5M5XJ

Rna polymerase i elongation complex 1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m5xJ00
3D1NI 5DS9A 2LR8A 2Y9YA 5GPCA 3TEDA 3S15J 3RZOJ 1MSEC 2EH3A 1VF9A 2FX0A 4A93J 5FKNA 2EZHA 5IYBJ 3GTGJ 1IG7A 2MW8A 3PO3J 3ZQFA 2K9NA 5GPAA 5F0HA 3BR3A 1FIPA 4Y52J 4DW6A 3HOZJ 4XRSG 4BKXA 3JRGA 2DA6A 2O8KA 1AHDP 2XPWA 3CCYA 1SANA 3WHBA 4RDUA 1VFCA 1UHSA 2DMTA 2LY9A 1WH5A 2R0QC 2DA1A 1X58A 1RPWA 1H8AC 3RQIA 2YU9J 2B63J 3HDDA 2ZB9A 4HNVA 4DYRA 2XPVA 2JA8J 2VI6A 5IP7J 1ETXA 3K2AA 4M3GA 4XIDA 1IRZA 3FK6A 1WGXA 4GFBA 1HF0A 3H0GJ 3Q0UA 5K7ZA 1XS9A 1WPKA 3HEFA 4XRMA 2EBIA 2L7FP 1YRNA 4C3HJ 4A3EJ 4M6VA 1JT6A 2PMZN 5EDNA 5EGOA 2R7ZJ 1X2MA 1B8IB 2VPRA 3GTQJ 5K7FA 3OSGA 2R92J 4FISA 3QQAA 2X9DA 2X6OA 2QF7A 3ZQHA 2M2EA 3GTKJ 1RKTA 4A69C 3UKGA 3O8HA 1FEXA 3BG5A 2NS8A 1ITYA 1RKWA 2R5ZB 1D5YA 3HM5A 2WB1N 4B4CA 4A3DJ 4M3BA 4D7NA 1ZKGA 4UUSA 4DZPA 1U9NA 2R93J 2DJNA 4MFDA 3HOUJ 2CQXA 2JMWA 5HODA 4A3MJ 1GV2A 5DTDA 1QVTA 4FE7A 1OCTC 4Y7NJ 1MBFA 2DA2A 4C2MJ 2NVQJ 1Y1VJ 5M3FJ 3WHCA 4AC0A 5EF6A 3NARA 4B1RA 4QSHA 3IH2A 4AUXA 5J3LA 2JJ7A 3O8GA 4IHWA 2DA4A 1WCMJ 5FKMA 1ENHA 2EZLA 4FCYA 2L0KA 1QVUA 2EZIA 2GBYA 3GTOJ 2VUMJ 2DMQA 1BA5A 1CQTA 2G0EA 3MN2A 3SFIA 3HOXJ 2R5YB 2XGDA 1OCPA 3FK7A 1A6IA 3S2DJ 3DCFA 1MSFC 5IYDJ 4BBRJ 4AYBN 1Z0XA 1HDDC 3A01B 3BG9A 2MG4A 3IH4A 3HBLA 5IOYA 3CMYA 2FJ1A 4BY1J 5F08A 2VKVA 2MGQA 2R5ZA 3LSRA 3CDLA 1MBEA 2WV1A 1JKPC 4D7MA 2HI3A 3JRAA 4BY7J 3HOYJ 1I3QJ 4I76A 4BBSJ 3S1MJ 1QRYA 2NVYJ 3JRFA 3QPLA 3ZQLA 4ABZA 3BG3A 2CJJA 2KT0A 1ZR4A 2M0CA 5FKOA 1HDPA 5IYCJ 1MNMC 3NAUA 5C44J 4A3JJ 2IAIA 4C3JJ 2CRGA 2TCTA 2MSYA 3BTJA 3LOCA 1GDTA 2HQ5A 1ZGWA 3M3YJ 1W0TA 3F0CA 4CYCA 3S16J 2QCOA 5F0FA 5EG0B 5FKLA 1H89C 4W97A 1RETA 1MBGA 4JX5A 3GTLJ 1E3OC 5IP6A 3DEWA 1SFOJ 1TC3C 5FLMJ 2X48A 3Q3SA 3K7AJ 2R5YA 4MIMA 2YS9A 3HOVJ 1WI3A 5F1JA 3SDGA 1FIAA 5IP9J 5FJ8J 1MBKA 1U8BA 2NVXJ 3BR2A 3BTLA 4V2FA 1B72A 5M3MJ 4M3FA 1JJ6C 5EYRA 2GLOA 1Z77A 2CQQA 1U78A 4A3FJ 5EZHA 3A01A 1IUFA 4BXXJ 5E3LA 3MKLA 3W6VA 4EEFG 2GM4A 5BNGA 2YUSA 1AKHB 2D5VA 3IH3A 1K83J 3ZQGA 4XICA 2Y9ZA 5F27A 1JJ8C 2Y31A 1ORKA 3C2BA 2ID6A 5E3OA 3JRCA 2ELKA 2EZKA 1P7JA 1ETOA 2E1OA 2XSDC 2LD5A 2E2HJ 3G1LA 3G1OA 2XB5A 1JKOC 5IPAA 1BW5A 3BR0A 1UMQA 2XB0X 1F43A 2FD5A 3M4OJ 1F36A 1GVDA 4JP0A 1ETKA 4XRSA 2JA5J 1T33A 1A5JA 1QPIA 4S0HB 5J1RA 1HOMA 2XRLA 4B3AA 3BQYA 3HOWJ 4LOCA 3S17J 1ETYA 2W48A 2JA6J 3I4MJ 3BR1A 4L5EA 5EG0A 2HOSA 1VI0A 1TWHJ 3HGYA 1JUPA 2ECBA 2LP0A 1BW6A 5F0CA 2I10A 5GP9A 1TWAJ 4DZJA 1LE8B 3H3VK 3TP3A 1W0UA 1PUFB 2DMUA 3A03A 5FLVA 1B8IA 2L9RA 1I50J 3HB9A 4QIWN 4JX6A 5F04A 2O7OA 1MH4A 2DTZA 2M9HA 5E3NA 2HXOA 5JLWA 2DA5A 3BTCA 2AHQA 1GT0C 4IHYA 2Y0SN 1IDYA 1YRNB 4I6ZA 1IDZA 1I6HJ 3TP0A 2Y2ZA 1S7EA 3A02A 1AKHA 3TW7A 1DU6A 1JKQC 3B6AA 2Y30A 3GTPJ 1HCRA 3ZQIA 1G2HA 4D5FA 1K61A 1NK3P 2HDDA 5M5XJ 1R9TJ 1MH3A 4QTRA 2H1KA 2JK3A 3JRBA 1HLVA 1ZR2A 1DU0A 2DA3A 4A3BJ 4MLOA 1XC5A 1JTYA 2FQ4A 4DYQA 1XG1A 1BL0A 2E2JJ 3BR5A 1MBJA 1ETQA 4JYKA 2JN6A 4W1UA 3RZDJ 1ZTRA 1ZQ3P 3CQZJ 3ZOBA 3TW6A 2K9QA 2ME6A 3FKIJ 4UUSB 1NK2P 2LLKA 3S1NJ 3JREA 4X6AJ 1X2NA 4MFEA 4G12A 3E7LA 2N8GA 2M8GX 2OPTA 3JR9A 1Y1WJ 3RKQA 2WAQN 2IBDA 1LE8A 5C4XJ 2HOAA 5M5YJ 3GBGA 2IEKA 1PUFA 1Q1VA 4X1EA 5E3MA 1TWGJ 4M3DA 2DN0A 4C3IJ 3BT9A 1GV5A 4XK4A 3LSPA 4A3KJ 1JKRC 3ZQCA 1APLC 2XPUA 3MVPA 2TRTA 2XGCA 4UUTA 2RAEA 2LTPA 2NS7A 4J19A 5C4JJ 1BJZA 2CUFA 2CUEA 1P7IA 2OF7A 4A3IJ 4V2GA 2K40A 3HKZN 3PM1A 5J1UA 3VPRA 5EEAA 1JT0A 4NDLA 2L7ZA 3SJMA 2O9LA 2K9SA 3GTJJ 2KDZA 4DYCA 2AO9A 1VNDA 1ZK8A 1U9OA 2HYJA 2LKXA 1LFUP 1JUSA 1FTTA 1RR7A 1FJLA 1IGNA 5IOZA 2DMPA 3PO2J 2HXIA 2VKEA 1POGA 3BQZA 2LVSA 1TWFJ 2HOTA 4IHVA 1H88C 2M34A 4JX4A 2NVTJ 2NOGA 3IV5A 3FISA 2H8RA 2LK2A 2JA7J 3GTMJ 1IC8A 1TWCJ 3G1MA 1IV6A 3Q0WA 3L1PA 3OOUA 5C3EJ 1RESA 3OSFA 3HGGA 1LFBA 3S14J 1GUUA 1T56A 2EQRA 3LSJA 3JRDA 3S1QJ 1MBHA 2DA7A 3BTIA 4RBOA 4A3GJ 1AU7A 3S2HJ 3B6CA 5FKKA 3JRIA 1FTZA 1O4XA 2JWTA 1OJLA 2COBA 5M5WJ 5J1YA 2LFBA 2CU7A 2ECCA 3LSGA 4CYCB 4A3CJ 3I4NJ 3BR6A 3S1RJ 2P81A 2ID3A 2L7MP 2E19A 5JLXA 4IHXA 3Q0VA 4IEJA 1ETWA 5K7HA 4D5CA 1JUMA 1ETVA 2DMNA 4M3EA 1WH7A 3OIOA 4MO7A 1NTCA 2ME0A 1IJWC 5EGOB 3LNQA 5EZGA 4FTHA 2E2IJ 1OFCX 2XGEA 1JTXA 4FE4A 3QPSA 1UG2A 3FIWA 1JGGA 1B72B 4A3LJ 9ANTA 1EF4A 3JRHA
chains in the Genus database with same CATH superfamily
3D1NI 2LR8A 4BXFA 2F4OB 4G6TB 1JHHA 4XLNF 4HLYA 1J75A 1BIAA 2Y9YA 4CCLA 4EVIA 5GPCA 1SMTA 2A68F 2EH3A 3K2ZA 2QKMB 3WE3A 3CUQC 1Y8RB 2XAFA 2ZMEA 2WC2A 1VQMI 4CZZA 2P4WA 5IYBJ 5E1ZB 2V4JC 2UXNA 1IG7A 2MW8A 2QVOA 3HSRA 5GPAA 1R7JA 3V8KA 3DBHB 3PQKA 1G59A 4DW6A 1G8XA 3GFLA 1GLNA 1MJ9A 3QYEA 4BKXA 4WWCA 1G3SA 2HZDA 1WJAA 3E6BA 2BOLA 3KE2A 2FRHA 2F4IA 3DLLF 1REPC 4RDUA 2DMTA 2EIKH 3VYUB 1WJ5A 1WH5A 1HA8A 3F8FA 3AL0C 4BDYA 3HDDA 4LG0A 4II2A 2VBWA 4HNVA 1W4MA 3HPHA 4B3XA 1YIJI 1ETXA 5J47A 4QPOA 1IN8A 1IRZA 4OAYA 1WGXA 4XMYA 5ICFA 5L3EA 2Z2SB 4G7OF 3Q0UA 2WWYA 4M9ZA 1IN6A 3HTSB 5L3DA 3S3MA 2DDBA 1YTYA 5EDNA 4GRIA 5CVRA 4CGZA 3OSGA 5K1YA 2CFOA 2OAZA 2X9DA 3JTHA 3FMRA 1QZEA 3GLLA 2M4KA 1Z3YA 3VDXA 1TNTA 3TOAA 1FEXA 2W85A 3U1DA 3H9JA 1BIBA 1ITYA 1RKWA 3J7YJ 2VASA 1XMKA 4BQOA 4H4KC 1J5YA 2R5ZB 1X19A 1SD7A 4MTDA 2B7EA 4BGDA 2WB1N 4HLXA 3VSKA 4A3DJ 1Z21A 3WU1B 1HW2A 3AFHA 4Z2YA 3KYCB 5E20A 4D7NA 3CF5F 2HQRA 3VSLA 2KLOA 4UUSA 5KCMA 4BE0A 4L5IA 3GFJA 1FMVA 2L7KA 3E3VA 3HOUJ 1EH6A 1BN5A 2ESHA 2HPIA 2JMWA 2BY3A 2IA1A 4IOAF 5DTDA 1XMAA 3H1CA 4FE7A 4LFUA 1OCTC 5GAGJ 3SZGA 3CP2A 4YIFA 2CS3A 2DA2A 3M07A 3WHCA 4AC0A 2XF5A 3NARA 3ZPLA 2DOEA 1K6OA 4AUXA 3O8GA 5H20A 5D8KB 2ZXJA 4KICA 2VJIA 2FMYA 3WTSC 5FKMA 1ENHA 3B73A 5E17F 4K2EA 4PJMA 3ELKA 2DU9A 3DKXA 3H3UA 2EZIA 4IO9F 2GBYA 1ZRFA 1UHWA 3TDZC 2DMQA 2O0YA 3QOPA 1B9NA 5LEJA 2P5KA 3MN2A 3SFIA 3HOXJ 2FA5A 3EPZA 2F48A 4MGRA 1A6IA 4PK4A 2LNBA 2KIUA 5IYDJ 2V7FA 3SFZA 4B8XA 4BBRJ 2E1CA 3R61A 1GHCA 2F4MB 2LYCA 5TGTA 3HBLA 4G7HF 3QPTA 3MKZA 5F08A 1MD0A 3IRRA 2QBYB 2VKVA 3DU6A 4HRIA 2IS4A 2A6TA 3KEYA 2HI3A 2CO5A 2ELHA 3TQNA 4IX7A 2VLAA 3OIPA 2KMUA 4RB1A 3JRFA 1VQNI 4I0BA 4I98B 4RM2A 3WTUC 1P9QC 3MKWB 1DGWY 1XDUA 2CJJA 3Q9SA 2W24A 5D6EA 3GYHX 4RGSA 5FKOA 2X1EA 3IUOA 3ABLH 3DKWA 4KUMA 4Y4RA 2IAIA 2CRGA 2TCTA 3NRVA 2IA0A 1FYMA 2L9VA 2Y75A 1OMIA 3BP8A 3ZR8X 2HGCA 1ZGWA 4G7ZF 2E7XA 2F6CA 4CYCA 4EJWA 4XLCA 5CYVA 3TL4X 2QCOA 2K9LA 3I54A 2X51A 4W97A 1ON2A 2ZCWA 4XKBA 2IA2A 3RKYA 5D4SA 2IS6A 4CYDA 2FEZA 3DLAA 3A0HC 2MD0A 3DEWA 5CVIA 5IP6A 3O6BB 3OL3A 1XGOA 3CCRI 5KK1A 3DPLC 1OISA 3BJAA 2X48A 4G9YA 3OYFA 4BHCA 4MIMA 2YS9A 3HC7A 3SDGA 1KYWA 1MBKA 4HG2A 2EFNA 2VT3A 4BS9A 2DCEA 1ZLJA 2V9KA 2O8XA 3QAHA 3ZN0A 1U78A 4XLAA 5EZHA 3A01A 4A0XA 2WV0A 1T39A 2HKXA 3MKLA 1OR7C 2X6XA 3QODA 5AONA 2DJIA 1I3AA 3L2VA 1AKHB 1K83J 4PUSA 1USSA 3ZQGA 1LDKB 2ADUA 2KP6A 1WRJA 1JJ8C 2EPFA 4IVNA 1TNSA 2OTLI 3C2BA 4HNTA 5E3OA 2GIZA 2ELKA 4KISA 2UZKA 2EZKA 2A6HF 2MH2A 2XAGA 2E2HJ 2CQNA 3G1OA 2DPUA 4G6DA 1SEUA 1BW5A 1UMQA 1K78B 2DI3A 3DTIA 1GVDA 1PDNC 2K4JA 2P5VA 4PJ0C 4C9YA 1ZLKA 2ZFUA 3HRTA 4HF2A 1HBXG 2M45A 3H3ZA 1HOMA 3BQYA 3HOWJ 3WG7H 1ETYA 5HDGA 4XQFA 1D3YA 4L5EA 5EG0A 2HTSA 4ZTFA 2HOSA 1JUPA 3H3VK 2UWMA 3R60A 4QPQA 5FLXK 4RM3A 1F1ZA 1S9HA 3NWSA 1QZZA 3A03A 1O7LA 4QIWN 5F04A 1KYZA 2O7OA 3J80Z 2FBKA 3M7GA 5E3NA 2W1OA 1LFPA 5KAIC 5TISC 4IHYA 4ESJA 2BBYA 1XD7A 1YRNB 3G71I 3F21A 3PFIA 3FXOA 1H9GA 1S72I 5FROA 2YU3A 1MJAA 3CCLI 2XSJC 1FP1D 1JKQC 1DU6A 4N4NB 3CJQB 3GTPJ 3IP4B 3OYAA 2PJRA 1G2HA 2E36A 4D5FA 1K61A 2HDDA 1MGTA 3ZQ7A 1HSTA 2H8WA 5D5XB 5M5XJ 3F22A 3NEUA 1IAWA 2JK3A 1DU0A 3X2QH 1ZR2A 1SVOA 4A3BJ 3BCBA 4O6JA 1U2WA 3RJPA 3K70D 3H5AA 2XKPA 5L3BA 3HXLA 3KP7A 1ETQA 4AYBA 1ZQ3P 4XORA 4HNUA 2VONA 5LD2C 3ZOBA 2ZBKA 4NNJA 2IVMA 2R7UA 3WG9A 5ILSA 3ROUA 2LLKA 5D6FA 1QU3A 2X6YA 2ZO4A 1RRJA 4IXAA 1J9IA 2P6TA 2E7WA 3E7LA 3KP4A 1WKMA 2Y0MA 3A0BC 3BY6A 2IBDA 3S93A 1LE8A 1QNTA 1WI9A 2CV2A 5C4XJ 2L01A 3GW2A 2IEKA 1PUFA 2NS0A 2HVRA 5LEKA 1TWGJ 4IHTA 2JPBA 2DN0A 4C3IJ 3KCCA 3K4KA 4D1QA 4CA0A 4BQNA 1YX3A 1Z9CA 4IQJA 1ACIA 3R0JA 2ZJRF 1KQ0A 1W1WE 3OYNA 4BE2A 1VQ8I 2TRTA 4DIQA 1NH3A 3IAS2 3L2CA 1FWZA 4NC8A 4J19A 5HS8A 2QBYA 2CUEA 1P7IA 1U0JA 4B44A 3PM1A 2DT6A 3VPRA 5EEAA 1JT0A 4FASD 1G3TA 3K6GA 5JVGF 1PP7U 1OPCA 4NDLA 4L9TA 3GTJJ 4OMYA 1Q1HA 1VNDA 2ZXIA 1LFUP 5E8IA 2KPMA 2Q8KA 3PIOF 3OS1A 3FXKA 3SDBA 2E1MC 3V8LA 4S05A 2VBYA 1VZ0A 1ZRCA 2ZMEB 4BDZA 3OV8A 3SEQA 1YW9A 2ZNZA 4EJOA 1P92A 2NOGA 3IV5A 1LVAA 3C2HA 3HOTA 1O3QA 2NAZA 1Y0UA 2MBFA 3GTMJ 1UZCA 3TGNA 1TWCJ 3G1MA 3TO9A 2M4GA 3ASOH 2UUZA 2X0LA 4XOPA 2EQRA 2W25A 1P2FA 1J7KA 2DA7A 2DYSH 3BJ6A 3AKZA 1X3UA 3DU5A 3ECHA 2VXDA 2EFQA 4U7DA 3CF2A 3BDDA 2LY2A 2NNNA 3K1PA 4UVCA 3A2KA 2WAEA 