5M5YJ

Rna polymerase i elongation complex 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5m5yJ00
4I6ZA 3MVPA 4C3HJ 1GUUA 4FISA 4D7MA 2M2EA 5EEAA 1ZQ3P 4A3GJ 1AHDP 2H1KA 2VKEA 4D5FA 1IJWC 2DA5A 3GBGA 2HOAA 2R93J 2MG4A 3I4MJ 2LLKA 3QPLA 2VPRA 3CCYA 1JTXA 4Y7NJ 3LSRA 1WI3A 1I3QJ 5IP6A 2DJNA 1HDPA 5M5WJ 2DA7A 5FKNA 1PUFA 2DA2A 1JUSA 1ZKGA 2D5VA 2EZKA 2YU9J 1RKTA 3FIWA 3GTMJ 3LSPA 4M6VA 1MBJA 2ECBA 3G1OA 5F04A 4JX4A 2ID3A 3BG5A 1RPWA 1RKWA 5EZHA 3GTOJ 5EG0A 4M3GA 1F36A 1JT0A 2NVXJ 2XGEA 2HDDA 3JRDA 3FISA 4UUSA 2DA6A 1JJ8C 4NDLA 5M5XJ 5FKOA 4B3AA 4BBSJ 5FLMJ 2K40A 1T56A 2DMQA 1W0UA 3HB9A 1Z0XA 4XRSG 1ETWA 4X6AJ 1MSFC 2DA3A 4B1RA 1NK2P 5GPAA 3OIOA 4MO7A 2R7ZJ 1IDZA 4A3EJ 5IYDJ 1TWFJ 5EGOA 5K7HA 4QIWN 5E3MA 2MSYA 2WAQN 1U9NA 4RBOA 4A3DJ 3IH2A 2M9HA 1TWHJ 2L7MP 1Z77A 3HGYA 3BR3A 5C4JJ 2FJ1A 2FX0A 2XPVA 3S17J 5JLWA 4Y52J 2GLOA 2VUMJ 2HI3A 3B6CA 5DTDA 2ME0A 3S14J 3B6AA 4FTHA 3S1RJ 3BR0A 5EZGA 4IEJA 3Q0VA 2EQRA 3DCFA 3HOUJ 1U8BA 4W1UA 1U9OA 3L1PA 3HOXJ 5IP9J 1F43A 3HKZN 2DMPA 2CRGA 5HODA 3A03A 1BW5A 1OFCX 1RETA 2I10A 4MFDA 3RKQA 3SJMA 1P7JA 1HDDC 2CUFA 1IV6A 3IH3A 3VPRA 3BG9A 3NARA 1ZR4A 4A93J 2XB0X 2E2HJ 1TWAJ 3G1MA 3QPSA 4DW6A 1MSEC 3CQZJ 3WHBA 4BY7J 4A3LJ 2IEKA 1E3OC 4FCYA 3S2DJ 2H8RA 3ZQIA 1IC8A 2XPWA 3M3YJ 2JA6J 2X6OA 2AHQA 4V2GA 3Q0UA 1FIAA 1X58A 5IP7J 1UHSA 3HDDA 1ZR2A 5F0CA 3H3VK 1WGXA 2IAIA 2GBYA 2JN6A 4J19A 4V2FA 3BR1A 4JX6A 3G1LA 5C3EJ 4XIDA 3JR9A 1ETYA 3ZQGA 2CU7A 3GTLJ 2LVSA 1IG7A 2JA5J 1YRNB 3DEWA 4IHWA 5EDNA 1MBEA 2DMNA 3GTGJ 2ZB9A 2ELKA 2RAEA 4A69C 3JRHA 1ZK8A 2M8GX 3S1QJ 2L9RA 1XC5A 2FD5A 5F27A 1G2HA 3BR5A 3A01A 3HEFA 3QQAA 2EZHA 2W48A 4JYKA 4I76A 5DS9A 2L0KA 2YS9A 1U78A 2N8GA 1B72A 4QTRA 3BQZA 1BJZA 1HCRA 1JKPC 4JP0A 1ORKA 2XRLA 4M3FA 4RDUA 2O8KA 4A3IJ 5K7ZA 1JGGA 4EEFG 2LKXA 2R5YA 3JRCA 1JKRC 1ETXA 3LOCA 1DU6A 2JK3A 3JRFA 1B8IA 3M4OJ 1RESA 4IHVA 3HOYJ 1JT6A 1X2MA 2KT0A 3HBLA 2R5ZA 4BY1J 5FKKA 1BW6A 4QSHA 2OF7A 1VFCA 1WPKA 1H88C 1H8AC 3MKLA 2EH3A 4A3CJ 3FK6A 3HM5A 1WH7A 3E7LA 3UKGA 3OSGA 1OCTC 3S16J 1MBFA 4C3IJ 3K2AA 2HOTA 1I6HJ 