5M5VA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 2)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
b'ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5vA00
5M5VA 5M5UA 1UTCA 1C9IA 4G55A 3GD1I 5M61A 5M5RA 1BPOA 5M5TA 3GC3B 5M5SA 2XZGA 1C9LA
chains in the Genus database with same CATH superfamily
2VDMA 2GC4A 3MKSB 3PVWB 4J8BA 4CC9A 2B5NA 3CFSB 2XZGA 2XE4A 3PE7A 2GNQA 3N0EA 5GXHA 2OIZA 3JZGA 5CXCB 5FXYA 1ERJA 2B5MA 3AFCA 3DDUA 2HJ4A 3J81g 3SVWD 5CYKB 4ES0A 2G99A 2Z2OA 5M5UA 4X63B 5EMMB 1E8NA 1H2ZA 2P9NC 3ZDYA 4O1QD 3UVLA 2OVQB 5IJ7E 3EI3A 3I7KA 4O3UB 1A0RB 2MTAH 2VDKA 2BKLA 3FCUA 3O4GA 4BUJC 3MVDK 4E54A 5K1CC 1SQ9A 4O2WA 1O6GA 5EMLB 4H5IA 1H2XA 2IURA 4WK2A 2H14A 3MZLA 1YFQA 4L9OA 1GOTB 2P9UC 4DNWA 1SHYB 2H68A 4Z7NA 1K32A 1T2XA 1PEVA 1R5MA 5M5TA 4Z7QA 3FM0A 1K8KC 5TEEA 4QRJA 4J77A 4X61B 3HFQA 5EALA 3EQ8A 4FWWA 2BBKH 2J57G 3EQ7A 4Y7RA 3N0DA 3MUNA 3O4IA 4CZYA 1PI6A 4J79A 4OWRA 5FKQA 4L3HD 3U4YA 2IUVA 3E0CA 3UVKA 3DSMA 4BP8A 3I2NA 3SMRA 1TYEA 5HE3B 1YR2A 4BCBA 3OL2A 3PXTD 5E6SA 2AH1A 4JT6C 4QT8A 3UVNA 4A08A 2OK6A 5M5VA 3EI1A 4MK0B 2EBSA 2PBIB 3AL8B 3MKQA 4ZOXA 2H9PA 5H17A 1UOQA 3BG0A 3EG6A 1C9IA 4DNUA 3O4HA 1N6FA 2P9PC 2YNNA 4NSXA 5IC7A 3PXSD 5M5RA 4ERYA 5JWZA 5FLXg 3JAMg 4J78A 3SXTD 1N6EA 4A0AA 5HQGA 3GD1I 1SQJA 3SBQA 2AQ5A 3NIGA 2YBAA 5H14A 4CY3A 5IGQA 3BG1A 4A11B 4NBMA 2OK4A 1JTDB 1JV2A 4EWRA 5FQDA 3NVXA 3C9CA 3JROA 2AGWA 3UKUC 2VC2A 1H2YA 3KRWB 5TDHB 2OJYA 3JRPA 3K71A 3C75H 2YB8B 5K19A 2PM6B 3V5WB 4G1EA 2XL3A 4GM9A 2P9IC 5CXBA 5TF2A 5C2VB 4NC4A 4PBZA 3IKOA 3C5MA 4RE5A 3ZDZA 4NAAA 1GOHA 4XYHA 5I5IA 5KDOB 4FAND 3KRXB 1VYHC 2EIEA 2HKRA 3FCSA 3RRMC 3EI2A 2P9LC 3ORVD 2Q7QA 2I0RA 3MZKA 1UTCA 2BCJB 4IA9A 1E5TA 1MG3A 1QNIA 3F3GA 2OVPB 3UVOA 4A7JA 4R7AB 4E5ZA 3V9FA 3EI4A 5H1MA 2B5LA 2H3XA 2O9KA 3PSLA 3T3MA 1MG2A 4PBYA 5AMSA 1H2WA 2CE8A 3IIYA 4FAVD 4LG9A 4ERZA 2YNPA 5FKTA 