5M5VA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 2)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 84
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5vA00
1UTCA 1C9IA 5M5SA 5M5RA 3GC3B 5M5VA 5M5TA 1C9LA 5M61A 5M5UA 4G55A 2XZGA 1BPOA 3GD1I
chains in the Genus database with same CATH superfamily
5IJ8E 1UOOA 2HU7A 3EMHA 5GXHA 3V5WB 3DWLC 3I8CA 2YNNA 3N0DA 4DNUA 3UKRC 5EALA 4FAND 3UVOA 4LG8A 2P9UC 2VDMA 3SHFA 5SXMA 4PBZA 4OWRA 4U1EI 4U7AA 3I7LA 3VGZA 2H47A 3O4IA 4FB1D 5M61A 1TYEA 1SHYB 4GM9A 1H2WA 3O4JA 3KRXB 3JAMg 1K8KC 3P4FA 2IUPA 2VC2A 5FKQA 3V4VA 4BCDA 4D9SA 4IRZA 2H6KA 3BG0A 4WK2A 4IA9A 4Z7OA 5B4WA 3ORVD 3DSMA 2H68A 3I8EA 2UZYB 2VDOA 3C5MA 4Z7QA 4AOWA 5HE2B 3JZHA 4DNWA 2Z2PA 2YNOA 2CN2A 5EMJB 3IKOA 4MMZA 4NC4A 1MG2A 4CC9A 2AH1A 4XYHA 4CY3A 4ERYA 4A0BB 3FCSA 2B5NA 3JROA 5M5RA 1GOFA 1UOQA 4G1EA 4X60B 4FA9D 4E5ZB 1SQJA 4PBYA 3RFHA 3K26A 2XDWA 2XZGA 3OL2B 1P22A 4L1QD 1K32A 3HFQA 1VZ3A 4PSXB 3IUJA 3I7OA 3PSCB 4XYIA 3U4YA 5C9ZB 3MUOA 2P9IC 4J0XA 2H14A 4GZ8A 4UM8A 1K3IA 3I7HA 4BL0A 3NVNA 3IULA 4ES0A 2I0TA 3PSLA 4A0BA 2OVQB 4GMBA 3VA6A 3EI1A 4KFMB 2OJYA 4O3UB 3OL2A 2I0RA 3F3PA 4E54B 3I7PA 3GREA 3QHYB 2EIBA 4FHLA 3EQ7A 4PC0A 3UVLA 3NIDA 5TDHB 4A09B 3K27A 2AQ5A 4MMXA 5CXBB 5FXYA 3VI4A 2G99A 2I0SA 5AMSA 1PBYB 3FRXA 4G55A 2IURA 3IUNA 1B9XA 2Z2OA 4O1QD 3IJ0A 3V9FA 3PVWB 4D6VA 4A11B 3FM0A 1U4CA 3PVUB 3SMRA 2CO0C 3KCIA 2H13A 2BCJB 5H17A 3MUNA 4ZOZA 3NVXA 1M1XA 4CZXA 4E54A 1JTDB 2YBAA 3IUMA 3F3GA 1C9IA 3A0FA 3SBQA 2AGXA 1RI6A 5CXBA 5EMMB 5K1CC 3MZLA 2AGZA 4LGNA 2QZPA 3EG6A 2YMUA 1JJUB 1XKSA 3C99A 3T3MA 2CE9A 2P9SC 4QL1A 2B4EA 4JT5C 4RE6A 3EU7A 2HJBA 2CN3A 4A11A 4NBMA 3UR4A 1NEXB 4J8BA 4JHNA 3SBRA 2J57G 3IJCA 3NIGA 1MDAH 2HU5A 3RLMD 1OMWB 1YFQA 4GQ2P 4H5IA 1OLZA 4CI2A 2AH0A 1I2MB 3ZE2A 5I5MA 4ERQA 3RFGA 5FKTA 3ULEC 3OKYB 5C86A 3F3FA 2WQ8A 4CZVA 1GOHA 4PSWB 3V4PA 3SVWD 2IWFA 