2HYFA 4MQVA 1OJLA 2COBA 2LFBA 4LG0B 2CU7A 3HRMA 5H6QA 2Z16A 2BVMA 2D1HA 4YRVA 3S1RJ 2P81A 2ID3A 5CJ9A 1PUEE 2L7MP 2QZ8A 4I01A 5CKTA 4BYYA 1ZGJA 5LGNA 3LSTA 1ETWA 1R22A 1UAAA 4MO7A 3DPUA 3HJEA 3IL2A 2HPMA 3BC8A 1LEBA 1ZYRF 2QM3A 4F92B 2VE8A 3KZIC 2E2IJ 2XGEA 1JTXA 2H1LA 4Y13A 3F8BA 1J59A 2JSCA 5B3SH 2LREA 3FKJA 3OYGA 3EQLF 2W4SA 3TEDA 3RZOJ 1A35A 2DAOA 4ESFA 4RB0A 4D0PA 2STWA 2EFOA 1LJ9A 1VF9A 3M8JA 5F1RA 4YELA 3OR2C 2VKHA 2VQHA 1K78A 1Z6RA 2KKOA 3GWZA 4HQMA 3A4CA 4IL6C 3GTGJ 1JI8A 2Y0SA 1HKQA 1XN7A 1A6QA 1E2XA 2FU4A 3H36A 1XPXA 2K9NA 2QQ9A 1OQYA 2HVSA 4Y52J 1WFXA 2UV1A 3K4MA 1VQ5I 4XRSG 3JRGA 2DA6A 1Z05A 1R1VA 1AHDP 4LK0F 2KDOA 2JSPA 4IKFA 1SANA 4HV6A 3FF5A 2CV0A 1UHSA 5DV5A 4DJAA 5ED4A 1H8AC 1T0FA 3GFMA 1FLIA 3PNVA 3KZZA 2VC0A 3OL4A 1W7PD 4LLLA 3JAMK 2ZB9A 5A2QK 2E34A 3SZTA 2JA8J 5DEQA 1BR2A 1D0YA 2PMUA 4XIDA 1HW5A 1OLTA 3FK6A 3FXMA 5DM6F 1T98A 3H0GJ 1XS9A 1YI2I 3J81K 1WPKA 3HEFA 3I71A 4E7ZA 3LA3A 2DDAA 2L7FP 2GA1A 1YRNA 2R7SA 3EETA 4HDVA 4C3HJ 1Y0NA 2W57A 1JT6A 4XM3A 5K5OA 3CO6C 1X2MA 2VPRA 4UVBA 3WGGA 2R7XA 5TRDA 3HRUA 3ONQA 5K7FA 4HV5A 2EK5A 1YHQI 2R92J 1KU9A 1O7FA 3ZQHA 2ZJPF 1XB4A 2M2EA 2V26A 4UV8A 5EEHA 1I6XA 5F6FA 1ZG3A 4A69C 3UKGA 1X3WB 3O8HA 3BG5A 2PI0A 2DFHA 2M30A 2NS8A 3HSEA 4NUBA 4H0EA 1ON1A 3GX4X 4L0ZB 3ABMH 4OIOF 4P96A 3HM5A 5HLHA 1F9NA 2LC2A 5JR3A 2XF7A 2F5VA 1QHHD 5BMZA 4FQGA 1PYVA 1ZKGA 4HZFA 4DZPA 2L5QA 2X85A 2R93J 1SD4A 2FUG2 3IHUA 1FP2A 3M1EA 4MFDA 1WJFA 4A3MJ 3ZMTA 4CICA 4CSWA 1GV2A 1F4KA 1Z7UA 2V79A 2O03A 3EDPA 5FO5A 1MMGA 3LQQA 4C2MJ 1FY7A 1Y1VJ 5M3FJ 1ZN2A 4B1RA 2QQ8A 3MMYB 4PDKA 4NC7A 4QSHA 3WGHA 5LGUA 1VTNC 2BYVE 5J3LA 2JJ7A 3E5XA 4L0YB 1MMDA 2EV5A 2VB6A 1WCMJ 2P7CB 2DK5A 2GAUA 1YW8A 4FCYA 1K6YA 1VQ7I 1MNDA 2VQLA 4FT8A 1Z6TA 3GTOJ 1S29A 3GVAA 3CCSI 1CQTA 5DYMA 4ENNA 4B43A 2JVGA 2ZNYA 2XGDA 4L9VA 1OCPA 3K4JA 3FK7A 1QBJA 4HX4A 1RNLA 1DQUA 2KIMA 2PQ8A 2VBXA 2VQGA 4E6KG 4YG2F 2GQQA 1Z0XA 2RC4A 3A01B 1YJWI 3BG9A 4KNYA 1P6RA 3CMYA 4WXCA 2FJ1A 4XSXF 1P4XA 2M3AA 2V6EA 4PZJA 3RI4A 3EYYA 1X1AA 2MGQA 2L4MA 3LSRA 2Z3YA 5LBQA 3DV8A 3BZKA 3JRAA 1N78A 5CPRB 3F8CA 1I3QJ 2Y69H 1QRYA 3O2PE 4DBRA 3QWLA 1YJ9I 3F9KA 4OWRB 2JZYA 2DFFA 2DFIA 1BOBA 3IRQA 2F5EA 4GGGA 2M0CA 3CMAI 1HDPA 5IYCJ 1MNMC 1BR1A 5C44J 3I9V2 4C3JJ 4M6YA 5ILVA 2MSYA 4UXNA 3RPUD 3BCAA 3GF2A 2IS2A 2WADA 2KRCA 5DUKA 2FMLA 2Q1ZB 3F0CA 2XKOA 4XKWA 3EUHA 2L3DA 4NBQA 3S16J 4YFNF 1R6RA 2ZSHB 1R5HA 1IW7F 5EG0B 4ZYDA 4AWXB 4OIPF 2E71A 2XV4S 3K1MA 4HAMA 1U5TA 3KIOA 1MBGA 3VEPA 3GTLJ 3DP7A 3F23A 1E3OC 2QQAA 2JVHA 1QA6A 2HR3A 3F6OA 2MABA 4ZZDA 1SFOJ 4ZH4F 3PSIA 4ZZLA 1IN7A 3EUAA 3I4PA 2HWVA 2R5YA 2O3FA 4F7ZA 4AIDA 3F6VA 5FJ8J 1FIAA 1U8BA 3DF8A 1H0MA 3CCJI 3KFWX 1WQ2A 2K3PA 4Y15A 4DQ2A 1JJ6C 4MEXF 4P5OA 3I5UA 4IF4A 4IZZA 4XKCA 2FNAA 3HG9A 2JUCA 5E3LA 2XRNA 2XGXA 2GM4A 5BNGA 1E0EA 2K7LA 2D5VA 3FXQA 3IH3A 2QENA 1TL8A 2DO7A 3S8PA 3PNYA 3WTWC 2Y9ZA 3LSIA 5IY5H 2XF6A 1XGMA 5F27A 2PJRB 1ZHFA 4UV9A 2VC1A 1BM9A 3QRFF 3LA7A 3BROA 1HXDA 1P7JA 3QOEA 4L5JA 1T95A 3W6JB 1A04A 4EM2A 2ZXWH 1X4OA 3JCUC 3HIFA 2XB0X 3CO7C 2W7NA 2PEXA 1F43A 2K27A 1ZG5A 1ZREA 2KRHA 2JA5J 4GCVA 3AG2H 2IXSA 3DEUA 1O3SA 1QPIA 2XRLA 3PJRA 4B3AA 3CZ6A 4BE1A 3MCZA 3S17J 2W48A 1M1EB 1WZ2A 1BC8C 4EJUA 1Y56A 2HEOA 3BR1A 4CZCA 1TWHJ 3HGYA 1S7OA 2ECBA 2LP0A 1BW6A 3K4CA 2I10A 2MC4A 1LE8B 4N9HA 4BAYA 1W0UA 3G73A 1PUFB 2R7DA 2DMUA 1JE8A 1KU7A 5FLVA 2DW4A 3RCOA 4N9IA 3J7ZI 2Y48A 2VIXA 3RKWA 2QSHX 3IWZA 1TZLA 1MH4A 4KMFA 1Z1DA 2DTZA 2M9HA 3KETA 1SAXA 1NG7A 1OYWA 5JLWA 3I56I 3CTAA 2HDCA 2DA5A 3U21A 3FBNB 5CQEA 3I64A 2WY7Q 2OC6A 3J7AY 2AXTC 3KLNA 2KIFA 4I6ZA 1FOXA 2R7TA 4A6DA 2IJLA 4CH7A 4UNOA 2HZTA 1HCRA 3U1KA 4CCOA 1MH3A 1R9TJ 3TMOA 1DGRM 1R5ID 2A3SA 2P7VB 1W5TA 3JRBA 2P5LC 1R1UA 3I59B 1JTYA 1PJRA 4DYQA 2BHZA 1XG1A 3WTXC 3ECOA 4NHJA 3CESA 2E2JJ 1V55H 2ZJQF 4E7JA 2L54A 2VL8A 2JN6A 2KZGA 3RZDJ 3L2WA 3CQZJ 5FRMA 1LKXA 3TW6A 3T5XA 2LY1A 2OQRA 3M8FA 2YR2A 2LRDA 2E60A 4HYEA 4MFEA 3RYRA 2H6BA 3P5JA 5LHHA 3JSOA 4RAYA 1R00A 3BG7A 1AOYA 2OJED 3JR9A 1MMAA 4DOZA 1Y1WJ 1W7PA 1YIOA 2DFEA 2W00A 4A12A 3RKQA 5H2FC 2STTA 3DPTA 5J40A 2M7AA 2F5DA 2ELJA 4U88A 2ISZA 4RB2C 2HU9A 4ETSA 4X1EA 4M3DA 4P9FA 2XAUA 2EFPA 2BVLA 1T6SA 2D1VA 2EINH 4ENKA 1YG2A 4HEA2 4F3QA 4II3A 4G6QA 2RQQA 4A3KJ 2OZ6A 4OIQF 2XPUA 1Y6IA 4U0YA 2OD5A 3HUGA 1LEAA 2JTVA 3CDHA 3E6MA 3QU3A 5K5QA 2CUJA 1BJZA 2CUFA 4RA2A 2HQNA 5FB2A 5J1UA 1BI0A 2G7UA 3V7CA 1GXPA 2L7ZA 2FBHA 1FSHA 2KDZA 2AO9A 2GZWA 2OBPA 1U9OA 5JFRA 5BQTA 4A0YA 1JUSA 3D5SC 2MA3A 4HX8A 1FJLA 3GUDA 1IGNA 2CW0F 2W82A 3GCMA 5LGTA 4LLGF 2QQBA 4GYIA 1W36D 1IXSB 1POGA 3BQZA 1V5EA 4XONA 4WF2A 5E18F 4IHVA 3E1SA 4QLCU 1H88C 2HKOA 3DFGA 1OYYA 4L9NA 3GMEA 4V19K 1HSJA 2CW7A 3FISA 2J5PA 3K69A 3FXRA 3TBIA 3ZXSA 1TP4A 3BZ6A 1EH7A 4ASNA 1YFHA 1LFBA 2FSWA 4HX7A 3JRDA 1MBHA 3DEEA 4A3GJ 1AU7A 4HSTA 3OIQA 1X1BA 3S2WA 3JRIA 1O4XA 1FOKA 2BXYA 4B48A 2HNHA 3GLXA 2ICWG 3I4NJ 1T08B 1ZH5A 1CGPA 3KEQA 5E1XA 4XLFA 4XR6A 3Q9VA 5JLXA 1Z91A 2HDWA 1B6AA 4IEJA 2BY1A 2X6WA 3GEZA 4D5CA 1JUMA 4CCJA 1ETVA 2DMNA 2VODA 3P9KA 3JAMZ 5HNFA 1E17A 2M7BA 1IJWC 3LNQA 1QGPA 5EZGA 5ICGA 2G7HA 5A2QZ 4Q5SF 1UFMA 1D8JA 5FGMA 1VQ4I 3FIWA 3ERED 9ANTA 1A31A 1DDNA 3J81Z 2BZTA 3E6CC 1T0FC 1MIJA 1IN5A 1QQIA 1FBQA 1MSEC 2H94A 4A93J 1LVKA 4JQFA 4XOTA 1FMWA 2K5CA 5LFAA 4WK8F 5FKNA 2EZHA 2JQ7A 1OCCH 5HOOA 3ML6A 4LLNA 3ZQFA 1PVEA 3T0YA 1BI2A 3PO3J 1DPUA 2CSOA 4AIJA 3HOSA 3BR3A 3KP2A 4LB5A 2IPQX 4AU7A 5BS6A 3OYMA 4AIHA 3RPUA 2O8KA 3RYPA 3BJOA 1NHAA 5BPDA 2EIJH 4PJNA 3WTYC 2CV1A 3G3ZA 2XPWA 1JXSA 1FOYA 3CCYA 2BE5F 2G9WA 3WHBA 1XX5A 1IN4A 3DTKA 4N0BA 2DA1A 4KT5C 2DYRH 1CF7A 3W2AA 3P9IA 1IO2A 2QWWA 2EV0A 3TDUC 5L3CA 3RQIA 4EJTA 2YU9J 2B63J 1E3HA 3HZJA 3K9TA 1BJAA 2CYYA 2VI6A 4HF0A 2V1XA 3C1DA 4MTEA 4IRIA 4M3GA 3FHZA 1MDMB 2NYXA 4GFBA 2R3SA 1HF0A 2KQRA 3CJTB 4ZYAA 5K7ZA 2EBIA 4ZYHA 2OCEA 3UR3C 4A3EJ 4NB5A 1I27A 5EGOA 2R7ZJ 2XIGA 2Z5UA 4ON0A 2VXZA 4FISA 2X6OA 3G4SI 4NQWA 2QF7A 3G2BA 5ILUA 1O3RA 2LBFA 4BXUA 3GTKJ 1RKTA 1RI7A 3I59A 5ICEA 1VQ9I 1BOAA 4OINF 1Z67A 1XCVA 4UHTA 4B4CA 5H6RA 3V4GA 5J4YA 3I0TA 4OU0A 4PFPA 2O6GE 1U9NA 1VQ6I 2M0MA 2RN7A 3ZMVA 2EIMH 2TDXA 5J6XA 4FX4A 3HKZA 5D5UB 2EWNA 5HODA 4BACA 5GADJ 1QVTA 3IC7A 2F5FA 3H92A 4AVPA 5L3FA 4Y7NJ 5B1AH 2L9NA 3CC4I 1KQ8A 2E1NA 1YX5A 1YS7A 2JA2A 4PGHA 2IP2A 2ZMEC 4RLQA 4BH9A 3W3CA 3V8JA 4B09A 4IQ4A 4KA4A 2LOOA 2LF8A 1U5TB 4LB6B 3VYSB 3K70C 2KL4A 4KITB 1IRXA 2L0KA 3W2VA 4BEHB 4EQQA 4BQAA 4LG3A 2VUMJ 2HQAA 2P6SA 5HLTA 2R5YB 2OCCH 4CXFA 3S2DJ 2AQFA 3ZRGA 1MSFC 3KLOA 1N75A 2R4GA 3BPVA 3K4NA 4AYBN 4J00A 1HDDC 2RGVA 3AAFA 2MG4A 3IH4A 2QUFA 3QP5A 5EEGA 1QHGA 2DBBA 2FQ3A 1TW3A 1USTA 3EUHC 4LK1F 1R49A 3M8EA 2KZVA 4BY1J 5CLSA 2FBIA 4I0AA 1U5TC 1MMSA 4D7MA 4XLHA 1IXCA 4BY7J 3MZHA 4EGZA 3HOYJ 3FWEA 4I76A 2V9PA 2IGMA 3S32A 2ZXHA 5AIQA 2F2EA 3ZQLA 3COAC 1YQAA 5DCFA 4F55A 1W5SA 3I3LA 1ZR4A 4L18B 4CCMA 3CCVI 4LJZF 3U9GA 3IKTA 3NAUA 4A3JJ 2DPDA 1D0XA 5LHGA 3BTJA 4Y33A 1KQ9A 3E0JB 4KIBA 4KDPA 4JK1X 1OCRH 3LOCA 2UXXA 2K3FA 2K85A 2KHMA 3HSFA 1W0TA 4R1HA 1AA7A 3RQ4A 2PBIA 3ABUA 2B0LA 1R4NB 4HQEA 4YFXF 4MEYF 3RPQA 4U7BA 2GOMA 1RETA 4JX5A 4Q4ZF 3R4KA 4PCQA 1TC3C 5FLMJ 4XL9A 2LH9A 3Q3SA 3BZCA 1U3EM 1WI3A 3N05A 5F1JA 5IP9J 3HOVJ 2NVXJ 3LAJA 1X1DA 3OWTA 4EMSA 3QP6A 5M3MJ 3WODF 4M3FA 1XGNA 1LNWA 3SEZA 3ZP5A 4IRGA 2JT1A 1F5TA 1WJDA 2QYOA 3BWGA 5CVVA 1IRFA 2H6CA 4Y17A 2H09A 4CHUA 2IW5A 4EEFG 2LDUA 4M9XA 2C6YA 2A05A 2XAHA 4IJAA 2ESNA 2Z33A 1MZBA 4HOBA 2X1CA 4XICA 2JPCA 1RZ4A 2Y31A 1A36A 4RGUA 2FE3A 3VODA 2OQGA 2BY2A 2ID6A 5HS9A 3NQOA 1BI3A 4PGGA 3G6EI 1SC7A 4KIGA 3G1LA 4A5NA 2DQLA 3MZYA 3L00A 2XB5A 2IRFG 3D0SA 1G6NA 2W84A 4I09A 4U87A 5CVUA 3M4OJ 1F36A 1YYVA 4JP0A 2X1DA 1FYLA 1VQOI 2LG4A 2BY0A 2XASA 5E1WA 2MFZA 2A5WA 2BHYA 2ZSIB 4LIUA 4WXHA 5J1RA 4I99C 2R7VA 2DT7B 4LOCA 2WB1A 3I4MJ 2VJ5A 4GYGA 1MDMA 1W7PB 4KMUX 4KFCA 1QO0D 3OYHA 2FOKA 5F0CA 5GP9A 3R6SA 4DZJA 3HYIA 3TP3A 1OYIA 4RAGA 2HYGD 2MH9A 3TO7A 3H35A 1VQLI 2XAJA 2L9RA 2V6CA 1I50J 3KYDB 4I2OA 3GFIA 4WX9A 2CUZA 3QYBA 2DXIA 2L4AA 1D1AA 2HXOA 4XNFA 3BTCA 3HUGB 3ABKH 2RDPA 4E7SA 4DBQA 2Y0SN 1IDYA 5E79C 1IDZA 3ZCOA 2NVUB 2Y2ZA 4DNCA 1S7EA 1TT0A 2MD5A 2VE9A 3A02A 1TQMA 3PFYA 3TW7A 3QYFA 2XVCA 3FXUA 1J2XA 5HVQC 3B6AA 3QPHA 5D8LB 3EUKL 3ZQIA 1FZPB 2F5CA 3BLYA 3OYKA 1MNEA 1HLVA 3W6KB 1RUOA 1Y39A 2FQ4A 4TV7A 1E3PA 1BL0A 3AL0B 3BR5A 2RV8A 2A69F 4QWQA 3CJRB 4AD9A 1BR4A 2PJPA 1MBJA 1G3WA 3E5QA 4PJJA 1ZTRA 1KA8A 2HVQA 4M73A 3I53A 2ZFWA 2K9QA 3F8NA 1XSDA 2ME6A 3OYEA 2RNGA 3ABTA 2NNYA 1UHMA 4OIRF 1YLFA 4CCKA 1NK2P 3S1NJ 1S6LA 2BXZA 2BW3A 2Q0OA 4X6AJ 2N8GA 4E4HA 1S5LC 4XLPF 2LMDA 2M8GX 