5M5VA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 2)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5vA00
1C9IA 5M5SA 3GC3B 2XZGA 5M5RA 5M5TA 5M5VA 1UTCA 3GD1I 5M5UA 4G55A 1BPOA 1C9LA 5M61A
chains in the Genus database with same CATH superfamily
4PBZA 1TYQC 5M5RA 4J8BA 3PXTD 4YVDA 3C9CA 4J73A 4FA4D 2OK4A 3AL8A 4O3UB 3EG6A 3K6SA 2IURA 2CN2A 2EIDA 5EAPA 5K1CC 4JD2C 4AMZA 3VI3A 4O3TB 4J82A 3DWLC 2IUQA 5HE1B 1R5MA 2YNOA 2I0TA 3I7LA 5M5TA 3OTTA 2H6QA 4RE6A 4Z8LA 2PM6B 5E6SA 1JMZB 2OVQB 3PSLA 2YNNA 4UM8A 2CE9A 4O9DA 3V7DB 3ZE0A 3SBRA 2J57G 4ZOYA 5GXIA 4WK0A 3SBPA 2HYEA 3N0EA 2H13A 1VE7A 3AL8B 4A08A 2IWKA 1VZ2A 4PXWA 4ERZA 4GQ2P 5K19A 3SXTD 2PM9A 2I0SA 1MDAH 1PGUA 2CNXA 3PXSD 3W15A 4CY5A 1JTDB 2XU7A 4CI3A 4PBYA 3FGBA 5CXCA 5FFOA 2H47A 4AX4A 2IUVA 2YMUA 2XYIA 3MZLA 3UKUC 4EWRA 3SHFA 3V4PA 2H6KA 3BG0A 4X3EA 3RFGA 3ZE2A 1UTCA 4QRJA 3NIFA 4QAMA 5IGQA 5A2Qg 4A08B 5B4WA 1YR2A 3U4YA 1O6GA 3PSCB 4FA9D 4FAVD 5IJ8E 5IT9g 2H6NA 4CZVA 1UOPA 4A11A 2AGZA 4NENA 2XL3A 4A0BA 1S4UX 3O4HA 4CZYA 4L3HD 4JT6C 2Q7QA 2AGLA 4PSXB 3T3PA 4A2MA 1JOFA 1H2XA 3J81g 4ZOZA 2EICA 3MMYA 4HDJA 4IA9A 2AH1A 4KFMB 4WK2A 4AOWA 3F3GA 3EU7A 3K71A 1N6DA 1OMWB 5CXBA 4BCBA 1H2WA 4BP9A 3IUJA 5C92A 4LGNA 3PVUB 3K72A 3I2NA 1U4CA 3SBQA 2CE8A 3GREA 5GSAA 2QC5A 5THAA 4DNVA 4NAAA 4U7AA 1PI6A 4A11B 4G1MA 5IC7A 4QQEA 3J80g 4LG9A 4NC4A 5EMJB 2BBKH 4JT5C 5M5UA 3PVWB 5EMKB 3MUOA 2VDNA 3ORVD 1E8NA 5AMSA 4GGAA 1SHYB 3JZNA 1GOFA 3IJEA 3OW8A 4DNUA 4X63B 2GNQA 2IWFA 5H17A 1NR0A 3I7PA 5CXBB 3O4JA 1I2MB 3L4MD 5C2VB 1JJUB 2H68A 3O4GA 1K3IA 3RSEC 5EMLB 1PEVA 1VE6A 2QXVA 4JSNC 5HYNB 4BUJC 3ZWLB 1UOQA 4GGDA 1N6FA 4R7AB 5EM2A 1A12A 3KRWB 2J55H 2P9LC 3CFVA 4GM3A 4BH6A 3NIDA 3ZDYA 5TDHB 5KDOB 1B9YA 1L0QA 1SQJA 3JB9L 2AH0A 4K3JB 2VDQA 4Z7OA 2VC2A 1P22A 4O45A 3JROA 4PSWB 1XIPA 3UVKA 5TF2A 4CI1A 2PM7B 3SFZA 3IUMA 1U8CA 3IIWA 4L1MA 5EARA 