5A2Qg 5GMKn 2GC4A 3FGBA 4JSVC 5H14A 3CFSB 4O3TB 4JT6C 2BBKH 4ZOYA 2P9LC 1QNIA 3EWEA 2W18A 3OTTA 4J81A 3ZE0A 3BG1A 4J77A 5EMLB 5CYKB 1L0QA 4R7AB 5AJAA 3PE7A 4EWRA 1E8NA 3OKYA 2P9NC 3EI2B 3K6SA 1T2XA 5EAMA 2IUQA 4AN1A 2GC7A 2HXCA 2QXVA 4K3ID 1JV2A 3O4GA 2J56H 4Y7RA 3O4HA 2VDLA 4J84A 3SBPA 3T3PA 2OK6A 4X3EA 4UM9A 3L4MD 1L5GA 5IGOA 1ERJA 1H2YA 3OF7A 3IJEA 1C9LA 3I89A 5HDBA 4CI3A 4CZYA 3L4OD 5CYKA 2MTAH 2OVPB 5K19A 3PXSD 3EI1B 3DXMC 4L3GD 2H9PA 3FCUA 4O2WA 1PI6A 2CO0A 1YR2A 3JRPA 3RN1D 5HE0B 3J81g 3EI2A 4MMYA 1VYHC 1VE7A 3MXXA 2XL2A 4L9OA 5EM2B 4N14A 2HKRA 3QI0A 2CNXA 1SQ9A 3JZGA 3JPXA 3EI3B 3GC3B 3MKQA 4J0WA 4X63B 3MZKA 5FQDA 4CY1A 5C2WB 5HYNB 3N0EA 3EI4B 2YB8B 4O9DA 4FA5D 4O45A 2EICA 3RSEC 2OK4A 1UOPA 4WK4A 3BWSA 4NAAA 4I79A 4HDJA 2IWKA 5E6RA 2VZ1A 5M5UA 4RE5A 5THAA 4YVDA 5CXCA 3DXKC 4JHPC 4A0AB 4NSXA 2B5LA 2P9KC 5EM2A 4GQBB 2QC5A 4J86A 5FKRA 1JMXB 1H2ZA 4FWWA 3EI3A 4BCBA 1E5TA 4J73A 2HJ4A 3EI4A 4LG9A 2B5MA 4A2LA 4UI9R 4J8GA 1A12A 1N6EA 4WK0A 5EARA 5M5VA 5I5IA 5C2VB 4BH6A 3B7FA 3I2NA 5TEEA 4ZOXA 3UVKA 4A0AA 1N6FA 2OIZA 2H9MA 5KDOB 3AH8B 4FA4D 3RRMC 3OKTA 3UKUC 3CFVA 4L1MA 4NENA 5FFGA 4OZUA 2XU7A 2VDPA 5EMKB 2XE4A 4QT8A 4BP9A 3SWSD 1QFMA 3I7NA 3E0CA 4G1MA 2XL3A 3SLED 2H9LA 1O6FA 2AGYA 3GD1I 5FKSA 1XHMA 4XEIC 4A7JA 4D0KA 4ZOVA 4A2MA 3RN0D 2VDQA 3CIKB 4BP8A 3MKSB 4PXWA 1U8CA 4CY2A 4FAVD 1NR0A 3IURA 5I5JA 4JXMA 2VDKA 4QQEA 4MK0B 3JB9L 2TRCB 2PBIB 2O9KA 4FA1D 3IIWA 4GM3A 3DM0A 2EIDA 2PM7B 1XIPA 2EIEA 5HE1B 3RMZD 5M5SA 1GOTB 4IMMA 2PM6B 2AGWA 4L3HD 4GGAA 5FA5B 2HKMA 2QR5A 4JSNC 3PXWD 4BCCA 1VE6A 1H2XA 4PNKB 2YNPA 4AN0A 4GM8A 3IUQA 1TYQC 3UVMA 3VH0A 1E8MA 3DDUA 3I7KA 4QAMA 2P9PC 5IT9g 2GNQA 2H3XA 5FFOA 2PM9B 3ZDXA 1A0RB 2AGLA 5H1MA 3SCYA 4WJKA 4GQ1A 4AX4A 3V7DB 4O02A 4QRJA 3OKWA 5EAPA 2Q7QA 5TEFA 5C92A 4TZ4A 3K72A 2HU8A 3MVDK 5IC7A 1S4UX 3ODTA 3SN6B 3AFCA 5CXCB 1O6GA 3ZDZA 2EBSA 2UZXB 5GSAA 