VFUA 5F1VA 2NUXA 2Y2WA 3P5ZA 1GG1A 3G8RA 4UQCA 1KM2A 3LHWA 4IG2A 1KFEA 3PPFA 3U4AA 4IHCA 2YIHA 3K4WA 2NVAA 1CYGA 3C0LA 3P5YA 1M9HA 1SFJA 1NFGA 2V69A 1J12A 4J3VA 1JDFA 3NZGA 3GG1A 3II1A 1G94A 3BMVA 4Q8VA 1ZUAX 1HJSA 4WHBA 4UNKA 1G9HA 3GTHA 2OWCA 4BQ2A 1EBGA 1N55A 1V6TA 1EWEA 5AOUA 1M04A 3DESA 3W85A 4F0LA 4ZQOA 3QFWA 3WLPA 4O28A 4YYCA 3K30A 5A6AA 1XINA 1KW1A 1AQ0A 4Q4PA 1A5LC 1RVKA 1XW8A 3S6TA 4CVWA 3NOEA 4MB4A 3KS6A 1HXJA 4IPIA 1JVNA 4Y90A 1JI2A 1L8NA 1YRRA 2D0FA 5CJMA 5G2HA 2QCCA 3S5OA 3Q67A 4DBUA 3B9DA 4KEMA 3VCRA 2GPTA 3WCZA 2XUCA 3OQ8A 4O12A 2FFCA 4Y9PA 5TAOA 3U5YA 4TTUA 1LL6A 1A5NC 3EDFA 2BWGA 2GFTA 2R1LA 4AD3A 6CGTA 1UW9A 2Y88A 5K4ZA 3DFPA 5I03A 2XSBA 4GZEA 2PDIA 1Q5MA 3CHDA 2HWGA 3PR2A 4E4UA 1N7KA 3DGBA 4D9PA 5HPCA 3TQKA 3WFAA 1AODA 4LXFA 2VEFA 4E0CA 1ECQA 4N7QA 3RU6A 1M7OA 3NG3A 4UWMA 2A2IA 2YA1A 2D20A 3NIYA 3WQ6A 4DAFA 4ZO9A 3H2AA 3CHCA 3CV7A 2VM8A 3U5UA 4JTIA 4WKFA 3ONBA 4US5D 4JL2A 1J5SA 1FWCC 2W5FA 3WH8A 1QOXA 3TXVA 1YBQB 1P0BA 2PGEA 4I8YA 2C1GA 1Y5WA 4LUTB 4XIMA 3VOJA 4PMOA 2BGQA 3AS0A 4LY4A 2DZSA 1IWBA 1HL2A 7ENLA 1TV7A 1SPQA 1U1JA 3RAOA 2OGJA 1GVQA 2Q02A 3A47A 3CZKA 2OPJA 3R12A 4K2SA 1XRFA 3B04A 1OFEA 1WBJA 3D3AA 5DLCA 3WQOA 1RQBA 1QOQA 4I9JA 2YBVA 1UHVA 3DERA 3IRSA 3L0KA 4HK6A 3CLWA 4I7UA 3P2VA 2QXWA 4IGNA 4WOZA 3MHUA 4B5TA 1UKQA 5D02A 1TJ1A 3MYPA 2E9LA 1JDDA 4JD4A 4EX4A 1S2AA 4HU8A 1L8PA 4MNJA 2AMGA 1V4YA 5L6UA 5B7YA 4AD0A 4N9CA 3GNRA 4O1EA 3NL2A 1PIGA 4NIRA 3WFLA 2B7PA 4F79A 4AMCA 1TREA 3KOYA 4CQDA 1XSKA 4PYSA 1GVYA 3U6WA 2GWGA 3CV2A 3OIXA 2VQTA 2WC3A 5ABFB 1RCQA 4O13A 3R8RA 4LC6A 1LWHA 4CQCA 4I8DA 3MMDA 2VRQA 1E1CB 1JZ3A 1UQYA 3QOMA 3BLIA 2CZDA 4YLWA 4P7OA 7A3HA 1US3A 1E55A 2NZLA 4FLSA 2FHCA 5C9RA 5D2YA 2WMGA 4C6QA 6XIAA 3K4AA 1PVNA 3IANA 3QKZA 3ZJKA 5E9AA 3A9BA 3CWHA 1JFXA 3BCJA 2FMNA 3PNUA 2YL9A 1G0CA 4WLCA 2YFNA 3QY6A 3OVPA 2QQ6A 3HOJA 2Q8LA 1X38A 1HJXA 1SJBA 2OZ8A 1S5MA 1SJDA 1MSSA 2O9TA 4GH3A 1VH7A 2ALDA 4W87A 5D2XA 4ZB2A 1DP0A 1SJAA 1CXEA 4RKAA 4UOQA 4LV4A 1UWUA 5E70A 3GE7A 4HU3A 3MUY1 