4KIFA 2OPTA 4EATA 3TOBA 4O5VA 2EFWA 4BEHA 3L9FA 1W5CC 3K10A 3GBGA 5M5YJ 3ULQB 4EV0A 5JHFA 3V7SA 1Q1VA 2JRTA 4E70A 3K1NA 2CFXA 1IF1A 4WXDA 3D5LA 4Q48A 1HQCA 4XK4A 3CCQI 3LSPA 3FM3A 4D9JA 5FLXZ 3ZQCA 1JKRC 1APLC 2CGPA 3B02A 3E97A 2XGCA 4UUTA 2RAEA 5DCMA 2LTPA 2RVCA 1Z7LA 5C4JJ 4ITVA 2D2WA 3DQVC 2Z1DA 4OAZA 4V2GA 2K40A 3ZMUA 3HTUA 1LDDA 5L3GA 2WA0A 3OS0A 2KJCA 3SYTA 1K4SA 4CO8A 3SJMA 2O9LA 2K9SA 3RSNA 1R36A 4DYCA 2MC3A 1ZK8A 2HYJA 2PMHA 3ASNH 2LKXA 3L2RA 2PMZA 2A07F 1ONVA 3DKYA 1UJ8A 1XMXA 1MW7A 1R23A 2M1BA 5IOZA 2DMPA 2XUBA 1J0RA 3ESWB 4XLEA 5IT9K 4BJ6C 1R1TA 4ZYEA 2LVSA 2HOTA 3FBIB 5FRNA 2M34A 4HBLA 4JX4A 1T38A 2NVTJ 2ETHA 1LQ1A 1TTYA 1VQPI 2JA7J 1IC8A 3K0LA 4PSWA 1XTAA 3KX2A 3Q0WA 1IV6A 5C3EJ 4EJVA 5IT3A 3OSFA 3HGGA 5B5EC 1BBYA 1GUUA 1T56A 2HS5A 5HLIA 5GTIC 4RBOA 1ODDA 3B6CA 5FKKA 3PL8A 4KYWA 1CF7B 3CMMA 1WJBA 2LF7A 1O57A 3HRSA 3H5NA 5LRSA 5J1YA 4FETA 3LSGA 3TO6A 3T1BA 5GAHJ 3BR6A 3ZN1A 3FXJA 4C2UA 1SFKA 3Q0VA 2ZC2A 1S8NA 4A6EA 5HDKA 1R71A 4M3EA 1WH7A 4LIVA 1D0ZA 3OIOA 3VFZA 3ZGKA 4BJTA 5DD4A 3CCMI 1D8KA 1EV7A 1S3JA 1SFXA 3CC7I 5EGOB 1V54H 1SVMA 1HKSA 2V1NA 3L09A 1OFCX 4RMNA 1WJEA 3DWLE 3P7NA 4EM0B 3LAPA 2IGNA 1IV8A 2P0WA 3GXOA 3QPSA 1UG2A 1LUJB 4NQWB 1JGGA 1B72B 1V4RA 3BPXA 1EF4A 4F52A 4KJZA 2LBFB 3JRHA 1K4TA 1MKMA 4YIIA 5DS9A 3GO5A 2L02A 4ESBA 1LB2A 3OYCA 1G3YA 3S15J 2DLLA 2DODA 2OZUA 4XN0A 3CDIA 4BL0B 2FX0A 4HPQA 4JBAA 2BV6A 5LRRA 1P4WA 1J09A 1MMNA 5ICCA 3LL7A 1TW2A 1SFEA 3J7AO 3K4BA 5J8FA 1RR8C 4RAZA 3HL2A 3CD6I 1YITI 3VWBA 3R0AA 3A1YA 1KU3A 1UG0A 2L2OA 5DDGA 5F0HA 1FIPA 2L9SA 2IGKA 3HOZJ 2WBMA 3RTRA 2LKSA 2VQCA 3FDYA 2QKLB 1V5GA 3WTVC 1AWCA 1EJ9A 2VN2A 4M6XA 3PQJA 1VFCA 3C18A 2LY9A 3MQ0A 2R0QC 3ZQQA 1X58A 4ZC3A 4UB6C 1RPWA 2O61A 1Z3XA 3T8TA 3LFKA 3VYTB 2CQ7A 2QLZA 5B66C 1ZG1A 4P55A 4DYRA 1D1CA 2GWRA 2XPVA 1DP7P 5IP7J 1SMYF 3TKYA 3K2AA 3CUQA 2NRAC 2Z99A 4IHSA 4R79A 3S3NA 1V5FA 4XRMA 4RLFA 5HLGA 5FFXA 3BOQA 3I58A 2EILH 2OUMA 1QZYA 4M6VA 2PMZN 1B8IB 3M9AA 1YE9A 4J01A 2Z9OA 3MZ8A 3GTQJ 2E35A 2M8EA 3H9QA 1EKEA 3QQAA 4RB3C 4FX0A 5KAFC 4UB8C 3WE2A 4YFKF 1LPQA 1YO5C 3H5RA 4XRFA 2YX7A 1B9MA 5B1BH 3V7RA 1FOWA 3IKVA 3KP6A 3PIPF 4BJ5C 3K4LA 1D5YA 3S3OA 3OS2A 4HSRA 3QU6A 5D5WB 4M3BA 3JW4A 4HDUA 4E7HA 2BGCA 4IPAA 4RS8A 3KEOA 1IXRC 2I5UA 3OYLA 4PSXA 2DJNA 3ZMZA 3FXLA 1T8IA 1X1CA 2CQXA 2OU2A 1WWXA 3CJNA 1ZELA 3NWTA 2KRFA 2ZJ2A 2V1DA 2JUGA 2A61A 2DOAA 1OKRA 1MBFA 1UB9A 1X3ZB 2O5RA 3DBRB 4Q47A 3SZPA 2NVQJ 1WJCA 2WAFA 4C2TA 5EF6A 1HKTA 3IH2A 3CUOA 1JGSA 3FHNA 3AG3H 4M71A 4IHWA 2DA4A 3WTZA 3AG1H 1DUXC 4MHGA 2RREA 1G4DA 2R7FA 3KPHA 2VT2A 4KN4X 2EZLA 2QSFX 3SHFA 3EYIA 3REOA 3FZVA 3L2UA 1QVUA 2I8DA 4LMYA 4E7IA 1BA5A 5K5RA 2G0EA 4PJLA 2KISA 3DCFA 1VQKI 3MD2A 4RGXA 5KNLA 4O3MA 1FSEA 1B59A 4M74A 4P1WA 3F3XA 4M72A 2GOXB 1O3TA 5IOYA 5LHIA 2CWEA 4Z6YA 2EV6A 1FBUA 2PFBA 3ISPA 2EJRA 1EH8A 1FPQA 4GDFA 4F93B 2R5ZA 3CDLA 5FD6A 1MBEA 2WV1A 2CW8A 1JKPC 3VYRB 3C2GA 2VJJA 1C0WA 2MLGA 2YX4A 2X4HA 3RKXA 5D4RA 1P4AA 2MLKA 1I1GA 4Y3OA 3S1MJ 4BBSJ 2NVYJ 2GA2A 4XKVA 3LSHA 1YS6A 3BG6A 2CG4A 3PUBA 3QPLA 1HC8A 2V9VA 5KVRA 2OA4A 3BG3A 4ABZA 3GZNB 2KT0A 2YSRA 1I5ZA 2R7OA 3C3WA 3OR1C 2WY8Q 1LDJA 4L9JA 2ZKZA 4LITA 2LSOA 1H9TA 1KZHA 1T2KA 4BHBA 3L2QA 4A2UA 2Q2EB 1GDTA 4M9SA 2HQ5A 2EB7A 3M3YJ 4R8HA 2DT5A 1ZAOA 4YEJA 3RIRA 3U2RA 2J5OA 1NG6A 5F0FA 2R7WA 1FT9A 5FKLA 3OYIA 1H89C 1TT5B 4CDGA 2HFHA 1W36C 4UY8I 2EA4A 1ERDA 1B1BA 2E5NA 3FMQA 3OYBA 3H0DA 1DPRA 4JOMA 1I39A 3AG4H 5FD5A 4S04A 3K7AJ 3PNTA 3OMYA 2WAQA 3GZ6A 2E1MB 3F72A 5EJCA 3GZ5A 1BC7C 2HTJA 3BR2A 3BTLA 4V2FA 4F91B 3CCEI 2CH0A 3DBLB 1X4PA 1B72A 2VOPA 4GO1A 2NXNB 1IZ1A 5EYRA 1Y8QB 2GLOA 1KU2A 1Z77A 2CQQA 4A3FJ 3SXYA 1IUFA 4BXXJ 2OV7A 1RIOH 5ERIA 4OMZA 2K86A 2XC7A 3W6VA 2PLYA 1N25A 4PFOA 1L0OC 1R5GA 3M1CA 2YUSA 4LGWA 2VBZA 1TLHB 2K02A 4BQQA 4ZDPA 1FNNA 3LQRA 2K9MA 1DP3A 3WGIA 4G94A 1RUNA 1EA3A 1FX7A 2QSGX 1SAUA 1ORKA 1WVRA 3JRCA 3CC2I 1FC3A 3CLQA 2CMPA 2MYSA 4HA8A 1ETOA 2E1OA 2XSDC 2LD5A 4ANJA 3DTEA 1XGSA 4E7KA 4ZDLA 1JKOC 2VOOA 3ZMSA 1YW7A 5IPAA 2RKHA 3BR0A 3IAM2 2FOWA 4LD5A 1R58A 2FD5A 2JRMA 3MFKA 3OYJA 1ETKA 3HPGA 4XRSA 1T33A 3HHGA 1A5JA 4CCNA 1IRGA 1R4MB 4S0HB 5BPIA 1KONA 3F8MA 2BW3B 2QGUA 3CMEI 1OR7A 1ZGAA 4I02A 1ULYA 3N4MA 2FF4A 4ZTJA 2JA6J 5D5VB 2M87A 1U8RA 1RC9A 1WHUA 3KZYA 1VI0A 4GXOA 3H9GA 3SQNA 1TWAJ 4X0GA 1OCOH 1JHFA 4XSZF 5BOXA 3OOPA 4AIKA 5CQGA 2R7RA 4RGRA 1OCZH 1B8IA 4P9UA 2XAQA 3HB9A 4MQ9F 4DGWB 4A0ZA 3LFUA 4JX6A 2D45A 2P8TA 2WTEA 2VPLA 4ZYGA 2NOJB 3HHHA 3LSMA 3MEXA 1UELB 1N77A 1K79A 2AHQA 3MKYB 1GT0C 5DCMB 3P9CA 3CLOA 3WU0A 3CCUI 5KHDA 4N4OB 1I6HJ 3TP0A 3MWMA 2GXAA 4A5MA 1FYKA 1AKHA 4HF1A 4KT6A 1GVJA 2Y30A 2GXBA 3OYDA 1NK3P 2PX9A 4QTRA 2XROA 2PG4A 3ERMA 4MNUA 2H1KA 1SVLA 1TQIA 3I55I 2DA3A 2RQPA 5JHUA 4MLOA 1XC5A 4IOCF 3L7WA 3LSKA 3LA2A 2EA2A 5GAEJ 3LMMA 2GIVA 3JSPA 2K4BA 4JYKA 4W1UA 3PSFA 3WU2C 4AM3A 4BNCA 1K7AA 3FKIJ 1D5VA 2VJ4A 4HW0A 4UUSB 4CUGA 4KN7X 4NC6A 1PP8F 2XDVA 3JREA 1X2NA 3MAJA 2FXAA 4OOIA 2GXGA 5IT9Z 3C7JA 2XHKA 4G12A 4BUPA 1MJBA 1KGSA 2OTJI 1D1BA 2IT0A 3ZMDA 3J80K 2WAQN 2H27A 2V1UA 2DK8A 5DUIA 1GXQA 2HOAA 1BI1A 2M5WA 1U6GA 3W2WA 5E3MA 1ZRDA 5TJJA 4XBFA 3V42A 4I7HA 4ZJZA 5LLQA 4YIRX 4U0VA 2IS1A 3PUFA 1S7AA 3BT9A 1V3FA 4UVAA 1IUYA 2KFDA 1GV5A 2IGOA 3UNGC 3MVPA 4EM1A 2NS7A 5HDNA 3D5RC 1XSXA 4AVZA 2OF7A 4A3IJ 2AXLA 3LWFA 3HKZN 4B47A 3O3KA 2LKPA 5GTHC 2ACJA 1XCBA 3VB2A 2KJBA 1B4AA 4U0WA 2DOFA 1FTTA 1RR7A 1ZARA 4BHPA 3PO2J 2QA4I 2AS5F 2HXIA 2VKEA 3DXJF 2E5ZA 2YPRA 1TWFJ 4IRHA 4C30A 1X1PA 5HS7A 1TBXA 4BU2A 5AIPA 2Q2EA 5E8GA 2H8RA 1STZA 2FNPA 2LK2A 4XN3A 1SFUA 3L1PA 4WCGA 3OOUA 3FMSA 1RESA 2A5YB 1TQPA 4G8XA 3Q5FA 3S14J 1L3LA 3LSJA 3E5UA 3S1QJ 3OY9A 3BTIA 3IWFA 3CP8A 3FM5A 5FFZA 5J8CA 3S2HJ 1FBSA 3KP5A 2ISYA 5HNHA 1HW1A 1FTZA 2JWTA 2QEXI 2KIQA 5J4VA 5M5WJ 5JVTA 3JTGA 5CVJA 2ECCA 3RDIA 1XSVA 2BEOA 4CYCB 3T8RA 3WTTC 4A3CJ 1YOVB 5F64A 3E6DA 1QPMA 3CUQB 2PN6A 3FX3A 2E19A 1XDSA 3KP3A 4IHXA 3KYLA 2DQRA 1SD5A 2R7QA 2COMA 5K7HA 2AQEA 3N97A 2DTRA 1YJNI 2VKDA 4EGYA 1WSUA 1SD6A 1I1SA 1NTCA 2ME0A 2A6EF 2HOEA 4FHTA 2B9SA 4E7LA 4UUVA 4FTHA 3VOEA 5DD8A 4ZDOA 1UCRA 2RNJA 4ENJA 6PAXA 4FE4A 5JI6A 4RAFA 4ENMA 5DM7F 2CQKA 4A3LJ
chains in the Genus database with same CATH topology
3D1NI 5DS9A 2LR8A 2Y9YA 5GPCA 3TEDA 3S15J 3RZOJ 1MSEC 2EH3A 1VF9A 2FX0A 4A93J 5FKNA 2EZHA 5IYBJ 3GTGJ 1IG7A 2MW8A 3PO3J 3ZQFA 2K9NA 5GPAA 5F0HA 3BR3A 1FIPA 4Y52J 4DW6A 3HOZJ 4XRSG 4BKXA 3JRGA 2DA6A 2O8KA 1AHDP 2XPWA 3CCYA 1SANA 3WHBA 4RDUA 1VFCA 1UHSA 2DMTA 2LY9A 1WH5A 2R0QC 2DA1A 1X58A 1RPWA 1H8AC 3RQIA 2YU9J 2B63J 3HDDA 2ZB9A 4HNVA 4DYRA 2XPVA 2JA8J 2VI6A 5IP7J 1ETXA 3K2AA 4M3GA 4XIDA 1IRZA 3FK6A 1WGXA 4GFBA 1HF0A 3H0GJ 3Q0UA 5K7ZA 1XS9A 1WPKA 3HEFA 4XRMA 2EBIA 2L7FP 1YRNA 4C3HJ 4A3EJ 4M6VA 1JT6A 2PMZN 5EDNA 5EGOA 2R7ZJ 1X2MA 1B8IB 2VPRA 3GTQJ 5K7FA 3OSGA 2R92J 4FISA 3QQAA 2X9DA 2X6OA 2QF7A 3ZQHA 2M2EA 3GTKJ 1RKTA 4A69C 3UKGA 3O8HA 1FEXA 3BG5A 2NS8A 1ITYA 1RKWA 2R5ZB 1D5YA 3HM5A 2WB1N 4B4CA 4A3DJ 4M3BA 4D7NA 1ZKGA 4UUSA 4DZPA 1U9NA 2R93J 2DJNA 4MFDA 3HOUJ 2CQXA 2JMWA 5HODA 4A3MJ 1GV2A 5DTDA 1QVTA 4FE7A 1OCTC 4Y7NJ 1MBFA 2DA2A 4C2MJ 2NVQJ 1Y1VJ 5M3FJ 3WHCA 4AC0A 5EF6A 3NARA 4B1RA 4QSHA 3IH2A 4AUXA 5J3LA 2JJ7A 3O8GA 4IHWA 2DA4A 1WCMJ 5FKMA 1ENHA 2EZLA 4FCYA 2L0KA 1QVUA 2EZIA 2GBYA 3GTOJ 2VUMJ 2DMQA 1BA5A 1CQTA 2G0EA 3MN2A 3SFIA 3HOXJ 2R5YB 2XGDA 1OCPA 3FK7A 1A6IA 3S2DJ 3DCFA 1MSFC 5IYDJ 4BBRJ 4AYBN 1Z0XA 1HDDC 3A01B 3BG9A 2MG4A 3IH4A 3HBLA 5IOYA 3CMYA 2FJ1A 4BY1J 5F08A 2VKVA 2MGQA 2R5ZA 3LSRA 3CDLA 1MBEA 2WV1A 1JKPC 4D7MA 2HI3A 3JRAA 4BY7J 3HOYJ 1I3QJ 4I76A 4BBSJ 3S1MJ 1QRYA 2NVYJ 3JRFA 3QPLA 3ZQLA 4ABZA 3BG3A 2CJJA 2KT0A 1ZR4A 2M0CA 5FKOA 1HDPA 5IYCJ 1MNMC 3NAUA 5C44J 4A3JJ 2IAIA 4C3JJ 2CRGA 2TCTA 2MSYA 3BTJA 3LOCA 1GDTA 2HQ5A 1ZGWA 3M3YJ 1W0TA 3F0CA 4CYCA 3S16J 2QCOA 5F0FA 5EG0B 5FKLA 1H89C 4W97A 1RETA 1MBGA 4JX5A 3GTLJ 1E3OC 5IP6A 3DEWA 1SFOJ 1TC3C 5FLMJ 2X48A 3Q3SA 3K7AJ 2R5YA 4MIMA 2YS9A 3HOVJ 1WI3A 5F1JA 3SDGA 1FIAA 5IP9J 5FJ8J 1MBKA 1U8BA 2NVXJ 3BR2A 3BTLA 4V2FA 1B72A 5M3MJ 4M3FA 1JJ6C 5EYRA 2GLOA 1Z77A 2CQQA 1U78A 4A3FJ 5EZHA 3A01A 1IUFA 4BXXJ 5E3LA 3MKLA 3W6VA 4EEFG 2GM4A 5BNGA 2YUSA 1AKHB 2D5VA 3IH3A 1K83J 3ZQGA 4XICA 2Y9ZA 5F27A 1JJ8C 2Y31A 1ORKA 3C2BA 2ID6A 5E3OA 3JRCA 2ELKA 2EZKA 1P7JA 1ETOA 2E1OA 2XSDC 2LD5A 2E2HJ 3G1LA 3G1OA 2XB5A 1JKOC 5IPAA 1BW5A 3BR0A 1UMQA 2XB0X 1F43A 2FD5A 3M4OJ 1F36A 1GVDA 4JP0A 1ETKA 4XRSA 2JA5J 1T33A 1A5JA 1QPIA 4S0HB 5J1RA 1HOMA 2XRLA 4B3AA 3BQYA 3HOWJ 4LOCA 3S17J 1ETYA 2W48A 2JA6J 3I4MJ 3BR1A 4L5EA 5EG0A 2HOSA 1VI0A 1TWHJ 3HGYA 1JUPA 2ECBA 2LP0A 1BW6A 5F0CA 2I10A 