5M5YJ

Rna polymerase i elongation complex 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m5yJ00
3Q3SA 3LSJA 1GV5A 1HDDC 2WV1A 3GTPJ 3HKZN 2XGCA 3HBLA 2R5ZA 2H8RA 4XRMA 2L7MP 3G1LA 5E3LA 4V2FA 1CQTA 1ORKA 2R0QC 4DZJA 1BW5A 3TW6A 2EZHA 1WH5A 1TWGJ 5DTDA 3BR6A 4C2MJ 3K2AA 1VNDA 5EGOA 1LFUP 1UHSA 4I6ZA 4RDUA 3O8GA 1TC3C 3OIOA 2HXIA 1HF0A 1W0UA 3LOCA 4BKXA 5M5WJ 2XPWA 5FKOA 2Y2ZA 2NS8A 2FJ1A 3M4OJ 3Q0UA 3BQZA 1Z77A 5FLVA 3IV5A 2HQ5A 1IRZA 4XK4A 4DYRA 3OOUA 1Y1VJ 4MLOA 3WHCA 1WI3A 2DA1A 2DMQA 3BT9A 2JN6A 2MGQA 4NDLA 4AC0A 5C4JJ 4UUSB 1G2HA 3RKQA 2O7OA 4IHYA 2M2EA 5EEAA 1PUFA 3HOWJ 2O9LA 1LFBA 1U9OA 2EZLA 4L5EA 2JA5J 1IV6A 5IOYA 1JUMA 1TWHJ 2DJNA 1APLC 4XIDA 1JT0A 1XG1A 3VPRA 1H8AC 1MBHA 1AKHB 1I3QJ 4Y52J 3BQYA 2IAIA 1FJLA 4A3DJ 5FJ8J 2EQRA 1UG2A 2LR8A 4A3BJ 9ANTA 3PM1A 4EEFG 3GBGA 3S1MJ 4A3JJ 1QRYA 5M3FJ 1MBGA 3GTQJ 1FTZA 1VI0A 1U78A 4FE4A 5F0FA 4IHVA 1S7EA 4A69C 3JRDA 2DMNA 2JMWA 4RBOA 4BBRJ 1DU0A 3BR2A 4M3BA 4I76A 1RPWA 2L0KA 3HEFA 5IYBJ 3ZQLA 1QVTA 1MBJA 4A93J 1ETOA 1GVDA 4QIWN 4A3IJ 1VF9A 1JKRC 4B1RA 2E1OA 2ID3A 2LFBA 3M3YJ 3TP0A 3GTLJ 2M0CA 4BY7J 2WAQN 2I10A 4FISA 3D1NI 3QPSA 3HOUJ 5K7HA 3TW7A 1IUFA 4V2GA 5E3OA 3JRBA 3OSFA 1B72A 1WGXA 5M5XJ 5J1RA 1U9NA 3JRHA 3GTGJ 3F0CA 2AHQA 1IG7A 2DN0A 5J1YA 2KDZA 4XRSG 1YRNA 1POGA 3S14J 4M3FA 2O8KA 2M8GX 3ZOBA 2DA7A 2IBDA 2OF7A 4W97A 4D7MA 3GTJJ 3A01A 2CQXA 5IP7J 3HGYA 2ME0A 3IH2A 2YUSA 5IOZA 3S1QJ 3CQZJ 2L7ZA 1JJ8C 1T56A 2EH3A 4AUXA 5FKLA 1GT0C 2X48A 2R7ZJ 1H89C 5EZHA 4D5CA 3SJMA 3GTMJ 1RR7A 3FIWA 3HOYJ 1MBKA 2K9NA 3HOVJ 3L1PA 3W6VA 1Z0XA 2LTPA 1D5YA 2K9QA 1FEXA 1QVUA 2Y30A 3UKGA 2HOSA 4UUTA 4M3DA 4CYCA 3MVPA 5EG0B 1X58A 2DA6A 1BA5A 1BL0A 2GM4A 3SDGA 2XRLA 4W1UA 1FIPA 1ZGWA 4A3EJ 2DA4A 2LP0A 2M34A 3PO3J 5EDNA 1JT6A 2XB0X 2LKXA 1U8BA 1XS9A 2R5ZB 5IP6A 2JA7J 2NVQJ 2DA5A 1ZR2A 2HXOA 2K40A 2K9SA 2VKEA 3PO2J 5EF6A 2E2HJ 5JLXA 3RZDJ 5IYCJ 2R92J 2N8GA 2B63J 4C3HJ 1IDZA 3LSRA 2DTZA 5EGOB 2DA2A 1LE8A 5F27A 4FE7A 1ETXA 1WPKA 5GPAA 2GBYA 2HDDA 4GFBA 4QSHA 2ME6A 1SFOJ 1QPIA 1X2NA 5DS9A 1NK2P 1T33A 2CRGA 2ECBA 3OSGA 5K7ZA 3BTLA 3A02A 3FKIJ 2E2IJ 3BG5A 1OJLA 2L7FP 2DMUA 2NS7A 5J3LA 1ETYA 4J19A 1K83J 2CUEA 2Y9YA 2EZIA 3NARA 1JTYA 3MKLA 1B8IA 4BBSJ 4M3GA 2ELKA 2VI6A 2ZB9A 1JTXA 2JA8J 3QPLA 2CUFA 4XICA 4HNVA 2YU9J 4JX4A 2GLOA 3ZQGA 4DW6A 5M5YJ 1JGGA 1ZR4A 1PUFB 3CMYA 1I50J 3HGGA 5HODA 1ENHA 2DMPA 1A5JA 1OFCX 4BY1J 4A3CJ 1ITYA 5C4XJ 3ZQCA 3H3VK 2EBIA 1RKWA 4C3JJ 2TRTA 5F0CA 3LSGA 3ZQIA 2M9HA 1IC8A 4A3LJ 3JREA 5FKKA 2EZKA 1TWFJ 3BR0A 1HDPA 3CDLA 3JRIA 2R5YA 1H88C 3JR9A 5EYRA 4M6VA 3BR5A 2P81A 5EZGA 3WHBA 3HDDA 4ABZA 3S17J 2HI3A 1P7JA 3IH3A 4QTRA 2NVXJ 4A3KJ 3NAUA 2AO9A 3Q0VA 1BJZA 1W0TA 3RZOJ 1VFCA 3C2BA 3FK7A 5E3MA 1GDTA 1NK3P 1A6IA 5IP9J 2CJJA 1TWCJ 2E2JJ 2XB5A 2FD5A 1FIAA 3GTKJ 1IDYA 3LNQA 3MN2A 5K7FA 1F43A 2D5VA 1RKTA 3QQAA 3S2DJ 2LD5A 3SFIA 3CCYA 3S2HJ 2G0EA 3TEDA 2JJ7A 3G1OA 1B72B 4BXXJ 1BW6A 3Q0WA 1DU6A 1AU7A 2LLKA 1XC5A 2MW8A 3I4MJ 1YRNB 1F36A 2FX0A 5BNGA 3B6AA 3O8HA 1ZQ3P 4S0HB 4UUSA 2HYJA 3JRCA 1UMQA 2CU7A 2XPUA 3A01B 1SANA 4IEJA 2H1KA 3K7AJ 2KT0A 1JUPA 3FISA 3BTIA 4M3EA 4DZPA 4Y7NJ 3HOZJ 1EF4A 3BG9A 3HB9A 3RQIA 3S1RJ 1GV2A 2Y9ZA 2JWTA 3IH4A 3S15J 4MFEA 1WH7A 3ZQHA 4IHXA 1FTTA 3A03A 1AKHA 4LOCA 3I4NJ 1ETWA 4AYBN 4D5FA 3GTOJ 3BTJA 3DEWA 4CYCB 2Y0SN 4C3IJ 5GPCA 2QF7A 2TCTA 4JP0A 3FK6A 4JYKA 5F0HA 5F1JA 2YS9A 4B4CA 1Y1WJ 1IGNA 3BR3A 1JJ6C 4XRSA 3H0GJ 1JUSA 1R9TJ 1GUUA 2DMTA 2COBA 1MH4A 4A3FJ 1JKPC 5GP9A 1K61A 3S1NJ 1RETA 2W48A 4MIMA 2HOTA 5FKNA 1E3OC 5E3NA 1ETKA 5C3EJ 1IJWC 3BR1A 1TWAJ 1I6HJ 1ETVA 4JX5A 4D7NA 5IPAA 1MNMC 2LVSA 2OPTA 2Y31A 1Q1VA 3DCFA 2MG4A 5F08A 3ZQFA 3JRAA 2IEKA 1MBEA 2VKVA 2LY9A 4A3MJ 1NTCA 2VUMJ 2LK2A 3LSPA 2NOGA 1LE8B 2R93J 4A3GJ 1ZTRA 2ID6A 3HOXJ 2JA6J 4MFDA 4G12A 2VPRA 1JKQC 5JLWA 3S16J 1HOMA 4MO7A 4IHWA 2NVTJ 1MH3A 5IYDJ 1RESA 2RAEA 3B6CA 1P7IA 3BG3A 1OCTC 1MBFA 1X2MA 3TP3A 1B8IB 2L9RA 1ZK8A 2DA3A 2FQ4A 2JK3A 1ZKGA 2XGEA 5FKMA 4DYQA 2CQQA 3BTCA 3G1MA 2WB1N 3HM5A 2XSDC 4FTHA 1HLVA 2HOAA 3JRFA 2X9DA 2XPVA 2QCOA 4DYCA 1JKOC 1AHDP 3E7LA 5FLMJ 5C44J 4FCYA 5F04A 1MSFC 5M3MJ 4X1EA 1HCRA 5EG0A 1ETQA 2PMZN 2E19A 1WCMJ 2X6OA 1OCPA 4B3AA 2MSYA 1O4XA 3JRGA 2R5YB 2ECCA 4X6AJ 4JX6A 2XGDA 1MSEC 2NVYJ 5J1UA
chains in the Genus database with same CATH superfamily
1Y56A 3LSJA 1GV5A 2WY7Q 3LSIA 4F93B 3GTPJ 3VFZA 1TL8A 4A0YA 2XGCA 1R6RA 4Q48A 1G4DA 3WGGA 4GCVA 4GDFA 4PJJA 3H9GA 4V2FA 3WU1B 4E7JA 1FT9A 2WAFA 2BVMA 4LJZF 1WH5A 2IS4A 4BYYA 4CCKA 1RUOA 1VQ5I 4GYIA 3K2AA 1FBSA 1MDMB 4ZH4F 5EGOA 2V1NA 4HEA2 2MD0A 4B09A 3D5SC 4E7IA 1LFUP 5HLIA 2JVHA 4NC7A 3ZMZA 3L2WA 4FQGA 2QVOA 4ASNA 3CJQB 4BKXA 2XPWA 3CJRB 1MMNA 1FYLA 2ETHA 3CCMI 5IT9Z 2AXLA 3Q0UA 3S2WA 1ZGJA 5FLVA 3LQRA 4XR6A 2DJIA 2I8DA 2VASA 3HXLA 4X0GA 4P9UA 3K1NA 2P5KA 4YRVA 2M7BA 3BCBA 1WI3A 4EM0B 4XLCA 3OIQA 3OYAA 4IJAA 4AC0A 4NDLA 5C4JJ 1Y8QB 2KJCA 4L5JA 3CCQI 2W82A 5K5RA 2O7OA 1RRJA 2OTJI 3HOWJ 1LDJA 4PSWA 2KZGA 4KMUX 4L5EA 2JA5J 1IV6A 1OR7C 1YW8A 1YQAA 5LHHA 1D0ZA 1G59A 1XG1A 2LKSA 2VOOA 3DBLB 3I71A 1MJAA 3BPVA 2IAIA 4II3A 1X1DA 3OIPA 5HOOA 3IRQA 4LB5A 6PAXA 2V79A 4A3BJ 2L4MA 2FMYA 3KX2A 2F4OB 4HV5A 3ASNH 4RLQA 5ICCA 5LEKA 3EPZA 4G6TB 4M72A 4A0ZA 2IA2A 3L7WA 3UNGC 1R71A 2TDXA 2V4JC 3AG2H 4TV7A 3ZR8X 4IVNA 4NQWB 2A6TA 4A69C 3JRDA 2DMNA 2JMWA 2V9PA 3EYYA 2EV5A 3DPTA 4BBRJ 3OYDA 2D1HA 3PUBA 3BROA 3GZ5A 3EQLF 3CF5F 1RPWA 4XOTA 4CXFA 3GCMA 2K4JA 3CP2A 3ZQLA 4L9VA 3TDZC 1MBJA 4L9TA 1GVDA 4E7HA 3KIOA 3VSKA 3WGHA 1T98A 2ID3A 3WG9A 2LFBA 1WJFA 3TP0A 3KZYA 3GTLJ 4HOBA 5FLXZ 2DFIA 2DT6A 5D8LB 1NG7A 1J59A 2ISZA 3HOUJ 2HU9A 1R5HA 5K7HA 3TW7A 5HVQC 2EIMH 2M5WA 2VXDA 5FO5A 3OSFA 2CW0F 4M6YA 4WXHA 2X6YA 3JRHA 3GTGJ 1BI0A 2MABA 2OA4A 3LQQA 1IG7A 2DN0A 1QGPA 1USSA 3I0TA 2K7LA 2WAEA 5ILVA 1Z3YA 2KKOA 1YOVB 3CLQA 2NOJB 3E6MA 4M3FA 1HKTA 1XSXA 2A5YB 2M8GX 4IRIA 2ZFUA 3K70C 4GGGA 3A01A 1O3RA 1HA8A 2ME0A 2H6BA 1BN5A 2NAZA 2E35A 2YUSA 3H5AA 2X4HA 4KMFA 4BE1A 5FKLA 4IKFA 3CUQB 1G3YA 4D5CA 4IOAF 1ZAOA 2FE3A 3FIWA 3HOYJ 1P4XA 1MBKA 4JOMA 4A0XA 3B02A 1X4PA 3CZ6A 2DODA 4WF2A 3A0BC 2KPMA 4B44A 3OYMA 2E36A 3H3UA 3OV8A 1DGRM 2HYFA 2CYYA 5JFRA 4XM3A 2VL8A 2MBFA 2O03A 1MJBA 2A69F 1UHMA 1XMAA 4C9YA 1OLTA 2E5NA 2M87A 2QGUA 2RQPA 1R36A 3KEQA 3HOTA 4LK1F 4A3EJ 1KONA 3REOA 3J80Z 1PJRA 4G7ZF 1E17A 3BJOA 3CDIA 2XB0X 2FBKA 4IO9F 4U87A 1D5VA 2R5ZB 4M9XA 2LREA 3KP6A 1E3HA 3EUAA 1ZR2A 2E71A 1B9NA 2ISYA 2M1BA 1LNWA 1WJCA 4Z2YA 4AWXB 4BL0B 2DTZA 3F3XA 2Q0OA 5F27A 2ZBKA 1ETXA 1QPIA 3WG7H 2QBYB 3HOSA 3OSGA 5HLTA 4BQAA 1D8KA 1EV7A 2RDPA 2RVCA 3NWSA 4AVPA 2ZXWH 3RYPA 2KRHA 4EJOA 1F5TA 4BAYA 2HQAA 4HAMA 2PBIA 1K83J 2CUEA 2JPBA 4AM3A 1JTYA 5L3EA 4RB1A 4OIOF 2ELKA 1CF7B 1USTA 2CQ7A 2DI3A 2ZB9A 2JSPA 1ZH5A 1KA8A 3I55I 1W4MA 3DQVC 4XICA 2QQ8A 3ZN0A 2D1VA 4DW6A 1YS6A 1I3AA 1OCCH 1JI8A 1FP1D 3HGGA 1ENHA 1TBXA 3RKWA 1OFCX 4A3CJ 3F8BA 1Q1HA 5J4VA 4KIBA 3H3VK 2EBIA 3ULQB 3T8RA 4G7HF 4IZZA 4KICA 5F0CA 3LSGA 1SMYF 3ZQIA 1IC8A 4QPOA 3SQNA 3CCEI 3V42A 4CGZA 1VQOI 1HDPA 1HSTA 2R5YA 1IXSB 4M6VA 2KIQA 4BNCA 2K02A 1WRJA 3HC7A 1ERDA 1KZHA 1P7JA 2F5CA 4Q5SF 3IH3A 4ON0A 3I3LA 3K4KA 3ELKA 2FBHA 3G71I 3Q0VA 3SZTA 5K5OA 2JRMA 1W0TA 4DBRA 4EMSA 5F1RA 3EUHC 1F9NA 4H0EA 3C2BA 3FK7A 1Z3XA 4A12A 4KIGA 1MDMA 3BJ6A 3S32A 3FDYA 2KIFA 4D0PA 3TKYA 1U5TB 5D6FA 3AL0C 2VOPA 1SFXA 2FD5A 1S6LA 1TNTA 4BDZA 4CO8A 3LNQA 1T2KA 3WTXC 2D5VA 3LA3A 3QQAA 4L9JA 2LD5A 5GADJ 3TEDA 2JRTA 2QYOA 2L3DA 3CJTB 2IGOA 1UAAA 4BXXJ 2Z3YA 2LBFB 3K4JA 1DU6A 3DU6A 3HSEA 3HIFA 2VB6A 3OYHA 4F91B 4PSXA 4ESBA 3RPQA 3P9CA 4S0HB 2XSJC 2HYJA 3DKXA 3E6BA 1IZ1A 4PUSA 5HNFA 3TO9A 4I0BA 2CU7A 3JTGA 3PNVA 2BBYA 2KT0A 2PJRB 5DYMA 3BTIA 4M3EA 2VQLA 2VONA 1PP8F 1XCVA 2VQHA 1TW3A 4HLXA 3ZMVA 2BXZA 3IH4A 4UXNA 4MFEA 1WH7A 5J47A 3ABTA 1G3SA 3K4BA 3HL2A 4K2EA 5CJ9A 3C3WA 3FHNA 1IRXA 4LMYA 4LOCA 4KYWA 1ETWA 4UNOA 1UG0A 3BLYA 3GYHX 1E0EA 2XKOA 2EFPA 3VYSB 4CYCB 4NUBA 5FRMA 3VOEA 1YG2A 2R7XA 4JP0A 4JYKA 1WI9A 1DGWY 3M7GA 5F1JA 2R7UA 1HSJA 3R4KA 2VBXA 2ESHA 4B4CA 4RM2A 3BR3A 2ZJRF 3HRTA 3L2QA 2V9VA 4NQWA 4LLLA 2DMTA 3BC8A 2Y0SA 5GAEJ 3GWZA 5GP9A 3AG4H 2OAZA 3PUFA 1VZ0A 3O3KA 2W48A 3ROUA 3CP8A 4F55A 2EA2A 3GFJA 1ETKA 1E3OC 3VYUB 1K4SA 3KPHA 3CCVI 1LEAA 3BR1A 3LSMA 4JX5A 2BY0A 1S9HA 5IPAA 1KU3A 2VE9A 3LAPA 2LVSA 2Y31A 3E3VA 2GIZA 2F5FA 3S93A 3R60A 4MTDA 2DO7A 3K0LA 3GLLA 4RB2C 3DLLF 3GUDA 2YX4A 3LSPA 2NOGA 4YFNF 3GFIA 1E2XA 2ZMEB 1WVRA 1OCOH 1T0FC 5IY5H 1ZTRA 5E1WA 2KRCA 3HOXJ 2JA6J 1VQNI 1WJAA 4I01A 3KP4A 1BOAA 5E18F 4Q4ZF 2HTJA 1S8NA 3QP6A 1MH3A 1RESA 1X1BA 3B6CA 3BG3A 1R58A 1OCTC 2BY2A 4MTEA 1H0MA 3TP3A 2VBWA 2RREA 3COAC 2KDOA 3FXRA 