3WJXA 4H8NA 4MOZA 3VOFA 3KBMA 1A49A 3UR5A 2XIIA 2Z6IA 3AZRA 4PRTA 2CBVA 4FXRA 2EHHA 4V2XA 4HBKA 3WF2A 1ECEA 5EFFA 1JXJA 2PGWA 2CC0A 4TTGA 4GA8A 1FWGC 3QPEA 1EZWA 1XGZA 4KGJA 3HU7A 3PZTA 4CN4A 4AYSA 4DVOA 5A2CA 2ZRZA 4JKMA 4QM1A 4KGLA 3VKAA 2NWSA 3B4YA 4M1BA 2J75A 1U5VA 3LYEA 3FK4A 3SQSA 1OWQA 1KLZA 4D1IA 3FS2A 2EG7A 1AH0A 2XHYA 5E0KA 3NVTA 2X16A 4O4WA 1JRBA 1FCUA 5LHFA 2GUBA 4UTUA 1CXKA 1WNOA 3PJXA 4OKDA 4Q8MA 1RD6A 4Z42C 4K68A 3GNOA 2GVGA 3DFTA 3LY0A 2WJFA 4TIMA 3GVGA 1Q66A 1E40A 4X2RA 3DU0A 3UBPC 4HTBA 3BCDA 4GX8A 5A95A 2GL5A 2B7OA 2XYLA 4F2BA 1V6VA 5K9DA 4WGHA 4HU4A 3Q94A 1X39A 1XWYA 4GUJA 1O1ZA 4S39A 2AGKA 1L6FA 3E49A 1FDZA 3N9SA 1XSJA 1WO2A 3GXPA 2CLMA 9RUBA 4ICMA 3QY8A 3QGKC 1VFOA 2QJIA 4JZ5A 3MHGA 5SWUA 3RHGA 1Z7AA 2YYUA 2PEVA 3VIMA 3C3NA 1VAHA 2XIOA 3MPGA 3DENA 4GXMA 1ZJBA 1ICPA 3CUHA 2VI0A 1TMLA 5E5CA 4CCDA 1FXPA 4M6VA 2UY4A 3LPGA 3CTLA 4PBEA 1I2QA 1I2NA 3TYEA 1CW2A 4MLJA 4IWWA 4GD0A 1DQXA 3OHMB 1MUMA 1DIKA 3QN3A 3THDA 1TA3B 3M0YA 1Q6RA 3AYTA 4RW3A 2BXYA 4DWSD 2Y8UA 3ZT5A 1LYXA 3B8TA 3KFTA 1E6NA 2QIIA 4TX6A 3GAYA 3UD6A 3E0LA 3SY8A 3BGGA 3WEOA 4AWTA 4TMBA 5HMSA 1XYCA 2ACUA 3K2GA 1XBZA 3M0ZA 5FIPA 3MMWA 1RP8A 4LYPA 1HJQA 1C3FA 1W9BM 2ZE0A 2WW5A 4U33A 2C0HA 4GYPA 2G3IA 1VFLA 2BY2A 1CEOA 4DXKA 5C9UA 2PB1A 4PB4A 2P0IA 2DPEA 3KOXA 1UH2A 1NU5A 1EGZA 3EBVA 3CEUA 3WQEA 1RSCA 4BKNA 2D2JA 3LU2A 2VO5A 4JIQA 3W1PA 5E0CA 4DJDC 2X0HA 5JQ9A 5DQPA 3ECQA 3IGXA 2QIWA 2NXGA 4D8AA 4XZNX 2XTKA 1EC8A 3I6RA 1SZRA 3TN5A 4QLLA 5FEXA 5BXSA 1S2WA 1JQVA 3SN0A 4M7SA 7PTDA 2RJGA 5BRBA 3L5AA 1O94A 1JCNA 1N8FA 3AS3A 4RDZA 2JGQA 1OC6A 4EACA 1XDLA 1E3ZA 3O0KA 4C6EA 2Z29A 2ZX6A 3FXYA 2OT1A 3K8MA 3VOHA 3ZM8A 4AHPA 3N34A 3TAKA 2CLIA 4RLIA 3VC6A 1T96A 4QS5A 1CZ1A 3QGVA 4FK9A 1XG3A 2WVUA 3UNDA 5DN1A 2XIMA 1S2UA 2VRKA 2B81A 3CUJA 2VC5A 3R5EA 1TWDA 1Q63A 4QDPA 3TMLA 2VC9A 2F9RA 3GR8A 1W2PA 2PC4A 1H62A 5D9PA 1R46A 5AC4A 3TOPA 2INEA 4UQAA 5A2AA 3SR7A 1EJXC 1IR2A 4AISA 3O07A 3SCQA 3G3DA 3KZPA 2V68A 4K8HA 4R27A 3WQPA 1R6WA 1QNVA 1QUMA 2QPUA 