5GP9A 1TWAJ 4DZJA 1LE8B 3H3VK 3TP3A 1W0UA 1PUFB 2DMUA 3A03A 5FLVA 1B8IA 2L9RA 1I50J 3HB9A 4QIWN 4JX6A 5F04A 2O7OA 1MH4A 2DTZA 2M9HA 5E3NA 2HXOA 5JLWA 2DA5A 3BTCA 2AHQA 1GT0C 4IHYA 2Y0SN 1IDYA 1YRNB 4I6ZA 1IDZA 1I6HJ 3TP0A 2Y2ZA 1S7EA 3A02A 1AKHA 3TW7A 1DU6A 1JKQC 3B6AA 2Y30A 3GTPJ 1HCRA 3ZQIA 1G2HA 4D5FA 1K61A 1NK3P 2HDDA 5M5XJ 1R9TJ 1MH3A 4QTRA 2H1KA 2JK3A 3JRBA 1HLVA 1ZR2A 1DU0A 2DA3A 4A3BJ 4MLOA 1XC5A 1JTYA 2FQ4A 4DYQA 1XG1A 1BL0A 2E2JJ 3BR5A 1MBJA 1ETQA 4JYKA 2JN6A 4W1UA 3RZDJ 1ZTRA 1ZQ3P 3CQZJ 3ZOBA 3TW6A 2K9QA 2ME6A 3FKIJ 4UUSB 1NK2P 2LLKA 3S1NJ 3JREA 4X6AJ 1X2NA 4MFEA 4G12A 3E7LA 2N8GA 2M8GX 2OPTA 3JR9A 1Y1WJ 3RKQA 2WAQN 2IBDA 1LE8A 5C4XJ 2HOAA 5M5YJ 3GBGA 2IEKA 1PUFA 1Q1VA 4X1EA 5E3MA 1TWGJ 4M3DA 2DN0A 4C3IJ 3BT9A 1GV5A 4XK4A 3LSPA 4A3KJ 1JKRC 3ZQCA 1APLC 2XPUA 3MVPA 2TRTA 2XGCA 4UUTA 2RAEA 2LTPA 2NS7A 4J19A 5C4JJ 1BJZA 2CUFA 2CUEA 1P7IA 2OF7A 4A3IJ 4V2GA 2K40A 3HKZN 3PM1A 5J1UA 3VPRA 5EEAA 1JT0A 4NDLA 2L7ZA 3SJMA 2O9LA 2K9SA 3GTJJ 2KDZA 4DYCA 2AO9A 1VNDA 1ZK8A 1U9OA 2HYJA 2LKXA 1LFUP 1JUSA 1FTTA 1RR7A 1FJLA 1IGNA 5IOZA 2DMPA 3PO2J 2HXIA 2VKEA 1POGA 3BQZA 2LVSA 1TWFJ 2HOTA 4IHVA 1H88C 2M34A 4JX4A 2NVTJ 2NOGA 3IV5A 3FISA 2H8RA 2LK2A 2JA7J 3GTMJ 1IC8A 1TWCJ 3G1MA 1IV6A 3Q0WA 3L1PA 3OOUA 5C3EJ 1RESA 3OSFA 3HGGA 1LFBA 3S14J 1GUUA 1T56A 2EQRA 3LSJA 3JRDA 3S1QJ 1MBHA 2DA7A 3BTIA 4RBOA 4A3GJ 1AU7A 3S2HJ 3B6CA 5FKKA 3JRIA 1FTZA 1O4XA 2JWTA 1OJLA 2COBA 5M5WJ 5J1YA 2LFBA 2CU7A 2ECCA 3LSGA 4CYCB 4A3CJ 3I4NJ 3BR6A 3S1RJ 2P81A 2ID3A 2L7MP 2E19A 5JLXA 4IHXA 3Q0VA 4IEJA 1ETWA 5K7HA 4D5CA 1JUMA 1ETVA 2DMNA 4M3EA 1WH7A 3OIOA 4MO7A 1NTCA 2ME0A 1IJWC 5EGOB 3LNQA 5EZGA 4FTHA 2E2IJ 1OFCX 2XGEA 1JTXA 4FE4A 3QPSA 1UG2A 3FIWA 1JGGA 1B72B 4A3LJ 9ANTA 1EF4A 3JRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1N I;  5DS9 A;  2LR8 A;  2Y9Y A;  5GPC A;  3TED A;  3S15 J;  3RZO J;  1MSE C;  2EH3 A;  1VF9 A;  2FX0 A;  4A93 J;  5FKN A;  2EZH A;  5IYB J;  3GTG J;  1IG7 A;  2MW8 A;  3PO3 J;  3ZQF A;  2K9N A;  5GPA A;  5F0H A;  3BR3 A;  1FIP A;  4Y52 J;  4DW6 A;  3HOZ J;  4XRS G;  4BKX A;  3JRG A;  2DA6 A;  2O8K A;  1AHD P;  2XPW A;  3CCY A;  1SAN A;  3WHB A;  4RDU A;  1VFC A;  1UHS A;  2DMT A;  2LY9 A;  1WH5 A;  2R0Q C;  2DA1 A;  1X58 A;  1RPW A;  1H8A C;  3RQI A;  2YU9 J;  2B63 J;  3HDD A;  2ZB9 A;  4HNV A;  4DYR A;  2XPV A;  2JA8 J;  2VI6 A;  5IP7 J;  1ETX A;  3K2A A;  4M3G A;  4XID A;  1IRZ A;  3FK6 A;  1WGX A;  4GFB A;  1HF0 A;  3H0G J;  3Q0U A;  5K7Z A;  1XS9 A;  1WPK A;  3HEF A;  4XRM A;  2EBI A;  2L7F P;  1YRN A;  4C3H J;  4A3E J;  4M6V A;  1JT6 A;  2PMZ N;  5EDN A;  5EGO A;  2R7Z J;  1X2M A;  1B8I B;  2VPR A;  3GTQ J;  5K7F A;  3OSG A;  2R92 J;  4FIS A;  3QQA A;  2X9D A;  2X6O A;  2QF7 A;  3ZQH A;  2M2E A;  3GTK J;  1RKT A;  4A69 C;  3UKG A;  3O8H A;  1FEX A;  3BG5 A;  2NS8 A;  1ITY A;  1RKW A;  2R5Z B;  1D5Y A;  3HM5 A;  2WB1 N;  4B4C A;  4A3D J;  4M3B A;  4D7N A;  1ZKG A;  4UUS A;  4DZP A;  1U9N A;  2R93 J;  2DJN A;  4MFD A;  3HOU J;  2CQX A;  2JMW A;  5HOD A;  4A3M J;  1GV2 A;  5DTD A;  1QVT A;  4FE7 A;  1OCT C;  4Y7N J;  1MBF A;  2DA2 A;  4C2M J;  2NVQ J;  1Y1V J;  5M3F J;  3WHC A;  4AC0 A;  5EF6 A;  3NAR A;  4B1R A;  4QSH A;  3IH2 A;  4AUX A;  5J3L A;  2JJ7 A;  3O8G A;  4IHW A;  2DA4 A;  1WCM J;  5FKM A;  1ENH A;  2EZL A;  4FCY A;  2L0K A;  1QVU A;  2EZI A;  2GBY A;  3GTO J;  2VUM J;  2DMQ A;  1BA5 A;  1CQT A;  2G0E A;  3MN2 A;  3SFI A;  3HOX J;  2R5Y B;  2XGD A;  1OCP A;  3FK7 A;  1A6I A;  3S2D J;  3DCF A;  1MSF C;  5IYD J;  4BBR J;  4AYB N;  1Z0X A;  1HDD C;  3A01 B;  3BG9 A;  2MG4 A;  3IH4 A;  3HBL A;  5IOY A;  3CMY A;  2FJ1 A;  4BY1 J;  5F08 A;  2VKV A;  2MGQ A;  2R5Z A;  3LSR A;  3CDL A;  1MBE A;  2WV1 A;  1JKP C;  4D7M A;  2HI3 A;  3JRA A;  4BY7 J;  3HOY J;  1I3Q J;  4I76 A;  4BBS J;  3S1M J;  1QRY A;  2NVY J;  3JRF A;  3QPL A;  3ZQL A;  4ABZ A;  3BG3 A;  2CJJ A;  2KT0 A;  1ZR4 A;  2M0C A;  5FKO A;  1HDP A;  5IYC J;  1MNM C;  3NAU A;  5C44 J;  4A3J J;  2IAI A;  4C3J J;  2CRG A;  2TCT A;  2MSY A;  3BTJ A;  3LOC A;  1GDT A;  2HQ5 A;  1ZGW A;  3M3Y J;  1W0T A;  3F0C A;  4CYC A;  3S16 J;  2QCO A;  5F0F A;  5EG0 B;  5FKL A;  1H89 C;  4W97 A;  1RET A;  1MBG A;  4JX5 A;  3GTL J;  1E3O C;  5IP6 A;  3DEW A;  1SFO J;  1TC3 C;  5FLM J;  2X48 A;  3Q3S A;  3K7A J;  2R5Y A;  4MIM A;  2YS9 A;  3HOV J;  1WI3 A;  5F1J A;  3SDG A;  1FIA A;  5IP9 J;  5FJ8 J;  1MBK A;  1U8B A;  2NVX J;  3BR2 A;  3BTL A;  4V2F A;  1B72 A;  5M3M J;  4M3F A;  1JJ6 C;  5EYR A;  2GLO A;  1Z77 A;  2CQQ A;  1U78 A;  4A3F J;  5EZH A;  3A01 A;  1IUF A;  4BXX J;  5E3L A;  3MKL A;  3W6V A;  4EEF G;  2GM4 A;  5BNG A;  2YUS A;  1AKH B;  2D5V A;  3IH3 A;  1K83 J;  3ZQG A;  4XIC A;  2Y9Z A;  5F27 A;  1JJ8 C;  2Y31 A;  1ORK A;  3C2B A;  2ID6 A;  5E3O A;  3JRC A;  2ELK A;  2EZK A;  1P7J A;  1ETO A;  2E1O A;  2XSD C;  2LD5 A;  2E2H J;  3G1L A;  3G1O A;  2XB5 A;  1JKO C;  5IPA A;  1BW5 A;  3BR0 A;  1UMQ A;  2XB0 X;  1F43 A;  2FD5 A;  3M4O J;  1F36 A;  1GVD A;  4JP0 A;  1ETK A;  4XRS A;  2JA5 J;  1T33 A;  1A5J A;  1QPI A;  4S0H B;  5J1R A;  1HOM A;  2XRL A;  4B3A A;  3BQY A;  3HOW J;  4LOC A;  3S17 J;  1ETY A;  2W48 A;  2JA6 J;  3I4M J;  3BR1 A;  4L5E A;  5EG0 A;  2HOS A;  1VI0 A;  1TWH J;  3HGY A;  1JUP A;  2ECB A;  2LP0 A;  1BW6 A;  5F0C A;  2I10 A;  5GP9 A;  1TWA J;  4DZJ A;  1LE8 B;  3H3V K;  3TP3 A;  1W0U A;  1PUF B;  2DMU A;  3A03 A;  5FLV A;  1B8I A;  2L9R A;  1I50 J;  3HB9 A;  4QIW N;  4JX6 A;  5F04 A;  2O7O A;  1MH4 A;  2DTZ A;  2M9H A;  5E3N A;  2HXO A;  5JLW A;  2DA5 A;  3BTC A;  2AHQ A;  1GT0 C;  4IHY A;  2Y0S N;  1IDY A;  1YRN B;  4I6Z A;  1IDZ A;  1I6H J;  3TP0 A;  2Y2Z A;  1S7E A;  3A02 A;  1AKH A;  3TW7 A;  1DU6 A;  1JKQ C;  3B6A A;  2Y30 A;  3GTP J;  1HCR A;  3ZQI A;  1G2H A;  4D5F A;  1K61 A;  1NK3 P;  2HDD A;  5M5X J;  1R9T J;  1MH3 A;  4QTR A;  2H1K A;  2JK3 A;  3JRB A;  1HLV A;  1ZR2 A;  1DU0 A;  2DA3 A;  4A3B J;  4MLO A;  1XC5 A;  1JTY A;  2FQ4 A;  4DYQ A;  1XG1 A;  1BL0 A;  2E2J J;  3BR5 A;  1MBJ A;  1ETQ A;  4JYK A;  2JN6 A;  4W1U A;  3RZD J;  1ZTR A;  1ZQ3 P;  3CQZ J;  3ZOB A;  3TW6 A;  2K9Q A;  2ME6 A;  3FKI J;  4UUS B;  1NK2 P;  2LLK A;  3S1N J;  3JRE A;  4X6A J;  1X2N A;  4MFE A;  4G12 A;  3E7L A;  2N8G A;  2M8G X;  2OPT A;  3JR9 A;  1Y1W J;  3RKQ A;  2WAQ N;  2IBD A;  1LE8 A;  5C4X J;  2HOA A;  5M5Y J;  3GBG A;  2IEK A;  1PUF A;  1Q1V A;  4X1E A;  5E3M A;  1TWG J;  4M3D A;  2DN0 A;  4C3I J;  3BT9 A;  1GV5 A;  4XK4 A;  3LSP A;  4A3K J;  1JKR C;  3ZQC A;  1APL C;  2XPU A;  3MVP A;  2TRT A;  2XGC A;  4UUT A;  2RAE A;  2LTP A;  2NS7 A;  4J19 A;  5C4J J;  1BJZ A;  2CUF A;  2CUE A;  1P7I A;  2OF7 A;  4A3I J;  4V2G A;  2K40 A;  3HKZ N;  3PM1 A;  5J1U A;  3VPR A;  5EEA A;  1JT0 A;  4NDL A;  2L7Z A;  3SJM A;  2O9L A;  2K9S A;  3GTJ J;  2KDZ A;  4DYC A;  2AO9 A;  1VND A;  1ZK8 A;  1U9O A;  2HYJ A;  2LKX A;  1LFU P;  1JUS A;  1FTT A;  1RR7 A;  1FJL A;  1IGN A;  5IOZ A;  2DMP A;  3PO2 J;  2HXI A;  2VKE A;  1POG A;  3BQZ A;  2LVS A;  1TWF J;  2HOT A;  4IHV A;  1H88 C;  2M34 A;  4JX4 A;  2NVT J;  2NOG A;  3IV5 A;  3FIS A;  2H8R A;  2LK2 A;  2JA7 J;  3GTM J;  1IC8 A;  1TWC J;  3G1M A;  1IV6 A;  3Q0W A;  3L1P A;  3OOU A;  5C3E J;  1RES A;  3OSF A;  3HGG A;  1LFB A;  3S14 J;  1GUU A;  1T56 A;  2EQR A;  3LSJ A;  3JRD A;  3S1Q J;  1MBH A;  2DA7 A;  3BTI A;  4RBO A;  4A3G J;  1AU7 A;  3S2H J;  3B6C A;  5FKK A;  3JRI A;  1FTZ A;  1O4X A;  2JWT A;  1OJL A;  2COB A;  5M5W J;  5J1Y A;  2LFB A;  2CU7 A;  2ECC A;  3LSG A;  4CYC B;  4A3C J;  3I4N J;  3BR6 A;  3S1R J;  2P81 A;  2ID3 A;  2L7M P;  2E19 A;  5JLX A;  4IHX A;  3Q0V A;  4IEJ A;  1ETW A;  5K7H A;  4D5C A;  1JUM A;  1ETV A;  2DMN A;  4M3E A;  1WH7 A;  3OIO A;  4MO7 A;  1NTC A;  2ME0 A;  1IJW C;  5EGO B;  3LNQ A;  5EZG A;  4FTH A;  2E2I J;  1OFC X;  2XGE A;  1JTX A;  4FE4 A;  3QPS A;  1UG2 A;  3FIW A;  1JGG A;  1B72 B;  4A3L J;  9ANT A;  1EF4 A;  3JRH A; 
#chains in the Genus database with same CATH topology