3UVMA 5A2Qg 1JOFA 3IUJA 3C99A 3ZWLB 1L5GA 5SXMA 4BCCA 4GZ8A 4JSPC 1BPOA 3DXKC 3GC3B 2Z2PA 3EMHA 1E8MA 2GC7A 5EAMA 3VH0A 4PSWB 4GGDA 4CI2A 3J80g 4AMYA 3EI3B 3FRXA 3IUQA 4U1EI 3OKYA 4CY5A 4A09A 2VDNA 3NIDA 5THAA 4K3JB 5FA5B 4D6VA 4DNVA 4ERQA 3NVQA 4E54B 2QC5A 5HE0B 2J56H 2I3TA 5EM2B 2QZPA 1QFSA 5FKSA 3OF7A 3SBPA 2I0SA 3RSEC 1U8CA 3AL8A 2AGZA 3OW8A 4CZVA 4ESGA 5FKRA 3K6SA 2HKMA 1M1XA 3RFHA 3KCIA 4KFMB 4LGNA 2WQ8A 1A12A 4Z7OA 3I7NA 3SLED 4WK4A 5HE2B 4Z8LA 3DXMC 3K26A 4J84A 3UR4A 4CI3A 5HDBA 2PM9A 2IUPA 4JT5C 2JKXA 4L1QD 4CI8A 1MDAH 3NVNA 3JZHA 3IJCA 2AGXA 1U4CA 2H9MA 3IJ0A 4JHPC 4O45A 5C92A 4A0BA 4G1MA 1VZ3A 3IUNA 4MMZA 2XDWA 4J0WA 4XYIA 3K72A 3ULEC 4FA4D 2CO0A 4GGCA 3OL2B 2I3SA 2HESX 2HU7A 3BWSA 2H47A 1JJUB 5HE1B 1C9LA 4A08B 4TZ4A 3IJEA 4OZUA 1OLZA 2OVRB 2G9AA 4J86A 3PVUB 4O3TB 3OKWA 3QHYB 4ZOYA 3W15A 3K27A 1OMWB 3I7LA 5M5SA 1B9XA 3L4OD 4JHNA 2HXCA 2VZ1A 4O9DA 5CXCA 4BCDA 4AN1A 1UOOA 3B7FA 2VDPA 2H13A 4J8GA 2H9NA 4Y5RD 4AEZA 5C2WB 3GREA 2HYEA 3IVMA 3VA6A 4GMBA 4PC0A 2CN3A 5CYKA 3V4VA 4A0AB 1XKSA 2I0TA 4J81A 2H9LA 1NEXB 3SHFA 2CNXA 2VDQA 4MMXA 5GXIA 4YVDA 5IGOA 2IAAA 4UM8A 4UI9R 3O4JA 1O6FA 5E6UA 4J87A 1VE6A 3NIFA 4D9SA 4GGAA 3IULA 1S4UX 4AOWA 3VI4A 1QFMA 5I5JA 2Z2NA 3DWLC 1N6DA 3RLMD 5HYNB 3SWSD 3PXWD 2QXVA 4JXMA 3I8EA 3RMZD 2W18A 3EWEA 4BL0A 2UZXB 3AL9A 4AMZA 5EAPA 4IMMA 2QR5A 5EMJB 5CXBB 3ODTA 4O02A 3P4FA 2J55H 4BH6A 5EARA 5C9ZB 3A0FA 4JD2C 3ZDXA 4G56B 1U2VC 4PSXB 3VI3A 3EU7A 5GMKn 2VDOA 1UOPA 3OTTA 1TYQC 2PM7B 4X60B 3EI2B 1XIPA 4PXWA 4JSVC 4CY1A 5IT9g 3RN1D 2CO0C 3T3PA 4FB1D 4CZXA 5EMKB 1TBGA 3MUOA 4GM8A 5EM2A 3RN0D 1GG2B 1VE7A 3JPXA 4WJKA 4D0KA 1JMZB 4E5ZB 4ZN4A 4PNKB 5I5MA 3EI4B 1P22A 1B9YA 4IRZA 3I7HA 4LG8A 5FFOA 4U7AA 5E6RA 4GQ1A 4J0XA 2CE9A 2EICA 2HU5A 3SJLD 4UM9A 5B4WA 3F3PA 5M61A 3SN6B 2UZYB 1PGUA 4AN0A 1GOFA 1L0QA 3MXXA 4FA1D 3I7PA 4JSNC 1JMXB 2B4EA 2XU7A 2TRCB 4QAMA 4J82A 