4CI1A 2PM9A 4K3JB 3VI3A 5FLXg 1JMZB 1QFSA 2I3TA 5TF2A 2IAAA 1N6DA 4AEZA 4Y5RD 5M5TA 4CI8A 1Q47A 4G56B 5E6UA 3K71A 4J82A 1PEVA 2HYEA 4ERZA 4H5JA 5HQGA 1GXRA 2J55H 2VDRA 3NIFA 3IJ1A 4DNVA 5IGQA 3IIYA 3ZDYA 3EQ9A 1GP2B 1B9YA 1UTCA 3IVMA 3AL8B 5IJ7E 4GGDA 2H6NA 4E5ZA 3AL9A 1VZ2A 2HESX 5GXIA 4A08B 1GG2B 3W15A 4AMZA 4Z7NA 3OW8A 3SFZA 2OVRB 1TBGA 4AMYA 4J78A 5E6SA 1GOGA 4J87A 4CY5A 4GGCA 5HE3B 3ZWLB 4ZN4A 2Z2NA 3KRWB 2H6QA 2H9NA 3NVQA 4ESGA 3AL8A 3ZE1A 3SXTD 2CE8A 5AFU3 4X61B 4JSXC 2VZ3A 1FWXA 2VDNA 3GFCA 3PXTD 3EQ8A 3C75H 4A08A 1MG3A 3JZNA 4JD2C 2I3SA 2XYIA 3MMYA 4JSPC 1BPOA 2BKLA 2IUVA 5JWZA 4A09A 4Z8LA 3UVNA 2G9AA 1R5MA 4J79A 3SJLD 4BUJC 2JKXA 1U2VC 3J80g 1PGUA 1JOFA 3C9CA
chains in the Genus database with same CATH topology
1UTCA 1C9IA 5M5SA 5M5RA 3GC3B 5M5VA 5M5TA 1C9LA 5M61A 5M5UA 4G55A 2XZGA 1BPOA 3GD1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTC A;  1C9I A;  5M5S A;  5M5R A;  3GC3 B;  5M5V A;  5M5T A;  1C9L A;  5M61 A;  5M5U A;  4G55 A;  2XZG A;  1BPO A;  3GD1 I; 
#chains in the Genus database with same CATH topology
 5IJ8 E;  1UOO A;  2HU7 A;  3EMH A;  5GXH A;  3V5W B;  3DWL C;  3I8C A;  2YNN A;  3N0D A;  4DNU A;  3UKR C;  5EAL A;  4FAN D;  3UVO A;  4LG8 A;  2P9U C;  2VDM A;  3SHF A;  5SXM A;  4PBZ A;  4OWR A;  4U1E I;  4U7A A;  3I7L A;  3VGZ A;  2H47 A;  3O4I A;  4FB1 D;  5M61 A;  1TYE A;  1SHY B;  4GM9 A;  1H2W A;  3O4J A;  3KRX B;  3JAM g;  1K8K C;  3P4F A;  2IUP A;  2VC2 A;  5FKQ A;  3V4V A;  4BCD A;  4D9S A;  4IRZ A;  2H6K A;  3BG0 A;  4WK2 A;  4IA9 A;  4Z7O A;  5B4W A;  3ORV D;  3DSM A;  2H68 A;  3I8E A;  2UZY B;  2VDO A;  3C5M A;  4Z7Q A;  4AOW A;  5HE2 B;  3JZH A;  4DNW A;  2Z2P A;  2YNO A;  2CN2 A;  5EMJ B;  3IKO A;  4MMZ A;  4NC4 A;  1MG2 A;  4CC9 A;  2AH1 A;  4XYH A;  4CY3 A;  4ERY A;  4A0B B;  3FCS A;  2B5N A;  3JRO A;  5M5R A;  1GOF A;  1UOQ A;  4G1E A;  4X60 