4Z1YA 5ABFA 3W2KA 4J28A 4DYKA 3P82A 5I3FA 4S3CA 4JYDA 4M51A 1UD8A 5BMWA 3B8SA 1A5KC 4JTEA 1UJPA 4EAMA 1F3EA 3EMCA 3ID7A 4E4PA 2X2YA 4UFHA 1LM1A 3N12A 3CMJA 4AYGA 2EF9A 3PZVA 1JI1A 5H8MA 2HROA 4CQAA 4YHGA 3MW7A 3ES8A 3QZEA 4C1KA 3LX9A 1W37A 5HAOA 1EJTC 3N2MA 3WBAA 2VR4A 5D9NA 1P43A 2EPMX 5KZEA 3F4VA 1CXFA 3NCOA 4MNMA 3KE0A 4DJFD 3E0FA 3JZUA 3B8UA 3LZ3A 4AF0B 1E70M 3BW2A 3ENLA 1NDVA 1XC6A 4IQJA 2PZ0A 2ZUSA 1KM1A 3PTQA 2ZRXA 3UYIA 1ZALA 1PTDA 2Y24A 2OKOA 3W84A 3F4WA 3DUGA 2ZDSA 1L2UA 4B4HA 3UG4A 4GUIA 2C19A 2G50A 1H1ZA 1UPPA 1QNSA 3TLLA 1HJUA 3TDFA 5AHIA 3ARZA 4FNQA 1T8XA 1UWAA 4RPPA 3WO8A 1ICSA 3VM5A 2OODA 1TCDA 4EWJA 2X2GA 3OEXA 4D72A 2YSWA 1EJRC 3W7RA 5H8PA 3NWRA 2W9MA 4C6BA 3SIMA 4XAPA 3T0BA 1SFTA 2RDWA 3L65A 5A6BD 4QFUA 2IPJA 2FGZA 3LQGA 3TVAA 3NZ1A 3W28A 3JRKA 4TX8A 3RCYA 2JIEA 4P8XA 1TIWA 4DO7A 5J5DA 3PUOA 3QBUA 3WD3A 2DUAA 2F2HA 3O6DA 4LALA 3C2YA 5A6KA 4Y9NA 4PCFA 3T0CA 3PTDA 1JUEA 3UZWA 3BSGA 2CZFA 1LRTA 3SGUA 2ACSA 2PDXA 1GJWA 2P5NA 5FESA 4ZTXA 1YDVA 3B0YA 4K39A 5CXPA 2J79A 1UD4A 1W9XA 1H61A 5T8GA 4DIAA 3NNTA 3IIXA 2ZUWA 1UH3A 1GZ1A 1RBAA 1PHQA 4QCFA 5AY7A 3T78A 4JX5A 5LNSA 2FTPA 1Q7MA 1C29A 1O66A 1DIOA 2G37A 1PO9A 3ZSTA 4NU7A 4WSKA 1Z32X 2WLZA 1OD8A 2VNCA 3LM3A 2EJ1A 3VIFA 1GPWA 1P0NA 3PZIA 4W5UA 2OR2A 2VX7A 3FVMA 5D33A 4DEFA 1W17A 2QUNA 3HPSA 3SIZA 1Z8AA 1S2VA 4Y8FA 2RFGA 5LA0A 1VHNA 3DOPA 1IEWA 3G18A 3CMGA 4GY0A 3W24A 2H3DA 3P3BA 3CK5A 2G41A 1GTHA 4A3QA 3EOOA 4JKLA 2EPKX 4L9ZA 5FI8A 4LF2A 3MCNA 4ATDA 3L9CA 4IFOA 2WWCA 3LERA 5LNRA 4HA4A 2WJEA 4YWIA 3DZ1A 3S42A 1XGEA 1ICQA 4MKVA 3VC5A 3MBDA 1W56A 4JTCA 4YWSA 3TR2A 2WCSA 1KFKA 2WBGA 1TVPA 1Z69A 6TAAA 3H4WA 1M7XA 4JTHA 3ORWA 3H2FA 4S23A 4MNKA 1XH0A 1EKOA 4UMAA 1WDSA 5HDRA 1PB0A 2HMCA 3QRHA 3E2QA 2J7BA 3EWWA 2YX0A 3NSNA 5HR6A 1GUVA 1VHCA 3K1DA 3AALA 5D8WA 3I7SA 1PTAA 1EHAA 2XWDA 3NQBA 3SUSA 1TV3A 5KZ6A 3LM7A 1JCXA 4C7FA 3N9RA 1UIOA 4PMNA 4WDXA 2NVCA 3M7SA 4IP5A 3BJSA 4NZ4A 3G3MA 5DT5A 4HOXA 2WK2A 1PIIA 2NXIA 2VWSA 3A4JA 4RPQA 2IQDA 2DJXA 2YPIA 4XIAA 3G1FA