1JUPA 2VKVA 3BQYA 2ME6A 2NOGA 2M34A 3RZDJ 4MFEA 1UMQA 4UUTA 4M3DA 2OPTA 1APLC 2O7OA 3PM1A 2HQ5A 5F0HA 4CYCA 4DYQA 1AU7A 3ZQLA 2LP0A 1GDTA 1FJLA 3JREA 1JKQC 3GTQJ 3ZQFA 4B4CA 1K83J 3SFIA 1S7EA 1LE8B 1CQTA 5FJ8J 2K9NA 3NAUA 3HGGA 2JA7J 3PO3J 1D5YA 2NVYJ 4C3JJ 3S15J 4ABZA 2FQ4A 3BTJA 5BNGA 3PO2J 3JRGA 4JX5A 4S0HB 1OJLA 5K7FA 1HOMA 2HOSA 2X9DA 2LD5A 5JLXA 1W0TA 2MW8A 1AKHB 5F1JA 2CUEA 1MBGA 4XRSA 4X1EA 3K7AJ 2HXOA 1WCMJ 2L7ZA 1I50J 3HOWJ 1XS9A 3A01B 1JKOC 3GTPJ 3LSJA 5F08A 4DZJA 1R9TJ 1ETOA 1SANA 5IOZA 5J3LA 1IRZA 1PUFB 2E2JJ 2XGDA 2JJ7A 3TW7A 2NVQJ 2DA4A 1ETVA 1IDYA 1Q1VA 3SDGA 2HYJA 2NS8A 3CMYA 2GM4A 3ZOBA 2Y9YA 3GTJJ 2WB1N 1IUFA 5IOYA 2AO9A 3JRBA 5EG0B 5GP9A 1B8IB 1MBHA 3BTCA 5IYBJ 4UUSB 1RR7A 2Y0SN 3S1MJ 1FEXA 1P7IA 4C2MJ 5M3MJ 2R92J 1Y1WJ 1BA5A 1VI0A 4A3MJ 3I4NJ 2IBDA 2CQXA 3RQIA 5E3LA 9ANTA 2XB5A 1QVUA 3A02A 2E1OA 2LR8A 4GFBA 2M0CA 2LK2A 3FK7A 2X48A 3BT9A 5C4XJ 2NVTJ 4FE7A 5EGOB 1TWGJ 4D7NA 2DTZA 2VI6A 4G12A 1SFOJ 1A5JA 1XG1A 1ZTRA 2K9QA 5EF6A 2LTPA 1GV2A 2Y30A 5GPCA 3BTIA 1TC3C 3C2BA 2XSDC 3OSFA 2HXIA 1FTZA 2EZLA 1POGA 4DYRA 3IV5A 1JJ6C 2KDZA 3BG3A 4CYCB 4BBRJ 4XK4A 2DMTA 1QPIA 1VNDA 2LY9A 4D5CA 2JWTA 5IPAA 1NK3P 4AYBN 4M3BA 1HLVA 4MLOA 4IHXA 3TP0A 1NTCA 3ZQHA 2K9SA 2EBIA 4MIMA 1YRNA 2DMUA 1ETQA 1FIPA 1QRYA 1LFUP 1DU0A 3JRIA 4IHYA 3D1NI 2DN0A 1LFBA 3ZQCA 1IGNA 4BXXJ 1O4XA 1X2NA 5E3NA 3MN2A 1TWCJ 3Q0WA 4M3EA 2TRTA 1K61A 2L7FP 2G0EA 3W6VA 5J1RA 3F0CA 3FKIJ 4BKXA 2EZIA 1JTYA 3TP3A 1ZGWA 3HOZJ 3JRAA 5E3OA 1FTTA 1VF9A 1WH5A 1OCPA 1HF0A 2QCOA 3TEDA 3H0GJ 2Y9ZA 3S1NJ 5F0FA 1H89C 4A3FJ 4A3JJ 4FE4A 2MGQA 2DA1A 2P81A 3LNQA 5EYRA 2O9LA 2NS7A 3LSGA 3O8GA 2XGCA 1BL0A 5C44J 3Q3SA 1ETKA 1GVDA 1Y1VJ 3CDLA 1MNMC 5M3FJ 3BR6A 1A6IA 4AC0A 2B63J 5FKMA 5M5YJ 5IYCJ 1ENHA 1GT0C 1B72B 1UG2A 3HOVJ 3BR2A 2PMZN 3S2HJ 2ECCA 1MH3A 4AUXA 2R0QC 3BTLA 1MBKA 2LFBA 2YUSA 4A3BJ 2JA8J 2R5YB 2Y31A 2QF7A 1T33A 4A3KJ 4XICA 2E2IJ 4XRMA 5FLVA 1MH4A 4LOCA 4W97A 2CJJA 3TW6A 4DYCA 2COBA 2JMWA 2Y2ZA 5J1YA 1ITYA 1QVTA 2TCTA 3WHCA 4L5EA 1LE8A 2R5ZB 3IH4A 3OOUA 1GV5A 3GTKJ 2E19A 3O8HA 2ID6A 2CQQA 4HNVA 1JUMA 2XPUA 1EF4A 2WV1A 5FKLA 4DZPA 5J1UA 3RZOJ 1AKHA