 3D1N I;  2LR8 A;  4BXF A;  2F4O B;  4G6T B;  1JHH A;  4XLN F;  4HLY A;  1J75 A;  1BIA A;  2Y9Y A;  4CCL A;  4EVI A;  5GPC A;  1SMT A;  2A68 F;  2EH3 A;  3K2Z A;  2QKM B;  3WE3 A;  3CUQ C;  1Y8R B;  2XAF A;  2ZME A;  2WC2 A;  1VQM I;  4CZZ A;  2P4W A;  5IYB J;  5E1Z B;  2V4J C;  2UXN A;  1IG7 A;  2MW8 A;  2QVO A;  3HSR A;  5GPA A;  1R7J A;  3V8K A;  3DBH B;  3PQK A;  1G59 A;  4DW6 A;  1G8X A;  3GFL A;  1GLN A;  1MJ9 A;  3QYE A;  4BKX A;  4WWC A;  1G3S A;  2HZD A;  1WJA A;  3E6B A;  2BOL A;  3KE2 A;  2FRH A;  2F4I A;  3DLL F;  1REP C;  4RDU A;  2DMT A;  2EIK H;  3VYU B;  1WJ5 A;  1WH5 A;  1HA8 A;  3F8F A;  3AL0 C;  4BDY A;  3HDD A;  4LG0 A;  4II2 A;  2VBW A;  4HNV A;  1W4M A;  3HPH A;  4B3X A;  1YIJ I;  1ETX A;  5J47 A;  4QPO A;  1IN8 A;  1IRZ A;  4OAY A;  1WGX A;  4XMY A;  5ICF A;  5L3E A;  2Z2S B;  4G7O F;  3Q0U A;  2WWY A;  4M9Z A;  1IN6 A;  3HTS B;  5L3D A;  3S3M A;  2DDB A;  1YTY A;  5EDN A;  4GRI A;  5CVR A;  4CGZ A;  3OSG A;  5K1Y A;  2CFO A;  2OAZ A;  2X9D A;  3JTH A;  3FMR A;  1QZE A;  3GLL A;  2M4K A;  1Z3Y A;  3VDX A;  1TNT A;  3TOA A;  1FEX A;  2W85 A;  3U1D A;  3H9J A;  1BIB A;  1ITY A;  1RKW A;  3J7Y J;  2VAS A;  1XMK A;  4BQO A;  4H4K C;  1J5Y A;  2R5Z B;  1X19 A;  1SD7 A;  4MTD A;  2B7E A;  4BGD A;  2WB1 N;  4HLX A;  3VSK A;  4A3D J;  1Z21 A;  3WU1 B;  1HW2 A;  3AFH A;  4Z2Y A;  3KYC B;  5E20 A;  4D7N A;  3CF5 F;  2HQR A;  3VSL A;  2KLO A;  4UUS A;  5KCM A;  4BE0 A;  4L5I A;  3GFJ A;  1FMV A;  2L7K A;  3E3V A;  3HOU J;  1EH6 A;  1BN5 A;  2ESH A;  2HPI A;  2JMW A;  2BY3 A;  2IA1 A;  4IOA F;  5DTD A;  1XMA A;  3H1C A;  4FE7 A;  4LFU A;  1OCT C;  5GAG J;  3SZG A;  3CP2 A;  4YIF A;  2CS3 A;  2DA2 A;  3M07 A;  3WHC A;  4AC0 A;  2XF5 A;  3NAR A;  3ZPL A;  2DOE A;  1K6O A;  4AUX A;  3O8G A;  5H20 A;  5D8K B;  2ZXJ A;  4KIC A;  2VJI A;  2FMY A;  3WTS C;  5FKM A;  1ENH A;  3B73 A;  5E17 F;  4K2E A;  4PJM A;  3ELK A;  2DU9 A;  3DKX A;  3H3U A;  2EZI A;  4IO9 F;  2GBY A;  1ZRF A;  1UHW A;  3TDZ C;  2DMQ A;  2O0Y A;  3QOP A;  1B9N A;  5LEJ A;  2P5K A;  3MN2 A;  3SFI A;  3HOX J;  2FA5 A;  3EPZ A;  2F48 A;  4MGR A;  1A6I A;  4PK4 A;  2LNB A;  2KIU A;  5IYD J;  2V7F A;  3SFZ A;  4B8X A;  4BBR J;  2E1C A;  3R61 A;  1GHC A;  2F4M B;  2LYC A;  5TGT A;  3HBL A;  4G7H F;  3QPT A;  3MKZ A;  5F08 A;  1MD0 A;  3IRR A;  2QBY B;  2VKV A;  3DU6 A;  4HRI A;  2IS4 A;  2A6T A;  3KEY A;  2HI3 A;  2CO5 A;  2ELH A;  3TQN A;  4IX7 A;  2VLA A;  3OIP A;  2KMU A;  4RB1 A;  3JRF A;  1VQN I;  4I0B A;  4I98 B;  4RM2 A;  3WTU C;  1P9Q C;  3MKW B;  1DGW Y;  1XDU A;  2CJJ A;  3Q9S A;  2W24 A;  5D6E A;  3GYH X;  4RGS A;  5FKO A;  2X1E A;  3IUO A;  3ABL H;  3DKW A;  4KUM A;  4Y4R A;  2IAI A;  2CRG A;  2TCT A;  3NRV A;  2IA0 A;  1FYM A;  2L9V A;  2Y75 A;  1OMI A;  3BP8 A;  3ZR8 X;  2HGC A;  1ZGW A;  4G7Z F;  2E7X A;  2F6C A;  4CYC A;  4EJW A;  4XLC A;  5CYV A;  3TL4 X;  2QCO A;  2K9L A;  3I54 A;  2X51 A;  4W97 A;  1ON2 A;  2ZCW A;  4XKB A;  2IA2 A;  3RKY A;  5D4S A;  2IS6 A;  4CYD A;  2FEZ A;  3DLA A;  3A0H C;  2MD0 A;  3DEW A;  5CVI A;  5IP6 A;  3O6B B;  3OL3 A;  1XGO A;  3CCR I;  5KK1 A;  3DPL C;  1OIS A;  3BJA A;  2X48 A;  4G9Y A;  3OYF A;  4BHC A;  4MIM A;  2YS9 A;  3HC7 A;  3SDG A;  1KYW A;  1MBK A;  4HG2 A;  2EFN A;  2VT3 A;  4BS9 A;  2DCE A;  1ZLJ A;  2V9K A;  2O8X A;  3QAH A;  3ZN0 A;  1U78 A;  4XLA A;  5EZH A;  3A01 A;  4A0X A;  2WV0 A;  1T39 A;  2HKX A;  3MKL A;  1OR7 C;  2X6X A;  3QOD A;  5AON A;  2DJI A;  1I3A A;  3L2V A;  1AKH B;  1K83 J;  4PUS A;  1USS A;  3ZQG A;  1LDK B;  2ADU A;  2KP6 A;  1WRJ A;  1JJ8 C;  2EPF A;  4IVN A;  1TNS A;  2OTL I;  3C2B A;  4HNT A;  5E3O A;  2GIZ A;  2ELK A;  4KIS A;  2UZK A;  2EZK A;  2A6H F;  2MH2 A;  2XAG A;  2E2H J;  2CQN A;  3G1O A;  2DPU A;  4G6D A;  1SEU A;  1BW5 A;  1UMQ A;  1K78 B;  2DI3 A;  3DTI A;  1GVD A;  1PDN C;  2K4J A;  2P5V A;  4PJ0 C;  4C9Y A;  1ZLK A;  2ZFU A;  3HRT A;  4HF2 A;  1HBX G;  2M45 A;  3H3Z A;  1HOM A;  3BQY A;  3HOW J;  3WG7 H;  1ETY A;  5HDG A;  4XQF A;  1D3Y A;  4L5E A;  5EG0 A;  2HTS A;  4ZTF A;  2HOS A;  1JUP A;  3H3V K;  2UWM A;  3R60 A;  4QPQ A;  5FLX K;  4RM3 A;  1F1Z A;  1S9H A;  3NWS A;  1QZZ A;  3A03 A;  1O7L A;  4QIW N;  5F04 A;  1KYZ A;  2O7O A;  3J80 Z;  2FBK A;  3M7G A;  5E3N A;  2W1O A;  1LFP A;  5KAI C;  5TIS C;  4IHY A;  4ESJ A;  2BBY A;  1XD7 A;  1YRN B;  3G71 I;  3F21 A;  3PFI A;  3FXO A;  1H9G A;  1S72 I;  5FRO A;  2YU3 A;  1MJA A;  3CCL I;  2XSJ C;  1FP1 D;  1JKQ C;  1DU6 A;  4N4N B;  3CJQ B;  3GTP J;  3IP4 B;  3OYA A;  2PJR A;  1G2H A;  2E36 A;  4D5F A;  1K61 A;  2HDD A;  1MGT A;  3ZQ7 A;  1HST A;  2H8W A;  5D5X B;  5M5X J;  3F22 A;  3NEU A;  1IAW A;  2JK3 A;  1DU0 A;  3X2Q H;  1ZR2 A;  1SVO A;  4A3B J;  3BCB A;  4O6J A;  1U2W A;  3RJP A;  3K70 D;  3H5A A;  2XKP A;  5L3B A;  3HXL A;  3KP7 A;  1ETQ A;  4AYB A;  1ZQ3 P;  4XOR A;  4HNU A;  2VON A;  5LD2 C;  3ZOB A;  2ZBK A;  4NNJ A;  2IVM A;  2R7U A;  3WG9 A;  5ILS A;  3ROU A;  2LLK A;  5D6F A;  1QU3 A;  2X6Y A;  2ZO4 A;  1RRJ A;  4IXA A;  1J9I A;  2P6T A;  2E7W A;  3E7L A;  3KP4 A;  1WKM A;  2Y0M A;  3A0B C;  3BY6 A;  2IBD A;  3S93 A;  1LE8 A;  1QNT A;  1WI9 A;  2CV2 A;  5C4X J;  2L01 A;  3GW2 A;  2IEK A;  1PUF A;  2NS0 A;  2HVR A;  5LEK A;  1TWG J;  4IHT A;  2JPB A;  2DN0 A;  4C3I J;  3KCC A;  3K4K A;  4D1Q A;  4CA0 A;  4BQN A;  1YX3 A;  1Z9C A;  4IQJ A;  1ACI A;  3R0J A;  2ZJR F;  1KQ0 A;  1W1W E;  3OYN A;  4BE2 A;  1VQ8 I;  2TRT A;  4DIQ A;  1NH3 A;  3IAS 2;  3L2C A;  1FWZ A;  4NC8 A;  4J19 A;  5HS8 A;  2QBY A;  2CUE A;  1P7I A;  1U0J A;  4B44 A;  3PM1 A;  2DT6 A;  3VPR A;  5EEA A;  1JT0 A;  4FAS D;  1G3T A;  3K6G A;  5JVG F;  1PP7 U;  1OPC A;  4NDL A;  4L9T A;  3GTJ J;  4OMY A;  1Q1H A;  1VND A;  2ZXI A;  1LFU P;  5E8I A;  2KPM A;  2Q8K A;  3PIO F;  3OS1 A;  3FXK A;  3SDB A;  2E1M C;  3V8L A;  4S05 A;  2VBY A;  1VZ0 A;  1ZRC A;  2ZME B;  4BDZ A;  3OV8 A;  3SEQ A;  1YW9 A;  2ZNZ A;  4EJO A;  1P92 A;  2NOG A;  3IV5 A;  1LVA A;  3C2H A;  3HOT A;  1O3Q A;  2NAZ A;  1Y0U A;  2MBF A;  3GTM J;  1UZC A;  3TGN A;  1TWC J;  3G1M A;  3TO9 A;  2M4G A;  3ASO H;  2UUZ A;  2X0L A;  4XOP A;  2EQR A;  2W25 A;  1P2F A;  1J7K A;  2DA7 A;  2DYS H;  3BJ6 A;  3AKZ A;  1X3U A;  3DU5 A;  3ECH A;  2VXD A;  2EFQ A;  4U7D A;  3CF2 A;  3BDD A;  2LY2 A;  2NNN A;  3K1P A;  4UVC A;  3A2K A;  2WAE A;  2HYF A;  4MQV A;  1OJL A;  2COB A;  2LFB A;  4LG0 B;  2CU7 A;  3HRM A;  5H6Q A;  2Z16 A;  2BVM A;  2D1H A;  4YRV A;  3S1R J;  2P81 A;  2ID3 A;  5CJ9 A;  1PUE E;  2L7M P;  2QZ8 A;  4I01 A;  5CKT A;  4BYY A;  1ZGJ A;  5LGN A;  3LST A;  1ETW A;  1R22 A;  1UAA A;  4MO7 A;  3DPU A;  3HJE A;  3IL2 A;  2HPM A;  3BC8 A;  1LEB A;  1ZYR F;  2QM3 A;  4F92 B;  2VE8 A;  3KZI C;  2E2I J;  2XGE A;  1JTX A;  2H1L A;  4Y13 A;  3F8B A;  1J59 A;  2JSC A;  5B3S H;  2LRE A;  3FKJ A;  3OYG A;  3EQL F;  2W4S A;  3TED A;  3RZO J;  1A35 A;  2DAO A;  4ESF A;  4RB0 A;  4D0P A;  2STW A;  2EFO A;  1LJ9 A;  1VF9 A;  3M8J A;  5F1R A;  4YEL A;  3OR2 C;  2VKH A;  2VQH A;  1K78 A;  1Z6R A;  2KKO A;  3GWZ A;  4HQM A;  3A4C A;  4IL6 C;  3GTG J;  1JI8 A;  2Y0S A;  1HKQ A;  1XN7 A;  1A6Q A;  1E2X A;  2FU4 A;  3H36 A;  1XPX A;  2K9N A;  2QQ9 A;  1OQY A;  2HVS A;  4Y52 J;  1WFX A;  2UV1 A;  3K4M A;  1VQ5 I;  4XRS G;  3JRG A;  2DA6 A;  1Z05 A;  1R1V A;  1AHD P;  4LK0 F;  2KDO A;  2JSP A;  4IKF A;  1SAN A;  4HV6 A;  3FF5 A;  2CV0 A;  1UHS A;  5DV5 A;  4DJA A;  5ED4 A;  1H8A C;  1T0F A;  3GFM A;  1FLI A;  3PNV A;  3KZZ A;  2VC0 A;  3OL4 A;  1W7P D;  4LLL A;  3JAM K;  2ZB9 A;  5A2Q K;  2E34 A;  3SZT A;  2JA8 J;  5DEQ A;  1BR2 A;  1D0Y A;  2PMU A;  4XID A;  1HW5 A;  1OLT A;  3FK6 A;  3FXM A;  5DM6 F;  1T98 A;  3H0G J;  1XS9 A;  1YI2 I;  3J81 K;  1WPK A;  3HEF A;  3I71 A;  4E7Z A;  3LA3 A;  2DDA A;  2L7F P;  2GA1 A;  1YRN A;  2R7S A;  3EET A;  4HDV A;  4C3H J;  1Y0N A;  2W57 A;  1JT6 A;  4XM3 A;  5K5O A;  3CO6 C;  1X2M A;  2VPR A;  4UVB A;  3WGG A;  2R7X A;  5TRD A;  3HRU A;  3ONQ A;  5K7F A;  4HV5 A;  2EK5 A;  1YHQ I;  2R92 J;  1KU9 A;  1O7F A;  3ZQH A;  2ZJP F;  1XB4 A;  2M2E A;  2V26 A;  4UV8 A;  5EEH A;  1I6X A;  5F6F A;  1ZG3 A;  4A69 C;  3UKG A;  1X3W B;  3O8H A;  3BG5 A;  2PI0 A;  2DFH A;  2M30 A;  2NS8 A;  3HSE A;  4NUB A;  4H0E A;  1ON1 A;  3GX4 X;  4L0Z B;  3ABM H;  4OIO F;  4P96 A;  3HM5 A;  5HLH A;  1F9N A;  2LC2 A;  5JR3 A;  2XF7 A;  2F5V A;  1QHH D;  5BMZ A;  4FQG A;  1PYV A;  1ZKG A;  4HZF A;  4DZP A;  2L5Q A;  2X85 A;  2R93 J;  1SD4 A;  2FUG 2;  3IHU A;  1FP2 A;  3M1E A;  4MFD A;  1WJF A;  4A3M J;  3ZMT A;  4CIC A;  4CSW A;  1GV2 A;  1F4K A;  1Z7U A;  2V79 A;  2O03 A;  3EDP A;  5FO5 A;  1MMG A;  3LQQ A;  4C2M J;  1FY7 A;  1Y1V J;  5M3F J;  1ZN2 A;  4B1R A;  2QQ8 A;  3MMY B;  4PDK A;  4NC7 A;  4QSH A;  3WGH A;  5LGU A;  1VTN C;  2BYV E;  5J3L A;  2JJ7 A;  3E5X A;  4L0Y B;  1MMD A;  2EV5 A;  2VB6 A;  1WCM J;  2P7C B;  2DK5 A;  2GAU A;  1YW8 A;  4FCY A;  1K6Y A;  1VQ7 I;  1MND A;  2VQL A;  4FT8 A;  1Z6T A;  3GTO J;  