3BZCA 3RIRA 3ZCOA 3EYIA 4AIKA 1ZK8A 4KFCA 3O6BB 2DA3A 4LLNA 2CW7A 5JR3A 2JK3A 4NHJA 3CCLI 2LC2A 4II2A 2CQQA 4RLFA 3BTCA 1B59A 3DU5A 3FXKA 2VPLA 3CUQA 3HM5A 5CVVA 5EEGA 2ESNA 5AIQA 4RAGA 3VB2A 3IL2A 1XSDA 1K78B 5FB2A 2RNJA 2XPVA 1AHDP 2R7SA 3OR2C 4FCYA 3PIOF 2DT7B 2DFHA 2OZ6A 2ZSHB 4U0WA 4ZTJA 2X6OA 2Z5UA 4B3AA 3FM3A 4HF2A 2MSYA 1XMXA 3JTHA 2OUMA 2ECCA 3QYFA 4XLHA 4JX6A 4X6AJ 2GIVA 2NVYJ 4ZYGA 4YIIA 5J1UA 1ON2A 3Q3SA 1HDDC 5EEHA 1TNSA 4LD5A 4XSZF 1I1SA 2AXTC 4L0YB 2R5ZA 2LKPA 2Q8KA 2K3PA 3PSIA 3HTSB 2JQ7A 5TRDA 2A05A 5E3LA 2DDBA 1YYVA 3RYRA 3ZQ7A 2R0QC 1BW5A 4AD9A 3TW6A 3LA7A 3W6KB 4CUGA 1MZBA 4O3MA 3HKZA 3BR6A 2O3FA 3E97A 1VNDA 4PFPA 2LDUA 1UHWA 1UHSA 3K1MA 4I6ZA 3O8GA 4Y4RA 1V5FA 2VT2A 3IHUA 3OIOA 3LOCA 2QBYA 1OYIA 3VYTB 5M5WJ 1G3WA 2L5QA 2ZJPF 2NS8A 3JAMZ 3F6OA 2FJ1A 3IP4B 4BHCA 4PJNA 1LDKB 3NWTA 2UXNA 4XRFA 3N97A 3RTRA 3IUOA 4XK4A 5DCMB 4DYRA 2M45A 5JHFA 2LSOA 3T1BA 2CW8A 3RPUA 3QP5A 1GXQA 1CF7A 1MMDA 4HA8A 5B1AH 2E7XA 1VQ9I 3IC7A 5H20A 1BM9A 2MGQA 4KDPA 5B3SH 4ZZLA 2R7QA 5ERIA 2HPMA 4UY8I 5EJCA 1SAUA 1IRGA 4BS9A 2JPCA 1A31A 2M2EA 2BEOA 4ZC3A 2QKMB 2EZLA 3V8KA 2NNNA 1MW7A 3N4MA 2FF4A 2BV6A 3MZ8A 1TWHJ 4F52A 1J75A 4LFUA 4HRIA 3RKXA 1JT0A 1U2WA 3VPRA 4XN3A 2P5LC 1AKHB 4EJTA 1HW1A 4HNUA 4Y52J 3DKWA 1RC9A 2JZYA 3BQYA 3FXJA 2ELJA 5FJ8J 2GA2A 9ANTA 5J6XA 2NVUB 1GLNA 1R1VA 3S1MJ 4A3JJ 3K4NA 5M3FJ 2NS0A 4ESJA 2X51A 1FTZA 1VI0A 4XSXF 1W1WE 4P9FA 3MQ0A 1STZA 2XF5A 4FE4A 2OCEA 4HG2A 1FYKA 2EIKH 3ML6A 1YITI 1SEUA 2GA1A 4GO1A 2K27A 1WFXA 4ZDPA 3BR2A 4A6DA 2AS5F 2DQLA 1T6SA 2CUJA 1MMGA 1TQMA 2WBMA 2R7VA 1X4OA 4WX9A 1XPXA 3HEFA 1QU3A 3OYNA 1U5TA 4ZDLA 2XDVA 3PSFA 2E1OA 4O5VA 1VQLI 2DQRA 2HQNA 4XL9A 2P7CB 4RM3A 1FSHA 2M0CA 2A07F 1BIAA 4MQ9F 2XHKA 2F2EA 5DD4A 1ZELA 3SFZA 4G8XA 2P6SA 3D1NI 3MEXA 4V2GA 2IA1A 2FBIA 1JHFA 3W3CA 4IX7A 5J1RA 3KFWX 1IN4A 2LBFA 4A2UA 4XLAA 2ZKZA 2KZVA 2WAQA 5ILSA 2KDZA 1S72I 4KIFA 2BY1A 3S14J 2OD5A 1BR4A 4L9NA 2E1NA 2O8KA 1Z67A 3ISPA 5JHUA 4UVAA 4DNCA 1JGSA 2DFEA 4HDVA 1QO0D 4P1WA 1EA3A 3KCCA 3OYFA 3ZMSA 2PMZA 3IH2A 4I02A 5LEJA 4PFOA 2CWEA 4HSRA 4Z6YA 3S1QJ 4HX7A 1JJ8C 2PJRA 5F6FA 2V1XA 1EH8A 1J5YA 2IGNA 1GT0C 4J00A 2HVSA 5EZHA 4OAYA 3SJMA 3OYEA 3TOBA 2MH9A 2XKPA 2UUZA 3K4CA 4HPQA 3ZMUA 4EGZA 4QLCU 1ZYRF 2HEOA 2GZWA 3UR3C 3L1PA 2LTPA 1D5YA 2J5PA 2K9QA 1SD4A 2PMHA 1QVUA 3CCSI 2F6CA 1FEXA 3UKGA 2A68F 3N05A 4AIHA 1X3WB 1YIOA 3DTIA 4CYCA 3MVPA 5EG0B 2DA6A 1SD5A 1QA6A 3QPHA 4HV6A 2ZC2A 4B43A 3ASOH 2EA4A 4ZJZA 2BOLA 3JCUC 2LP0A 2QSFX 2I5UA 5BMZA 1KU7A 1BOBA 1YW9A 3ECOA 1RZ4A 5LGNA 2LKXA 2DK5A 2RKHA 1K79A 1XS9A 1YFHA 2ADUA 3PQJA 2ZFWA 1B4AA 1G8XA 2K9SA 2XAJA 4LK0F 2ACJA 3CTAA 2HDWA 3ABMH 3K70D 1AOYA 4OIQF 4LG0B 2R92J 1V55H 2N8GA 3RJPA 3ABKH 1DQUA 1XGNA 3HHHA 3PL8A 3KZIC 1C0WA 1R4NB 2ZMEA 4FE7A 4BEHA 2CV2A 1WPKA 2IGKA 2ME6A 1SFOJ 1K6OA 3AAFA 1WHUA 4P5OA 2VXZA 2ECBA 4PJ0C 5A2QZ 2P6TA 4RGRA 3A02A 3BY6A 1U0JA 3FXUA 2WADA 5ICGA 2DMUA 4KUMA 2Y9YA 5D4SA 2PN6A 1OYYA 2ZNYA 2IT0A 1YI2I 2JA8J 1YO5C 3QPLA 2DLLA 3EETA 1MD0A 3P9KA 5DDGA 4R8HA 4LGWA 1JGGA 3DLAA 3HSFA 2Z16A 4Y3OA 1K78A 2DMPA 5HDGA 2JSCA 4UV8A 4BY1J 3J81Z 1OYWA 3CC2I 3BG6A 4I99C 1RKWA 1I39A 3L2UA 3F8FA 2TRTA 2VIXA 2L02A 2H6CA 2DTRA 4F92B 1QPMA 1X3ZB 2DYSH 3MKZA 3AL0B 4OU0A 1VQMI 1FBUA 5FKKA 1G3TA 1HKSA 1KU2A 5B1BH 3AFHA 1O57A 1N78A 2VODA 1H88C 3JR9A 1P4AA 4IRHA 3BR5A 1O7FA 3DTEA 2FOWA 5LRRA 1YX3A 1WZ2A 3S17J 3HUGB 4FHTA 2XIGA 2GXGA 4QWQA 2BHYA 2MLKA 4MGRA 4HQMA 1QQIA 1BJZA 3RI4A 3ZXSA 4BQQA 3QU6A 4CCNA 2HOEA 1SD6A 5LGUA 2VQCA 3DBHB 3FM5A 2KIUA 3SEZA 2WA0A 1GDTA 1P2FA 1R7JA 1A6IA 5DM6F 3DPUA 5IT3A 1IV8A 2AQEA 4PGHA 5AONA 3TMOA 3H9QA 2LY2A 4BQOA 3GZNB 3CC4I 1IDYA 1VQKI 2IP2A 3MN2A 1F43A 1Y8RB 3ESWB 5H2FC 3OYLA 4BJTA 1RKTA 2F5EA 3CCYA 2G0EA 2MC3A 2HZTA 3WTYC 5DCMA 3OL3A 1GVJA 1EH6A 1IXCA 2BGCA 3Q0WA 3ZP5A 1AU7A 1MKMA 1R00A 3I4MJ 3E6DA 4L18B 1ONVA 2XAGA 4GRIA 1Y0UA 5LBQA 1F36A 1LQ1A 1YRNB 1I6XA 3O8HA 1X1PA 1Y39A 1D1CA 1UMQA 4MNUA 2OC6A 5HLGA 2XPUA 1OMIA 1Z6RA 4U0VA 3GZ6A 4Y13A 3LL7A 2H1LA 2Z99A 4JQFA 4DZPA 2GOXB 3HOZJ 1MNEA 2K85A 2M0MA 3LFUA 3RQIA 3SZPA 3S1RJ 2VBYA 1YHQI 1W5SA 2NYXA 1UFMA 1WSUA 3TO6A 4IHXA 5H6QA 2JTVA 3JW4A 3RQ4A 1AKHA 1FOYA 2CFXA 4FASD 4DIQA 5L3GA 5ICEA 3I4NJ 4OMZA 4D5FA 4DBQA 4CCJA 3BTJA 1FC3A 2UV1A 3OWTA 2TCTA 1Y0NA 3FK6A 4BUPA 3HSRA 5LD2C 2E60A 4P96A 1VTNC 1D0YA 2VE8A 3WTVC 4AYBA 3H0GJ 4CCMA 1T39A 1GUUA 3ERMA 1MH4A 1KGSA 1JKPC 4L0ZB 1FYMA 2QKLB 4MHGA 2LY1A 1K61A 2V1UA 2XF6A 4IQJA 3IKVA 4E7KA 2HOTA 2EPFA 2MFZA 3ONQA 5FKNA 2H27A 5C3EJ 1IJWC 2C6YA 4N0BA 1TWAJ 1I6HJ 2GXAA 1J2XA 2VBZA 1Q1VA 3LSTA 3ZQFA 2IEKA 1MBEA 4ENJA 2F5VA 2YX7A 4YEJA 4A3MJ 3K6GA 4YELA 2EV6A 1FLIA 5BQTA 4YIFA 2KIMA 1TLHB 4MQVA 5HDKA 2ID6A 1VQ7I 3GXOA 4V19K 3GLXA 1FP2A 1JKQC 4CZZA 4ZYDA 1MGTA 1HOMA 3DEEA 3SYTA 4C2TA 5IYDJ 1HW2A 1XCBA 2DK8A 2CQKA 2FMLA 3SXYA 1VQ4I 4CA0A 2KL4A 1JHHA 3U1DA 1QHHD 2W24A 2FQ4A 1ZKGA 2FU4A 2HVRA 2V26A 3E5QA 3LSKA 5HS9A 2XSDC 3R61A 4XBFA 4CCOA 2X6XA 3C1DA 1HLVA 3DKYA 2X9DA 4DYCA 3QOPA 2XAFA 3E7LA 5FLMJ 1O7LA 3KETA 2RC4A 3TBIA 2WC2A 3TOAA 2R3SA 5E20A 4BU2A 1MNDA 2EFOA 4E7ZA 1EJ9A 2WB1A 3FMSA 5EG0A 1EH7A 5CVRA 2PMZN 3PJRA 3IKTA 2E34A 2XF7A 1O4XA 1XGSA 4KISA 3HPHA 3CC7I 3OYKA 2XGDA 4ENNA 2Y75A 4HZFA 1ZHFA 2EIJH 4Y17A 3V7RA 4BXUA 2WV1A 5FRNA 4G6QA 4BACA 3GEZA 2J5OA 1SAXA 2CG4A 2EINH 1FX7A 1SC7A 3W2VA 5HS8A 1RR8C 1CQTA 2PEXA 4LB6B 3GFLA 5IT9K 2OJED 1W5CC 3MKYB 2VJJA 1YIJI 4LG0A 4YFKF 1TP4A 1TWGJ 2ZXJA 2FRHA 3CDHA 5DTDA 1K6YA 2EK5A 2KJBA 2P4WA 4R1HA 2OU2A 3MMYB 2DPUA 2IJLA 1R5GA 4RDUA 4ENMA 4XQFA 1BI2A 5D5UB 3HTUA 2A6EF 2HXIA 1TZLA 1W0UA 2PI0A 2DU9A 2BYVE 1DPRA 2Y2ZA 4KT5C 3ZN1A 3J7ZI 4UVBA 5FD6A 4BDYA 3BQZA 1Z77A 4O6JA 3IV5A 1G6NA 4G9YA 2V6CA 2RV8A 1ON1A 1BI1A 2RQQA 1UZCA 3I59B 2EFNA 2G7HA 3CMMA 3M8EA 1Y1VJ 4MLOA 2DA1A 2UXXA 1IF1A 3CUQC 2VQGA 3QWLA 3LSHA 3BT9A 3H1CA 2JN6A 4EM1A 2BHZA 3HHGA 1G2HA 4PGGA 3RKQA 5L3CA 1H9GA 3DV8A 3F6VA 5EEAA 4IHYA 4M71A 1LFBA 1U9OA 3MZHA 3KP5A 2LNBA 1PDNC 4WWCA 4F3QA 5IOYA 1JUMA 1IRFA 4U0YA 1HXDA 1APLC 4XKVA 3E1SA 2K4BA 1D8JA 3OS1A 1H8AC 1IN8A 4XLFA 1I3QJ 3V8JA 2R7WA 4A3DJ 2PG4A 1Z21A 3RKYA 3CJNA 2EQRA 2LR8A 4C2UA 3IWZA 1FSEA 4EEFG 3PFYA 1RNLA 2H94A 3HUGA 1MBGA 3GTQJ 1U78A 1MJ9A 2R7OA 4PCQA 1DDNA 5FD5A 3CUOA 3MAJA 3ZGKA 4CCLA 1KQ8A 5F0FA 5DM7F 5FLXK 1S7EA 2LG4A 1D1AA 1S7AA 5GAGJ 4RBOA 2GAUA 1DU0A 3BZKA 2OQRA 4UB8C 4I76A 1F4KA 3OY9A 2YPRA 1S5LC 1QVTA 4ZZDA 4A93J 1ETOA 1KU9A 2H09A 4QIWN 4A3IJ 3A4CA 4B1RA 2XC7A 2XUBA 2VKHA 1BIBA 4LLGF 5JI6A 3KEYA 5E1ZB 1IUFA 1A35A 3BZ6A 5B5EC 3CLOA 3JSOA 1U9NA 1XDUA 3F0CA 2AHQA 2L9VA 2STTA 4XRSG 1YRNA 3LWFA 1V5GA 4EJVA 2IBDA 1K7AA 2FSWA 4D7MA 1IN6A 3GTJJ 3CESA 2CQXA 2HNHA 3HGYA 4RMNA 2QSGX 4UV9A 3ZPLA 5IOZA 2YR2A 3F8NA 2CFOA 4XLNF 2WTEA 2X48A 2DBBA 3G6EI 1FOXA 2ZXHA 1A04A 3GTMJ 3IAM2 1VQ6I 1YTYA 5L3FA 3J80K 2NRAC 3B73A 4PDKA 1QBJA 4BHBA 1BR2A 2Q1ZB 1LVAA 2A61A 4CYDA 3W6VA 4MEXF 3H5NA 2MA3A 4BH9A 5L3BA 2HOSA 1J7KA 4M3DA 3G2BA 5H6RA 5J8CA 4PK4A 4HLYA 1X58A 1BA5A 1B6AA 1FWZA 4RB0A 1T0FA 4N9HA 1BL0A 1DP3A 2MD5A 4XKWA 2ELHA 2PJPA 1ZGWA 2X85A 3PIPF 2D45A 4ANJA 2F4IA 2M34A 1J09A 3I5UA 2E1MC 3RSNA 5EDNA 2PFBA 3W2WA 3OYBA 3PNTA 3R6SA 1BC7C 2CV1A 2Q2EB 2IPQX 4M73A 3WE2A 4B8XA 2X1EA 2JA7J 3C2HA 1U5TC 5IP6A 2W1OA 2DA5A 1Z1DA 5FGMA 3KEOA 4PJLA 2K40A 2VKEA 2JA2A 5LFAA 3PO2J 4CICA 3OS2A 5EF6A 3Q5FA 3NQOA 2R7FA 4LITA 2DFFA 2E2HJ 1OKRA 5IYCJ 3ZMTA 3CCRI 2B63J 1IDZA 3LSRA 3TO7A 2FA5A 1OCRH 4HYEA 2DOFA 1R49A 5GPAA 2GBYA 1Z9CA 2HDDA 4QSHA 1YJNI 4GFBA 3OYGA 5DS9A 2CRGA 2CV0A 2IS6A 2VLAA 2K86A 5J40A 4BJ6C 3BTLA 2E2IJ 3BG5A 1T08B 2UWMA 3AG3H 5DCFA 2NXNB 1W5TA 2HGCA 1XSVA 5DUIA 3QOEA 1ETYA 1FMWA 2JT1A 4G7OF 2IW5A 1X19A 3NARA 3MKLA 1LFPA 1JXSA 2DW4A 1JTXA 4HF1A 3OR1C 3J7AO 1Z7UA 1ZREA 2CUFA 2YU9J 4NB5A 4EJUA 2GLOA 2PLYA 3ZQGA 3KE2A 5M5YJ 2V1DA 1ZR4A 1PUFB 3CMYA 5HODA 4R79A 1FY7A 5J4YA 2BXYA 2QENA 2HDCA 5DD8A 3T5XA 1ITYA 5KHDA 3ZQCA 1IXRC 1ZGAA 1A6QA 4YFXF 1BI3A 4DQ2A 4CZCA 2M9HA 1SFEA 4XNFA 1REPC 2EILH 3PQKA 2EZKA 1FZPB 2XASA 1TWFJ 3BR0A 4HX4A 1D3YA 4OINF 2E1CA 4CHUA 5EYRA 2P81A 1W36C 4KN7X 3HDDA 3D5RC 3T8TA 4ABZA 2O8XA 2DDAA 2HI3A 5E8GA 4ENKA 1QZEA 4QTRA 4EM2A 3H3ZA 1YS7A 2LH9A 3RZOJ 1ULYA 1XD7A 3E5UA 3LFKA 3LMMA 4UB6C 3T0YA 1VFCA 5E3MA 1WKMA 1JE8A 1NK3P 5CVIA 2OCCH 3WU2C 3WTWC 2XAUA 3IAS2 1LJ9A 3J7YJ 1ZG1A 4WK8F 2D2WA 5JVGF 1S29A 5IP9J 1TWCJ 2K3FA 2M4KA 3H0DA 1T38A 2XB5A 1X1AA 4UUVA 2VJ4A 3GTKJ 4I7HA 3E0JB 3F8MA 5K7FA 5CVJA 1HC8A 4KN4X 4S05A 3S2DJ 3FBNB 3SFIA 3V4GA 1BBYA 5B66C 3G1OA 1B72B 3I59A 1ZN2A 5HNHA 2Y0MA 2LF8A 3C7JA 3FMQA 4RA2A 3P7NA 4FX4A 1I27A 3A2KA 3K1PA 1PUEE 2FX0A 2X1DA 3B6AA 1ODDA 