chains in the Genus database with same CATH superfamily
4I6ZA 3FXOA 1V4RA 3F8CA 3BZCA 5ILSA 3KP6A 2H1KA 2VKEA 4D5FA 2R7RA 1VQ7I 2DA5A 3GBGA 1OKRA 4O3MA 1KU2A 3I4MJ 2VPRA 2E1MB 1IW7F 1I3QJ 2DJNA 1HDPA 1TLHB 2DXIA 3KIOA 2CUZA 4BEHB 5B1BH 5FKNA 2D5VA 1P4XA 5AIQA 5GTIC 2DTRA 2HOEA 4R8HA 4G7HF 4M6VA 4V19K 2ECBA 2RKHA 4RB2C 3IKVA 3H9JA 2KRHA 2E1CA 2XVCA 3L9FA 1T39A 2DAOA 4ZDPA 4A5MA 2EK5A 4NC8A 4P1WA 2VB6A 1ZG1A 3FXJA 2HDDA 4PFPA 2FBIA 3BY6A 1YOVB 2DA6A 3GLXA 4XQFA 1BM9A 3CMMA 4NDLA 1FYLA 5FKOA 1S6LA 2QVOA 2P5VA 2K40A 1T56A 4NB5A 1Z0XA 3M7GA 4BGDA 3JW4A 1CGPA 2ZNYA 3K70D 2M4KA 2M87A 1QBJA 2HVQA 4OOIA 2ZO4A 2MSYA 4YIFA 1U9NA 4M9XA 1A6QA 2LRDA 4RBOA 1YJ9I 1DDNA 4A3DJ 1STZA 1FYKA 1VQLI 2M9HA 3IRRA 3CP2A 2KP6A 1HKTA 1BR4A 3WODF 2FJ1A 1FNNA 4D9JA 4LG0A 3ZMUA 5JLWA 3QU6A 1UAAA 4Y52J 4DIQA 3V7RA 2VUMJ 2GA2A 3RQ4A 4YFXF 5DTDA 4RGUA 5DUIA 2CQ7A 4U0YA 1KU9A 1DUXC 2L3DA 3H5AA 4BQNA 2NAZA 5EZGA 2P7CB 3DCFA 3Q0VA 1OR7C 1U8BA 1MMSA 2PLYA 1PJRA 3CJQB 2QA4I 1MKMA 2WY8Q 3A03A 2DFHA 2WAQA 1OFCX 4MQVA 1ZRFA 1BW5A 3G2BA 3LQQA 2P8TA 3OYFA 1J59A 2KPMA 1KYWA 1ZR4A 1O7FA 3AG1H 2E2HJ 2VLAA 3G1MA 4AU7A 2X4HA 2RN7A 3WHBA 4A3LJ 4FCYA 4L9TA 1PYVA 2H8RA 2EIMH 5E1ZB 3ZQIA 1G3WA 2VL8A 2PMUA 1IC8A 1OCRH 3M3YJ 5D8LB 1ZN2A 1VQPI 4RMNA 1RZ4A 1OCZH 2JA6J 1KYZA 2FRHA 2AHQA 3CDHA 2DODA 3KLNA 2TDXA 5IP7J 3IAM2 2LH9A 4HX8A 3HDDA 4XN0A 2I5UA 1BN5A 3ZP5A 4OINF 2IAIA 3OR2C 4V2FA 4JX6A 5C3EJ 1FMWA 1Y0UA 2CU7A 1TNTA 4XSZF 4CYDA 2LOOA 2OU2A 2OQRA 4XKVA 4ZYGA 5HDKA 4IHWA 2ZMEC 1O57A 4Y17A 5J6XA 2ZB9A 3PJRA 2ELKA 3G4SI 2E7XA 2QKMB 4XN3A 3MCZA 1J09A 2WAEA 4OAZA 3OYNA 3VDXA 3WTVC 1XC5A 2PJPA 2DDBA 1TTYA 2X6WA 5F27A 3HXLA 3CCVI 3BR5A 3A01A 3GW2A 2LMDA 1ZGJA 4FHTA 1V54H 2ZXJA 5CVUA 3DBLB 3MZYA 4QTRA 4PCQA 3KLOA 5E18F 2WBMA 4XKWA 1JKPC 4JP0A 4PGHA 4MQ9F 2JRMA 1ZHFA 4RDUA 2O8KA 5FROA 2AQFA 1JGGA 4EEFG 3HRMA 3JRCA 1TQPA 3HSRA 4MGRA 1CF7B 4EJTA 2VONA 2HKOA 3U9GA 3I71A 1K79A 1GLNA 3P9CA 4IHVA 1YTYA 3HOYJ 1JT6A 1X2MA 2KT0A 2STTA 