B;  4FA9 D;  4E5Z B;  1SQJ A;  4PBY A;  3RFH A;  3K26 A;  2XDW A;  2XZG A;  3OL2 B;  1P22 A;  4L1Q D;  1K32 A;  3HFQ A;  1VZ3 A;  4PSX B;  3IUJ A;  3I7O A;  3PSC B;  4XYI A;  3U4Y A;  5C9Z B;  3MUO A;  2P9I C;  4J0X A;  2H14 A;  4GZ8 A;  4UM8 A;  1K3I A;  3I7H A;  4BL0 A;  3NVN A;  3IUL A;  4ES0 A;  2I0T A;  3PSL A;  4A0B A;  2OVQ B;  4GMB A;  3VA6 A;  3EI1 A;  4KFM B;  2OJY A;  4O3U B;  3OL2 A;  2I0R A;  3F3P A;  4E54 B;  3I7P A;  3GRE A;  3QHY B;  2EIB A;  4FHL A;  3EQ7 A;  4PC0 A;  3UVL A;  3NID A;  5TDH B;  4A09 B;  3K27 A;  2AQ5 A;  4MMX A;  5CXB B;  5FXY A;  3VI4 A;  2G99 A;  2I0S A;  5AMS A;  1PBY B;  3FRX A;  4G55 A;  2IUR A;  3IUN A;  1B9X A;  2Z2O A;  4O1Q D;  3IJ0 A;  3V9F A;  3PVW B;  4D6V A;  4A11 B;  3FM0 A;  1U4C A;  3PVU B;  3SMR A;  2CO0 C;  3KCI A;  2H13 A;  2BCJ B;  5H17 A;  3MUN A;  4ZOZ A;  3NVX A;  1M1X A;  4CZX A;  4E54 A;  1JTD B;  2YBA A;  3IUM A;  3F3G A;  1C9I A;  3A0F A;  3SBQ A;  2AGX A;  1RI6 A;  5CXB A;  5EMM B;  5K1C C;  3MZL A;  2AGZ A;  4LGN A;  2QZP A;  3EG6 A;  2YMU A;  1JJU B;  1XKS A;  3C99 A;  3T3M A;  2CE9 A;  2P9S C;  4QL1 A;  2B4E A;  4JT5 C;  4RE6 A;  3EU7 A;  2HJB A;  2CN3 A;  4A11 A;  4NBM A;  3UR4 A;  1NEX B;  4J8B A;  4JHN A;  3SBR A;  2J57 G;  3IJC A;  3NIG A;  1MDA H;  2HU5 A;  3RLM D;  1OMW B;  1YFQ A;  4GQ2 P;  4H5I A;  1OLZ A;  4CI2 A;  2AH0 A;  1I2M B;  3ZE2 A;  5I5M A;  4ERQ A;  3RFG A;  5FKT A;  3ULE C;  3OKY B;  5C86 A;  3F3F A;  2WQ8 A;  4CZV A;  1GOH A;  4PSW B;  3V4P A;  3SVW D;  2IWF A;  5A2Q g;  5GMK n;  2GC4 A;  3FGB A;  4JSV C;  5H14 A;  3CFS B;  4O3T B;  4JT6 C;  2BBK H;  4ZOY A;  2P9L C;  1QNI A;  3EWE A;  2W18 A;  3OTT A;  4J81 A;  3ZE0 A;  3BG1 A;  4J77 A;  5EML B;  5CYK B;  1L0Q A;  4R7A B;  5AJA A;  3PE7 A;  4EWR A;  1E8N A;  3OKY A;  2P9N C;  3EI2 B;  3K6S A;  1T2X A;  5EAM A;  2IUQ A;  4AN1 A;  2GC7 A;  2HXC A;  