1S29 A;  3GVA A;  3CCS I;  1CQT A;  5DYM A;  4ENN A;  4B43 A;  2JVG A;  2ZNY A;  2XGD A;  4L9V A;  1OCP A;  3K4J A;  3FK7 A;  1QBJ A;  4HX4 A;  1RNL A;  1DQU A;  2KIM A;  2PQ8 A;  2VBX A;  2VQG A;  4E6K G;  4YG2 F;  2GQQ A;  1Z0X A;  2RC4 A;  3A01 B;  1YJW I;  3BG9 A;  4KNY A;  1P6R A;  3CMY A;  4WXC A;  2FJ1 A;  4XSX F;  1P4X A;  2M3A A;  2V6E A;  4PZJ A;  3RI4 A;  3EYY A;  1X1A A;  2MGQ A;  2L4M A;  3LSR A;  2Z3Y A;  5LBQ A;  3DV8 A;  3BZK A;  3JRA A;  1N78 A;  5CPR B;  3F8C A;  1I3Q J;  2Y69 H;  1QRY A;  3O2P E;  4DBR A;  3QWL A;  1YJ9 I;  3F9K A;  4OWR B;  2JZY A;  2DFF A;  2DFI A;  1BOB A;  3IRQ A;  2F5E A;  4GGG A;  2M0C A;  3CMA I;  1HDP A;  5IYC J;  1MNM C;  1BR1 A;  5C44 J;  3I9V 2;  4C3J J;  4M6Y A;  5ILV A;  2MSY A;  4UXN A;  3RPU D;  3BCA A;  3GF2 A;  2IS2 A;  2WAD A;  2KRC A;  5DUK A;  2FML A;  2Q1Z B;  3F0C A;  2XKO A;  4XKW A;  3EUH A;  2L3D A;  4NBQ A;  3S16 J;  4YFN F;  1R6R A;  2ZSH B;  1R5H A;  1IW7 F;  5EG0 B;  4ZYD A;  4AWX B;  4OIP F;  2E71 A;  2XV4 S;  3K1M A;  4HAM A;  1U5T A;  3KIO A;  1MBG A;  3VEP A;  3GTL J;  3DP7 A;  3F23 A;  1E3O C;  2QQA A;  2JVH A;  1QA6 A;  2HR3 A;  3F6O A;  2MAB A;  4ZZD A;  1SFO J;  4ZH4 F;  3PSI A;  4ZZL A;  1IN7 A;  3EUA A;  3I4P A;  2HWV A;  2R5Y A;  2O3F A;  4F7Z A;  4AID A;  3F6V A;  5FJ8 J;  1FIA A;  1U8B A;  3DF8 A;  1H0M A;  3CCJ I;  3KFW X;  1WQ2 A;  2K3P A;  4Y15 A;  4DQ2 A;  1JJ6 C;  4MEX F;  4P5O A;  3I5U A;  4IF4 A;  4IZZ A;  4XKC A;  2FNA A;  3HG9 A;  2JUC A;  5E3L A;  2XRN A;  2XGX A;  2GM4 A;  5BNG A;  1E0E A;  2K7L A;  2D5V A;  3FXQ A;  3IH3 A;  2QEN A;  1TL8 A;  2DO7 A;  3S8P A;  3PNY A;  3WTW C;  2Y9Z A;  3LSI A;  5IY5 H;  2XF6 A;  1XGM A;  5F27 A;  2PJR B;  1ZHF A;  4UV9 A;  2VC1 A;  1BM9 A;  3QRF F;  3LA7 A;  3BRO A;  1HXD A;  1P7J A;  3QOE A;  4L5J A;  1T95 A;  3W6J B;  1A04 A;  4EM2 A;  2ZXW H;  1X4O A;  3JCU C;  3HIF A;  2XB0 X;  3CO7 C;  2W7N A;  2PEX A;  1F43 A;  2K27 A;  1ZG5 A;  1ZRE A;  2KRH A;  2JA5 J;  4GCV A;  3AG2 H;  2IXS A;  3DEU A;  1O3S A;  1QPI A;  2XRL A;  3PJR A;  4B3A A;  3CZ6 A;  4BE1 A;  3MCZ A;  3S17 J;  2W48 A;  1M1E B;  1WZ2 A;  1BC8 C;  4EJU A;  1Y56 A;  2HEO A;  3BR1 A;  4CZC A;  1TWH J;  3HGY A;  1S7O A;  2ECB A;  2LP0 A;  1BW6 A;  3K4C A;  2I10 A;  2MC4 A;  1LE8 B;  4N9H A;  4BAY A;  1W0U A;  3G73 A;  1PUF B;  2R7D A;  2DMU A;  1JE8 A;  1KU7 A;  5FLV A;  2DW4 A;  3RCO A;  4N9I A;  3J7Z I;  2Y48 A;  2VIX A;  3RKW A;  2QSH X;  3IWZ A;  1TZL A;  1MH4 A;  4KMF A;  1Z1D A;  2DTZ A;  2M9H A;  3KET A;  1SAX A;  1NG7 A;  1OYW A;  5JLW A;  3I56 I;  3CTA A;  2HDC A;  2DA5 A;  3U21 A;  3FBN B;  5CQE A;  3I64 A;  2WY7 Q;  2OC6 A;  3J7A Y;  2AXT C;  3KLN A;  2KIF A;  4I6Z A;  1FOX A;  2R7T A;  4A6D A;  2IJL A;  4CH7 A;  4UNO A;  2HZT A;  1HCR A;  3U1K A;  4CCO A;  1MH3 A;  1R9T J;  3TMO A;  1DGR M;  1R5I D;  2A3S A;  2P7V B;  1W5T A;  3JRB A;  2P5L C;  1R1U A;  3I59 B;  1JTY A;  1PJR A;  4DYQ A;  2BHZ A;  1XG1 A;  3WTX C;  3ECO A;  4NHJ A;  3CES A;  2E2J J;  1V55 H;  2ZJQ F;  4E7J A;  2L54 A;  2VL8 A;  2JN6 A;  2KZG A;  3RZD J;  3L2W A;  3CQZ J;  5FRM A;  1LKX A;  3TW6 A;  3T5X A;  2LY1 A;  2OQR A;  3M8F A;  2YR2 A;  2LRD A;  2E60 A;  4HYE A;  4MFE A;  3RYR A;  2H6B A;  3P5J A;  5LHH A;  3JSO A;  4RAY A;  1R00 A;  3BG7 A;  1AOY A;  2OJE D;  3JR9 A;  1MMA A;  4DOZ A;  1Y1W J;  1W7P A;  1YIO A;  2DFE A;  2W00 A;  4A12 A;  3RKQ A;  5H2F C;  2STT A;  3DPT A;  5J40 A;  2M7A A;  2F5D A;  2ELJ A;  4U88 A;  2ISZ A;  4RB2 C;  2HU9 A;  4ETS A;  4X1E A;  4M3D A;  4P9F A;  2XAU A;  2EFP A;  2BVL A;  1T6S A;  2D1V A;  2EIN H;  4ENK A;  1YG2 A;  4HEA 2;  4F3Q A;  4II3 A;  4G6Q A;  2RQQ A;  4A3K J;  2OZ6 A;  4OIQ F;  2XPU A;  1Y6I A;  4U0Y A;  2OD5 A;  3HUG A;  1LEA A;  2JTV A;  3CDH A;  3E6M A;  3QU3 A;  5K5Q A;  2CUJ A;  1BJZ A;  2CUF A;  4RA2 A;  2HQN A;  5FB2 A;  5J1U A;  1BI0 A;  2G7U A;  3V7C A;  1GXP A;  2L7Z A;  2FBH A;  1FSH A;  2KDZ A;  2AO9 A;  2GZW A;  2OBP A;  1U9O A;  5JFR A;  5BQT A;  4A0Y A;  1JUS A;  3D5S C;  2MA3 A;  4HX8 A;  1FJL A;  3GUD A;  1IGN A;  2CW0 F;  2W82 A;  3GCM A;  5LGT A;  4LLG F;  2QQB A;  4GYI A;  1W36 D;  1IXS B;  1POG A;  3BQZ A;  1V5E A;  4XON A;  4WF2 A;  5E18 F;  4IHV A;  3E1S A;  4QLC U;  1H88 C;  2HKO A;  3DFG A;  1OYY A;  4L9N A;  3GME A;  4V19 K;  1HSJ A;  2CW7 A;  3FIS A;  2J5P A;  3K69 A;  3FXR A;  3TBI A;  3ZXS A;  1TP4 A;  3BZ6 A;  1EH7 A;  4ASN A;  1YFH A;  1LFB A;  2FSW A;  4HX7 A;  3JRD A;  1MBH A;  3DEE A;  4A3G J;  1AU7 A;  4HST A;  3OIQ A;  1X1B A;  3S2W A;  3JRI A;  1O4X A;  1FOK A;  2BXY A;  4B48 A;  2HNH A;  3GLX A;  2ICW G;  3I4N J;  1T08 B;  1ZH5 A;  1CGP A;  3KEQ A;  5E1X A;  4XLF A;  4XR6 A;  3Q9V A;  5JLX A;  1Z91 A;  2HDW A;  1B6A A;  4IEJ A;  2BY1 A;  2X6W A;  3GEZ A;  4D5C A;  1JUM A;  4CCJ A;  1ETV A;  2DMN A;  2VOD A;  3P9K A;  3JAM Z;  5HNF A;  1E17 A;  2M7B A;  1IJW C;  3LNQ A;  1QGP A;  5EZG A;  5ICG A;  2G7H A;  5A2Q Z;  4Q5S F;  1UFM A;  1D8J A;  5FGM A;  1VQ4 I;  3FIW A;  3ERE D;  9ANT A;  1A31 A;  1DDN A;  3J81 Z;  2BZT A;  3E6C C;  1T0F C;  1MIJ A;  1IN5 A;  1QQI A;  1FBQ A;  1MSE C;  2H94 A;  4A93 J;  1LVK A;  4JQF A;  4XOT A;  1FMW A;  2K5C A;  5LFA A;  4WK8 F;  5FKN A;  2EZH A;  2JQ7 A;  1OCC H;  5HOO A;  3ML6 A;  4LLN A;  3ZQF A;  1PVE A;  3T0Y A;  1BI2 A;  3PO3 J;  1DPU A;  2CSO A;  4AIJ A;  3HOS A;  3BR3 A;  3KP2 A;  4LB5 A;  2IPQ X;  4AU7 A;  5BS6 A;  3OYM A;  4AIH A;  3RPU A;  2O8K A;  3RYP A;  3BJO A;  1NHA A;  5BPD A;  2EIJ H;  4PJN A;  3WTY C;  2CV1 A;  3G3Z A;  2XPW A;  1JXS A;  1FOY A;  3CCY A;  2BE5 F;  2G9W A;  3WHB A;  1XX5 A;  1IN4 A;  3DTK A;  4N0B A;  2DA1 A;  4KT5 C;  2DYR H;  1CF7 A;  3W2A A;  3P9I A;  1IO2 A;  2QWW A;  2EV0 A;  3TDU C;  5L3C A;  3RQI A;  4EJT A;  2YU9 J;  2B63 J;  1E3H A;  3HZJ A;  3K9T A;  1BJA A;  2CYY A;  2VI6 A;  4HF0 A;  2V1X A;  3C1D A;  4MTE A;  4IRI A;  4M3G A;  3FHZ A;  1MDM B;  2NYX A;  4GFB A;  2R3S A;  1HF0 A;  2KQR A;  3CJT B;  4ZYA A;  5K7Z A;  2EBI A;  4ZYH A;  2OCE A;  3UR3 C;  4A3E J;  4NB5 A;  1I27 A;  5EGO A;  2R7Z J;  2XIG A;  2Z5U A;  4ON0 A;  2VXZ A;  4FIS A;  2X6O A;  3G4S I;  4NQW A;  2QF7 A;  3G2B A;  5ILU A;  1O3R A;  2LBF A;  4BXU A;  3GTK J;  1RKT A;  1RI7 A;  3I59 A;  5ICE A;  1VQ9 I;  1BOA A;  4OIN F;  1Z67 A;  1XCV A;  4UHT A;  4B4C A;  5H6R A;  3V4G A;  5J4Y A;  3I0T A;  4OU0 A;  4PFP A;  2O6G E;  1U9N A;  1VQ6 I;  2M0M A;  2RN7 A;  3ZMV A;  2EIM H;  2TDX A;  5J6X A;  4FX4 A;  3HKZ A;  5D5U B;  2EWN A;  5HOD A;  4BAC A;  5GAD J;  1QVT A;  3IC7 A;  2F5F A;  3H92 A;  4AVP A;  5L3F A;  4Y7N J;  5B1A H;  2L9N A;  3CC4 I;  1KQ8 A;  2E1N A;  1YX5 A;  1YS7 A;  2JA2 A;  4PGH A;  2IP2 A;  2ZME C;  4RLQ A;  4BH9 A;  3W3C A;  3V8J A;  4B09 A;  4IQ4 A;  4KA4 A;  2LOO A;  2LF8 A;  1U5T B;  4LB6 B;  3VYS B;  3K70 C;  2KL4 A;  4KIT B;  1IRX A;  2L0K A;  3W2V A;  4BEH B;  4EQQ A;  4BQA A;  4LG3 A;  2VUM J;  2HQA A;  2P6S A;  5HLT A;  2R5Y B;  2OCC H;  4CXF A;  3S2D J;  2AQF A;  3ZRG A;  1MSF C;  3KLO A;  1N75 A;  2R4G A;  3BPV A;  3K4N A;  4AYB N;  4J00 A;  1HDD C;  2RGV A;  3AAF A;  2MG4 A;  3IH4 A;  2QUF A;  3QP5 A;  5EEG A;  1QHG A;  2DBB A;  2FQ3 A;  1TW3 A;  1UST A;  3EUH C;  4LK1 F;  1R49 A;  3M8E A;  2KZV A;  4BY1 J;  5CLS A;  2FBI A;  4I0A A;  1U5T C;  1MMS A;  4D7M A;  4XLH A;  1IXC A;  4BY7 J;  3MZH A;  4EGZ A;  3HOY J;  3FWE A;  4I76 A;  2V9P A;  2IGM A;  3S32 A;  2ZXH A;  5AIQ A;  2F2E A;  3ZQL A;  3COA C;  1YQA A;  5DCF A;  4F55 A;  1W5S A;  3I3L A;  1ZR4 A;  4L18 B;  4CCM A;  3CCV I;  4LJZ F;  3U9G A;  3IKT A;  3NAU A;  4A3J J;  2DPD A;  1D0X A;  5LHG A;  3BTJ A;  4Y33 A;  1KQ9 A;  3E0J B;  4KIB A;  4KDP A;  4JK1 X;  1OCR H;  3LOC A;  2UXX A;  2K3F A;  2K85 A;  2KHM A;  3HSF A;  1W0T A;  4R1H A;  1AA7 A;  3RQ4 A;  2PBI A;  3ABU A;  2B0L A;  1R4N B;  4HQE A;  4YFX F;  4MEY F;  3RPQ A;  4U7B A;  2GOM A;  1RET A;  4JX5 A;  4Q4Z F;  3R4K A;  4PCQ A;  1TC3 C;  5FLM J;  4XL9 A;  2LH9 A;  3Q3S A;  3BZC A;  1U3E M;  1WI3 A;  3N05 A;  5F1J A;  5IP9 J;  3HOV J;  2NVX J;  3LAJ A;  1X1D A;  3OWT A;  4EMS A;  3QP6 A;  5M3M J;  3WOD F;  4M3F A;  1XGN A;  1LNW A;  3SEZ A;  3ZP5 A;  4IRG A;  2JT1 A;  1F5T A;  1WJD A;  2QYO A;  3BWG A;  5CVV A;  1IRF A;  2H6C A;  4Y17 A;  2H09 A;  4CHU A;  2IW5 A;  4EEF G;  2LDU A;  4M9X A;  2C6Y A;  2A05 A;  2XAH A;  4IJA A;  2ESN A;  2Z33 A;  1MZB A;  4HOB A;  2X1C A;  4XIC A;  2JPC A;  1RZ4 A;  2Y31 A;  1A36 A;  4RGU A;  2FE3 A;  3VOD A;  2OQG A;  2BY2 A;  