3KETA 4ENJA 1JXSA 2EFOA 4HX7A 1H88C 2OQGA 1FSEA 1MJBA 3MKLA 4P55A 3P9KA 4YIRX 4A3CJ 2OAZA 1T98A 3UKGA 1EJ9A 2NNNA 3QYFA 5GAHJ 2HOTA 2K02A 5IY5H 2XC7A 2VKVA 5L3FA 4E7ZA 3JAMK 4IOAF 2EINH 3GFJA 3K9TA 3CMEI 2R7QA 5ED4A 3K4BA 1B59A 3EUHC 3PNTA 4UV8A 3ECOA 2KHMA 2BV6A 2JVGA 2A68F 4UUTA 3QAHA 4CYCA 1AU7A 3OYLA 4DYQA 1U2WA 4IL6C 1S9HA 3WU2C 4BEHA 1FOXA 4C2TA 2K4BA 3I59B 3MKYB 3GTQJ 1LDJA 1Z3YA 3KP5A 1K83J 4B4CA 4NBQA 1XCVA 2UZKA 3I53A 1LE8B 3HGGA 2JA7J 3LSMA 4LMYA 5CPRB 2MD5A 2LKSA 1I6XA 3IUOA 3RSNA 2NVYJ 1O3QA 2ISZA 1PVEA 3J7YJ 5TGTA 1YIJI 4RA2A 5BNGA 4JBAA 4XSXF 2IJLA 4KN7X 2FUG2 1VTNC 3X2QH 1OJLA 2ZFUA 1BJAA 2ICWG 2HOSA 1HOMA 2LYCA 1N77A 3H0DA 5JLXA 3K0LA 2W24A 3DFGA 3KP4A 2RNGA 2L7ZA 1I50J 3DLLF 1V5EA 2MABA 1DQUA 3RKYA 2R7WA 3LSJA 5DYMA 2OBPA 1OR7A 3ELKA 1SANA 2O6GE 2JA2A 5EEGA 2VC0A 2ZJPF 3GVAA 4EJOA 1ETVA 3SFZA 1KA8A 3QP6A 1YE9A 3I4PA 5D5UB 3SDGA 1NG7A 2NS8A 2O61A 2GM4A 3KE2A 3ZOBA 2FBKA 2Y9YA 1BI3A 3K4NA 3KZZA 3FXUA 3OV8A 5TISC 2Y0SN 4LIVA 3S1MJ 1P7IA 2ZXWH 4C2MJ 5M3MJ 2XGXA 5D6EA 2R92J 1QNTA 3DP7A 1P4AA 3M1EA 2XB5A 1QVUA 2KMUA 3A02A 4B44A 2STWA 3U21A 2M0CA 1FOWA 2LK2A 5L3BA 2RC4A 2YR2A 2X48A 3HSEA 3BT9A 3EETA 2UWMA 3GO5A 1L3LA 2Q8KA 4D7NA 1YX3A 2VI6A 4KMFA 1A5JA 1XG1A 2OCEA 2VJJA 1ZTRA 4PFOA 1QGPA 1GV2A 2Y30A 2ZMEA 4HSTA 3G73A 3ZQQA 5AIPA 4DYRA 5KK1A 5HLGA 3BG3A 3OS1A 2V26A 3OOPA 4BBRJ 3GZ6A 1D0ZA 3ECHA 3GYHX 2RNJA 2RV8A 4UV9A 4Q48A 2MFZA 1DPUA 4D5CA 1XPXA 1KQ8A 4GYGA 4UVAA 3FF5A 3ZMDA 3MFKA 4E7IA 1O7LA 2CSOA 1HLVA 3TP0A 3PNYA 5HNFA 3F9KA 2EBIA 4IOCF 3HSFA 2DMUA 1ETQA 1NH3A 1LFUP 1OCCH 3GF2A 4DQ2A 2KQRA 3SYTA 5JHUA 2F5DA 3CO6C 1R6RA 3MN2A 2BVLA 2TRTA 2AQEA 4AIKA 4WXDA 2GOXB 1VQ9I 3CMAI 4PJNA 3W6VA 1SAUA 4LK1F 4ZYAA 3FKIJ 2PI0A 1BIAA 2ZNZA 2EZIA 1JTYA 3M9AA 3J81Z 3VYSB 1QPMA 2H8WA 3HPGA 2PJRB 4P96A 3PQKA 5HOOA 4B47A 3LMMA 1FTTA 1JE8A 2QEXI 5FGMA 4EGYA 2K3FA 1HF0A 5L3CA 1JHFA 5K5OA 3IWZA 2LDUA 5F0FA 2KIFA 3F6OA 4XR6A 1MMDA 5E20A 4FE4A 4A5NA 3OYAA 3D5SC 2DA1A 4M71A 2ADUA 3RYPA 2ZFWA 3HOTA 4L0YB 3W2WA 2EV6A 2DYRH 2X0LA 2EIKH 5D5VB 1Y1VJ 3C18A 