2ZCWA 3FMRA 3JRCA 2PX9A 2ZJ2A 1YLFA 2VJ5A 3K4LA 3GX4X 4YG2F 4IPAA 2H1KA 3K7AJ 2PQ8A 4YIRX 2B9SA 1XX5A 2V9KA 1YJWI 1LB2A 2MYSA 2JVGA 1EF4A 3BG9A 1VQPI 4IRGA 2Y9ZA 2JWTA 4IQ4A 1V4RA 3S15J 2JUGA 3ZQHA 2QQ9A 1TW2A 3AG1H 3ZRGA 1UB9A 2RNGA 2R7RA 2ZSIB 3GTOJ 3HJEA 2GQQA 4XN0A 3DEWA 4XOPA 3CD6I 3FF5A 2Y0SN 2EJRA 2W4SA 2W7NA 1Y6IA 3F22A 2FQ3A 5DEQA 4RGSA 2IGMA 1JJ6C 1K4TA 3BDDA 4XRSA 4GYGA 2HKOA 2COBA 3VWBA 4A3FJ 2HKXA 4DGWB 1O3SA 3TL4X 3S1NJ 4U88A 1RIOH 1RETA 1UJ8A 5L3DA 1AA7A 2CMPA 2E7WA 3L00A 2WWYA 1IAWA 5LHIA 3H5RA 4XKBA 1ETVA 5F08A 3DCFA 2B7EA 2MG4A 3FZVA 4BHPA 4KA4A 3S3NA 2FNAA 1Z7LA 3HZJA 4AU7A 2LY9A 1B9MA 1YX5A 1NTCA 4NNJA 2Y48A 2VUMJ 3OOPA 4RAFA 2QEXI 1LE8B 2V7FA 3DP7A 2QA4I 1E3PA 1XN7A 1L3LA 4RB3C 2R93J 3M1EA 4WXCA 2JUCA 3R0AA 3R0JA 1N75A 2VPRA 3S16J 2P7VB 3Q9SA 1DP7P 3L9FA 5DUKA 4N9IA 3CCJI 4MO7A 4IHWA 3F23A 3FBIB 2NVTJ 2IXSA 4F7ZA 3H35A 4GXOA 1P7IA 3L2RA 1MBFA 1PP7U 3HG9A 1X2MA 2P0WA 1B8IB 2IVMA 2L9RA 1ZLJA 2O5RA 4P55A 1LUJB 4KITB 3VODA 2K5CA 2Z2SB 2ZNZA 4RAZA 1WQ2A 3F72A 4FTHA 2QQBA 2F5DA 2F4MB 5BS6A 3JRFA 3NRVA 2QCOA 3KP2A 4HSTA 3M07A 3TGNA 3WODF 1Z05A 1BJAA 5M3MJ 4KJZA 1TQPA 4X1EA 1HCRA 3TDUC 2LYCA 5D6EA 4BXFA 1OISA 1OR7A 2V6EA 1YE9A 2IRFG 1P9QC 2ICWG 2XV4S 3JRGA 2EFWA 4Q47A 3VYRB 3HRMA 3IRRA 4N4NB 2Y69H 4RS8A 2BZTA 1QZYA 5CQGA 1BC8C 2HFHA 4IHSA 2Q2EA 2HS5A 4RAYA 2YU3A 3HKZN 2H8RA 3HBLA 3SEQA 4AIJA 1R1UA 2KHMA 3F9KA 4D1QA 4XRMA 3F8CA 4XKCA 2HVQA 2L7MP 3G1LA 3MD2A 3JAMK 1ORKA 1SFKA 4HQEA 3MCZA 4DZJA 1TTYA 4KT6A 1W7PB 1XTAA 4BE2A 2A6HF 4OAZA 2EZHA 3M9AA 3E6CC 2W85A 1YJ9I 4IF4A 4C2MJ 3M1CA 3X2QH 5KAFC 1TC3C 1SFUA 1FNNA 3GF2A 1HF0A 2Z9OA 1UCRA 2BW3B 2A3SA 2X0LA 3I4PA 4FX0A 5FKOA 1S3JA 1RUNA 1ZRDA 3BPXA 1U6GA 5GTHC 3M4OJ 3FX3A 2HQ5A 1IRZA 1IN5A 2MLGA 3MFKA 3OOUA 4I98B 3S3MA 3D5LA 3DWLE 4WXDA 2OBPA 1FOWA 2L4AA 3WHCA 4ZYHA 2KFDA 2DMQA 1KQ9A 3KLOA 2P5VA 3I58A 3OYIA 5LRSA 4UUSB 2EWNA 1QHGA 1NH3A 2LRDA 3CMAI 5BOXA 5ILUA 1PUFA 2HWVA 4FETA 2O9LA 4C30A 3VDXA 2W00A 3KZZA 5FFXA 1ZLKA 3W2AA 2DJNA 1LDDA 3SZGA 5ED4A 4XIDA 1ZG3A 4ESFA 1R22A 2VKDA 4PJMA 1SD7A 4E7SA 3GVAA 1MBHA 2STWA 1YW7A 1MMSA 2FXAA 4OOIA 5ICFA 4ZYAA 2ZJQF 2IS1A 1Z6TA 2L54A 3KLNA 5CLSA 5CYVA 1M1EB 4OMYA 1FJLA 2B0LA 3BG7A 5E1XA 5KAIC 1GHCA 1UG2A 2M3AA 3DXJF 2UZKA 3BCAA 3PM1A 3GBGA 3FHZA 1QRYA 2XAHA 4S04A 4M74A 2KMUA 3C18A 2O6GE 5TGTA 1P6RA 3WU0A 2GWRA 4N4OB 4HF0A 2VC0A 1VQ8I 4IHVA 2QLZA 4L5IA 1XMKA 5FFZA 2CUZA 2R4GA 2CS3A 1LKXA 4M3BA 1TT5B 2W25A 1F1ZA 5LGTA 3ABLH 1NG6A 5TISC 3W6JB 2L0KA 5IYBJ 2HR3A 3ABUA 1ZG5A 2R7DA 2OV7A 1VF9A 1JKRC 1W7PD 4G94A 4QPQA 3FWEA 2Z33A 1O3TA 3M3YJ 2NNYA 1QNTA 3H36A 3QAHA 4BY7J 1LPQA 2WAQN 2DAOA 2I10A 4FISA 1V5EA 3DF8A 3QPSA 2DYRH 5D5WB 5E3OA 1AWCA 1ZARA 5HS7A 3JRBA 3FXOA 2P8TA 1B72A 1OCZH 1WGXA 5M5XJ 4LIVA 1RI7A 3DTKA 2VJIA 3MZYA 5J1YA 2RGVA 1POGA 2Z1DA 3E5XA 4BGDA 3GMEA 3ZOBA 2DA7A 2LMDA 3BWGA 2OF7A 2YSRA 2E1MB 4W97A 1MIJA 5IP7J 3OMYA 2MH2A 3JSPA 2LOOA 1X1CA 4IOCF 3WTSC 3CQZJ 2L7ZA 1T56A 2EH3A 1A36A 3QU3A 4NBQA 4AUXA 2R7ZJ 3WTTC 1H89C 1RR7A 4OWRB 3LAJA 4E4HA 1HBXG 3DFGA 2K9NA 3HOVJ 3K2ZA 3WTZA 3CMEI 5KNLA 3S3OA 1Z0XA 5GTIC 5GAHJ 2Y30A 1J0RA 4UUTA 2DXIA 4NC6A 2OQGA 2GM4A 1P4WA 3SDGA 2XRLA 1FPQA 2M4GA 3Q9VA 4W1UA 5D8KB 3H9JA 1FIPA 3VSLA 4CDGA 2DA4A 3LA2A 1FBQA 4CSWA 1WJ5A 3AKZA 3PO3J 1DPUA 3RPUD 5JVTA 1R23A 1JT6A 2ZXIA 4E7LA 2OZUA 3HPGA 2DCEA 1GXPA 3KYDB 1XB4A 3PNYA 1SVMA 5KK1A 1U8BA 2WV0A 2QM3A 2NVQJ 2ZO4A 2AQFA 1OPCA 1IN7A 2HXOA 1WJDA 5D5VB 5A2QK 2W57A 3K69A 2E5ZA 3WGIA 5CVUA 5JLXA 2DT5A 4B47A 3RZDJ 3EUHA 1U3EM 3FXMA 4C3HJ 1CGPA 5EGOB 2DA2A 3I53A 1O3QA 1LE8A 3K9TA 5TJJA 3ECHA 3G73A 1X2NA 4M9SA 1NK2P 2KISA 1T33A 3CCUI 4J01A 1MSEC 4KNYA 3QYBA 1BR1A 2L9SA 5K7ZA 2HYGD 3FKIJ 1OJLA 1SVOA 2EB7A 1FOKA 4E6KG 2L7FP 2FUG2 2KQRA 1XGMA 2G7UA 2EV0A 3QRFF 5KVRA 2NS7A 5J3LA 3J81K 4J19A 1N77A 1KYWA 3V7SA 2EZIA 2M7AA 5DV5A 3S8PA 1B8IA 2VN2A 3DPLC 4BBSJ 4M3GA 2VI6A 2IS2A 1D1BA 2FNPA 4NC8A 4PZJA 3K10A 3IWFA 2DOEA 4HNVA 2HPIA 2RN7A 3QPTA 4JX4A 3CO6C 4ZTFA 4Y15A 1R1TA 2XROA 1I50J 1A5JA 4IHTA 4HDUA 2CH0A 2K9MA 2XAQA 3HRUA 3U9GA 5C4XJ 3OL4A 3DBRB 4BE0A 2GOMA 4C3JJ 4BEHB 1IO2A 3DEUA 2VC1A 4IXAA 4XLPF 4A3LJ 2O61A 3JREA 5CKTA 3U2RA 2BY3A 4HX8A 1ZRCA 1PVEA 3CDLA 3JRIA 3RDIA 4UVCA 4ZDOA 2R7TA 2CSOA 5EZGA 5CPRB 3WHBA 2EFQA 1IW7F 5FROA 3OYCA 2IA0A 3L09A 3I54A 3NEUA 2NVXJ 2FEZA 4A3KJ 4LG3A 3NAUA 3RCOA 3VEPA 4DOZA 2AO9A 3M8JA 5LLQA 1X3UA 3M8FA 1LVKA 4EJWA 3ZMDA 2HZDA 1XDSA 3TQNA 3HRSA 1W7PA 4I09A 1NHAA 3GFMA 4U7BA 3QYEA 5K5QA 2BE5F 2VT3A 4EQQA 1P92A 2CJJA 3D0SA 2WY8Q 1T8IA 2E2JJ 1LEBA 3G3ZA 3A0HC 1OQYA 2LF7A 1FIAA 2BW3A 2L01A 4D9JA 1V54H 3OS0A 3I9V2 4I2OA 3BJAA 4XORA 4IL6C 3ERED 4RGXA 3S2HJ 2X1CA 1N25A 2JJ7A 1Z91A 4B3XA 2BVLA 3PFIA 1L0OC 1PYVA 1BW6A 3C2GA 4EATA 4EVIA 3EUKL 4UHTA 2LLKA 1FMVA 1XC5A 4JBAA 2MW8A 4XONA 4A5NA 1I1GA 2XGXA 2W84A 5BNGA 1ZQ3P 4H4KC 2QZ8A 3CF2A 4UUSA 4ITVA 3ZQQA 4DJAA 4XLEA 2L9NA 1W36D 5AIPA 3P9IA 3A01B 3CO7C 1R4MB 2CQNA 3A1YA 1SANA 2QQAA 4IEJA 4Y33A 3I56I 5LHGA 3WTUC 4EGYA 2DPDA 1JUPA 3FISA 4Y7NJ 1S7OA 3WE3A 3HB9A 3G4SI 3V7CA 1D0XA 5CQEA 1GV2A 1U8RA 4E70A 1T95A 4HBLA 1FTTA 5BPDA 3A03A 5D4RA 1V3FA 2QWWA 3FKJA 4AYBN 3HYIA 4LIUA 3H92A 4FT8A 4XMYA 5BPIA 1KYZA 1WJBA 2MC4A 3BOQA 4C3IJ 5GPCA 2G9WA 4CH7A 3FXQA 2QF7A 2L2OA 3V8LA 1HW5A 2X6WA 5F0HA 5HLHA 1XGOA 2YS9A 1R5ID 5E79C 4HW0A 2FOKA 1Y1WJ 1IGNA 1ZRFA 2HQRA 2H8WA 1JUSA 1H9TA 3KYLA 2M8EA 1R9TJ 3MKWB 3U21A 1UELB 3O2PE 1WWXA 4ETSA 1I5ZA 4G6DA 1MMAA 1TQIA 2KP6A 4MIMA 2XVCA 1TT0A 3BP8A 5E3NA 4I0AA 4OIPF 2F48A 4U7DA 3OYJA 3K4MA 4D7NA 1MNMC 3KYCB 3L2CA 2OPTA 3JRAA 3GO5A 4A6EA 4EV0A 2M30A 2VKVA 2CGPA 3F21A 4HNTA 4JK1X 2LK2A 2KRFA 4B48A 2XRNA 3MWMA 1HKQA 2OTLI 4A3GJ 4MFDA 4G12A 1SVLA 5JLWA 1ACIA 4M9ZA 4OIRF 3U1KA 2KLOA 3QODA 4AVZA 1QZZA 2PMUA 2RAEA 5J8FA 1WJEA 3KP7A 4M6XA 1EKEA 3KP3A 1HQCA 4ZYEA 4WCGA 2COMA 3EDPA 1DUXC 5HDNA 2XGEA 5FKMA 2DOAA 4DYQA 3GW2A 3G1MA 2WB1N 5F64A 2HOAA 2A5WA 2GXBA 3P5JA 2L7KA 1JKOC 4BJ5C 5KCMA 5C44J 3SDBA 2ZMEC 4RGUA 2QUFA 5F04A 2CO5A 3SHFA 1MSFC 4MEYF 2K9LA 1J9IA 3J7AY 5D5XB 1ETQA 4A5MA 1KQ0A 2E19A 2HTSA 1WCMJ 1OCPA 3L2VA 3FXLA 3I64A 5E8IA 5K1YA 1B1BA 5E17F 4AIDA 1SMTA 2R5YB 2QSHX 2O0YA 4BQNA 1IUYA
chains in the Genus database with same CATH topology
3Q3SA 3LSJA 1GV5A 1HDDC 2WV1A 3GTPJ 3HKZN 2XGCA 3HBLA 2R5ZA 2H8RA 4XRMA 2L7MP 3G1LA 5E3LA 4V2FA 1CQTA 1ORKA 2R0QC 4DZJA 1BW5A 3TW6A 2EZHA 1WH5A 1TWGJ 5DTDA 3BR6A 4C2MJ 3K2AA 1VNDA 5EGOA 1LFUP 1UHSA 4I6ZA 4RDUA 3O8GA 1TC3C 3OIOA 2HXIA 1HF0A 1W0UA 3LOCA 4BKXA 5M5WJ 2XPWA 5FKOA 2Y2ZA 2NS8A 2FJ1A 3M4OJ 3Q0UA 3BQZA 1Z77A 5FLVA 3IV5A 2HQ5A 1IRZA 4XK4A 4DYRA 3OOUA 1Y1VJ 4MLOA 3WHCA 1WI3A 2DA1A 2DMQA 3BT9A 2JN6A 2MGQA 4NDLA 4AC0A 5C4JJ 4UUSB 1G2HA 3RKQA 2O7OA 4IHYA 2M2EA 5EEAA 1PUFA 3HOWJ 2O9LA 1LFBA 1U9OA 2EZLA 4L5EA 2JA5J 1IV6A 5IOYA 1JUMA 1TWHJ 2DJNA 1APLC 4XIDA 1JT0A 1XG1A 3VPRA 1H8AC 1MBHA 1AKHB 1I3QJ 4Y52J 3BQYA 2IAIA 1FJLA 4A3DJ 5FJ8J 2EQRA 1UG2A 2LR8A 4A3BJ 9ANTA 3PM1A 4EEFG 3GBGA 3S1MJ 4A3JJ 1QRYA 5M3FJ 1MBGA 3GTQJ 1FTZA 1VI0A 1U78A 4FE4A 5F0FA 4IHVA 1S7EA 4A69C 3JRDA 2DMNA 2JMWA 4RBOA 4BBRJ 1DU0A 3BR2A 4M3BA 4I76A 1RPWA 2L0KA 3HEFA 5IYBJ 3ZQLA 1QVTA 1MBJA 4A93J 1ETOA 1GVDA 4QIWN 4A3IJ 1VF9A 1JKRC 4B1RA 2E1OA 2ID3A 2LFBA 3M3YJ 3TP0A 3GTLJ 2M0CA 4BY7J 2WAQN 2I10A 4FISA 3D1NI 3QPSA 3HOUJ 5K7HA 3TW7A 1IUFA 4V2GA 5E3OA 3JRBA 3OSFA 1B72A 1WGXA 5M5XJ 5J1RA 1U9NA 3JRHA 3GTGJ 3F0CA 2AHQA 1IG7A 2DN0A 5J1YA 2KDZA 4XRSG 1YRNA 1POGA 3S14J 4M3FA 2O8KA 2M8GX 3ZOBA 2DA7A 2IBDA 2OF7A 4W97A 4D7MA 3GTJJ 3A01A 2CQXA 5IP7J 3HGYA 2ME0A 3IH2A 2YUSA 5IOZA 3S1QJ 3CQZJ 2L7ZA 1JJ8C 1T56A 2EH3A 4AUXA 5FKLA 1GT0C 2X48A 2R7ZJ 1H89C 5EZHA 4D5CA 3SJMA 3GTMJ 1RR7A 3FIWA 3HOYJ 1MBKA 2K9NA 3HOVJ 3L1PA 3W6VA 1Z0XA 2LTPA 1D5YA 2K9QA 1FEXA 1QVUA 2Y30A 3UKGA 2HOSA 4UUTA 4M3DA 4CYCA 3MVPA 5EG0B 1X58A 2DA6A 1BA5A 1BL0A 2GM4A 3SDGA 2XRLA 4W1UA 1FIPA 1ZGWA 4A3EJ 2DA4A 2LP0A 2M34A 3PO3J 5EDNA 1JT6A 2XB0X 2LKXA 1U8BA 1XS9A 2R5ZB 5IP6A 2JA7J 2NVQJ 2DA5A 1ZR2A 2HXOA 2K40A 2K9SA 2VKEA 3PO2J 5EF6A 2E2HJ 5JLXA 3RZDJ 5IYCJ 2R92J 2N8GA 2B63J 4C3HJ 1IDZA 3LSRA 2DTZA 5EGOB 2DA2A 1LE8A 5F27A 4FE7A 1ETXA 1WPKA 5GPAA 2GBYA 2HDDA 4GFBA 4QSHA 2ME6A 1SFOJ 1QPIA 1X2NA 5DS9A 1NK2P 1T33A 2CRGA 2ECBA 3OSGA 5K7ZA 3BTLA 3A02A 3FKIJ 2E2IJ 3BG5A 1OJLA 2L7FP 2DMUA 2NS7A 5J3LA 1ETYA 4J19A 1K83J 2CUEA 2Y9YA 2EZIA 3NARA 1JTYA 3MKLA 1B8IA 4BBSJ 4M3GA 2ELKA 2VI6A 2ZB9A 1JTXA 2JA8J 3QPLA 2CUFA 4XICA 4HNVA 2YU9J 4JX4A 2GLOA 3ZQGA 4DW6A 5M5YJ 1JGGA 1ZR4A 1PUFB 3CMYA 1I50J 3HGGA 5HODA 1ENHA 2DMPA 1A5JA 1OFCX 4BY1J 4A3CJ 1ITYA 5C4XJ 3ZQCA 3H3VK 2EBIA 1RKWA 4C3JJ 2TRTA 5F0CA 3LSGA 