2ID6 A;  5HS9 A;  3NQO A;  1BI3 A;  4PGG A;  3G6E I;  1SC7 A;  4KIG A;  3G1L A;  4A5N A;  2DQL A;  3MZY A;  3L00 A;  2XB5 A;  2IRF G;  3D0S A;  1G6N A;  2W84 A;  4I09 A;  4U87 A;  5CVU A;  3M4O J;  1F36 A;  1YYV A;  4JP0 A;  2X1D A;  1FYL A;  1VQO I;  2LG4 A;  2BY0 A;  2XAS A;  5E1W A;  2MFZ A;  2A5W A;  2BHY A;  2ZSI B;  4LIU A;  4WXH A;  5J1R A;  4I99 C;  2R7V A;  2DT7 B;  4LOC A;  2WB1 A;  3I4M J;  2VJ5 A;  4GYG A;  1MDM A;  1W7P B;  4KMU X;  4KFC A;  1QO0 D;  3OYH A;  2FOK A;  5F0C A;  5GP9 A;  3R6S A;  4DZJ A;  3HYI A;  3TP3 A;  1OYI A;  4RAG A;  2HYG D;  2MH9 A;  3TO7 A;  3H35 A;  1VQL I;  2XAJ A;  2L9R A;  2V6C A;  1I50 J;  3KYD B;  4I2O A;  3GFI A;  4WX9 A;  2CUZ A;  3QYB A;  2DXI A;  2L4A A;  1D1A A;  2HXO A;  4XNF A;  3BTC A;  3HUG B;  3ABK H;  2RDP A;  4E7S A;  4DBQ A;  2Y0S N;  1IDY A;  5E79 C;  1IDZ A;  3ZCO A;  2NVU B;  2Y2Z A;  4DNC A;  1S7E A;  1TT0 A;  2MD5 A;  2VE9 A;  3A02 A;  1TQM A;  3PFY A;  3TW7 A;  3QYF A;  2XVC A;  3FXU A;  1J2X A;  5HVQ C;  3B6A A;  3QPH A;  5D8L B;  3EUK L;  3ZQI A;  1FZP B;  2F5C A;  3BLY A;  3OYK A;  1MNE A;  1HLV A;  3W6K B;  1RUO A;  1Y39 A;  2FQ4 A;  4TV7 A;  1E3P A;  1BL0 A;  3AL0 B;  3BR5 A;  2RV8 A;  2A69 F;  4QWQ A;  3CJR B;  4AD9 A;  1BR4 A;  2PJP A;  1MBJ A;  1G3W A;  3E5Q A;  4PJJ A;  1ZTR A;  1KA8 A;  2HVQ A;  4M73 A;  3I53 A;  2ZFW A;  2K9Q A;  3F8N A;  1XSD A;  2ME6 A;  3OYE A;  2RNG A;  3ABT A;  2NNY A;  1UHM A;  4OIR F;  1YLF A;  4CCK A;  1NK2 P;  3S1N J;  1S6L A;  2BXZ A;  2BW3 A;  2Q0O A;  4X6A J;  2N8G A;  4E4H A;  1S5L C;  4XLP F;  2LMD A;  2M8G X;  4KIF A;  2OPT A;  4EAT A;  3TOB A;  4O5V A;  2EFW A;  4BEH A;  3L9F A;  1W5C C;  3K10 A;  3GBG A;  5M5Y J;  3ULQ B;  4EV0 A;  5JHF A;  3V7S A;  1Q1V A;  2JRT A;  4E70 A;  3K1N A;  2CFX A;  1IF1 A;  4WXD A;  3D5L A;  4Q48 A;  1HQC A;  4XK4 A;  3CCQ I;  3LSP A;  3FM3 A;  4D9J A;  5FLX Z;  3ZQC A;  1JKR C;  1APL C;  2CGP A;  3B02 A;  3E97 A;  2XGC A;  4UUT A;  2RAE A;  5DCM A;  2LTP A;  2RVC A;  1Z7L A;  5C4J J;  4ITV A;  2D2W A;  3DQV C;  2Z1D A;  4OAZ A;  4V2G A;  2K40 A;  3ZMU A;  3HTU A;  1LDD A;  5L3G A;  2WA0 A;  3OS0 A;  2KJC A;  3SYT A;  1K4S A;  4CO8 A;  3SJM A;  2O9L A;  2K9S A;  3RSN A;  1R36 A;  4DYC A;  2MC3 A;  1ZK8 A;  2HYJ A;  2PMH A;  3ASN H;  2LKX A;  3L2R A;  2PMZ A;  2A07 F;  1ONV A;  3DKY A;  1UJ8 A;  1XMX A;  1MW7 A;  1R23 A;  2M1B A;  5IOZ A;  2DMP A;  2XUB A;  1J0R A;  3ESW B;  4XLE A;  5IT9 K;  4BJ6 C;  1R1T A;  4ZYE A;  2LVS A;  2HOT A;  3FBI B;  5FRN A;  2M34 A;  4HBL A;  4JX4 A;  1T38 A;  2NVT J;  2ETH A;  1LQ1 A;  1TTY A;  1VQP I;  2JA7 J;  1IC8 A;  3K0L A;  4PSW A;  1XTA A;  3KX2 A;  3Q0W A;  1IV6 A;  5C3E J;  4EJV A;  5IT3 A;  3OSF A;  3HGG A;  5B5E C;  1BBY A;  1GUU A;  1T56 A;  2HS5 A;  5HLI A;  5GTI C;  4RBO A;  1ODD A;  3B6C A;  5FKK A;  3PL8 A;  4KYW A;  1CF7 B;  3CMM A;  1WJB A;  2LF7 A;  1O57 A;  3HRS A;  3H5N A;  5LRS A;  5J1Y A;  4FET A;  3LSG A;  3TO6 A;  3T1B A;  5GAH J;  3BR6 A;  3ZN1 A;  3FXJ A;  4C2U A;  1SFK A;  3Q0V A;  2ZC2 A;  1S8N A;  4A6E A;  5HDK A;  1R71 A;  4M3E A;  1WH7 A;  4LIV A;  1D0Z A;  3OIO A;  3VFZ A;  3ZGK A;  4BJT A;  5DD4 A;  3CCM I;  1D8K A;  1EV7 A;  1S3J A;  1SFX A;  3CC7 I;  5EGO B;  1V54 H;  1SVM A;  1HKS A;  2V1N A;  3L09 A;  1OFC X;  4RMN A;  1WJE A;  3DWL E;  3P7N A;  4EM0 B;  3LAP A;  2IGN A;  1IV8 A;  2P0W A;  3GXO A;  3QPS A;  1UG2 A;  1LUJ B;  4NQW B;  1JGG A;  1B72 B;  1V4R A;  3BPX A;  1EF4 A;  4F52 A;  4KJZ A;  2LBF B;  3JRH A;  1K4T A;  1MKM A;  4YII A;  5DS9 A;  3GO5 A;  2L02 A;  4ESB A;  1LB2 A;  3OYC A;  1G3Y A;  3S15 J;  2DLL A;  2DOD A;  2OZU A;  4XN0 A;  3CDI A;  4BL0 B;  2FX0 A;  4HPQ A;  4JBA A;  2BV6 A;  5LRR A;  1P4W A;  1J09 A;  1MMN A;  5ICC A;  3LL7 A;  1TW2 A;  1SFE A;  3J7A O;  3K4B A;  5J8F A;  1RR8 C;  4RAZ A;  3HL2 A;  3CD6 I;  1YIT I;  3VWB A;  3R0A A;  3A1Y A;  1KU3 A;  1UG0 A;  2L2O A;  5DDG A;  5F0H A;  1FIP A;  2L9S A;  2IGK A;  3HOZ J;  2WBM A;  3RTR A;  2LKS A;  2VQC A;  3FDY A;  2QKL B;  1V5G A;  3WTV C;  1AWC A;  1EJ9 A;  2VN2 A;  4M6X A;  3PQJ A;  1VFC A;  3C18 A;  2LY9 A;  3MQ0 A;  2R0Q C;  3ZQQ A;  1X58 A;  4ZC3 A;  4UB6 C;  1RPW A;  2O61 A;  1Z3X A;  3T8T A;  3LFK A;  3VYT B;  2CQ7 A;  2QLZ A;  5B66 C;  1ZG1 A;  4P55 A;  4DYR A;  1D1C A;  2GWR A;  2XPV A;  1DP7 P;  5IP7 J;  1SMY F;  3TKY A;  3K2A A;  3CUQ A;  2NRA C;  2Z99 A;  4IHS A;  4R79 A;  3S3N A;  1V5F A;  4XRM A;  4RLF A;  5HLG A;  5FFX A;  3BOQ A;  3I58 A;  2EIL H;  2OUM A;  1QZY A;  4M6V A;  2PMZ N;  1B8I B;  3M9A A;  1YE9 A;  4J01 A;  2Z9O A;  3MZ8 A;  3GTQ J;  2E35 A;  2M8E A;  3H9Q A;  1EKE A;  3QQA A;  4RB3 C;  4FX0 A;  5KAF C;  4UB8 C;  3WE2 A;  4YFK F;  1LPQ A;  1YO5 C;  3H5R A;  4XRF A;  2YX7 A;  1B9M A;  5B1B H;  3V7R A;  1FOW A;  3IKV A;  3KP6 A;  3PIP F;  4BJ5 C;  3K4L A;  1D5Y A;  3S3O A;  3OS2 A;  4HSR A;  3QU6 A;  5D5W B;  4M3B A;  3JW4 A;  4HDU A;  4E7H A;  2BGC A;  4IPA A;  4RS8 A;  3KEO A;  1IXR C;  2I5U A;  3OYL A;  4PSX A;  2DJN A;  3ZMZ A;  3FXL A;  1T8I A;  1X1C A;  2CQX A;  2OU2 A;  1WWX A;  3CJN A;  1ZEL A;  3NWT A;  2KRF A;  2ZJ2 A;  2V1D A;  2JUG A;  2A61 A;  2DOA A;  1OKR A;  1MBF A;  1UB9 A;  1X3Z B;  2O5R A;  3DBR B;  4Q47 A;  3SZP A;  2NVQ J;  1WJC A;  2WAF A;  4C2T A;  5EF6 A;  1HKT A;  3IH2 A;  3CUO A;  1JGS A;  3FHN A;  3AG3 H;  4M71 A;  4IHW A;  2DA4 A;  3WTZ A;  3AG1 H;  1DUX C;  4MHG A;  2RRE A;  1G4D A;  2R7F A;  3KPH A;  2VT2 A;  4KN4 X;  2EZL A;  2QSF X;  3SHF A;  3EYI A;  3REO A;  3FZV A;  3L2U A;  1QVU A;  2I8D A;  4LMY A;  4E7I A;  1BA5 A;  5K5R A;  2G0E A;  4PJL A;  2KIS A;  3DCF A;  1VQK I;  3MD2 A;  4RGX A;  5KNL A;  4O3M A;  1FSE A;  1B59 A;  4M74 A;  4P1W A;  3F3X A;  4M72 A;  2GOX B;  1O3T A;  5IOY A;  5LHI A;  2CWE A;  4Z6Y A;  2EV6 A;  1FBU A;  2PFB A;  3ISP A;  2EJR A;  1EH8 A;  1FPQ A;  4GDF A;  4F93 B;  2R5Z A;  3CDL A;  5FD6 A;  1MBE A;  2WV1 A;  2CW8 A;  1JKP C;  3VYR B;  3C2G A;  2VJJ A;  1C0W A;  2MLG A;  2YX4 A;  2X4H A;  3RKX A;  5D4R A;  1P4A A;  2MLK A;  1I1G A;  4Y3O A;  3S1M J;  4BBS J;  2NVY J;  2GA2 A;  4XKV A;  3LSH A;  1YS6 A;  3BG6 A;  2CG4 A;  3PUB A;  3QPL A;  1HC8 A;  2V9V A;  5KVR A;  2OA4 A;  3BG3 A;  4ABZ A;  3GZN B;  2KT0 A;  2YSR A;  1I5Z A;  2R7O A;  3C3W A;  3OR1 C;  2WY8 Q;  1LDJ A;  4L9J A;  2ZKZ A;  4LIT A;  2LSO A;  1H9T A;  1KZH A;  1T2K A;  4BHB A;  3L2Q A;  4A2U A;  2Q2E B;  1GDT A;  4M9S A;  2HQ5 A;  2EB7 A;  3M3Y J;  4R8H A;  2DT5 A;  1ZAO A;  4YEJ A;  3RIR A;  3U2R A;  2J5O A;  1NG6 A;  5F0F A;  2R7W A;  1FT9 A;  5FKL A;  3OYI A;  1H89 C;  1TT5 B;  4CDG A;  2HFH A;  1W36 C;  4UY8 I;  2EA4 A;  1ERD A;  1B1B A;  2E5N A;  3FMQ A;  3OYB A;  3H0D A;  1DPR A;  4JOM A;  1I39 A;  3AG4 H;  5FD5 A;  4S04 A;  3K7A J;  3PNT A;  3OMY A;  2WAQ A;  3GZ6 A;  2E1M B;  3F72 A;  5EJC A;  3GZ5 A;  1BC7 C;  2HTJ A;  3BR2 A;  3BTL A;  4V2F A;  4F91 B;  3CCE I;  2CH0 A;  3DBL B;  1X4P A;  1B72 A;  2VOP A;  4GO1 A;  2NXN B;  1IZ1 A;  5EYR A;  1Y8Q B;  2GLO A;  1KU2 A;  1Z77 A;  2CQQ A;  4A3F J;  3SXY A;  1IUF A;  4BXX J;  2OV7 A;  1RIO H;  5ERI A;  4OMZ A;  2K86 A;  2XC7 A;  3W6V A;  2PLY A;  1N25 A;  4PFO A;  1L0O C;  1R5G A;  3M1C A;  2YUS A;  4LGW A;  2VBZ A;  1TLH B;  2K02 A;  4BQQ A;  4ZDP A;  1FNN A;  3LQR A;  2K9M A;  1DP3 A;  3WGI A;  4G94 A;  1RUN A;  1EA3 A;  1FX7 A;  2QSG X;  1SAU A;  1ORK A;  1WVR A;  3JRC A;  3CC2 I;  1FC3 A;  3CLQ A;  2CMP A;  2MYS A;  4HA8 A;  1ETO A;  2E1O A;  2XSD C;  2LD5 A;  4ANJ A;  3DTE A;  1XGS A;  4E7K A;  4ZDL A;  1JKO C;  2VOO A;  3ZMS A;  1YW7 A;  5IPA A;  2RKH A;  3BR0 A;  3IAM 2;  2FOW A;  4LD5 A;  1R58 A;  2FD5 A;  2JRM A;  3MFK A;  3OYJ A;  1ETK A;  3HPG A;  4XRS A;  1T33 A;  3HHG A;  1A5J A;  4CCN A;  1IRG A;  1R4M B;  4S0H B;  5BPI A;  1KON A;  3F8M A;  2BW3 B;  2QGU A;  3CME I;  1OR7 A;  1ZGA A;  4I02 A;  1ULY A;  3N4M A;  2FF4 A;  4ZTJ A;  2JA6 J;  5D5V B;  2M87 A;  1U8R A;  1RC9 A;  1WHU A;  3KZY A;  1VI0 A;  4GXO A;  3H9G A;  3SQN A;  1TWA J;  4X0G A;  1OCO H;  1JHF A;  4XSZ F;  5BOX A;  3OOP A;  4AIK A;  5CQG A;  2R7R A;  4RGR A;  1OCZ H;  1B8I A;  4P9U A;  2XAQ A;  3HB9 A;  4MQ9 F;  4DGW B;  4A0Z A;  3LFU A;  4JX6 A;  2D45 A;  2P8T A;  2WTE A;  2VPL A;  4ZYG A;  2NOJ B;  3HHH A;  3LSM A;  3MEX A;  1UEL B;  1N77 A;  1K79 A;  2AHQ A;  3MKY B;  1GT0 C;  5DCM B;  3P9C A;  3CLO A;  3WU0 A;  3CCU I;  5KHD A;  4N4O B;  1I6H J;  3TP0 A;  3MWM A;  2GXA A;  4A5M A;  1FYK A;  1AKH A;  4HF1 A;  4KT6 A;  1GVJ A;  