2QXV A;  4K3I D;  1JV2 A;  3O4G A;  2J56 H;  4Y7R A;  3O4H A;  2VDL A;  4J84 A;  3SBP A;  3T3P A;  2OK6 A;  4X3E A;  4UM9 A;  3L4M D;  1L5G A;  5IGO A;  1ERJ A;  1H2Y A;  3OF7 A;  3IJE A;  1C9L A;  3I89 A;  5HDB A;  4CI3 A;  4CZY A;  3L4O D;  5CYK A;  2MTA H;  2OVP B;  5K19 A;  3PXS D;  3EI1 B;  3DXM C;  4L3G D;  2H9P A;  3FCU A;  4O2W A;  1PI6 A;  2CO0 A;  1YR2 A;  3JRP A;  3RN1 D;  5HE0 B;  3J81 g;  3EI2 A;  4MMY A;  1VYH C;  1VE7 A;  3MXX A;  2XL2 A;  4L9O A;  5EM2 B;  4N14 A;  2HKR A;  3QI0 A;  2CNX A;  1SQ9 A;  3JZG A;  3JPX A;  3EI3 B;  3GC3 B;  3MKQ A;  4J0W A;  4X63 B;  3MZK A;  5FQD A;  4CY1 A;  5C2W B;  5HYN B;  3N0E A;  3EI4 B;  2YB8 B;  4O9D A;  4FA5 D;  4O45 A;  2EIC A;  3RSE C;  2OK4 A;  1UOP A;  4WK4 A;  3BWS A;  4NAA A;  4I79 A;  4HDJ A;  2IWK A;  5E6R A;  2VZ1 A;  5M5U A;  4RE5 A;  5THA A;  4YVD A;  5CXC A;  3DXK C;  4JHP C;  4A0A B;  4NSX A;  2B5L A;  2P9K C;  5EM2 A;  4GQB B;  2QC5 A;  4J86 A;  5FKR A;  1JMX B;  1H2Z A;  4FWW A;  3EI3 A;  4BCB A;  1E5T A;  4J73 A;  2HJ4 A;  3EI4 A;  4LG9 A;  2B5M A;  4A2L A;  4UI9 R;  4J8G A;  1A12 A;  1N6E A;  4WK0 A;  5EAR A;  5M5V A;  5I5I A;  5C2V B;  4BH6 A;  3B7F A;  3I2N A;  5TEE A;  4ZOX A;  3UVK A;  4A0A A;  1N6F A;  2OIZ A;  2H9M A;  5KDO B;  3AH8 B;  4FA4 D;  3RRM C;  3OKT A;  3UKU C;  3CFV A;  4L1M A;  4NEN A;  5FFG A;  4OZU A;  2XU7 A;  2VDP A;  5EMK B;  2XE4 A;  4QT8 A;  4BP9 A;  3SWS D;  1QFM A;  3I7N A;  3E0C A;  4G1M A;  2XL3 A;  3SLE D;  2H9L A;  1O6F A;  2AGY A;  3GD1 I;  5FKS A;  1XHM A;  4XEI C;  4A7J A;  4D0K A;  4ZOV A;  4A2M A;  3RN0 D;  2VDQ A;  3CIK B;  4BP8 A;  3MKS B;  4PXW A;  1U8C A;  4CY2 A;  4FAV D;  1NR0 A;  3IUR A;  5I5J A;  4JXM A;  2VDK A;  4QQE A;  4MK0 B;  3JB9 L;  2TRC B;  2PBI B;  2O9K A;  4FA1 D;  3IIW A;  4GM3 A;  3DM0 A;  2EID A;  2PM7 B;  1XIP A;  2EIE A;  5HE1 B;  3RMZ D;  5M5S A;  1GOT