5EM2B 5GMKn 2G99A 5M61A 4AEZA 3GD1I 4J81A 2I3TA 5I5IA 1E8MA 4I79A 4ZN4A 2BCJB 5CYKA 3EI2A 2B5NA 5E6UA 4GMBA 4A09A 3RLMD 3IURA 3F3FA 5E6RA 2J56H 2P9PC 4Y7RA 5IGOA 3DXKC 4JSVC 4D9SA 2JKXA 2WQ8A 3MVDK 4OZUA 3IULA 3C75H 2EIBA 5FKRA 2BKLA 1QFMA 3MUNA 4E54A 2VZ3A 4Z7NA 5FQDA 5HQGA 3EQ7A 4DNWA 3A0FA 2HU7A 3OKWA 2PM9B 3T3MA 4JHPC 3IJ1A 3PXWD 4FB1D 1A0RB 5AJAA 3SMRA 5CXCB 4NSXA 5CYKB 3EI2B 4O1QD 4A09B 3SVWD 4XYHA 2VDRA 4J84A 1UOOA 3UVMA 4L9OA 3N0DA 3O4IA 4J0XA 4MMYA 5FFGA 1BPOA 4XYIA 1GOHA 4FA1D 2XZGA 3CFSB 3V9FA 4J79A 2H9MA 4GGCA 1H2YA 3IUQA 4A2LA 3UR4A 4NBMA 4IMMA 4E54B 2B4EA 3AH8B 4MK0B 4G55A 3SN6B 2GC4A 2B5MA 3HFQA 1K32A 4J8GA 1C9LA 1B9XA 4JHNA 2CO0A 3I8EA 4N14A 3SWSD 5C86A 5M5VA 4O2WA 3B7FA 5AFU3 2XE4A 4A0BB 2YB8B 2CO0C 3UVOA 5FXYA 3DXMC 1JV2A 1N6EA 3RFHA 4K3ID 1MG2A 4E5ZB 1MG3A 5I5MA 3EI4A 3FCSA 3K26A 2HKRA 2HJBA 5C2WB 4H5JA 2OIZA 4CC9A 2UZYB 3GC3B 3I89A 4JSPC 3I7NA 1SQ9A 4D6VA 2CN3A 1L5GA 2O9KA 3UVNA 2VZ1A 4CZXA 3OKYA 1T2XA 3FRXA 3E0CA 4AN1A 2H9LA 2EIEA 2Z2PA 3F3PA 1GOTB 3IKOA 5EAMA 4UM9A 3ODTA 4CY2A 2I3SA 3EQ8A 4J87A 4FWWA 3EI4B 4Z7QA 4CY3A 5FA5B 3IUNA 4OWRA 2VDMA 4LG8A 2H14A 2AGXA 1JMXB 1Q47A 3IIYA 2B5LA 3EI1A 1QFSA 3JRPA 3QI0A 5FLXg 3ZDXA 4J86A 2VDKA 3GFCA 2H3XA 3OL2A 4J78A 2QR5A 3RN1D 4FHLA 4A0AA 3RN0D 3AL9A 4MMZA 3OKYB 5HDBA 4AN0A 3VA6A 3EMHA 1TYEA 1OLZA 3QHYB 4GM8A 4H5IA 4U1EI 4FAND 1RI6A 2YNPA 4UI9R 3UKRC 4QL1A 3P4FA 3VH0A 2P9NC 2OK6A 2HXCA 4PNKB 5FKTA 4GQBB 4BCCA 4J77A 2Z2NA 2XDWA 4D0KA 1QNIA 4L1QD 3EI3A 4JXMA 5GXHA 2VDLA 3L4OD 5H14A 4BL0A 2TRCB 2HKMA 3IJCA 3RMZD 4ZOVA 5H1MA 3EI1B 2OVPB 2HESX 2UZXB 1XKSA 4CY1A 3OL2B 5SXMA 4ERYA 3IVMA 5HE0B 4A0AB 5M5SA 2P9KC 2HJ4A 3NVQA 3C99A 5FKQA 3UVLA 2G9AA 3I7OA 3FM0A 3C5MA 3ULEC 3DSMA 5IJ7E 1PBYB 2Z2OA 3MKSB 1FWXA 2GC7A 2YBAA 4BP8A 4GZ8A 3KRXB 3MXXA 3V4VA 2AGYA 1GP2B 5HE2B 3EI3B 2AQ5A 4GM9A 3I7KA 5HE3B 3SJLD 4ES0A 4G1EA 4WK4A 1VZ3A 