4E7HA 4XLFA 4UHTA 3ABMH 1T0FA 3BR6A 4IQJA 4H4KC 3A1YA 2PEXA 5D8KB 5AONA 2VT2A 3CC7I 2IXSA 3ESWB 5FD6A 1SFKA 3DTKA 2VBZA 4RAGA 2GA1A 1EH6A 1R58A 3KFWX 3JAMZ 1DGRM 4IF4A 2MC3A 4RM2A 3F8NA 2CQNA 5H6RA 3S2WA 3NWTA 4EMSA 4DOZA 1MBKA 4P5OA 1L0OC 2LFBA 2UUZA 3CF5F 3G6EI 4CDGA 2WY7Q 3SEZA 1MJ9A 2CGPA 1HW1A 1ZG3A 4A6DA 3DWLE 4A3KJ 2EFPA 3T5XA 4XICA 1ZG5A 1ZLKA 2XRNA 3LA2A 3C2HA 1YFHA 2LY1A 3ERMA 1G3SA 5FLXK 4LOCA 5FRNA 1MNDA 3CJNA 3OMYA 1YW9A 2IS6A 2VQCA 3ONQA 1PUEE 1DP7P 5L3GA 3EYIA 1LE8A 3CC2I 2M1BA 1WKMA 1GV5A 1TNSA 3IHUA 1T95A 1XGSA 1RR8C 2V4JC 5LLQA 2E19A 3DTEA 2HFHA 4O6JA 2Z3YA 3I56I 5BMZA 3H9GA 2P5LC 2CQQA 1B9NA 1LUJB 3BJAA 3CCEI 4UXNA 1JUMA 1ZARA 4EJVA 3GUDA 4BDYA 2BZTA 2E34A 3RDIA 5ERIA 3E5QA 5L3DA 4HX4A 5DD4A 3VB2A 1IJWC 1VQOI 3LAJA 2CFXA 2FOWA 1JTXA 2BY1A 2DT5A 2DU9A 4CCLA 5IP6A 3FMQA 2HKXA 2R3SA 4PSXA 2FNAA 4BXFA 1LKXA 2FA5A 3D5RC 3F22A 1RUNA 2EZKA 1I1GA 1BBYA 3GTMJ 1LDDA 4XMYA 4HYEA 2CG4A 2DOFA 1XDUA 2VC1A 1YS6A 1E17A 4AVPA 2DCEA 2DO7A 3BG5A 4KITB 1N25A 3R0JA 1SVOA 1U5TB 5DUKA 3V7SA 1UZCA 4P9UA 1RKWA 5EZHA 4IZZA 3PIOF 4KT6A 3E0JB 4M3GA 1F36A 2L9NA 1JT0A 2NVXJ 1W4MA 4ZTFA 3JRDA 2P7VB 4KT5C 2XDVA 5K1YA 2HZDA 1WFXA 3ERED 1D8JA 4MTDA 2EFQA 2X1DA 1J7KA 3GLLA 4BBSJ 5FLMJ 3E6MA 2DMQA 1ZLJA 4II2A 3HB9A 4AIDA 4X6AJ 1MSFC 2IW5A 4B1RA 5LBQA 1Z05A 3JSOA 3GWZA 2HDWA 1T38A 4L9VA 1HC8A 2B0LA 1LEAA 1IDZA 2Q0OA 5IYDJ 5E3MA 3R6SA 1ULYA 5H2FC 3R61A 1FSHA 1TWHJ 1Z77A 2C6YA 3HGYA 2LREA 3WTTC 4RLQA 5C4JJ 3ZPLA 2HYGD 1XMAA 3K10A 2KIMA 1R36A 4KFCA 2DK5A 3H3ZA 3B6AA 4LGWA 1LVKA 3WTWC 1WI9A 2MH2A 2KL4A 4N4OB 2ZC2A 3DBHB 1U9OA 4W1UA 2NVUB 2EIJH 5BS6A 1I39A 1XGMA 2CS3A 5IP9J 2L9VA 1P2FA 2XAHA 4ZDLA 5HODA 4IJAA 1RETA 3FM5A 3RJPA 1SFEA 1P7JA 4A0ZA 5B3SH 1FBSA 2K9LA 2DQLA 3NARA 3ZMVA 1R5GA 1SD7A 1TWAJ 3ZMTA 1R7JA 3CQZJ 3BDDA 4BY7J 3ZGKA 1QO0D 1SFXA 4BL0B 3S2DJ 1QA6A 3M07A 1K4TA 3SZTA 3TQNA 4N4NB 1IN7A 2XPWA 2VT3A 1J0RA 4CA0A 3LA7A 4NC7A 2K85A 4V2GA 3Q0UA 2EPFA 2Z9OA 1X58A 2V6CA 3BJOA 5FRMA 1X1PA 1ZR2A 3H3VK 4WCGA 1UG0A 1R1UA 1YS7A 2GBYA 1S5LC 1TQMA 3BR1A 3JR9A 1K78A 