3GFCA 2VDRA 3MMYA 3SFZA 2CN2A 4MMYA 3I7OA 1RI6A 3ZE2A 4CI1A 2VDLA 4ZOVA 1FWXA 3I8CA 3L4MD 3I89A 3OKYB 4RE6A 4A09B 2EIDA 2P9SC 4NENA 1GOGA 1I2MB 1GP2B 1Q47A 4A11A 5GSAA 3IURA 5C86A 4A2LA 2H6QA 2IWKA 4A2MA 4XEIC 3PSCB 3SBRA 3IUMA 2AH0A 2XL2A 4I79A 2IUQA 2XYIA 2H6NA 4AX4A 2EIBA 1NR0A 4ZOZA 4WK0A 4CY2A 3VGZA 3ZE0A 3V4PA 3CIKB 3EI1B 4GQ2P 2AGYA 3JB9L 3V7DB 3SCYA 5AFU3 4QL1A 1K3IA 2YNOA 3AH8B 4L3GD 4K3ID 4BP9A 2HJBA 4L1MA 2PM9B 3UKRC 3EQ9A 3IJ1A 4FA9D 2HU8A 3FGBA 4N14A 4GQBB 2AGLA 4GM3A 1GXRA 1VZ2A 5AJAA 1XHMA 2H6KA 4A0BB 4G55A 2IWFA 3DM0A 4HDJA 4QQEA 3RFGA 2P9KC 2VZ3A 3JZNA 3OKTA 3CFVA 5TEFA 4J73A 3ZE1A 2YMUA 4X3EA 1PBYB 4FHLA 4H5JA 4JSXC 3F3FA 3QI0A 4FA5D 5IJ8E 3IIWA 5FFGA
chains in the Genus database with same CATH topology
5M5VA 5M5UA 1UTCA 1C9IA 4G55A 3GD1I 5M61A 5M5RA 1BPOA 5M5TA 3GC3B 5M5SA 2XZGA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5V A;  5M5U A;  1UTC A;  1C9I A;  4G55 A;  3GD1 I;  5M61 A;  5M5R A;  1BPO A;  5M5T A;  3GC3 B;  5M5S A;  2XZG A;  1C9L A; 
#chains in the Genus database with same CATH topology
 2VDM A;  2GC4 A;  3MKS B;  3PVW B;  4J8B A;  4CC9 A;  2B5N A;  3CFS B;  2XZG A;  2XE4 A;  3PE7 A;  2GNQ A;  3N0E A;  5GXH A;  2OIZ A;  3JZG A;  5CXC B;  5FXY A;  1ERJ A;  2B5M A;  3AFC A;  3DDU A;  2HJ4 A;  3J81 g;  3SVW D;  5CYK B;  4ES0 A;  2G99 A;  2Z2O A;  5M5U A;  4X63 B;  5EMM B;  1E8N A;  1H2Z A;  2P9N C;  3ZDY A;  4O1Q D;  3UVL A;  2OVQ B;  5IJ7 E;  3EI3 A;  3I7K A;  4O3U B;  1A0R B;  2MTA H;  2VDK A;  2BKL A;  3FCU A;  3O4G A;  4BUJ C;  3MVD K;  4E54 A;  5K1C C;  1SQ9 A;  4O2W A;  1O6G A;  5EML B;  4H5I A;  1H2X A;  2IUR A;  4WK2 A;  2H14 A;  3MZL A;  1YFQ A;  4L9O A;  1GOT B;  2P9U C;  4DNW A;  1SHY B;  2H68 A;  4Z7N A;  1K32 A;  1T2X A;  1PEV A;  1R5M A;  5M5T A;  4Z7Q A;  3FM0 A;  1K8K C;  5TEE A;  4QRJ A;  4J77 A;  4X61 B;  3HFQ A;  5EAL A;  3EQ8 