4WJKA 3DDUA 1E5TA 3RRMC 5C9ZB 1O6FA 3EWEA 4ZOXA 2PBIB 1NEXB 4X61B 1GOGA 4BCDA 3I8CA 2AGWA 5I5JA 5TEEA 4E5ZA 1K8KC 4CI2A 4CI8A 3SCYA 4JSXC 4XEIC 3V5WB 4IRZA 3K27A 2P9IC 4Y5RD 4L3GD 1U2VC 4ERQA 2H9NA 4FA5D 3NVNA 5JWZA 2VDPA 2OVRB 3NIGA 5EMMB 3JAMg 5EALA 3JZGA 4MMXA 3EQ9A 1ERJA 2VDOA 3FCUA 3KCIA 4TZ4A 4O02A 3PE7A 3MZKA 1C9IA 3JPXA 4QT8A 2P9SC 1GXRA 1TBGA 1GG2B 3SLED 3AFCA 3VI4A 4PC0A 4AMYA 2I0RA 2IAAA 4G56B 2HU8A 2P9UC 2QZPA 1YFQA 1H2ZA 3NVXA 5TEFA 2H9PA 4RE5A 3JZHA 3IJ0A 3ZE1A 1VYHC 3BG1A 4A7JA 2MTAH 4GQ1A 3VGZA 3OKTA 1XHMA 2HU5A 2EBSA 3OF7A 1M1XA 3BWSA 4J0WA 3ZDZA 2W18A 4X60B 2IUPA 5FKSA 3MKQA 3DM0A 4ESGA 2OJYA 2XL2A 3CIKB 3I7HA
chains in the Genus database with same CATH topology
1C9IA 5M5SA 3GC3B 2XZGA 5M5RA 5M5TA 5M5VA 1UTCA 3GD1I 5M5UA 4G55A 1BPOA 1C9LA 5M61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9I A;  5M5S A;  3GC3 B;  2XZG A;  5M5R A;  5M5T A;  5M5V A;  1UTC A;  3GD1 I;  5M5U A;  4G55 A;  1BPO A;  1C9L A;  5M61 A; 
#chains in the Genus database with same CATH topology
 4PBZ A;  1TYQ C;  5M5R A;  4J8B A;  3PXT D;  4YVD A;  3C9C A;  4J73 A;  4FA4 D;  2OK4 A;  3AL8 A;  4O3U B;  3EG6 A;  3K6S A;  2IUR A;  2CN2 A;  2EID A;  5EAP A;  5K1C C;  4JD2 C;  4AMZ A;  3VI3 A;  4O3T B;  4J82 A;  3DWL C;  2IUQ A;  5HE1 B;  1R5M A;  2YNO A;  2I0T A;  3I7L A;  5M5T A;  3OTT A;  2H6Q A;  4RE6 A;  4Z8L A;  2PM6 B;  5E6S A;  1JMZ B;  2OVQ B;  3PSL A;  2YNN A;  4UM8 A;  2CE9 A;  4O9D A;  3V7D B;  3ZE0 A;  3SBR A;  2J57 G;  4ZOY A;  5GXI A;  4WK0 A;  3SBP A;  2HYE A;  3N0E A;  2H13 A;  1VE7 A;  3AL8 B;  4A08 A;  2IWK A;  1VZ2 A;  4PXW A;  4ERZ A;  4GQ2 P;  5K19 A;  3SXT D;  2PM9 A;  2I0S A;  1MDA H;  1PGU A;  2CNX A;  3PXS D;  3W15 A;  4CY5 A;  1JTD B;  2XU7 A;  4CI3 A;  4PBY A;  3FGB A;  5CXC A;  5FFO A;  2H47 A;  4AX4 A;  2IUV A;  2YMU A;  2XYI A;  3MZL A;  3UKU C;  4EWR