3ZQIA 2M9HA 1IC8A 4A3LJ 3JREA 5FKKA 2EZKA 1TWFJ 3BR0A 1HDPA 3CDLA 3JRIA 2R5YA 1H88C 3JR9A 5EYRA 4M6VA 3BR5A 2P81A 5EZGA 3WHBA 3HDDA 4ABZA 3S17J 2HI3A 1P7JA 3IH3A 4QTRA 2NVXJ 4A3KJ 3NAUA 2AO9A 3Q0VA 1BJZA 1W0TA 3RZOJ 1VFCA 3C2BA 3FK7A 5E3MA 1GDTA 1NK3P 1A6IA 5IP9J 2CJJA 1TWCJ 2E2JJ 2XB5A 2FD5A 1FIAA 3GTKJ 1IDYA 3LNQA 3MN2A 5K7FA 1F43A 2D5VA 1RKTA 3QQAA 3S2DJ 2LD5A 3SFIA 3CCYA 3S2HJ 2G0EA 3TEDA 2JJ7A 3G1OA 1B72B 4BXXJ 1BW6A 3Q0WA 1DU6A 1AU7A 2LLKA 1XC5A 2MW8A 3I4MJ 1YRNB 1F36A 2FX0A 5BNGA 3B6AA 3O8HA 1ZQ3P 4S0HB 4UUSA 2HYJA 3JRCA 1UMQA 2CU7A 2XPUA 3A01B 1SANA 4IEJA 2H1KA 3K7AJ 2KT0A 1JUPA 3FISA 3BTIA 4M3EA 4DZPA 4Y7NJ 3HOZJ 1EF4A 3BG9A 3HB9A 3RQIA 3S1RJ 1GV2A 2Y9ZA 2JWTA 3IH4A 3S15J 4MFEA 1WH7A 3ZQHA 4IHXA 1FTTA 3A03A 1AKHA 4LOCA 3I4NJ 1ETWA 4AYBN 4D5FA 3GTOJ 3BTJA 3DEWA 4CYCB 2Y0SN 4C3IJ 5GPCA 2QF7A 2TCTA 4JP0A 3FK6A 4JYKA 5F0HA 5F1JA 2YS9A 4B4CA 1Y1WJ 1IGNA 3BR3A 1JJ6C 4XRSA 3H0GJ 1JUSA 1R9TJ 1GUUA 2DMTA 2COBA 1MH4A 4A3FJ 1JKPC 5GP9A 1K61A 3S1NJ 1RETA 2W48A 4MIMA 2HOTA 5FKNA 1E3OC 5E3NA 1ETKA 5C3EJ 1IJWC 3BR1A 1TWAJ 1I6HJ 1ETVA 4JX5A 4D7NA 5IPAA 1MNMC 2LVSA 2OPTA 2Y31A 1Q1VA 3DCFA 2MG4A 5F08A 3ZQFA 3JRAA 2IEKA 1MBEA 2VKVA 2LY9A 4A3MJ 1NTCA 2VUMJ 2LK2A 3LSPA 2NOGA 1LE8B 2R93J 4A3GJ 1ZTRA 2ID6A 3HOXJ 2JA6J 4MFDA 4G12A 2VPRA 1JKQC 5JLWA 3S16J 1HOMA 4MO7A 4IHWA 2NVTJ 1MH3A 5IYDJ 1RESA 2RAEA 3B6CA 1P7IA 3BG3A 1OCTC 1MBFA 1X2MA 3TP3A 1B8IB 2L9RA 1ZK8A 2DA3A 2FQ4A 2JK3A 1ZKGA 2XGEA 5FKMA 4DYQA 2CQQA 3BTCA 3G1MA 2WB1N 3HM5A 2XSDC 4FTHA 1HLVA 2HOAA 3JRFA 2X9DA 2XPVA 2QCOA 4DYCA 1JKOC 1AHDP 3E7LA 5FLMJ 5C44J 4FCYA 5F04A 1MSFC 5M3MJ 4X1EA 1HCRA 5EG0A 1ETQA 2PMZN 2E19A 1WCMJ 2X6OA 1OCPA 4B3AA 2MSYA 1O4XA 3JRGA 2R5YB 2ECCA 4X6AJ 4JX6A 2XGDA 1MSEC 2NVYJ 5J1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3S A;  3LSJ A;  1GV5 A;  1HDD C;  2WV1 A;  3GTP J;  3HKZ N;  2XGC A;  3HBL A;  2R5Z A;  2H8R A;  4XRM A;  2L7M P;  3G1L A;  5E3L A;  4V2F A;  1CQT A;  1ORK A;  2R0Q C;  4DZJ A;  1BW5 A;  3TW6 A;  2EZH A;  1WH5 A;  1TWG J;  5DTD A;  3BR6 A;  4C2M J;  3K2A A;  1VND A;  5EGO A;  1LFU P;  1UHS A;  4I6Z A;  4RDU A;  3O8G A;  1TC3 C;  3OIO A;  2HXI A;  1HF0 A;  1W0U A;  3LOC A;  4BKX A;  5M5W J;  2XPW A;  5FKO A;  2Y2Z A;  2NS8 A;  2FJ1 A;  3M4O J;  3Q0U A;  3BQZ A;  1Z77 A;  5FLV A;  3IV5 A;  2HQ5 A;  1IRZ A;  4XK4 A;  4DYR A;  3OOU A;  1Y1V J;  4MLO A;  3WHC A;  1WI3 A;  2DA1 A;  2DMQ A;  3BT9 A;  2JN6 A;  2MGQ A;  4NDL A;  4AC0 A;  5C4J J;  4UUS B;  1G2H A;  3RKQ A;  2O7O A;  4IHY A;  2M2E A;  5EEA A;  1PUF A;  3HOW J;  2O9L A;  1LFB A;  1U9O A;  2EZL A;  4L5E A;  2JA5 J;  1IV6 A;  5IOY A;  1JUM A;  1TWH J;  2DJN A;  1APL C;  4XID A;  1JT0 A;  1XG1 A;  3VPR A;  1H8A C;  1MBH A;  1AKH B;  1I3Q J;  4Y52 J;  3BQY A;  2IAI A;  1FJL A;  4A3D J;  5FJ8 J;  2EQR A;  1UG2 A;  2LR8 A;  4A3B J;  9ANT A;  3PM1 A;  4EEF G;  3GBG A;  3S1M J;  4A3J J;  1QRY A;  5M3F J;  1MBG A;  3GTQ J;  1FTZ A;  1VI0 A;  1U78 A;  4FE4 A;  5F0F A;  4IHV A;  1S7E A;  4A69 C;  3JRD A;  2DMN A;  2JMW A;  4RBO A;  4BBR J;  1DU0 A;  3BR2 A;  4M3B A;  4I76 A;  1RPW A;  2L0K A;  3HEF A;  5IYB J;  3ZQL A;  1QVT A;  1MBJ A;  4A93 J;  1ETO A;  1GVD A;  4QIW N;  4A3I J;  1VF9 A;  1JKR C;  4B1R A;  2E1O A;  2ID3 A;  2LFB A;  3M3Y J;  3TP0 A;  3GTL J;  2M0C A;  4BY7 J;  2WAQ N;  2I10 A;  4FIS A;  3D1N I;  3QPS A;  3HOU J;  5K7H A;  3TW7 A;  1IUF A;  4V2G A;  5E3O A;  3JRB A;  3OSF A;  1B72 A;  1WGX A;  5M5X J;  5J1R A;  1U9N A;  3JRH A;  3GTG J;  3F0C A;  2AHQ A;  1IG7 A;  2DN0 A;  5J1Y A;  2KDZ A;  4XRS G;  1YRN A;  1POG A;  3S14 J;  4M3F A;  2O8K A;  2M8G X;  3ZOB A;  2DA7 A;  2IBD A;  2OF7 A;  4W97 A;  4D7M A;  3GTJ J;  3A01 A;  2CQX A;  5IP7 J;  3HGY A;  2ME0 A;  3IH2 A;  2YUS A;  5IOZ A;  3S1Q J;  3CQZ J;  2L7Z A;  1JJ8 C;  1T56 A;  2EH3 A;  4AUX A;  5FKL A;  1GT0 C;  2X48 A;  2R7Z J;  1H89 C;  5EZH A;  4D5C A;  3SJM A;  3GTM J;  1RR7 A;  3FIW A;  3HOY J;  1MBK A;  2K9N A;  3HOV J;  3L1P A;  3W6V A;  1Z0X A;  2LTP A;  1D5Y A;  2K9Q A;  1FEX A;  1QVU A;  2Y30 A;  3UKG A;  2HOS A;  4UUT A;  4M3D A;  4CYC A;  3MVP A;  5EG0 B;  1X58 A;  2DA6 A;  1BA5 A;  1BL0 A;  2GM4 A;  3SDG A;  2XRL A;  4W1U A;  1FIP A;  1ZGW A;  4A3E J;  2DA4 A;  2LP0 A;  2M34 A;  3PO3 J;  5EDN A;  1JT6 A;  2XB0 X;  2LKX A;  1U8B A;  1XS9 A;  2R5Z B;  5IP6 A;  2JA7 J;  2NVQ J;  2DA5 A;  1ZR2 A;  2HXO A;  2K40 A;  2K9S A;  2VKE A;  3PO2 J;  5EF6 A;  2E2H J;  5JLX A;  3RZD J;  5IYC J;  2R92 J;  2N8G A;  2B63 J;  4C3H J;  1IDZ A;  3LSR A;  2DTZ A;  5EGO B;  2DA2 A;  1LE8 A;  5F27 A;  4FE7 A;  1ETX A;  1WPK A;  5GPA A;  2GBY A;  2HDD A;  4GFB A;  4QSH A;  2ME6 A;  1SFO J;  1QPI A;  1X2N A;  5DS9 A;  1NK2 P;  1T33 A;  2CRG A;  2ECB A;  3OSG A;  5K7Z A;  3BTL A;  3A02 A;  3FKI J;  2E2I J;  3BG5 A;  1OJL A;  2L7F P;  2DMU A;  2NS7 A;  5J3L A;  1ETY A;  4J19 A;  1K83 J;  2CUE A;  2Y9Y A;  2EZI A;  3NAR A;  1JTY A;  3MKL A;  1B8I A;  4BBS J;  4M3G A;  2ELK A;  2VI6 A;  2ZB9 A;  1JTX A;  2JA8 J;  3QPL A;  2CUF A;  4XIC A;  4HNV A;  2YU9 J;  4JX4 A;  2GLO A;  3ZQG A;  4DW6 A;  5M5Y J;  1JGG A;  1ZR4 A;  1PUF B;  3CMY A;  1I50 J;  3HGG A;  5HOD A;  1ENH A;  2DMP A;  1A5J A;  1OFC X;  4BY1 J;  4A3C J;  1ITY A;  5C4X J;  3ZQC A;  3H3V K;  2EBI A;  1RKW A;  4C3J J;  2TRT A;  5F0C A;  3LSG A;  3ZQI A;  2M9H A;  1IC8 A;  4A3L J;  3JRE A;  5FKK A;  2EZK A;  1TWF J;  3BR0 A;  1HDP A;  3CDL A;  3JRI A;  2R5Y A;  1H88 C;  3JR9 A;  5EYR A;  4M6V A;  3BR5 A;  2P81 A;  5EZG A;  3WHB A;  3HDD A;  4ABZ A;  3S17 J;  2HI3 A;  1P7J A;  3IH3 A;  4QTR A;  2NVX J;  4A3K J;  3NAU A;  2AO9 A;  3Q0V A;  1BJZ A;  1W0T A;  3RZO J;  1VFC A;  3C2B A;  3FK7 A;  5E3M A;  1GDT A;  1NK3 P;  1A6I A;  5IP9 J;  2CJJ A;  1TWC J;  2E2J J;  2XB5 A;  2FD5 A;  1FIA A;  3GTK J;  1IDY A;  3LNQ A;  3MN2 A;  5K7F A;  1F43 A;  2D5V A;  1RKT A;  3QQA A;  3S2D J;  2LD5 A;  3SFI A;  3CCY A;  3S2H J;  2G0E A;  3TED A;  2JJ7 A;  3G1O A;  1B72 B;  4BXX J;  1BW6 A;  3Q0W A;  1DU6 A;  1AU7 A;  2LLK A;  1XC5 A;  2MW8 A;  3I4M J;  1YRN B;  1F36 A;  2FX0 A;  5BNG A;  3B6A A;  3O8H A;  1ZQ3 P;  4S0H B;  4UUS A;  2HYJ A;  3JRC A;  1UMQ A;  2CU7 A;  2XPU A;  3A01 B;  1SAN A;  4IEJ A;  2H1K A;  3K7A J;  2KT0 A;  1JUP A;  3FIS A;  3BTI A;  4M3E A;  4DZP A;  4Y7N J;  3HOZ J;  1EF4 A;  3BG9 A;  3HB9 A;  3RQI A;  3S1R J;  1GV2 A;  2Y9Z A;  2JWT A;  3IH4 A;  3S15 J;  4MFE A;  1WH7 A;  3ZQH A;  4IHX A;  1FTT A;  3A03 A;  1AKH A;  4LOC A;  3I4N J;  1ETW A;  4AYB N;  4D5F A;  3GTO J;  3BTJ A;  3DEW A;  4CYC B;  2Y0S N;  4C3I J;  5GPC A;  2QF7 A;  2TCT A;  4JP0 A;  3FK6 A;  4JYK A;  5F0H A;  5F1J A;  2YS9 A;  4B4C A;  1Y1W J;  1IGN A;  3BR3 A;  1JJ6 C;  4XRS A;  3H0G J;  1JUS A;  1R9T J;  1GUU A;  2DMT A;  2COB A;  1MH4 A;  4A3F J;  1JKP C;  5GP9 A;  1K61 A;  3S1N J;  1RET A;  2W48 A;  4MIM A;  2HOT A;  5FKN A;  1E3O C;  5E3N A;  1ETK A;  5C3E J;  1IJW C;  3BR1 A;  1TWA J;  1I6H J;  1ETV A;  4JX5 A;  4D7N A;  5IPA A;  1MNM C;  2LVS A;  2OPT A;  2Y31 A;  1Q1V A;  3DCF A;  2MG4 A;  5F08 A;  3ZQF A;  3JRA A;  2IEK A;  1MBE A;  2VKV A;  2LY9 A;  4A3M J;  1NTC A;  2VUM J;  2LK2 A;  3LSP A;  2NOG A;  1LE8 B;  2R93 J;  4A3G J;  1ZTR A;  2ID6 A;  3HOX J;  2JA6 J;  4MFD A;  4G12 A;  2VPR A;  1JKQ C;  5JLW A;  3S16 J;  1HOM A;  4MO7 A;  4IHW A;  2NVT J;  1MH3 A;  5IYD J;  1RES A;  2RAE A;  3B6C A;  1P7I A;  3BG3 A;  1OCT C;  1MBF A;  1X2M A;  3TP3 A;  1B8I B;  2L9R A;  1ZK8 A;  2DA3 A;  2FQ4 A;  2JK3 A;  1ZKG A;  2XGE A;  5FKM A;  4DYQ A;  2CQQ A;  3BTC A;  3G1M A;  2WB1 N;  3HM5 A;  2XSD C;  4FTH A;  1HLV A;  2HOA A;  3JRF A;  2X9D A;  2XPV A;  2QCO A;  4DYC A;  1JKO C;  1AHD P;  3E7L A;  5FLM J;  5C44 J;  4FCY A;  5F04 A;  1MSF C;  5M3M J;  4X1E A;  1HCR A;  5EG0 A;  1ETQ A;  2PMZ N;  2E19 A;  1WCM J;  2X6O A;  1OCP A;  4B3A A;  2MSY A;  1O4X A;  3JRG A;  2R5Y B;  2ECC A;  4X6A J;  4JX6 A;  2XGD A;  1MSE C;  2NVY J;  5J1U A; 
#chains in the Genus database with same CATH topology