A;  4FWW A;  2BBK H;  2J57 G;  3EQ7 A;  4Y7R A;  3N0D A;  3MUN A;  3O4I A;  4CZY A;  1PI6 A;  4J79 A;  4OWR A;  5FKQ A;  4L3H D;  3U4Y A;  2IUV A;  3E0C A;  3UVK A;  3DSM A;  4BP8 A;  3I2N A;  3SMR A;  1TYE A;  5HE3 B;  1YR2 A;  4BCB A;  3OL2 A;  3PXT D;  5E6S A;  2AH1 A;  4JT6 C;  4QT8 A;  3UVN A;  4A08 A;  2OK6 A;  5M5V A;  3EI1 A;  4MK0 B;  2EBS A;  2PBI B;  3AL8 B;  3MKQ A;  4ZOX A;  2H9P A;  5H17 A;  1UOQ A;  3BG0 A;  3EG6 A;  1C9I A;  4DNU A;  3O4H A;  1N6F A;  2P9P C;  2YNN A;  4NSX A;  5IC7 A;  3PXS D;  5M5R A;  4ERY A;  5JWZ A;  5FLX g;  3JAM g;  4J78 A;  3SXT D;  1N6E A;  4A0A A;  5HQG A;  3GD1 I;  1SQJ A;  3SBQ A;  2AQ5 A;  3NIG A;  2YBA A;  5H14 A;  4CY3 A;  5IGQ A;  3BG1 A;  4A11 B;  4NBM A;  2OK4 A;  1JTD B;  1JV2 A;  4EWR A;  5FQD A;  3NVX A;  3C9C A;  3JRO A;  2AGW A;  3UKU C;  2VC2 A;  1H2Y A;  3KRW B;  5TDH B;  2OJY A;  3JRP A;  3K71 A;  3C75 H;  2YB8 B;  5K19 A;  2PM6 B;  3V5W B;  4G1E A;  2XL3 A;  4GM9 A;  2P9I C;  5CXB A;  5TF2 A;  5C2V B;  4NC4 A;  4PBZ A;  3IKO A;  3C5M A;  4RE5 A;  3ZDZ A;  4NAA A;  1GOH A;  4XYH A;  5I5I A;  5KDO B;  4FAN D;  3KRX B;  1VYH C;  2EIE A;  2HKR A;  3FCS A;  3RRM C;  3EI2 A;  2P9L C;  3ORV D;  2Q7Q A;  2I0R A;  3MZK A;  1UTC A;  2BCJ B;  4IA9 A;  1E5T A;  1MG3 A;  1QNI A;  3F3G A;  2OVP B;  3UVO A;  4A7J A;  4R7A B;  4E5Z A;  3V9F A;  3EI4 A;  5H1M A;  2B5L A;  2H3X A;  2O9K A;  3PSL A;  3T3M A;  1MG2 A;  4PBY A;  5AMS A;  1H2W A;  2CE8 A;  3IIY A;  4FAV D;  4LG9 A;  4ERZ A;  2YNP A;  5FKT A;  3UVM A;  5A2Q g;  1JOF A;  3IUJ A;  3C99 A;  3ZWL B;  1L5G A;  5SXM A;  4BCC A;  4GZ8 A;  4JSP C;  1BPO A;  3DXK C;  3GC3 B;  2Z2P A;  3EMH A;  1E8M A;  2GC7 A;  5EAM A;  3VH0 A;  4PSW B;  4GGD A;  4CI2 A;  3J80 g;  4AMY A;  3EI3 B;  3FRX A;  3IUQ A;  4U1E I;  3OKY A;  4CY5 A;  4A09 A;  2VDN A;  3NID A;  5THA A;  4K3J B;  5FA5 B;  4D6V