A;  3SHF A;  3V4P A;  2H6K A;  3BG0 A;  4X3E A;  3RFG A;  3ZE2 A;  1UTC A;  4QRJ A;  3NIF A;  4QAM A;  5IGQ A;  5A2Q g;  4A08 B;  5B4W A;  1YR2 A;  3U4Y A;  1O6G A;  3PSC B;  4FA9 D;  4FAV D;  5IJ8 E;  5IT9 g;  2H6N A;  4CZV A;  1UOP A;  4A11 A;  2AGZ A;  4NEN A;  2XL3 A;  4A0B A;  1S4U X;  3O4H A;  4CZY A;  4L3H D;  4JT6 C;  2Q7Q A;  2AGL A;  4PSX B;  3T3P A;  4A2M A;  1JOF A;  1H2X A;  3J81 g;  4ZOZ A;  2EIC A;  3MMY A;  4HDJ A;  4IA9 A;  2AH1 A;  4KFM B;  4WK2 A;  4AOW A;  3F3G A;  3EU7 A;  3K71 A;  1N6D A;  1OMW B;  5CXB A;  4BCB A;  1H2W A;  4BP9 A;  3IUJ A;  5C92 A;  4LGN A;  3PVU B;  3K72 A;  3I2N A;  1U4C A;  3SBQ A;  2CE8 A;  3GRE A;  5GSA A;  2QC5 A;  5THA A;  4DNV A;  4NAA A;  4U7A A;  1PI6 A;  4A11 B;  4G1M A;  5IC7 A;  4QQE A;  3J80 g;  4LG9 A;  4NC4 A;  5EMJ B;  2BBK H;  4JT5 C;  5M5U A;  3PVW B;  5EMK B;  3MUO A;  2VDN A;  3ORV D;  1E8N A;  5AMS A;  4GGA A;  1SHY B;  3JZN A;  1GOF A;  3IJE A;  3OW8 A;  4DNU A;  4X63 B;  2GNQ A;  2IWF A;  5H17 A;  1NR0 A;  3I7P A;  5CXB B;  3O4J A;  1I2M B;  3L4M D;  5C2V B;  1JJU B;  2H68 A;  3O4G A;  1K3I A;  3RSE C;  5EML B;  1PEV A;  1VE6 A;  2QXV A;  4JSN C;  5HYN B;  4BUJ C;  3ZWL B;  1UOQ A;  4GGD A;  1N6F A;  4R7A B;  5EM2 A;  1A12 A;  3KRW B;  2J55 H;  2P9L C;  3CFV A;  4GM3 A;  4BH6 A;  3NID A;  3ZDY A;  5TDH B;  5KDO B;  1B9Y A;  1L0Q A;  1SQJ A;  3JB9 L;  2AH0 A;  4K3J B;  2VDQ A;  4Z7O A;  2VC2 A;  1P22 A;  4O45 A;  3JRO A;  4PSW B;  1XIP A;  3UVK A;  5TF2 A;  4CI1 A;  2PM7 B;  3SFZ A;  3IUM A;  1U8C A;  3IIW A;  4L1M A;  5EAR A;  5EM2 B;  5GMK n;  2G99 A;  5M61 A;  4AEZ A;  3GD1 I;  4J81 A;  2I3T A;  5I5I A;  1E8M A;  4I79 A;  4ZN4 A;  2BCJ B;  5CYK A;  3EI2 A;  2B5N A;  5E6U A;  4GMB A;  4A09 A;  3RLM D;  3IUR A;  3F3F A;  5E6R A;  2J56 H;  2P9P C;  4Y7R A;  5IGO A;  3DXK C;  4JSV C;  4D9S A;  2JKX A;  2WQ8 A;  