2Y30 A;  2GXB A;  3OYD A;  1NK3 P;  2PX9 A;  4QTR A;  2XRO A;  2PG4 A;  3ERM A;  4MNU A;  2H1K A;  1SVL A;  1TQI A;  3I55 I;  2DA3 A;  2RQP A;  5JHU A;  4MLO A;  1XC5 A;  4IOC F;  3L7W A;  3LSK A;  3LA2 A;  2EA2 A;  5GAE J;  3LMM A;  2GIV A;  3JSP A;  2K4B A;  4JYK A;  4W1U A;  3PSF A;  3WU2 C;  4AM3 A;  4BNC A;  1K7A A;  3FKI J;  1D5V A;  2VJ4 A;  4HW0 A;  4UUS B;  4CUG A;  4KN7 X;  4NC6 A;  1PP8 F;  2XDV A;  3JRE A;  1X2N A;  3MAJ A;  2FXA A;  4OOI A;  2GXG A;  5IT9 Z;  3C7J A;  2XHK A;  4G12 A;  4BUP A;  1MJB A;  1KGS A;  2OTJ I;  1D1B A;  2IT0 A;  3ZMD A;  3J80 K;  2WAQ N;  2H27 A;  2V1U A;  2DK8 A;  5DUI A;  1GXQ A;  2HOA A;  1BI1 A;  2M5W A;  1U6G A;  3W2W A;  5E3M A;  1ZRD A;  5TJJ A;  4XBF A;  3V42 A;  4I7H A;  4ZJZ A;  5LLQ A;  4YIR X;  4U0V A;  2IS1 A;  3PUF A;  1S7A A;  3BT9 A;  1V3F A;  4UVA A;  1IUY A;  2KFD A;  1GV5 A;  2IGO A;  3UNG C;  3MVP A;  4EM1 A;  2NS7 A;  5HDN A;  3D5R C;  1XSX A;  4AVZ A;  2OF7 A;  4A3I J;  2AXL A;  3LWF A;  3HKZ N;  4B47 A;  3O3K A;  2LKP A;  5GTH C;  2ACJ A;  1XCB A;  3VB2 A;  2KJB A;  1B4A A;  4U0W A;  2DOF A;  1FTT A;  1RR7 A;  1ZAR A;  4BHP A;  3PO2 J;  2QA4 I;  2AS5 F;  2HXI A;  2VKE A;  3DXJ F;  2E5Z A;  2YPR A;  1TWF J;  4IRH A;  4C30 A;  1X1P A;  5HS7 A;  1TBX A;  4BU2 A;  5AIP A;  2Q2E A;  5E8G A;  2H8R A;  1STZ A;  2FNP A;  2LK2 A;  4XN3 A;  1SFU A;  3L1P A;  4WCG A;  3OOU A;  3FMS A;  1RES A;  2A5Y B;  1TQP A;  4G8X A;  3Q5F A;  3S14 J;  1L3L A;  3LSJ A;  3E5U A;  3S1Q J;  3OY9 A;  3BTI A;  3IWF A;  3CP8 A;  3FM5 A;  5FFZ A;  5J8C A;  3S2H J;  1FBS A;  3KP5 A;  2ISY A;  5HNH A;  1HW1 A;  1FTZ A;  2JWT A;  2QEX I;  2KIQ A;  5J4V A;  5M5W J;  5JVT A;  3JTG A;  5CVJ A;  2ECC A;  3RDI A;  1XSV A;  2BEO A;  4CYC B;  3T8R A;  3WTT C;  4A3C J;  1YOV B;  5F64 A;  3E6D A;  1QPM A;  3CUQ B;  2PN6 A;  3FX3 A;  2E19 A;  1XDS A;  3KP3 A;  4IHX A;  3KYL A;  2DQR A;  1SD5 A;  2R7Q A;  2COM A;  5K7H A;  2AQE A;  3N97 A;  2DTR A;  1YJN I;  2VKD A;  4EGY A;  1WSU A;  1SD6 A;  1I1S A;  1NTC A;  2ME0 A;  2A6E F;  2HOE A;  4FHT A;  2B9S A;  4E7L A;  4UUV A;  4FTH A;  3VOE A;  5DD8 A;  4ZDO A;  1UCR A;  2RNJ A;  4ENJ A;  6PAX A;  4FE4 A;  5JI6 A;  4RAF A;  4ENM A;  5DM7 F;  2CQK A;  4A3L J; 
#chains in the Genus database with same CATH homology
 3D1N I;  5DS9 A;  2LR8 A;  2Y9Y A;  5GPC A;  3TED A;  3S15 J;  3RZO J;  1MSE C;  2EH3 A;  1VF9 A;  2FX0 A;  4A93 J;  5FKN A;  2EZH A;  5IYB J;  3GTG J;  1IG7 A;  2MW8 A;  3PO3 J;  3ZQF A;  2K9N A;  5GPA A;  5F0H A;  3BR3 A;  1FIP A;  4Y52 J;  4DW6 A;  3HOZ J;  4XRS G;  4BKX A;  3JRG A;  2DA6 A;  2O8K A;  1AHD P;  2XPW A;  3CCY A;  1SAN A;  3WHB A;  4RDU A;  1VFC A;  1UHS A;  2DMT A;  2LY9 A;  1WH5 A;  2R0Q C;  2DA1 A;  1X58 A;  1RPW A;  1H8A C;  3RQI A;  2YU9 J;  2B63 J;  3HDD A;  2ZB9 A;  4HNV A;  4DYR A;  2XPV A;  2JA8 J;  2VI6 A;  5IP7 J;  1ETX A;  3K2A A;  4M3G A;  4XID A;  1IRZ A;  3FK6 A;  1WGX A;  4GFB A;  1HF0 A;  3H0G J;  3Q0U A;  5K7Z A;  1XS9 A;  1WPK A;  3HEF A;  4XRM A;  2EBI A;  2L7F P;  1YRN A;  4C3H J;  4A3E J;  4M6V A;  1JT6 A;  2PMZ N;  5EDN A;  5EGO A;  2R7Z J;  1X2M A;  1B8I B;  2VPR A;  3GTQ J;  5K7F A;  3OSG A;  2R92 J;  4FIS A;  3QQA A;  2X9D A;  2X6O A;  2QF7 A;  3ZQH A;  2M2E A;  3GTK J;  1RKT A;  4A69 C;  3UKG A;  3O8H A;  1FEX A;  3BG5 A;  2NS8 A;  1ITY A;  1RKW A;  2R5Z B;  1D5Y A;  3HM5 A;  2WB1 N;  4B4C A;  4A3D J;  4M3B A;  4D7N A;  1ZKG A;  4UUS A;  4DZP A;  1U9N A;  2R93 J;  2DJN A;  4MFD A;  3HOU J;  2CQX A;  2JMW A;  5HOD A;  4A3M J;  1GV2 A;  5DTD A;  1QVT A;  4FE7 A;  1OCT C;  4Y7N J;  1MBF A;  2DA2 A;  4C2M J;  2NVQ J;  1Y1V J;  5M3F J;  3WHC A;  4AC0 A;  5EF6 A;  3NAR A;  4B1R A;  4QSH A;  3IH2 A;  4AUX A;  5J3L A;  2JJ7 A;  3O8G A;  4IHW A;  2DA4 A;  1WCM J;  5FKM A;  1ENH A;  2EZL A;  4FCY A;  2L0K A;  1QVU A;  2EZI A;  2GBY A;  3GTO J;  2VUM J;  2DMQ A;  1BA5 A;  1CQT A;  2G0E A;  3MN2 A;  3SFI A;  3HOX J;  2R5Y B;  2XGD A;  1OCP A;  3FK7 A;  1A6I A;  3S2D J;  3DCF A;  1MSF C;  5IYD J;  4BBR J;  4AYB N;  1Z0X A;  1HDD C;  3A01 B;  3BG9 A;  2MG4 A;  3IH4 A;  3HBL A;  5IOY A;  3CMY A;  2FJ1 A;  4BY1 J;  5F08 A;  2VKV A;  2MGQ A;  2R5Z A;  3LSR A;  3CDL A;  1MBE A;  2WV1 A;  1JKP C;  4D7M A;  2HI3 A;  3JRA A;  4BY7 J;  3HOY J;  1I3Q J;  4I76 A;  4BBS J;  3S1M J;  1QRY A;  2NVY J;  3JRF A;  3QPL A;  3ZQL A;  4ABZ A;  3BG3 A;  2CJJ A;  2KT0 A;  1ZR4 A;  2M0C A;  5FKO A;  1HDP A;  5IYC J;  1MNM C;  3NAU A;  5C44 J;  4A3J J;  2IAI A;  4C3J J;  2CRG A;  2TCT A;  2MSY A;  3BTJ A;  3LOC A;  1GDT A;  2HQ5 A;  1ZGW A;  3M3Y J;  1W0T A;  3F0C A;  4CYC A;  3S16 J;  2QCO A;  5F0F A;  5EG0 B;  5FKL A;  1H89 C;  4W97 A;  1RET A;  1MBG A;  4JX5 A;  3GTL J;  1E3O C;  5IP6 A;  3DEW A;  1SFO J;  1TC3 C;  5FLM J;  2X48 A;  3Q3S A;  3K7A J;  2R5Y A;  4MIM A;  2YS9 A;  3HOV J;  1WI3 A;  5F1J A;  3SDG A;  1FIA A;  5IP9 J;  5FJ8 J;  1MBK A;  1U8B A;  2NVX J;  3BR2 A;  3BTL A;  4V2F A;  1B72 A;  5M3M J;  4M3F A;  1JJ6 C;  5EYR A;  2GLO A;  1Z77 A;  2CQQ A;  1U78 A;  4A3F J;  5EZH A;  3A01 A;  1IUF A;  4BXX J;  5E3L A;  3MKL A;  3W6V A;  4EEF G;  2GM4 A;  5BNG A;  2YUS A;  1AKH B;  2D5V A;  3IH3 A;  1K83 J;  3ZQG A;  4XIC A;  2Y9Z A;  5F27 A;  1JJ8 C;  2Y31 A;  1ORK A;  3C2B A;  2ID6 A;  5E3O A;  3JRC A;  2ELK A;  2EZK A;  1P7J A;  1ETO A;  2E1O A;  2XSD C;  2LD5 A;  2E2H J;  3G1L A;  3G1O A;  2XB5 A;  1JKO C;  5IPA A;  1BW5 A;  3BR0 A;  1UMQ A;  2XB0 X;  1F43 A;  2FD5 A;  3M4O J;  1F36 A;  1GVD A;  4JP0 A;  1ETK A;  4XRS A;  2JA5 J;  1T33 A;  1A5J A;  1QPI A;  4S0H B;  5J1R A;  1HOM A;  2XRL A;  4B3A A;  3BQY A;  3HOW J;  4LOC A;  3S17 J;  1ETY A;  2W48 A;  2JA6 J;  3I4M J;  3BR1 A;  4L5E A;  5EG0 A;  2HOS A;  1VI0 A;  1TWH J;  3HGY A;  1JUP A;  2ECB A;  2LP0 A;  1BW6 A;  5F0C A;  2I10 A;  5GP9 A;  1TWA J;  4DZJ A;  1LE8 B;  3H3V K;  3TP3 A;  1W0U A;  1PUF B;  2DMU A;  3A03 A;  5FLV A;  1B8I A;  2L9R A;  1I50 J;  3HB9 A;  4QIW N;  4JX6 A;  5F04 A;  2O7O A;  1MH4 A;  2DTZ A;  2M9H A;  5E3N A;  2HXO A;  5JLW A;  2DA5 A;  3BTC A;  2AHQ A;  1GT0 C;  4IHY A;  2Y0S N;  1IDY A;  1YRN B;  4I6Z A;  1IDZ A;  1I6H J;  3TP0 A;  2Y2Z A;  1S7E A;  3A02 A;  1AKH A;  3TW7 A;  1DU6 A;  1JKQ C;  3B6A A;  2Y30 A;  3GTP J;  1HCR A;  3ZQI A;  1G2H A;  4D5F A;  1K61 A;  1NK3 P;  2HDD A;  5M5X J;  1R9T J;  1MH3 A;  4QTR A;  2H1K A;  2JK3 A;  3JRB A;  1HLV A;  1ZR2 A;  1DU0 A;  2DA3 A;  4A3B J;  4MLO A;  1XC5 A;  1JTY A;  2FQ4 A;  4DYQ A;  1XG1 A;  1BL0 A;  2E2J J;  3BR5 A;  1MBJ A;  1ETQ A;  4JYK A;  2JN6 A;  4W1U A;  3RZD J;  1ZTR A;  1ZQ3 P;  3CQZ J;  3ZOB A;  3TW6 A;  2K9Q A;  2ME6 A;  3FKI J;  4UUS B;  1NK2 P;  2LLK A;  3S1N J;  3JRE A;  4X6A J;  1X2N A;  4MFE A;  4G12 A;  3E7L A;  2N8G A;  2M8G X;  2OPT A;  3JR9 A;  1Y1W J;  3RKQ A;  2WAQ N;  2IBD A;  1LE8 A;  5C4X J;  2HOA A;  5M5Y J;  3GBG A;  2IEK A;  1PUF A;  1Q1V A;  4X1E A;  5E3M A;  1TWG J;  4M3D A;  2DN0 A;  4C3I J;  3BT9 A;  1GV5 A;  4XK4 A;  3LSP A;  4A3K J;  1JKR C;  3ZQC A;  1APL C;  2XPU A;  3MVP A;  2TRT A;  2XGC A;  4UUT A;  2RAE A;  2LTP A;  2NS7 A;  4J19 A;  5C4J J;  1BJZ A;  2CUF A;  2CUE A;  1P7I A;  2OF7 A;  4A3I J;  4V2G A;  2K40 A;  3HKZ N;  3PM1 A;  5J1U A;  3VPR A;  5EEA A;  1JT0 A;  4NDL A;  2L7Z A;  3SJM A;  2O9L A;  2K9S A;  3GTJ J;  2KDZ A;  4DYC A;  2AO9 A;  1VND A;  1ZK8 A;  1U9O A;  2HYJ A;  2LKX A;  1LFU P;  1JUS A;  1FTT A;  1RR7 A;  1FJL A;  1IGN A;  5IOZ A;  2DMP A;  3PO2 J;  2HXI A;  2VKE A;  1POG A;  3BQZ A;  2LVS A;  1TWF J;  2HOT A;  4IHV A;  1H88 C;  2M34 A;  4JX4 A;  2NVT J;  2NOG A;  3IV5 A;  3FIS A;  2H8R A;  2LK2 A;  2JA7 J;  3GTM J;  1IC8 A;  1TWC J;  3G1M A;  1IV6 A;  3Q0W A;  3L1P A;  3OOU A;  5C3E J;  1RES A;  3OSF A;  3HGG A;  1LFB A;  3S14 J;  1GUU A;  1T56 A;  2EQR A;  3LSJ A;  3JRD A;  3S1Q J;  1MBH A;  2DA7 A;  3BTI A;  4RBO A;  4A3G J;  1AU7 A;  3S2H J;  3B6C A;  5FKK A;  3JRI A;  1FTZ A;  1O4X A;  2JWT A;  1OJL A;  2COB A;  5M5W J;  5J1Y A;  2LFB A;  2CU7 A;  2ECC A;  3LSG A;  4CYC B;  4A3C J;  3I4N J;  3BR6 A;  3S1R J;  2P81 A;  2ID3 A;  2L7M P;  2E19 A;  5JLX A;  4IHX A;  3Q0V A;  4IEJ A;  1ETW A;  5K7H A;  4D5C A;  1JUM A;  1ETV A;  2DMN A;  4M3E A;  1WH7 A;  3OIO A;  4MO7 A;  1NTC A;  2ME0 A;  1IJW C;  5EGO B;  3LNQ A;  5EZG A;  4FTH A;  2E2I J;  1OFC X;  2XGE A;  1JTX A;  4FE4 A;  3QPS A;  1UG2 A;  3FIW A;  1JGG A;  1B72 B;  4A3L J;  9ANT A;  1EF4 A;  3JRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...