A;  4DNV A;  4ERQ A;  3NVQ A;  4E54 B;  2QC5 A;  5HE0 B;  2J56 H;  2I3T A;  5EM2 B;  2QZP A;  1QFS A;  5FKS A;  3OF7 A;  3SBP A;  2I0S A;  3RSE C;  1U8C A;  3AL8 A;  2AGZ A;  3OW8 A;  4CZV A;  4ESG A;  5FKR A;  3K6S A;  2HKM A;  1M1X A;  3RFH A;  3KCI A;  4KFM B;  4LGN A;  2WQ8 A;  1A12 A;  4Z7O A;  3I7N A;  3SLE D;  4WK4 A;  5HE2 B;  4Z8L A;  3DXM C;  3K26 A;  4J84 A;  3UR4 A;  4CI3 A;  5HDB A;  2PM9 A;  2IUP A;  4JT5 C;  2JKX A;  4L1Q D;  4CI8 A;  1MDA H;  3NVN A;  3JZH A;  3IJC A;  2AGX A;  1U4C A;  2H9M A;  3IJ0 A;  4JHP C;  4O45 A;  5C92 A;  4A0B A;  4G1M A;  1VZ3 A;  3IUN A;  4MMZ A;  2XDW A;  4J0W A;  4XYI A;  3K72 A;  3ULE C;  4FA4 D;  2CO0 A;  4GGC A;  3OL2 B;  2I3S A;  2HES X;  2HU7 A;  3BWS A;  2H47 A;  1JJU B;  5HE1 B;  1C9L A;  4A08 B;  4TZ4 A;  3IJE A;  4OZU A;  1OLZ A;  2OVR B;  2G9A A;  4J86 A;  3PVU B;  4O3T B;  3OKW A;  3QHY B;  4ZOY A;  3W15 A;  3K27 A;  1OMW B;  3I7L A;  5M5S A;  1B9X A;  3L4O D;  4JHN A;  2HXC A;  2VZ1 A;  4O9D A;  5CXC A;  4BCD A;  4AN1 A;  1UOO A;  3B7F A;  2VDP A;  2H13 A;  4J8G A;  2H9N A;  4Y5R D;  4AEZ A;  5C2W B;  3GRE A;  2HYE A;  3IVM A;  3VA6 A;  4GMB A;  4PC0 A;  2CN3 A;  5CYK A;  3V4V A;  4A0A B;  1XKS A;  2I0T A;  4J81 A;  2H9L A;  1NEX B;  3SHF A;  2CNX A;  2VDQ A;  4MMX A;  5GXI A;  4YVD A;  5IGO A;  2IAA A;  4UM8 A;  4UI9 R;  3O4J A;  1O6F A;  5E6U A;  4J87 A;  1VE6 A;  3NIF A;  4D9S A;  4GGA A;  3IUL A;  1S4U X;  4AOW A;  3VI4 A;  1QFM A;  5I5J A;  2Z2N A;  3DWL C;  1N6D A;  3RLM D;  5HYN B;  3SWS D;  3PXW D;  2QXV A;  4JXM A;  3I8E A;  3RMZ D;  2W18 A;  3EWE A;  4BL0 A;  2UZX B;  3AL9 A;  4AMZ A;  5EAP A;  4IMM A;  2QR5 A;  5EMJ B;  5CXB B;  3ODT A;  4O02 A;  3P4F A;  2J55 H;  4BH6 A;  5EAR A;  5C9Z B;  3A0F A;  4JD2 C;  3ZDX A;  4G56 B;  1U2V C;  4PSX B;  3VI3 A;  3EU7 A;  5GMK n;  2VDO A;  1UOP A;  3OTT A;  1TYQ C;  2PM7 B;  