3MVD K;  4OZU A;  3IUL A;  3C75 H;  2EIB A;  5FKR A;  2BKL A;  1QFM A;  3MUN A;  4E54 A;  2VZ3 A;  4Z7N A;  5FQD A;  5HQG A;  3EQ7 A;  4DNW A;  3A0F A;  2HU7 A;  3OKW A;  2PM9 B;  3T3M A;  4JHP C;  3IJ1 A;  3PXW D;  4FB1 D;  1A0R B;  5AJA A;  3SMR A;  5CXC B;  4NSX A;  5CYK B;  3EI2 B;  4O1Q D;  4A09 B;  3SVW D;  4XYH A;  2VDR A;  4J84 A;  1UOO A;  3UVM A;  4L9O A;  3N0D A;  3O4I A;  4J0X A;  4MMY A;  5FFG A;  1BPO A;  4XYI A;  1GOH A;  4FA1 D;  2XZG A;  3CFS B;  3V9F A;  4J79 A;  2H9M A;  4GGC A;  1H2Y A;  3IUQ A;  4A2L A;  3UR4 A;  4NBM A;  4IMM A;  4E54 B;  2B4E A;  3AH8 B;  4MK0 B;  4G55 A;  3SN6 B;  2GC4 A;  2B5M A;  3HFQ A;  1K32 A;  4J8G A;  1C9L A;  1B9X A;  4JHN A;  2CO0 A;  3I8E A;  4N14 A;  3SWS D;  5C86 A;  5M5V A;  4O2W A;  3B7F A;  5AFU 3;  2XE4 A;  4A0B B;  2YB8 B;  2CO0 C;  3UVO A;  5FXY A;  3DXM C;  1JV2 A;  1N6E A;  3RFH A;  4K3I D;  1MG2 A;  4E5Z B;  1MG3 A;  5I5M A;  3EI4 A;  3FCS A;  3K26 A;  2HKR A;  2HJB A;  5C2W B;  4H5J A;  2OIZ A;  4CC9 A;  2UZY B;  3GC3 B;  3I89 A;  4JSP C;  3I7N A;  1SQ9 A;  4D6V A;  2CN3 A;  1L5G A;  2O9K A;  3UVN A;  2VZ1 A;  4CZX A;  3OKY A;  1T2X A;  3FRX A;  3E0C A;  4AN1 A;  2H9L A;  2EIE A;  2Z2P A;  3F3P A;  1GOT B;  3IKO A;  5EAM A;  4UM9 A;  3ODT A;  4CY2 A;  2I3S A;  3EQ8 A;  4J87 A;  4FWW A;  3EI4 B;  4Z7Q A;  4CY3 A;  5FA5 B;  3IUN A;  4OWR A;  2VDM A;  4LG8 A;  2H14 A;  2AGX A;  1JMX B;  1Q47 A;  3IIY A;  2B5L A;  3EI1 A;  1QFS A;  3JRP A;  3QI0 A;  5FLX g;  3ZDX A;  4J86 A;  2VDK A;  3GFC A;  2H3X A;  3OL2 A;  4J78 A;  2QR5 A;  3RN1 D;  4FHL A;  4A0A A;  3RN0 D;  3AL9 A;  4MMZ A;  3OKY B;  5HDB A;  4AN0 A;  3VA6 A;  3EMH A;  1TYE A;  1OLZ A;  3QHY B;  4GM8 A;  4H5I A;  4U1E I;  4FAN D;  1RI6 A;  2YNP A;  4UI9 R;  3UKR C;  4QL1 A;  3P4F A;  3VH0 A;  2P9N C;  2OK6 A;  2HXC A;  4PNK B;  5FKT A;  4GQB B;  4BCC A;  4J77 