 1Y56 A;  3LSJ A;  1GV5 A;  2WY7 Q;  3LSI A;  4F93 B;  3GTP J;  3VFZ A;  1TL8 A;  4A0Y A;  2XGC A;  1R6R A;  4Q48 A;  1G4D A;  3WGG A;  4GCV A;  4GDF A;  4PJJ A;  3H9G A;  4V2F A;  3WU1 B;  4E7J A;  1FT9 A;  2WAF A;  2BVM A;  4LJZ F;  1WH5 A;  2IS4 A;  4BYY A;  4CCK A;  1RUO A;  1VQ5 I;  4GYI A;  3K2A A;  1FBS A;  1MDM B;  4ZH4 F;  5EGO A;  2V1N A;  4HEA 2;  2MD0 A;  4B09 A;  3D5S C;  4E7I A;  1LFU P;  5HLI A;  2JVH A;  4NC7 A;  3ZMZ A;  3L2W A;  4FQG A;  2QVO A;  4ASN A;  3CJQ B;  4BKX A;  2XPW A;  3CJR B;  1MMN A;  1FYL A;  2ETH A;  3CCM I;  5IT9 Z;  2AXL A;  3Q0U A;  3S2W A;  1ZGJ A;  5FLV A;  3LQR A;  4XR6 A;  2DJI A;  2I8D A;  2VAS A;  3HXL A;  4X0G A;  4P9U A;  3K1N A;  2P5K A;  4YRV A;  2M7B A;  3BCB A;  1WI3 A;  4EM0 B;  4XLC A;  3OIQ A;  3OYA A;  4IJA A;  4AC0 A;  4NDL A;  5C4J J;  1Y8Q B;  2KJC A;  4L5J A;  3CCQ I;  2W82 A;  5K5R A;  2O7O A;  1RRJ A;  2OTJ I;  3HOW J;  1LDJ A;  4PSW A;  2KZG A;  4KMU X;  4L5E A;  2JA5 J;  1IV6 A;  1OR7 C;  1YW8 A;  1YQA A;  5LHH A;  1D0Z A;  1G59 A;  1XG1 A;  2LKS A;  2VOO A;  3DBL B;  3I71 A;  1MJA A;  3BPV A;  2IAI A;  4II3 A;  1X1D A;  3OIP A;  5HOO A;  3IRQ A;  4LB5 A;  6PAX A;  2V79 A;  4A3B J;  2L4M A;  2FMY A;  3KX2 A;  2F4O B;  4HV5 A;  3ASN H;  4RLQ A;  5ICC A;  5LEK A;  3EPZ A;  4G6T B;  4M72 A;  4A0Z A;  2IA2 A;  3L7W A;  3UNG C;  1R71 A;  2TDX A;  2V4J C;  3AG2 H;  4TV7 A;  3ZR8 X;  4IVN A;  4NQW B;  2A6T A;  4A69 C;  3JRD A;  2DMN A;  2JMW A;  2V9P A;  3EYY A;  2EV5 A;  3DPT A;  4BBR J;  3OYD A;  2D1H A;  3PUB A;  3BRO A;  3GZ5 A;  3EQL F;  3CF5 F;  1RPW A;  4XOT A;  4CXF A;  3GCM A;  2K4J A;  3CP2 A;  3ZQL A;  4L9V A;  3TDZ C;  1MBJ A;  4L9T A;  1GVD A;  4E7H A;  3KIO A;  3VSK A;  3WGH A;  1T98 A;  2ID3 A;  3WG9 A;  2LFB A;  1WJF A;  3TP0 A;  3KZY A;  3GTL J;  4HOB A;  5FLX Z;  2DFI A;  2DT6 A;  5D8L B;  1NG7 A;  1J59 A;  2ISZ A;  3HOU J;  2HU9 A;  1R5H A;  5K7H A;  3TW7 A;  5HVQ C;  2EIM H;  2M5W A;  2VXD A;  5FO5 A;  3OSF A;  2CW0 F;  4M6Y A;  4WXH A;  2X6Y A;  3JRH A;  3GTG J;  1BI0 A;  2MAB A;  2OA4 A;  3LQQ A;  1IG7 A;  2DN0 A;  1QGP A;  1USS A;  3I0T A;  2K7L A;  2WAE A;  5ILV A;  1Z3Y A;  2KKO A;  1YOV B;  3CLQ A;  2NOJ B;  3E6M A;  4M3F A;  1HKT A;  1XSX A;  2A5Y B;  2M8G X;  4IRI A;  2ZFU A;  3K70 C;  4GGG A;  3A01 A;  1O3R A;  1HA8 A;  2ME0 A;  2H6B A;  1BN5 A;  2NAZ A;  2E35 A;  2YUS A;  3H5A A;  2X4H A;  4KMF A;  4BE1 A;  5FKL A;  4IKF A;  3CUQ B;  1G3Y A;  4D5C A;  4IOA F;  1ZAO A;  2FE3 A;  3FIW A;  3HOY J;  1P4X A;  1MBK A;  4JOM A;  4A0X A;  3B02 A;  1X4P A;  3CZ6 A;  2DOD A;  4WF2 A;  3A0B C;  2KPM A;  4B44 A;  3OYM A;  2E36 A;  3H3U A;  3OV8 A;  1DGR M;  2HYF A;  2CYY A;  5JFR A;  4XM3 A;  2VL8 A;  2MBF A;  2O03 A;  1MJB A;  2A69 F;  1UHM A;  1XMA A;  4C9Y A;  1OLT A;  2E5N A;  2M87 A;  2QGU A;  2RQP A;  1R36 A;  3KEQ A;  3HOT A;  4LK1 F;  4A3E J;  1KON A;  3REO A;  3J80 Z;  1PJR A;  4G7Z F;  1E17 A;  3BJO A;  3CDI A;  2XB0 X;  2FBK A;  4IO9 F;  4U87 A;  1D5V A;  2R5Z B;  4M9X A;  2LRE A;  3KP6 A;  1E3H A;  3EUA A;  1ZR2 A;  2E71 A;  1B9N A;  2ISY A;  2M1B A;  1LNW A;  1WJC A;  4Z2Y A;  4AWX B;  4BL0 B;  2DTZ A;  3F3X A;  2Q0O A;  5F27 A;  2ZBK A;  1ETX A;  1QPI A;  3WG7 H;  2QBY B;  3HOS A;  3OSG A;  5HLT A;  4BQA A;  1D8K A;  1EV7 A;  2RDP A;  2RVC A;  3NWS A;  4AVP A;  2ZXW H;  3RYP A;  2KRH A;  4EJO A;  1F5T A;  4BAY A;  2HQA A;  4HAM A;  2PBI A;  1K83 J;  2CUE A;  2JPB A;  4AM3 A;  1JTY A;  5L3E A;  4RB1 A;  4OIO F;  2ELK A;  1CF7 B;  1UST A;  2CQ7 A;  2DI3 A;  2ZB9 A;  2JSP A;  1ZH5 A;  1KA8 A;  3I55 I;  1W4M A;  3DQV C;  4XIC A;  2QQ8 A;  3ZN0 A;  2D1V A;  4DW6 A;  1YS6 A;  1I3A A;  1OCC H;  1JI8 A;  1FP1 D;  3HGG A;  1ENH A;  1TBX A;  3RKW A;  1OFC X;  4A3C J;  3F8B A;  1Q1H A;  5J4V A;  4KIB A;  3H3V K;  2EBI A;  3ULQ B;  3T8R A;  4G7H F;  4IZZ A;  4KIC A;  5F0C A;  3LSG A;  1SMY F;  3ZQI A;  1IC8 A;  4QPO A;  3SQN A;  3CCE I;  3V42 A;  4CGZ A;  1VQO I;  1HDP A;  1HST A;  2R5Y A;  1IXS B;  4M6V A;  2KIQ A;  4BNC A;  2K02 A;  1WRJ A;  3HC7 A;  1ERD A;  1KZH A;  1P7J A;  2F5C A;  4Q5S F;  3IH3 A;  4ON0 A;  3I3L A;  3K4K A;  3ELK A;  2FBH A;  3G71 I;  3Q0V A;  3SZT A;  5K5O A;  2JRM A;  1W0T A;  4DBR A;  4EMS A;  5F1R A;  3EUH C;  1F9N A;  4H0E A;  3C2B A;  3FK7 A;  1Z3X A;  4A12 A;  4KIG A;  1MDM A;  3BJ6 A;  3S32 A;  3FDY A;  2KIF A;  4D0P A;  3TKY A;  1U5T B;  5D6F A;  3AL0 C;  2VOP A;  1SFX A;  2FD5 A;  1S6L A;  1TNT A;  4BDZ A;  4CO8 A;  3LNQ A;  1T2K A;  3WTX C;  2D5V A;  3LA3 A;  3QQA A;  4L9J A;  2LD5 A;  5GAD J;  3TED A;  2JRT A;  2QYO A;  2L3D A;  3CJT B;  2IGO A;  1UAA A;  4BXX J;  2Z3Y A;  2LBF B;  3K4J A;  1DU6 A;  3DU6 A;  3HSE A;  3HIF A;  2VB6 A;  3OYH A;  4F91 B;  4PSX A;  4ESB A;  3RPQ A;  3P9C A;  4S0H B;  2XSJ C;  2HYJ A;  3DKX A;  3E6B A;  1IZ1 A;  4PUS A;  5HNF A;  3TO9 A;  4I0B A;  2CU7 A;  3JTG A;  3PNV A;  2BBY A;  2KT0 A;  2PJR B;  5DYM A;  3BTI A;  4M3E A;  2VQL A;  2VON A;  1PP8 F;  1XCV A;  2VQH A;  1TW3 A;  4HLX A;  3ZMV A;  2BXZ A;  3IH4 A;  4UXN A;  4MFE A;  1WH7 A;  5J47 A;  3ABT A;  1G3S A;  3K4B A;  3HL2 A;  4K2E A;  5CJ9 A;  3C3W A;  3FHN A;  1IRX A;  4LMY A;  4LOC A;  4KYW A;  1ETW A;  4UNO A;  1UG0 A;  3BLY A;  3GYH X;  1E0E A;  2XKO A;  2EFP A;  3VYS B;  4CYC B;  4NUB A;  5FRM A;  3VOE A;  1YG2 A;  2R7X A;  4JP0 A;  4JYK A;  1WI9 A;  1DGW Y;  3M7G A;  5F1J A;  2R7U A;  1HSJ A;  3R4K A;  2VBX A;  2ESH A;  4B4C A;  4RM2 A;  3BR3 A;  2ZJR F;  3HRT A;  3L2Q A;  2V9V A;  4NQW A;  4LLL A;  2DMT A;  3BC8 A;  2Y0S A;  5GAE J;  3GWZ A;  5GP9 A;  3AG4 H;  2OAZ A;  3PUF A;  1VZ0 A;  3O3K A;  2W48 A;  3ROU A;  3CP8 A;  4F55 A;  2EA2 A;  3GFJ A;  1ETK A;  1E3O C;  3VYU B;  1K4S A;  3KPH A;  3CCV I;  1LEA A;  3BR1 A;  3LSM A;  4JX5 A;  2BY0 A;  1S9H A;  5IPA A;  1KU3 A;  2VE9 A;  3LAP A;  2LVS A;  2Y31 A;  3E3V A;  2GIZ A;  2F5F A;  3S93 A;  3R60 A;  4MTD A;  2DO7 A;  3K0L A;  3GLL A;  4RB2 C;  3DLL F;  3GUD A;  2YX4 A;  3LSP A;  2NOG A;  4YFN F;  3GFI A;  1E2X A;  2ZME B;  1WVR A;  1OCO H;  1T0F C;  5IY5 H;  1ZTR A;  5E1W A;  2KRC A;  3HOX J;  2JA6 J;  1VQN I;  1WJA A;  4I01 A;  3KP4 A;  1BOA A;  5E18 F;  4Q4Z F;  2HTJ A;  1S8N A;  3QP6 A;  1MH3 A;  1RES A;  1X1B A;  3B6C A;  3BG3 A;  1R58 A;  1OCT C;  2BY2 A;  4MTE A;  1H0M A;  3TP3 A;  2VBW A;  2RRE A;  3COA C;  2KDO A;  3FXR A;  3BZC A;  3RIR A;  3ZCO A;  3EYI A;  4AIK A;  1ZK8 A;  4KFC A;  3O6B B;  2DA3 A;  4LLN A;  2CW7 A;  5JR3 A;  2JK3 A;  4NHJ A;  3CCL I;  2LC2 A;  4II2 A;  2CQQ A;  4RLF A;  3BTC A;  1B59 A;  3DU5 A;  3FXK A;  2VPL A;  3CUQ A;  3HM5 A;  5CVV A;  5EEG A;  2ESN A;  5AIQ A;  4RAG A;  3VB2 A;  3IL2 A;  1XSD A;  1K78 B;  5FB2 A;  2RNJ A;  2XPV A;  1AHD P;  2R7S A;  3OR2 C;  4FCY A;  3PIO F;  2DT7 B;  2DFH A;  2OZ6 A;  2ZSH B;  4U0W A;  4ZTJ A;  2X6O A;  2Z5U A;  4B3A A;  3FM3 A;  4HF2 A;  2MSY A;  1XMX A;  3JTH A;  2OUM A;  2ECC A;  3QYF A;  4XLH A;  4JX6 A;  4X6A J;  2GIV A;  2NVY J;  4ZYG A;  4YII A;  5J1U A;  1ON2 A;  3Q3S A;  1HDD C;  5EEH A;  1TNS A;  4LD5 A;  4XSZ F;  1I1S A;  2AXT C;  4L0Y B;  2R5Z A;  2LKP A;  2Q8K A;  2K3P A;  3PSI A;  3HTS B;  2JQ7 A;  5TRD A;  2A05 A;  5E3L A;  2DDB A;  1YYV A;  3RYR A;  3ZQ7 A;  2R0Q C;  1BW5 A;  4AD9 A;  3TW6 A;  3LA7 A;  3W6K B;  4CUG A;  1MZB A;  4O3M A;  3HKZ A;  3BR6 A;  2O3F A;  3E97 A;  1VND A;  4PFP A;  2LDU A;  1UHW A;  1UHS A;  3K1M A;  4I6Z A;  3O8G A;  4Y4R A;  1V5F A;  2VT2 A;  3IHU A;  3OIO A;  3LOC A;  2QBY A;  1OYI A;  3VYT B;  5M5W J;  1G3W A;  2L5Q A;  2ZJP F;  2NS8 A;  3JAM Z;  3F6O A;  2FJ1 A;  3IP4 B;  4BHC A;  4PJN A;  1LDK B;  3NWT A;  2UXN A;  4XRF A;  3N97 A;  3RTR A;  3IUO A;  4XK4 A;  5DCM B;  4DYR A;  2M45 A;  5JHF A;  2LSO A;  3T1B A;  2CW8 A;  3RPU A;  3QP5 A;  1GXQ A;  1CF7 A;  1MMD A;  4HA8 A;  5B1A H;  2E7X A;  1VQ9 I;  3IC7 A;  5H20 A;  1BM9 A;  2MGQ A;  4KDP A;  5B3S H;  4ZZL A;  2R7Q A;  5ERI A;  2HPM A;  4UY8 I;  5EJC A;  1SAU A;  1IRG A;  4BS9 A;  2JPC A;  1A31 A;  2M2E A;  2BEO A;  4ZC3 A;  2QKM B;  2EZL A;  3V8K A;  2NNN A;  1MW7 A;  3N4M A;  2FF4 A;  2BV6 A;  3MZ8 A;  1TWH J;  4F52 A;  1J75 A;  4LFU A;  4HRI A;  3RKX A;  1JT0 A;  1U2W A;  3VPR A;  4XN3 A;  2P5L C;  1AKH B;  4EJT A;  1HW1 A;  4HNU A;  4Y52 J;  3DKW A;  1RC9 A;  2JZY A;  3BQY A;  3FXJ A;  2ELJ A;  5FJ8 J;  2GA2 A;  9ANT A;  5J6X A;  2NVU B;  1GLN A;  1R1V A;  3S1M J;  4A3J J;  3K4N A;  5M3F J;  2NS0 A;  4ESJ A;  2X51 A;  1FTZ A;  1VI0 A;  4XSX F;  1W1W E;  4P9F A;  3MQ0 A;  1STZ A;  2XF5 A;  4FE4 A;  2OCE A;  4HG2 A;  1FYK A;  2EIK H;  3ML6 A;  1YIT I;  1SEU A;  2GA1 A;  4GO1 A;  2K27 A;  1WFX A;  4ZDP A;  3BR2 A;  4A6D A;  2AS5 F;  2DQL A;  1T6S A;  2CUJ A;  1MMG A;  1TQM A;  2WBM A;  2R7V A;  1X4O A;  4WX9 A;  1XPX A;  3HEF A;  1QU3 A;  3OYN A;  1U5T A;  4ZDL A;  2XDV A;  3PSF A;  2E1O A;  4O5V A;  1VQL I;  2DQR A;  2HQN A;  4XL9 A;  2P7C B;  4RM3 A;  1FSH A;  2M0C A;  2A07 F;  1BIA A;  4MQ9 F;  2XHK A;  2F2E A;  5DD4 A;  1ZEL A;  3SFZ A;  4G8X