B;  4IMM A;  2PM6 B;  2AGW A;  4L3H D;  4GGA A;  5FA5 B;  2HKM A;  2QR5 A;  4JSN C;  3PXW D;  4BCC A;  1VE6 A;  1H2X A;  4PNK B;  2YNP A;  4AN0 A;  4GM8 A;  3IUQ A;  1TYQ C;  3UVM A;  3VH0 A;  1E8M A;  3DDU A;  3I7K A;  4QAM A;  2P9P C;  5IT9 g;  2GNQ A;  2H3X A;  5FFO A;  2PM9 B;  3ZDX A;  1A0R B;  2AGL A;  5H1M A;  3SCY A;  4WJK A;  4GQ1 A;  4AX4 A;  3V7D B;  4O02 A;  4QRJ A;  3OKW A;  5EAP A;  2Q7Q A;  5TEF A;  5C92 A;  4TZ4 A;  3K72 A;  2HU8 A;  3MVD K;  5IC7 A;  1S4U X;  3ODT A;  3SN6 B;  3AFC A;  5CXC B;  1O6G A;  3ZDZ A;  2EBS A;  2UZX B;  5GSA A;  4CI1 A;  2PM9 A;  4K3J B;  3VI3 A;  5FLX g;  1JMZ B;  1QFS A;  2I3T A;  5TF2 A;  2IAA A;  1N6D A;  4AEZ A;  4Y5R D;  5M5T A;  4CI8 A;  1Q47 A;  4G56 B;  5E6U A;  3K71 A;  4J82 A;  1PEV A;  2HYE A;  4ERZ A;  4H5J A;  5HQG A;  1GXR A;  2J55 H;  2VDR A;  3NIF A;  3IJ1 A;  4DNV A;  5IGQ A;  3IIY A;  3ZDY A;  3EQ9 A;  1GP2 B;  1B9Y A;  1UTC A;  3IVM A;  3AL8 B;  5IJ7 E;  4GGD A;  2H6N A;  4E5Z A;  3AL9 A;  1VZ2 A;  2HES X;  5GXI A;  4A08 B;  1GG2 B;  3W15 A;  4AMZ A;  4Z7N A;  3OW8 A;  3SFZ A;  2OVR B;  1TBG A;  4AMY A;  4J78 A;  5E6S A;  1GOG A;  4J87 A;  4CY5 A;  4GGC A;  5HE3 B;  3ZWL B;  4ZN4 A;  2Z2N A;  3KRW B;  2H6Q A;  2H9N A;  3NVQ A;  4ESG A;  3AL8 A;  3ZE1 A;  3SXT D;  2CE8 A;  5AFU 3;  4X61 B;  4JSX C;  2VZ3 A;  1FWX A;  2VDN A;  3GFC A;  3PXT D;  3EQ8 A;  3C75 H;  4A08 A;  1MG3 A;  3JZN A;  4JD2 C;  2I3S A;  2XYI A;  3MMY A;  4JSP C;  1BPO A;  2BKL A;  2IUV A;  5JWZ A;  4A09 A;  4Z8L A;  3UVN A;  2G9A A;  1R5M A;  4J79 A;  3SJL D;  4BUJ C;  2JKX A;  1U2V C;  3J80 g;  1PGU A;  1JOF A;  3C9C A; 
#chains in the Genus database with same CATH homology
 1UTC A;  1C9I A;  5M5S A;  5M5R A;  3GC3 B;  5M5V A;  5M5T A;  1C9L A;  5M61 A;  5M5U A;  4G55 A;  2XZG A;  1BPO A;  3GD1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...