4MTEA 1R4MB 3FXLA 2LVSA 3L2VA 1YRNB 1ON1A 2BGCA 1R4NB 4CCMA 4G94A 4L0ZB 1BC7C 5DDGA 1MBEA 3WU0A 3GTGJ 5DEQA 3A0HC 3JRHA 2LC2A 4A0YA 4ZTJA 2GQQA 3I54A 4BXUA 2D1HA 2L9RA 4BH9A 2FD5A 1OCOH 4ETSA 1J5YA 3HEFA 3G3ZA 3QQAA 2EZHA 4BHCA 2JTVA 4I76A 2A6HF 2ZCWA 1U78A 4YFKF 1LEBA 1Y0NA 2XF5A 3SZGA 1W5CC 1Z67A 1HCRA 3QOPA 3DKYA 1D1CA 4C30A 3QODA 2VE9A 4UVCA 5KAIC 4BYYA 1GVJA 3F23A 1FT9A 2YU3A 1EH8A 1JKRC 3VFZA 5FLXZ 2A5WA 2W82A 2E1MC 2M45A 1RESA 3BWGA 4F55A 2XAQA 5JHFA 1QHHD 4HQEA 1YG2A 2VQHA 1X19A 2LBFB 3DV8A 4BY1J 2RVCA 4S04A 1BW6A 4LLLA 2OF7A 1X1AA 1WPKA 1VFCA 2W00A 4HZFA 3QYEA 4RAZA 2F2EA 3T0YA 2D1VA 3AAFA 1LJ9A 1TP4A 3GCMA 4IPAA 3ULQB 3SHFA 5ICEA 3BROA 3FK6A 3E7LA 3I64A 5LD2C 3K2AA 4OAYA 2CO5A 3A4CA 3P5JA 3GFIA 2NOGA 2EA2A 3ZMSA 2OTLI 1J9IA 4CH7A 3RYRA 2Q2EA 1B6AA 2DJIA 1H9TA 5B66C 1UMQA 4B48A 2GXBA 1X1DA 1VQ6I 2OPTA 5TRDA 3F8FA 3PM1A 4CSWA 1WRJA 4DNCA 3NQOA 1MZBA 3JREA 2OCCH 1G59A 5GTHC 3BZKA 3ZQFA 5CVRA 2QQAA 2CMPA 1CQTA 5FJ8J 2IP2A 2M3AA 5BPDA 3PO3J 1D5YA 1LPQA 3S15J 2KJCA 1U5TA 2BBYA 2MYSA 1X1BA 4ABZA 3LSKA 2LF7A 4G6TB 1WJFA 1RC9A 3KPHA 2JSCA 4E4HA 3JRGA 5K7FA 5HLTA 1K4SA 4KISA 2MBFA 4A0XA 2X9DA 3LSHA 5F1JA 2ZJQF 2WV0A 3QP5A 1FOKA 4X1EA 3K7AJ 2MC4A 2Z2SB 4LLNA 2JQ7A 2FBHA 1R9TJ 1YW8A 1PDNC 3Q9VA 2G7UA 5IOZA 4WF2A 2QQBA 1PUFB 4DGWB 2W4SA 3R0AA 2A6TA 3IWFA 2BXZA 1TL8A 4HLYA 4PJJA 5HLIA 1RIOH 3R60A 3TGNA 3HHHA 3MWMA 4A6EA 3H92A 5ICGA 1R23A 4HAMA 4XLEA 1BIBA 5F6FA 2IGOA 4F92B 4HA8A 5LEKA 4I01A 1IUFA 3BJ6A 5EG0B 5GP9A 1IN5A 4PDKA 1B8IB 4EQQA 2W7NA 2E71A 3PNVA 5IYBJ 4UUSB 1YX5A 2B7EA 5KNLA 4N9HA 1Y1WJ 1VI0A 3I4NJ 3AG4H 1YI2I 4P9FA 2CQXA 3RQIA 5E3LA 9ANTA 1IRXA 2XHKA 4G7OF 5KHDA 3TO6A 2E1OA 5H6QA 3QPTA 2MA3A 2YSRA 4YRVA 1A31A 2K9MA 2LY2A 4BQQA 1UHWA 2W25A 3OYHA 3J81K 4AM3A 4Y4RA 3OYJA 2BY0A 1Y39A 5C4XJ 4M72A 3FMSA 2ESNA 1E2XA 3CCMI 1QU3A 4GYIA 2F5FA 4G12A 2K9QA 2P4WA 1EH7A 4BDZA 1FYMA 2DYSH 2XSDC 1ACIA 2LKPA 3TMOA 2FF4A 2CV2A 4GDFA 2M4GA 4IRHA 1XGOA 1JJ6C 2F4OB 2VPLA 4XKBA 2Y0SA 2KZGA 3HHGA 2EILH 1IXCA 1AA7A 2VOOA 1U3EM 2QGUA 3CLQA 3CCJI 2YPRA 1VZ0A 