A;  2P6S A;  3D1N I;  3MEX A;  4V2G A;  2IA1 A;  2FBI A;  1JHF A;  3W3C A;  4IX7 A;  5J1R A;  3KFW X;  1IN4 A;  2LBF A;  4A2U A;  4XLA A;  2ZKZ A;  2KZV A;  2WAQ A;  5ILS A;  2KDZ A;  1S72 I;  4KIF A;  2BY1 A;  3S14 J;  2OD5 A;  1BR4 A;  4L9N A;  2E1N A;  2O8K A;  1Z67 A;  3ISP A;  5JHU A;  4UVA A;  4DNC A;  1JGS A;  2DFE A;  4HDV A;  1QO0 D;  4P1W A;  1EA3 A;  3KCC A;  3OYF A;  3ZMS A;  2PMZ A;  3IH2 A;  4I02 A;  5LEJ A;  4PFO A;  2CWE A;  4HSR A;  4Z6Y A;  3S1Q J;  4HX7 A;  1JJ8 C;  2PJR A;  5F6F A;  2V1X A;  1EH8 A;  1J5Y A;  2IGN A;  1GT0 C;  4J00 A;  2HVS A;  5EZH A;  4OAY A;  3SJM A;  3OYE A;  3TOB A;  2MH9 A;  2XKP A;  2UUZ A;  3K4C A;  4HPQ A;  3ZMU A;  4EGZ A;  4QLC U;  1ZYR F;  2HEO A;  2GZW A;  3UR3 C;  3L1P A;  2LTP A;  1D5Y A;  2J5P A;  2K9Q A;  1SD4 A;  2PMH A;  1QVU A;  3CCS I;  2F6C A;  1FEX A;  3UKG A;  2A68 F;  3N05 A;  4AIH A;  1X3W B;  1YIO A;  3DTI A;  4CYC A;  3MVP A;  5EG0 B;  2DA6 A;  1SD5 A;  1QA6 A;  3QPH A;  4HV6 A;  2ZC2 A;  4B43 A;  3ASO H;  2EA4 A;  4ZJZ A;  2BOL A;  3JCU C;  2LP0 A;  2QSF X;  2I5U A;  5BMZ A;  1KU7 A;  1BOB A;  1YW9 A;  3ECO A;  1RZ4 A;  5LGN A;  2LKX A;  2DK5 A;  2RKH A;  1K79 A;  1XS9 A;  1YFH A;  2ADU A;  3PQJ A;  2ZFW A;  1B4A A;  1G8X A;  2K9S A;  2XAJ A;  4LK0 F;  2ACJ A;  3CTA A;  2HDW A;  3ABM H;  3K70 D;  1AOY A;  4OIQ F;  4LG0 B;  2R92 J;  1V55 H;  2N8G A;  3RJP A;  3ABK H;  1DQU A;  1XGN A;  3HHH A;  3PL8 A;  3KZI C;  1C0W A;  1R4N B;  2ZME A;  4FE7 A;  4BEH A;  2CV2 A;  1WPK A;  2IGK A;  2ME6 A;  1SFO J;  1K6O A;  3AAF A;  1WHU A;  4P5O A;  2VXZ A;  2ECB A;  4PJ0 C;  5A2Q Z;  2P6T A;  4RGR A;  3A02 A;  3BY6 A;  1U0J A;  3FXU A;  2WAD A;  5ICG A;  2DMU A;  4KUM A;  2Y9Y A;  5D4S A;  2PN6 A;  1OYY A;  2ZNY A;  2IT0 A;  1YI2 I;  2JA8 J;  1YO5 C;  3QPL A;  2DLL A;  3EET A;  1MD0 A;  3P9K A;  5DDG A;  4R8H A;  4LGW A;  1JGG A;  3DLA A;  3HSF A;  2Z16 A;  4Y3O A;  1K78 A;  2DMP A;  5HDG A;  2JSC A;  4UV8 A;  4BY1 J;  3J81 Z;  1OYW A;  3CC2 I;  3BG6 A;  4I99 C;  1RKW A;  1I39 A;  3L2U A;  3F8F A;  2TRT A;  2VIX A;  2L02 A;  2H6C A;  2DTR A;  4F92 B;  1QPM A;  1X3Z B;  2DYS H;  3MKZ A;  3AL0 B;  4OU0 A;  1VQM I;  1FBU A;  5FKK A;  1G3T A;  1HKS A;  1KU2 A;  5B1B H;  3AFH A;  1O57 A;  1N78 A;  2VOD A;  1H88 C;  3JR9 A;  1P4A A;  4IRH A;  3BR5 A;  1O7F A;  3DTE A;  2FOW A;  5LRR A;  1YX3 A;  1WZ2 A;  3S17 J;  3HUG B;  4FHT A;  2XIG A;  2GXG A;  4QWQ A;  2BHY A;  2MLK A;  4MGR A;  4HQM A;  1QQI A;  1BJZ A;  3RI4 A;  3ZXS A;  4BQQ A;  3QU6 A;  4CCN A;  2HOE A;  1SD6 A;  5LGU A;  2VQC A;  3DBH B;  3FM5 A;  2KIU A;  3SEZ A;  2WA0 A;  1GDT A;  1P2F A;  1R7J A;  1A6I A;  5DM6 F;  3DPU A;  5IT3 A;  1IV8 A;  2AQE A;  4PGH A;  5AON A;  3TMO A;  3H9Q A;  2LY2 A;  4BQO A;  3GZN B;  3CC4 I;  1IDY A;  1VQK I;  2IP2 A;  3MN2 A;  1F43 A;  1Y8R B;  3ESW B;  5H2F C;  3OYL A;  4BJT A;  1RKT A;  2F5E A;  3CCY A;  2G0E A;  2MC3 A;  2HZT A;  3WTY C;  5DCM A;  3OL3 A;  1GVJ A;  1EH6 A;  1IXC A;  2BGC A;  3Q0W A;  3ZP5 A;  1AU7 A;  1MKM A;  1R00 A;  3I4M J;  3E6D A;  4L18 B;  1ONV A;  2XAG A;  4GRI A;  1Y0U A;  5LBQ A;  1F36 A;  1LQ1 A;  1YRN B;  1I6X A;  3O8H A;  1X1P A;  1Y39 A;  1D1C A;  1UMQ A;  4MNU A;  2OC6 A;  5HLG A;  2XPU A;  1OMI A;  1Z6R A;  4U0V A;  3GZ6 A;  4Y13 A;  3LL7 A;  2H1L A;  2Z99 A;  4JQF A;  4DZP A;  2GOX B;  3HOZ J;  1MNE A;  2K85 A;  2M0M A;  3LFU A;  3RQI A;  3SZP A;  3S1R J;  2VBY A;  1YHQ I;  1W5S A;  2NYX A;  1UFM A;  1WSU A;  3TO6 A;  4IHX A;  5H6Q A;  2JTV A;  3JW4 A;  3RQ4 A;  1AKH A;  1FOY A;  2CFX A;  4FAS D;  4DIQ A;  5L3G A;  5ICE A;  3I4N J;  4OMZ A;  4D5F A;  4DBQ A;  4CCJ A;  3BTJ A;  1FC3 A;  2UV1 A;  3OWT A;  2TCT A;  1Y0N A;  3FK6 A;  4BUP A;  3HSR A;  5LD2 C;  2E60 A;  4P96 A;  1VTN C;  1D0Y A;  2VE8 A;  3WTV C;  4AYB A;  3H0G J;  4CCM A;  1T39 A;  1GUU A;  3ERM A;  1MH4 A;  1KGS A;  1JKP C;  4L0Z B;  1FYM A;  2QKL B;  4MHG A;  2LY1 A;  1K61 A;  2V1U A;  2XF6 A;  4IQJ A;  3IKV A;  4E7K A;  2HOT A;  2EPF A;  2MFZ A;  3ONQ A;  5FKN A;  2H27 A;  5C3E J;  1IJW C;  2C6Y A;  4N0B A;  1TWA J;  1I6H J;  2GXA A;  1J2X A;  2VBZ A;  1Q1V A;  3LST A;  3ZQF A;  2IEK A;  1MBE A;  4ENJ A;  2F5V A;  2YX7 A;  4YEJ A;  4A3M J;  3K6G A;  4YEL A;  2EV6 A;  1FLI A;  5BQT A;  4YIF A;  2KIM A;  1TLH B;  4MQV A;  5HDK A;  2ID6 A;  1VQ7 I;  3GXO A;  4V19 K;  3GLX A;  1FP2 A;  1JKQ C;  4CZZ A;  4ZYD A;  1MGT A;  1HOM A;  3DEE A;  3SYT A;  4C2T A;  5IYD J;  1HW2 A;  1XCB A;  2DK8 A;  2CQK A;  2FML A;  3SXY A;  1VQ4 I;  4CA0 A;  2KL4 A;  1JHH A;  3U1D A;  1QHH D;  2W24 A;  2FQ4 A;  1ZKG A;  2FU4 A;  2HVR A;  2V26 A;  3E5Q A;  3LSK A;  5HS9 A;  2XSD C;  3R61 A;  4XBF A;  4CCO A;  2X6X A;  3C1D A;  1HLV A;  3DKY A;  2X9D A;  4DYC A;  3QOP A;  2XAF A;  3E7L A;  5FLM J;  1O7L A;  3KET A;  2RC4 A;  3TBI A;  2WC2 A;  3TOA A;  2R3S A;  5E20 A;  4BU2 A;  1MND A;  2EFO A;  4E7Z A;  1EJ9 A;  2WB1 A;  3FMS A;  5EG0 A;  1EH7 A;  5CVR A;  2PMZ N;  3PJR A;  3IKT A;  2E34 A;  2XF7 A;  1O4X A;  1XGS A;  4KIS A;  3HPH A;  3CC7 I;  3OYK A;  2XGD A;  4ENN A;  2Y75 A;  4HZF A;  1ZHF A;  2EIJ H;  4Y17 A;  3V7R A;  4BXU A;  2WV1 A;  5FRN A;  4G6Q A;  4BAC A;  3GEZ A;  2J5O A;  1SAX A;  2CG4 A;  2EIN H;  1FX7 A;  1SC7 A;  3W2V A;  5HS8 A;  1RR8 C;  1CQT A;  2PEX A;  4LB6 B;  3GFL A;  5IT9 K;  2OJE D;  1W5C C;  3MKY B;  2VJJ A;  1YIJ I;  4LG0 A;  4YFK F;  1TP4 A;  1TWG J;  2ZXJ A;  2FRH A;  3CDH A;  5DTD A;  1K6Y A;  2EK5 A;  2KJB A;  2P4W A;  4R1H A;  2OU2 A;  3MMY B;  2DPU A;  2IJL A;  1R5G A;  4RDU A;  4ENM A;  4XQF A;  1BI2 A;  5D5U B;  3HTU A;  2A6E F;  2HXI A;  1TZL A;  1W0U A;  2PI0 A;  2DU9 A;  2BYV E;  1DPR A;  2Y2Z A;  4KT5 C;  3ZN1 A;  3J7Z I;  4UVB A;  5FD6 A;  4BDY A;  3BQZ A;  1Z77 A;  4O6J A;  3IV5 A;  1G6N A;  4G9Y A;  2V6C A;  2RV8 A;  1ON1 A;  1BI1 A;  2RQQ A;  1UZC A;  3I59 B;  2EFN A;  2G7H A;  3CMM A;  3M8E A;  1Y1V J;  4MLO A;  2DA1 A;  2UXX A;  1IF1 A;  3CUQ C;  2VQG A;  3QWL A;  3LSH A;  3BT9 A;  3H1C A;  2JN6 A;  4EM1 A;  2BHZ A;  3HHG A;  1G2H A;  4PGG A;  3RKQ A;  5L3C A;  1H9G A;  3DV8 A;  3F6V A;  5EEA A;  4IHY A;  4M71 A;  1LFB A;  1U9O A;  3MZH A;  3KP5 A;  2LNB A;  1PDN C;  4WWC A;  4F3Q A;  5IOY A;  1JUM A;  1IRF A;  4U0Y A;  1HXD A;  1APL C;  4XKV A;  3E1S A;  2K4B A;  1D8J A;  3OS1 A;  1H8A C;  1IN8 A;  4XLF A;  1I3Q J;  3V8J A;  2R7W A;  4A3D J;  2PG4 A;  1Z21 A;  3RKY A;  3CJN A;  2EQR A;  2LR8 A;  4C2U A;  3IWZ A;  1FSE A;  4EEF G;  3PFY A;  1RNL A;  2H94 A;  3HUG A;  1MBG A;  3GTQ J;  1U78 A;  1MJ9 A;  2R7O A;  4PCQ A;  1DDN A;  5FD5 A;  3CUO A;  3MAJ A;  3ZGK A;  4CCL A;  1KQ8 A;  5F0F A;  5DM7 F;  5FLX K;  1S7E A;  2LG4 A;  1D1A A;  1S7A A;  5GAG J;  4RBO A;  2GAU A;  1DU0 A;  3BZK A;  2OQR A;  4UB8 C;  4I76 A;  1F4K A;  3OY9 A;  2YPR A;  1S5L C;  1QVT A;  4ZZD A;  4A93 J;  1ETO A;  1KU9 A;  2H09 A;  4QIW N;  4A3I J;  3A4C A;  4B1R A;  2XC7 A;  2XUB A;  2VKH A;  1BIB A;  4LLG F;  5JI6 A;  3KEY A;  5E1Z B;  1IUF A;  1A35 A;  3BZ6 A;  5B5E C;  3CLO A;  3JSO A;  1U9N A;  1XDU A;  3F0C A;  2AHQ A;  2L9V A;  2STT A;  4XRS G;  1YRN A;  3LWF A;  1V5G A;  4EJV A;  2IBD A;  1K7A A;  2FSW A;  4D7M A;  1IN6 A;  3GTJ J;  3CES A;  2CQX A;  2HNH A;  3HGY A;  4RMN A;  2QSG X;  4UV9 A;  3ZPL A;  5IOZ A;  2YR2 A;  3F8N A;  2CFO A;  4XLN F;  2WTE A;  2X48 A;  2DBB A;  3G6E I;  1FOX A;  2ZXH A;  1A04 A;  3GTM J;  3IAM 2;  1VQ6 I;  1YTY A;  5L3F A;  3J80 K;  2NRA C;  3B73 A;  4PDK A;  1QBJ A;  4BHB A;  1BR2 A;  2Q1Z B;  1LVA A;  2A61 A;  4CYD A;  3W6V A;  4MEX F;  3H5N A;  2MA3 A;  4BH9 A;  5L3B A;  2HOS A;  1J7K A;  4M3D A;  3G2B A;  5H6R A;  5J8C A;  4PK4 A;  4HLY A;  1X58 A;  1BA5 A;  1B6A A;  1FWZ A;  4RB0 A;  1T0F A;  4N9H A;  1BL0 A;  1DP3 A;  2MD5 A;  4XKW A;  2ELH A;  2PJP A;  1ZGW A;  2X85 A;  3PIP F;  2D45 A;  4ANJ A;  2F4I A;  2M34 A;  1J09 A;  3I5U A;  2E1M C;  3RSN A;  5EDN A;  2PFB A;  3W2W A;  3OYB A;  3PNT A;  3R6S A;  1BC7 C;  2CV1 A;  2Q2E B;  2IPQ X;  4M73 A;  3WE2 A;  4B8X A;  2X1E A;  2JA7 J;  3C2H A;  1U5T C;  5IP6 A;  2W1O A;  2DA5 A;  1Z1D A;  5FGM A;  3KEO A;  4PJL A;  2K40 A;  2VKE A;  2JA2 A;  5LFA A;  3PO2 J;  4CIC A;  3OS2 A;  5EF6 A;  3Q5F A;  3NQO A;  2R7F A;  4LIT A;  2DFF A;  2E2H J;  1OKR A;  5IYC J;  3ZMT A;  3CCR I;  2B63 J;  1IDZ A;  3LSR A;  3TO7 A;  2FA5 A;  1OCR H;  4HYE A;  2DOF A;  1R49 A;  5GPA A;  2GBY A;  1Z9C A;  2HDD A;  4QSH A;  1YJN I;  4GFB A;  3OYG A;  5DS9 A;  2CRG A;  2CV0 A;  2IS6 A;  2VLA A;  