A;  2Z2N A;  2XDW A;  4D0K A;  1QNI A;  4L1Q D;  3EI3 A;  4JXM A;  5GXH A;  2VDL A;  3L4O D;  5H14 A;  4BL0 A;  2TRC B;  2HKM A;  3IJC A;  3RMZ D;  4ZOV A;  5H1M A;  3EI1 B;  2OVP B;  2HES X;  2UZX B;  1XKS A;  4CY1 A;  3OL2 B;  5SXM A;  4ERY A;  3IVM A;  5HE0 B;  4A0A B;  5M5S A;  2P9K C;  2HJ4 A;  3NVQ A;  3C99 A;  5FKQ A;  3UVL A;  2G9A A;  3I7O A;  3FM0 A;  3C5M A;  3ULE C;  3DSM A;  5IJ7 E;  1PBY B;  2Z2O A;  3MKS B;  1FWX A;  2GC7 A;  2YBA A;  4BP8 A;  4GZ8 A;  3KRX B;  3MXX A;  3V4V A;  2AGY A;  1GP2 B;  5HE2 B;  3EI3 B;  2AQ5 A;  4GM9 A;  3I7K A;  5HE3 B;  3SJL D;  4ES0 A;  4G1E A;  4WK4 A;  1VZ3 A;  4WJK A;  3DDU A;  1E5T A;  3RRM C;  5C9Z B;  1O6F A;  3EWE A;  4ZOX A;  2PBI B;  1NEX B;  4X61 B;  1GOG A;  4BCD A;  3I8C A;  2AGW A;  5I5J A;  5TEE A;  4E5Z A;  1K8K C;  4CI2 A;  4CI8 A;  3SCY A;  4JSX C;  4XEI C;  3V5W B;  4IRZ A;  3K27 A;  2P9I C;  4Y5R D;  4L3G D;  1U2V C;  4ERQ A;  2H9N A;  4FA5 D;  3NVN A;  5JWZ A;  2VDP A;  2OVR B;  3NIG A;  5EMM B;  3JAM g;  5EAL A;  3JZG A;  4MMX A;  3EQ9 A;  1ERJ A;  2VDO A;  3FCU A;  3KCI A;  4TZ4 A;  4O02 A;  3PE7 A;  3MZK A;  1C9I A;  3JPX A;  4QT8 A;  2P9S C;  1GXR A;  1TBG A;  1GG2 B;  3SLE D;  3AFC A;  3VI4 A;  4PC0 A;  4AMY A;  2I0R A;  2IAA A;  4G56 B;  2HU8 A;  2P9U C;  2QZP A;  1YFQ A;  1H2Z A;  3NVX A;  5TEF A;  2H9P A;  4RE5 A;  3JZH A;  3IJ0 A;  3ZE1 A;  1VYH C;  3BG1 A;  4A7J A;  2MTA H;  4GQ1 A;  3VGZ A;  3OKT A;  1XHM A;  2HU5 A;  2EBS A;  3OF7 A;  1M1X A;  3BWS A;  4J0W A;  3ZDZ A;  2W18 A;  4X60 B;  2IUP A;  5FKS A;  3MKQ A;  3DM0 A;  4ESG A;  2OJY A;  2XL2 A;  3CIK B;  3I7H A; 
#chains in the Genus database with same CATH homology
 1C9I A;  5M5S A;  3GC3 B;  2XZG A;  5M5R A;  5M5T A;  5M5V A;  1UTC A;  3GD1 I;  5M5U A;  4G55 A;  1BPO A;  1C9L A;  5M61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...