4D0PA 2JWTA 1NK3P 3E97A 3CCUI 2HYFA 4M3BA 4AYBN 1Z9CA 4IHXA 2Z99A 1LDKB 3O6BB 4MIMA 4IXAA 1YRNA 1HA8A 1TW2A 3OIQA 2XIGA 4YELA 1P6RA 2KRFA 1DU0A 3V42A 4IO9F 2A07F 2DN0A 3ZQCA 3MZHA 3L00A 1UCRA 5L3EA 2RREA 1O4XA 4B43A 1SD4A 1IN8A 5ILUA 5E3NA 3KZIC 3N97A 2LNBA 5CVVA 1ZRDA 4G6DA 1SD6A 5CLSA 1WQ2A 2G0EA 3FMRA 5LFAA 3J80K 3J7ZI 2CUJA 5J1RA 3HYIA 3TP3A 4TV7A 1T0FC 3PSFA 1ZGWA 2EWNA 3KEOA 5E3OA 4RS8A 1WH5A 1OCPA 3TEDA 3F8BA 5JFRA 3H0GJ 1TZLA 4L9JA 3WE2A 3S1NJ 2H1LA 4PJMA 1F4KA 4A3JJ 3W6KB 2MGQA 4XOTA 3LNQA 5EYRA 2O9LA 2NS7A 2V9PA 2PFBA 3LSGA 1VQ4I 4Q4ZF 3C1DA 3Q3SA 1GVDA 1S29A 1OISA 2XUBA 2PMHA 4LJZF 4YEJA 2QM3A 2LBFA 3L2QA 1MNMC 1MD0A 5FKMA 5M5YJ 2GXGA 1A36A 3HZJA 3EPZA 1OPCA 4RM3A 3ZRGA 1ZYRF 3K1NA 2PMZN 4PZJA 4WX9A 1W7PD 3S2HJ 2ECCA 2BY2A 2NS0A 4AUXA 3I5UA 4I7HA 1ZREA 4I0BA 3MZ8A 4BUPA 2X51A 1SC7A 2OA4A 4A3BJ 2VKHA 3PQJA 2WC2A 2R5YB 1G4DA 2PX9A 3OIPA 1T33A 1XSDA 5CQEA 1D1AA 2E5ZA 1MNEA 1REPC 4W97A 5HS8A 5J1YA 4DYCA 2JMWA 5D4RA 1IAWA 3C7JA 4BAYA 4B09A 4L5EA 1T08B 2FSWA 3CZ6A 4M74A 5ICFA 2OTJI 2OV7A 3IH4A 1JHHA 2AXLA 2A69F 1XDSA 2CH0A 4ENNA 5HDNA 3O8HA 2MH9A 1Z7UA 2ID6A 3U2RA 3ZR8X 3K2ZA 2L5QA 2DPUA 3T8RA 5FKLA 1R49A 2DFFA 1SMYF 3LAPA 2HVRA 2JRTA 3F3XA 1ZQ3P 5EEAA 3FX3A 2HEOA 4A3GJ 4CZZA 2V6EA 2G7HA 2HOAA 2QYOA 2R93J 2LLKA 3RKXA 4KIFA 3CCYA 4Y7NJ 4HF2A 3BCAA 2VBYA 1WI3A 2BE5F 2DFEA 2V9VA 3D5LA 1BOAA 2QENA 1PUFA 1ZKGA 3AL0B 2YU9J 4KA4A 1P9QC 2MLGA 4XNFA 3LSPA 2Q1ZB 1MBJA 1GHCA 2W84A 3G1OA 1LQ1A 3FXRA 4JX4A 3K4LA 4KNYA 3RPQA 2Z5UA 4CICA 4UNOA 1RPWA 4UB6C 3HRSA 2NYXA 2HDCA 3FBIB 4GGGA 2ACJA 3RKWA 2BW3B 3GTOJ 5KCMA 5EG0A 2IS4A 1XMKA 3KEYA 4EVIA 2BXYA 2JZYA 5B5EC 3FISA 4UUSA 1MDMB 1HBXG 2IA0A 4ZJZA 1RUOA 4AD9A 2E60A 1BI0A 2X1EA 1JJ8C 2GXAA 3V8JA 5LGNA 3AL0C 1E0EA 3ZN1A 4LG3A 4XRSG 1TW3A 3COAC 1ETWA 4YIIA 2DA3A 1NK2P 2EB7A 2QZ8A 4IX7A 3OIOA 2OJED 3OY9A 2GAUA 3QRFF 2R7ZJ 2OC6A 3V7CA 4Q5SF 1TWFJ 5K7HA 4EV0A 2JUCA 3KX2A 3L09A 4QIWN 1BR1A 2BHZA 3IH2A 4ZDOA 2ZSIB 2L7MP 2QQ8A 4M73A 1LFPA 2HQAA 3BR3A 3LFKA 2NRAC 4UVBA 2DT6A 4FX0A 4DJAA 3RPUD 2FX0A 2COMA 1CF7A 