2K86 A;  5J40 A;  4BJ6 C;  3BTL A;  2E2I J;  3BG5 A;  1T08 B;  2UWM A;  3AG3 H;  5DCF A;  2NXN B;  1W5T A;  2HGC A;  1XSV A;  5DUI A;  3QOE A;  1ETY A;  1FMW A;  2JT1 A;  4G7O F;  2IW5 A;  1X19 A;  3NAR A;  3MKL A;  1LFP A;  1JXS A;  2DW4 A;  1JTX A;  4HF1 A;  3OR1 C;  3J7A O;  1Z7U A;  1ZRE A;  2CUF A;  2YU9 J;  4NB5 A;  4EJU A;  2GLO A;  2PLY A;  3ZQG A;  3KE2 A;  5M5Y J;  2V1D A;  1ZR4 A;  1PUF B;  3CMY A;  5HOD A;  4R79 A;  1FY7 A;  5J4Y A;  2BXY A;  2QEN A;  2HDC A;  5DD8 A;  3T5X A;  1ITY A;  5KHD A;  3ZQC A;  1IXR C;  1ZGA A;  1A6Q A;  4YFX F;  1BI3 A;  4DQ2 A;  4CZC A;  2M9H A;  1SFE A;  4XNF A;  1REP C;  2EIL H;  3PQK A;  2EZK A;  1FZP B;  2XAS A;  1TWF J;  3BR0 A;  4HX4 A;  1D3Y A;  4OIN F;  2E1C A;  4CHU A;  5EYR A;  2P81 A;  1W36 C;  4KN7 X;  3HDD A;  3D5R C;  3T8T A;  4ABZ A;  2O8X A;  2DDA A;  2HI3 A;  5E8G A;  4ENK A;  1QZE A;  4QTR A;  4EM2 A;  3H3Z A;  1YS7 A;  2LH9 A;  3RZO J;  1ULY A;  1XD7 A;  3E5U A;  3LFK A;  3LMM A;  4UB6 C;  3T0Y A;  1VFC A;  5E3M A;  1WKM A;  1JE8 A;  1NK3 P;  5CVI A;  2OCC H;  3WU2 C;  3WTW C;  2XAU A;  3IAS 2;  1LJ9 A;  3J7Y J;  1ZG1 A;  4WK8 F;  2D2W A;  5JVG F;  1S29 A;  5IP9 J;  1TWC J;  2K3F A;  2M4K A;  3H0D A;  1T38 A;  2XB5 A;  1X1A A;  4UUV A;  2VJ4 A;  3GTK J;  4I7H A;  3E0J B;  3F8M A;  5K7F A;  5CVJ A;  1HC8 A;  4KN4 X;  4S05 A;  3S2D J;  3FBN B;  3SFI A;  3V4G A;  1BBY A;  5B66 C;  3G1O A;  1B72 B;  3I59 A;  1ZN2 A;  5HNH A;  2Y0M A;  2LF8 A;  3C7J A;  3FMQ A;  4RA2 A;  3P7N A;  4FX4 A;  1I27 A;  3A2K A;  3K1P A;  1PUE E;  2FX0 A;  2X1D A;  3B6A A;  1ODD A;  2ZCW A;  3FMR A;  3JRC A;  2PX9 A;  2ZJ2 A;  1YLF A;  2VJ5 A;  3K4L A;  3GX4 X;  4YG2 F;  4IPA A;  2H1K A;  3K7A J;  2PQ8 A;  4YIR X;  2B9S A;  1XX5 A;  2V9K A;  1YJW I;  1LB2 A;  2MYS A;  2JVG A;  1EF4 A;  3BG9 A;  1VQP I;  4IRG A;  2Y9Z A;  2JWT A;  4IQ4 A;  1V4R A;  3S15 J;  2JUG A;  3ZQH A;  2QQ9 A;  1TW2 A;  3AG1 H;  3ZRG A;  1UB9 A;  2RNG A;  2R7R A;  2ZSI B;  3GTO J;  3HJE A;  2GQQ A;  4XN0 A;  3DEW A;  4XOP A;  3CD6 I;  3FF5 A;  2Y0S N;  2EJR A;  2W4S A;  2W7N A;  1Y6I A;  3F22 A;  2FQ3 A;  5DEQ A;  4RGS A;  2IGM A;  1JJ6 C;  1K4T A;  3BDD A;  4XRS A;  4GYG A;  2HKO A;  2COB A;  3VWB A;  4A3F J;  2HKX A;  4DGW B;  1O3S A;  3TL4 X;  3S1N J;  4U88 A;  1RIO H;  1RET A;  1UJ8 A;  5L3D A;  1AA7 A;  2CMP A;  2E7W A;  3L00 A;  2WWY A;  1IAW A;  5LHI A;  3H5R A;  4XKB A;  1ETV A;  5F08 A;  3DCF A;  2B7E A;  2MG4 A;  3FZV A;  4BHP A;  4KA4 A;  3S3N A;  2FNA A;  1Z7L A;  3HZJ A;  4AU7 A;  2LY9 A;  1B9M A;  1YX5 A;  1NTC A;  4NNJ A;  2Y48 A;  2VUM J;  3OOP A;  4RAF A;  2QEX I;  1LE8 B;  2V7F A;  3DP7 A;  2QA4 I;  1E3P A;  1XN7 A;  1L3L A;  4RB3 C;  2R93 J;  3M1E A;  4WXC A;  2JUC A;  3R0A A;  3R0J A;  1N75 A;  2VPR A;  3S16 J;  2P7V B;  3Q9S A;  1DP7 P;  3L9F A;  5DUK A;  4N9I A;  3CCJ I;  4MO7 A;  4IHW A;  3F23 A;  3FBI B;  2NVT J;  2IXS A;  4F7Z A;  3H35 A;  4GXO A;  1P7I A;  3L2R A;  1MBF A;  1PP7 U;  3HG9 A;  1X2M A;  2P0W A;  1B8I B;  2IVM A;  2L9R A;  1ZLJ A;  2O5R A;  4P55 A;  1LUJ B;  4KIT B;  3VOD A;  2K5C A;  2Z2S B;  2ZNZ A;  4RAZ A;  1WQ2 A;  3F72 A;  4FTH A;  2QQB A;  2F5D A;  2F4M B;  5BS6 A;  3JRF A;  3NRV A;  2QCO A;  3KP2 A;  4HST A;  3M07 A;  3TGN A;  3WOD F;  1Z05 A;  1BJA A;  5M3M J;  4KJZ A;  1TQP A;  4X1E A;  1HCR A;  3TDU C;  2LYC A;  5D6E A;  4BXF A;  1OIS A;  1OR7 A;  2V6E A;  1YE9 A;  2IRF G;  1P9Q C;  2ICW G;  2XV4 S;  3JRG A;  2EFW A;  4Q47 A;  3VYR B;  3HRM A;  3IRR A;  4N4N B;  2Y69 H;  4RS8 A;  2BZT A;  1QZY A;  5CQG A;  1BC8 C;  2HFH A;  4IHS A;  2Q2E A;  2HS5 A;  4RAY A;  2YU3 A;  3HKZ N;  2H8R A;  3HBL A;  3SEQ A;  4AIJ A;  1R1U A;  2KHM A;  3F9K A;  4D1Q A;  4XRM A;  3F8C A;  4XKC A;  2HVQ A;  2L7M P;  3G1L A;  3MD2 A;  3JAM K;  1ORK A;  1SFK A;  4HQE A;  3MCZ A;  4DZJ A;  1TTY A;  4KT6 A;  1W7P B;  1XTA A;  4BE2 A;  2A6H F;  4OAZ A;  2EZH A;  3M9A A;  3E6C C;  2W85 A;  1YJ9 I;  4IF4 A;  4C2M J;  3M1C A;  3X2Q H;  5KAF C;  1TC3 C;  1SFU A;  1FNN A;  3GF2 A;  1HF0 A;  2Z9O A;  1UCR A;  2BW3 B;  2A3S A;  2X0L A;  3I4P A;  4FX0 A;  5FKO A;  1S3J A;  1RUN A;  1ZRD A;  3BPX A;  1U6G A;  5GTH C;  3M4O J;  3FX3 A;  2HQ5 A;  1IRZ A;  1IN5 A;  2MLG A;  3MFK A;  3OOU A;  4I98 B;  3S3M A;  3D5L A;  3DWL E;  4WXD A;  2OBP A;  1FOW A;  2L4A A;  3WHC A;  4ZYH A;  2KFD A;  2DMQ A;  1KQ9 A;  3KLO A;  2P5V A;  3I58 A;  3OYI A;  5LRS A;  4UUS B;  2EWN A;  1QHG A;  1NH3 A;  2LRD A;  3CMA I;  5BOX A;  5ILU A;  1PUF A;  2HWV A;  4FET A;  2O9L A;  4C30 A;  3VDX A;  2W00 A;  3KZZ A;  5FFX A;  1ZLK A;  3W2A A;  2DJN A;  1LDD A;  3SZG A;  5ED4 A;  4XID A;  1ZG3 A;  4ESF A;  1R22 A;  2VKD A;  4PJM A;  1SD7 A;  4E7S A;  3GVA A;  1MBH A;  2STW A;  1YW7 A;  1MMS A;  2FXA A;  4OOI A;  5ICF A;  4ZYA A;  2ZJQ F;  2IS1 A;  1Z6T A;  2L54 A;  3KLN A;  5CLS A;  5CYV A;  1M1E B;  4OMY A;  1FJL A;  2B0L A;  3BG7 A;  5E1X A;  5KAI C;  1GHC A;  1UG2 A;  2M3A A;  3DXJ F;  2UZK A;  3BCA A;  3PM1 A;  3GBG A;  3FHZ A;  1QRY A;  2XAH A;  4S04 A;  4M74 A;  2KMU A;  3C18 A;  2O6G E;  5TGT A;  1P6R A;  3WU0 A;  2GWR A;  4N4O B;  4HF0 A;  2VC0 A;  1VQ8 I;  4IHV A;  2QLZ A;  4L5I A;  1XMK A;  5FFZ A;  2CUZ A;  2R4G A;  2CS3 A;  1LKX A;  4M3B A;  1TT5 B;  2W25 A;  1F1Z A;  5LGT A;  3ABL H;  1NG6 A;  5TIS C;  3W6J B;  2L0K A;  5IYB J;  2HR3 A;  3ABU A;  1ZG5 A;  2R7D A;  2OV7 A;  1VF9 A;  1JKR C;  1W7P D;  4G94 A;  4QPQ A;  3FWE A;  2Z33 A;  1O3T A;  3M3Y J;  2NNY A;  1QNT A;  3H36 A;  3QAH A;  4BY7 J;  1LPQ A;  2WAQ N;  2DAO A;  2I10 A;  4FIS A;  1V5E A;  3DF8 A;  3QPS A;  2DYR H;  5D5W B;  5E3O A;  1AWC A;  1ZAR A;  5HS7 A;  3JRB A;  3FXO A;  2P8T A;  1B72 A;  1OCZ H;  1WGX A;  5M5X J;  4LIV A;  1RI7 A;  3DTK A;  2VJI A;  3MZY A;  5J1Y A;  2RGV A;  1POG A;  2Z1D A;  3E5X A;  4BGD A;  3GME A;  3ZOB A;  2DA7 A;  2LMD A;  3BWG A;  2OF7 A;  2YSR A;  2E1M B;  4W97 A;  1MIJ A;  5IP7 J;  3OMY A;  2MH2 A;  3JSP A;  2LOO A;  1X1C A;  4IOC F;  3WTS C;  3CQZ J;  2L7Z A;  1T56 A;  2EH3 A;  1A36 A;  3QU3 A;  4NBQ A;  4AUX A;  2R7Z J;  3WTT C;  1H89 C;  1RR7 A;  4OWR B;  3LAJ A;  4E4H A;  1HBX G;  3DFG A;  2K9N A;  3HOV J;  3K2Z A;  3WTZ A;  3CME I;  5KNL A;  3S3O A;  1Z0X A;  5GTI C;  5GAH J;  2Y30 A;  1J0R A;  4UUT A;  2DXI A;  4NC6 A;  2OQG A;  2GM4 A;  1P4W A;  3SDG A;  2XRL A;  1FPQ A;  2M4G A;  3Q9V A;  4W1U A;  5D8K B;  3H9J A;  1FIP A;  3VSL A;  4CDG A;  2DA4 A;  3LA2 A;  1FBQ A;  4CSW A;  1WJ5 A;  3AKZ A;  3PO3 J;  1DPU A;  3RPU D;  5JVT A;  1R23 A;  1JT6 A;  2ZXI A;  4E7L A;  2OZU A;  3HPG A;  2DCE A;  1GXP A;  3KYD B;  1XB4 A;  3PNY A;  1SVM A;  5KK1 A;  1U8B A;  2WV0 A;  2QM3 A;  2NVQ J;  2ZO4 A;  2AQF A;  1OPC A;  1IN7 A;  2HXO A;  1WJD A;  5D5V B;  5A2Q K;  2W57 A;  3K69 A;  2E5Z A;  3WGI A;  5CVU A;  5JLX A;  2DT5 A;  4B47 A;  3RZD J;  3EUH A;  1U3E M;  3FXM A;  4C3H J;  1CGP A;  5EGO B;  2DA2 A;  3I53 A;  1O3Q A;  1LE8 A;  3K9T A;  5TJJ A;  3ECH A;  3G73 A;  1X2N A;  4M9S A;  1NK2 P;  2KIS A;  1T33 A;  3CCU I;  4J01 A;  1MSE C;  4KNY A;  3QYB A;  1BR1 A;  2L9S A;  5K7Z A;  2HYG D;  3FKI J;  1OJL A;  1SVO A;  2EB7 A;  1FOK A;  4E6K G;  2L7F P;  2FUG 2;  2KQR A;  1XGM A;  2G7U A;  2EV0 A;  3QRF F;  5KVR A;  2NS7 A;  5J3L A;  3J81 K;  4J19 A;  1N77 A;  1KYW A;  3V7S A;  2EZI A;  2M7A A;  5DV5 A;  3S8P A;  1B8I A;  2VN2 A;  3DPL C;  4BBS J;  4M3G A;  2VI6 A;  2IS2 A;  1D1B A;  2FNP A;  4NC8 A;  4PZJ A;  3K10 A;  3IWF A;  2DOE A;  4HNV A;  2HPI A;  2RN7 A;  3QPT A;  4JX4 A;  3CO6 C;  4ZTF A;  4Y15 A;  1R1T A;  2XRO A;  1I50 J;  1A5J A;  4IHT A;  4HDU A;  2CH0 A;  2K9M A;  2XAQ A;  3HRU A;  3U9G A;  5C4X J;  3OL4 A;  3DBR B;  4BE0 A;  2GOM A;  4C3J J;  4BEH B;  1IO2 A;  3DEU A;  2VC1 A;  4IXA A;  4XLP F;  4A3L J;  2O61 A;  3JRE A;  5CKT A;  3U2R A;  2BY3 A;  4HX8 A;  1ZRC A;  1PVE A;  3CDL A;  3JRI A;  3RDI A;  4UVC A;  4ZDO A;  2R7T A;  2CSO A;  5EZG A;  5CPR B;  3WHB A;  2EFQ A;  1IW7 F;  5FRO A;  3OYC A;  2IA0 A;  3L09 A;  3I54 A;  3NEU A;  2NVX J;  2FEZ A;  4A3K J;  4LG3 A;  3NAU A;  3RCO A;  3VEP A;  4DOZ A;  2AO9 A;  3M8J A;  5LLQ A;  1X3U A;  3M8F A;  1LVK A;  4EJW A;  3ZMD A;  2HZD A;  1XDS A;  3TQN A;  3HRS A;  1W7P A;  4I09 A;  1NHA A;  3GFM A;  4U7B A;  3QYE A;  5K5Q A;  2BE5 F;  2VT3 A;  4EQQ A;  1P92 A;  2CJJ A;  3D0S A;  2WY8 Q;  1T8I A;  2E2J J;  1LEB A;  3G3Z A;  3A0H C;  1OQY A;  2LF7 A;  1FIA A;  2BW3 A;  2L01 A;  4D9J A;  1V54 H;  3OS0 A;  3I9V 2;  4I2O A;  3BJA A;  4XOR A;  4IL6 C;  