4X60 B;  3EI2 B;  1XIP A;  4PXW A;  4JSV C;  4CY1 A;  5IT9 g;  3RN1 D;  2CO0 C;  3T3P A;  4FB1 D;  4CZX A;  5EMK B;  1TBG A;  3MUO A;  4GM8 A;  5EM2 A;  3RN0 D;  1GG2 B;  1VE7 A;  3JPX A;  4WJK A;  4D0K A;  1JMZ B;  4E5Z B;  4ZN4 A;  4PNK B;  5I5M A;  3EI4 B;  1P22 A;  1B9Y A;  4IRZ A;  3I7H A;  4LG8 A;  5FFO A;  4U7A A;  5E6R A;  4GQ1 A;  4J0X A;  2CE9 A;  2EIC A;  2HU5 A;  3SJL D;  4UM9 A;  5B4W A;  3F3P A;  5M61 A;  3SN6 B;  2UZY B;  1PGU A;  4AN0 A;  1GOF A;  1L0Q A;  3MXX A;  4FA1 D;  3I7P A;  4JSN C;  1JMX B;  2B4E A;  2XU7 A;  2TRC B;  4QAM A;  4J82 A;  3GFC A;  2VDR A;  3MMY A;  3SFZ A;  2CN2 A;  4MMY A;  3I7O A;  1RI6 A;  3ZE2 A;  4CI1 A;  2VDL A;  4ZOV A;  1FWX A;  3I8C A;  3L4M D;  3I89 A;  3OKY B;  4RE6 A;  4A09 B;  2EID A;  2P9S C;  4NEN A;  1GOG A;  1I2M B;  1GP2 B;  1Q47 A;  4A11 A;  5GSA A;  3IUR A;  5C86 A;  4A2L A;  2H6Q A;  2IWK A;  4A2M A;  4XEI C;  3PSC B;  3SBR A;  3IUM A;  2AH0 A;  2XL2 A;  4I79 A;  2IUQ A;  2XYI A;  2H6N A;  4AX4 A;  2EIB A;  1NR0 A;  4ZOZ A;  4WK0 A;  4CY2 A;  3VGZ A;  3ZE0 A;  3V4P A;  3CIK B;  3EI1 B;  4GQ2 P;  2AGY A;  3JB9 L;  3V7D B;  3SCY A;  5AFU 3;  4QL1 A;  1K3I A;  2YNO A;  3AH8 B;  4L3G D;  4K3I D;  4BP9 A;  2HJB A;  4L1M A;  2PM9 B;  3UKR C;  3EQ9 A;  3IJ1 A;  4FA9 D;  2HU8 A;  3FGB A;  4N14 A;  4GQB B;  2AGL A;  4GM3 A;  1GXR A;  1VZ2 A;  5AJA A;  1XHM A;  2H6K A;  4A0B B;  4G55 A;  2IWF A;  3DM0 A;  4HDJ A;  4QQE A;  3RFG A;  2P9K C;  2VZ3 A;  3JZN A;  3OKT A;  3CFV A;  5TEF A;  4J73 A;  3ZE1 A;  2YMU A;  4X3E A;  1PBY B;  4FHL A;  4H5J A;  4JSX C;  3F3F A;  3QI0 A;  4FA5 D;  5IJ8 E;  3IIW A;  5FFG A; 
#chains in the Genus database with same CATH homology
 5M5V A;  5M5U A;  1UTC A;  1C9I A;  4G55 A;  3GD1 I;  5M61 A;  5M5R A;  1BPO A;  5M5T A;  3GC3 B;  5M5S A;  2XZG A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...