3ERE D;  4RGX A;  3S2H J;  2X1C A;  1N25 A;  2JJ7 A;  1Z91 A;  4B3X A;  2BVL A;  3PFI A;  1L0O C;  1PYV A;  1BW6 A;  3C2G A;  4EAT A;  4EVI A;  3EUK L;  4UHT A;  2LLK A;  1FMV A;  1XC5 A;  4JBA A;  2MW8 A;  4XON A;  4A5N A;  1I1G A;  2XGX A;  2W84 A;  5BNG A;  1ZQ3 P;  4H4K C;  2QZ8 A;  3CF2 A;  4UUS A;  4ITV A;  3ZQQ A;  4DJA A;  4XLE A;  2L9N A;  1W36 D;  5AIP A;  3P9I A;  3A01 B;  3CO7 C;  1R4M B;  2CQN A;  3A1Y A;  1SAN A;  2QQA A;  4IEJ A;  4Y33 A;  3I56 I;  5LHG A;  3WTU C;  4EGY A;  2DPD A;  1JUP A;  3FIS A;  4Y7N J;  1S7O A;  3WE3 A;  3HB9 A;  3G4S I;  3V7C A;  1D0X A;  5CQE A;  1GV2 A;  1U8R A;  4E70 A;  1T95 A;  4HBL A;  1FTT A;  5BPD A;  3A03 A;  5D4R A;  1V3F A;  2QWW A;  3FKJ A;  4AYB N;  3HYI A;  4LIU A;  3H92 A;  4FT8 A;  4XMY A;  5BPI A;  1KYZ A;  1WJB A;  2MC4 A;  3BOQ A;  4C3I J;  5GPC A;  2G9W A;  4CH7 A;  3FXQ A;  2QF7 A;  2L2O A;  3V8L A;  1HW5 A;  2X6W A;  5F0H A;  5HLH A;  1XGO A;  2YS9 A;  1R5I D;  5E79 C;  4HW0 A;  2FOK A;  1Y1W J;  1IGN A;  1ZRF A;  2HQR A;  2H8W A;  1JUS A;  1H9T A;  3KYL A;  2M8E A;  1R9T J;  3MKW B;  3U21 A;  1UEL B;  3O2P E;  1WWX A;  4ETS A;  1I5Z A;  4G6D A;  1MMA A;  1TQI A;  2KP6 A;  4MIM A;  2XVC A;  1TT0 A;  3BP8 A;  5E3N A;  4I0A A;  4OIP F;  2F48 A;  4U7D A;  3OYJ A;  3K4M A;  4D7N A;  1MNM C;  3KYC B;  3L2C A;  2OPT A;  3JRA A;  3GO5 A;  4A6E A;  4EV0 A;  2M30 A;  2VKV A;  2CGP A;  3F21 A;  4HNT A;  4JK1 X;  2LK2 A;  2KRF A;  4B48 A;  2XRN A;  3MWM A;  1HKQ A;  2OTL I;  4A3G J;  4MFD A;  4G12 A;  1SVL A;  5JLW A;  1ACI A;  4M9Z A;  4OIR F;  3U1K A;  2KLO A;  3QOD A;  4AVZ A;  1QZZ A;  2PMU A;  2RAE A;  5J8F A;  1WJE A;  3KP7 A;  4M6X A;  1EKE A;  3KP3 A;  1HQC A;  4ZYE A;  4WCG A;  2COM A;  3EDP A;  1DUX C;  5HDN A;  2XGE A;  5FKM A;  2DOA A;  4DYQ A;  3GW2 A;  3G1M A;  2WB1 N;  5F64 A;  2HOA A;  2A5W A;  2GXB A;  3P5J A;  2L7K A;  1JKO C;  4BJ5 C;  5KCM A;  5C44 J;  3SDB A;  2ZME C;  4RGU A;  2QUF A;  5F04 A;  2CO5 A;  3SHF A;  1MSF C;  4MEY F;  2K9L A;  1J9I A;  3J7A Y;  5D5X B;  1ETQ A;  4A5M A;  1KQ0 A;  2E19 A;  2HTS A;  1WCM J;  1OCP A;  3L2V A;  3FXL A;  3I64 A;  5E8I A;  5K1Y A;  1B1B A;  5E17 F;  4AID A;  1SMT A;  2R5Y B;  2QSH X;  2O0Y A;  4BQN A;  1IUY A; 
#chains in the Genus database with same CATH homology
 3Q3S A;  3LSJ A;  1GV5 A;  1HDD C;  2WV1 A;  3GTP J;  3HKZ N;  2XGC A;  3HBL A;  2R5Z A;  2H8R A;  4XRM A;  2L7M P;  3G1L A;  5E3L A;  4V2F A;  1CQT A;  1ORK A;  2R0Q C;  4DZJ A;  1BW5 A;  3TW6 A;  2EZH A;  1WH5 A;  1TWG J;  5DTD A;  3BR6 A;  4C2M J;  3K2A A;  1VND A;  5EGO A;  1LFU P;  1UHS A;  4I6Z A;  4RDU A;  3O8G A;  1TC3 C;  3OIO A;  2HXI A;  1HF0 A;  1W0U A;  3LOC A;  4BKX A;  5M5W J;  2XPW A;  5FKO A;  2Y2Z A;  2NS8 A;  2FJ1 A;  3M4O J;  3Q0U A;  3BQZ A;  1Z77 A;  5FLV A;  3IV5 A;  2HQ5 A;  1IRZ A;  4XK4 A;  4DYR A;  3OOU A;  1Y1V J;  4MLO A;  3WHC A;  1WI3 A;  2DA1 A;  2DMQ A;  3BT9 A;  2JN6 A;  2MGQ A;  4NDL A;  4AC0 A;  5C4J J;  4UUS B;  1G2H A;  3RKQ A;  2O7O A;  4IHY A;  2M2E A;  5EEA A;  1PUF A;  3HOW J;  2O9L A;  1LFB A;  1U9O A;  2EZL A;  4L5E A;  2JA5 J;  1IV6 A;  5IOY A;  1JUM A;  1TWH J;  2DJN A;  1APL C;  4XID A;  1JT0 A;  1XG1 A;  3VPR A;  1H8A C;  1MBH A;  1AKH B;  1I3Q J;  4Y52 J;  3BQY A;  2IAI A;  1FJL A;  4A3D J;  5FJ8 J;  2EQR A;  1UG2 A;  2LR8 A;  4A3B J;  9ANT A;  3PM1 A;  4EEF G;  3GBG A;  3S1M J;  4A3J J;  1QRY A;  5M3F J;  1MBG A;  3GTQ J;  1FTZ A;  1VI0 A;  1U78 A;  4FE4 A;  5F0F A;  4IHV A;  1S7E A;  4A69 C;  3JRD A;  2DMN A;  2JMW A;  4RBO A;  4BBR J;  1DU0 A;  3BR2 A;  4M3B A;  4I76 A;  1RPW A;  2L0K A;  3HEF A;  5IYB J;  3ZQL A;  1QVT A;  1MBJ A;  4A93 J;  1ETO A;  1GVD A;  4QIW N;  4A3I J;  1VF9 A;  1JKR C;  4B1R A;  2E1O A;  2ID3 A;  2LFB A;  3M3Y J;  3TP0 A;  3GTL J;  2M0C A;  4BY7 J;  2WAQ N;  2I10 A;  4FIS A;  3D1N I;  3QPS A;  3HOU J;  5K7H A;  3TW7 A;  1IUF A;  4V2G A;  5E3O A;  3JRB A;  3OSF A;  1B72 A;  1WGX A;  5M5X J;  5J1R A;  1U9N A;  3JRH A;  3GTG J;  3F0C A;  2AHQ A;  1IG7 A;  2DN0 A;  5J1Y A;  2KDZ A;  4XRS G;  1YRN A;  1POG A;  3S14 J;  4M3F A;  2O8K A;  2M8G X;  3ZOB A;  2DA7 A;  2IBD A;  2OF7 A;  4W97 A;  4D7M A;  3GTJ J;  3A01 A;  2CQX A;  5IP7 J;  3HGY A;  2ME0 A;  3IH2 A;  2YUS A;  5IOZ A;  3S1Q J;  3CQZ J;  2L7Z A;  1JJ8 C;  1T56 A;  2EH3 A;  4AUX A;  5FKL A;  1GT0 C;  2X48 A;  2R7Z J;  1H89 C;  5EZH A;  4D5C A;  3SJM A;  3GTM J;  1RR7 A;  3FIW A;  3HOY J;  1MBK A;  2K9N A;  3HOV J;  3L1P A;  3W6V A;  1Z0X A;  2LTP A;  1D5Y A;  2K9Q A;  1FEX A;  1QVU A;  2Y30 A;  3UKG A;  2HOS A;  4UUT A;  4M3D A;  4CYC A;  3MVP A;  5EG0 B;  1X58 A;  2DA6 A;  1BA5 A;  1BL0 A;  2GM4 A;  3SDG A;  2XRL A;  4W1U A;  1FIP A;  1ZGW A;  4A3E J;  2DA4 A;  2LP0 A;  2M34 A;  3PO3 J;  5EDN A;  1JT6 A;  2XB0 X;  2LKX A;  1U8B A;  1XS9 A;  2R5Z B;  5IP6 A;  2JA7 J;  2NVQ J;  2DA5 A;  1ZR2 A;  2HXO A;  2K40 A;  2K9S A;  2VKE A;  3PO2 J;  5EF6 A;  2E2H J;  5JLX A;  3RZD J;  5IYC J;  2R92 J;  2N8G A;  2B63 J;  4C3H J;  1IDZ A;  3LSR A;  2DTZ A;  5EGO B;  2DA2 A;  1LE8 A;  5F27 A;  4FE7 A;  1ETX A;  1WPK A;  5GPA A;  2GBY A;  2HDD A;  4GFB A;  4QSH A;  2ME6 A;  1SFO J;  1QPI A;  1X2N A;  5DS9 A;  1NK2 P;  1T33 A;  2CRG A;  2ECB A;  3OSG A;  5K7Z A;  3BTL A;  3A02 A;  3FKI J;  2E2I J;  3BG5 A;  1OJL A;  2L7F P;  2DMU A;  2NS7 A;  5J3L A;  1ETY A;  4J19 A;  1K83 J;  2CUE A;  2Y9Y A;  2EZI A;  3NAR A;  1JTY A;  3MKL A;  1B8I A;  4BBS J;  4M3G A;  2ELK A;  2VI6 A;  2ZB9 A;  1JTX A;  2JA8 J;  3QPL A;  2CUF A;  4XIC A;  4HNV A;  2YU9 J;  4JX4 A;  2GLO A;  3ZQG A;  4DW6 A;  5M5Y J;  1JGG A;  1ZR4 A;  1PUF B;  3CMY A;  1I50 J;  3HGG A;  5HOD A;  1ENH A;  2DMP A;  1A5J A;  1OFC X;  4BY1 J;  4A3C J;  1ITY A;  5C4X J;  3ZQC A;  3H3V K;  2EBI A;  1RKW A;  4C3J J;  2TRT A;  5F0C A;  3LSG A;  3ZQI A;  2M9H A;  1IC8 A;  4A3L J;  3JRE A;  5FKK A;  2EZK A;  1TWF J;  3BR0 A;  1HDP A;  3CDL A;  3JRI A;  2R5Y A;  1H88 C;  3JR9 A;  5EYR A;  4M6V A;  3BR5 A;  2P81 A;  5EZG A;  3WHB A;  3HDD A;  4ABZ A;  3S17 J;  2HI3 A;  1P7J A;  3IH3 A;  4QTR A;  2NVX J;  4A3K J;  3NAU A;  2AO9 A;  3Q0V A;  1BJZ A;  1W0T A;  3RZO J;  1VFC A;  3C2B A;  3FK7 A;  5E3M A;  1GDT A;  1NK3 P;  1A6I A;  5IP9 J;  2CJJ A;  1TWC J;  2E2J J;  2XB5 A;  2FD5 A;  1FIA A;  3GTK J;  1IDY A;  3LNQ A;  3MN2 A;  5K7F A;  1F43 A;  2D5V A;  1RKT A;  3QQA A;  3S2D J;  2LD5 A;  3SFI A;  3CCY A;  3S2H J;  2G0E A;  3TED A;  2JJ7 A;  3G1O A;  1B72 B;  4BXX J;  1BW6 A;  3Q0W A;  1DU6 A;  1AU7 A;  2LLK A;  1XC5 A;  2MW8 A;  3I4M J;  1YRN B;  1F36 A;  2FX0 A;  5BNG A;  3B6A A;  3O8H A;  1ZQ3 P;  4S0H B;  4UUS A;  2HYJ A;  3JRC A;  1UMQ A;  2CU7 A;  2XPU A;  3A01 B;  1SAN A;  4IEJ A;  2H1K A;  3K7A J;  2KT0 A;  1JUP A;  3FIS A;  3BTI A;  4M3E A;  4DZP A;  4Y7N J;  3HOZ J;  1EF4 A;  3BG9 A;  3HB9 A;  3RQI A;  3S1R J;  1GV2 A;  2Y9Z A;  2JWT A;  3IH4 A;  3S15 J;  4MFE A;  1WH7 A;  3ZQH A;  4IHX A;  1FTT A;  3A03 A;  1AKH A;  4LOC A;  3I4N J;  1ETW A;  4AYB N;  4D5F A;  3GTO J;  3BTJ A;  3DEW A;  4CYC B;  2Y0S N;  4C3I J;  5GPC A;  2QF7 A;  2TCT A;  4JP0 A;  3FK6 A;  4JYK A;  5F0H A;  5F1J A;  2YS9 A;  4B4C A;  1Y1W J;  1IGN A;  3BR3 A;  1JJ6 C;  4XRS A;  3H0G J;  1JUS A;  1R9T J;  1GUU A;  2DMT A;  2COB A;  1MH4 A;  4A3F J;  1JKP C;  5GP9 A;  1K61 A;  3S1N J;  1RET A;  2W48 A;  4MIM A;  2HOT A;  5FKN A;  1E3O C;  5E3N A;  1ETK A;  5C3E J;  1IJW C;  3BR1 A;  1TWA J;  1I6H J;  1ETV A;  4JX5 A;  4D7N A;  5IPA A;  1MNM C;  2LVS A;  2OPT A;  2Y31 A;  1Q1V A;  3DCF A;  2MG4 A;  5F08 A;  3ZQF A;  3JRA A;  2IEK A;  1MBE A;  2VKV A;  2LY9 A;  4A3M J;  1NTC A;  2VUM J;  2LK2 A;  3LSP A;  2NOG A;  1LE8 B;  2R93 J;  4A3G J;  1ZTR A;  2ID6 A;  3HOX J;  2JA6 J;  4MFD A;  4G12 A;  2VPR A;  1JKQ C;  5JLW A;  3S16 J;  1HOM A;  4MO7 A;  4IHW A;  2NVT J;  1MH3 A;  5IYD J;  1RES A;  2RAE A;  3B6C A;  1P7I A;  3BG3 A;  1OCT C;  1MBF A;  1X2M A;  3TP3 A;  1B8I B;  2L9R A;  1ZK8 A;  2DA3 A;  2FQ4 A;  2JK3 A;  1ZKG A;  2XGE A;  5FKM A;  4DYQ A;  2CQQ A;  3BTC A;  3G1M A;  2WB1 N;  3HM5 A;  2XSD C;  4FTH A;  1HLV A;  2HOA A;  3JRF A;  2X9D A;  2XPV A;  2QCO A;  4DYC A;  1JKO C;  1AHD P;  3E7L A;  5FLM J;  5C44 J;  4FCY A;  5F04 A;  1MSF C;  5M3M J;  4X1E A;  1HCR A;  5EG0 A;  1ETQ A;  2PMZ N;  2E19 A;  1WCM J;  2X6O A;  1OCP A;  4B3A A;  2MSY A;  1O4X A;  3JRG A;  2R5Y B;  2ECC A;  4X6A J;  4JX6 A;  2XGD A;  1MSE C;  2NVY J;  5J1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...