1IZ1A 2O8XA 3S17J 3JSPA 2DK8A 1W5SA 3B6CA 2ME0A 3S14J 4F7ZA 4FTHA 4BJTA 3S1RJ 4N0BA 3BR0A 1JGSA 3VYTB 3C3WA 3HOUJ 1VQNI 2CYYA 2X85A 1G8XA 3L1PA 2F6CA 4Z2YA 3EUKL 4RGRA 1F43A 2XAGA 3BLYA 3W3CA 5JR3A 3E6CC 3HKZN 5TJJA 5LRRA 5K5RA 3KYLA 5BQTA 4MFDA 1ON2A 2AXTC 2YX4A 3SJMA 2E35A 1HDDC 3QWLA 2NNYA 3VPRA 3BG9A 1Z7LA 3L2UA 2M30A 2GZWA 2EJRA 4LLGF 4CCJA 4A93J 3I58A 4MNUA 1K6OA 2Y48A 1MSEC 3OS2A 1W36C 4RAFA 5J40A 1Z6TA 3J80Z 4HSRA 3KEQA 1T6SA 2L54A 1P92A 5EJCA 3AFHA 1UFMA 1V3FA 3S32A 5KVRA 2X6OA 3ZXSA 4A12A 1FIAA 2V7FA 1D5VA 1IRFA 1UHSA 2X1CA 2VJ4A 3N4MA 2Z33A 3CJTB 3I59A 5F0CA 3OYCA 3AG3H 3ZQ7A 2HWVA 2JN6A 3VYUB 1ODDA 2JT1A 3G1LA 4XIDA 3ZQGA 2QWWA 4RLFA 2HS5A 4HBLA 2EV0A 2IVMA 1IG7A 2JA5J 3PIPF 3SQNA 2G9WA 3KZYA 2ELHA 2XV4S 2KIQA 2RAEA 1YJNI 5LGUA 2L9SA 3BG6A 4GO1A 3L7WA 3S1QJ 3CCSI 4II3A 3H35A 2R7VA 3SEQA 2IRFG 3JCUC 4FQGA 3GFMA 1QZYA 2L0KA 2WTEA 3WGIA 1S7AA 3BPVA 4I0AA 4ON0A 4YFNF 2QSFX 1BJZA 3NRVA 3K4KA 1YLFA 2H27A 5J47A 3KCCA 1BC8C 3K6GA 3HRTA 4CCKA 3F8MA 3V8LA 3K4MA 4HDVA 3OYBA 4A3IJ 2F5EA 2H6BA 5ICCA 1S72I 1R71A 2LKXA 2R5YA 3DLAA 3KP2A 1ETXA 1DU6A 4HPQA 3M4OJ 2O3FA 2JSPA 3MAJA 1O3TA 2H6CA 1EA3A 3BOQA 3LA3A 2VXZA 3N05A 1K6YA 2QBYB 4XLPF 2MLKA 5FKKA 4M9SA 3FHNA 1B4AA 4HG2A 3WTUC 1IN6A 4XLHA 3DPTA 1FOYA 1H9GA 2FQ3A 3BPXA 3CJRB 3MQ0A 4J00A 3O3KA 1H8AC 1KU7A 3ABKH 2EH3A 2A61A 4XKCA 3HM5A 1WH7A 3S16J 4BHBA 1U5TC 4O5VA 3SDBA 1PP7U 4G6QA 4RB3C 1JUPA 3ABLH 3K69A 5E8GA 4RGXA 3BQYA 4Y15A 4N9IA 1Z6RA 2BOLA 4IKFA 2M34A 4R79A 3CUOA 3NEUA 4MFEA 4D1QA 2FEZA 3WTZA 1R5ID 4HF1A 1J75A 3TBIA 4S05A 4M3DA 1SVLA 3JTHA 1S7OA 4BHPA 4CCOA 1APLC 2K3PA 2HQ5A 2DOEA 5F0HA 3DEEA 1QZZA 2DDAA 1FJLA 1TBXA 2V1UA 4U88A 4Q47A 1X3WB 1D8KA 1FMVA 2NXNB 2V79A 1KZHA 1S7EA 3FXMA 4EJWA 4CO8A 3W2AA 2VASA 3M1CA 3P7NA 3WG7H 4C3JJ 3IC7A 4EGZA 2IS2A 3VODA 3MEXA 2BW3A 4AIJA 3PO2J 1W1WE 3FZVA 4JX5A 2DQRA 2IGKA 3BG7A 2LD5A 1AKHB 2MW8A 4NHJA 2CUEA 4MHGA 1MBGA 4X0GA 2V9KA 3ABUA 4XRSA 1O3RA 2HNHA 5CJ9A 5F64A 2K5CA 4RGSA 1UELB 2K27A 2O03A 5D4SA 4M6XA 1XS9A 3A01B 4LIUA 1JKOC 2PJRA 3S3OA 3A0BC 2KLOA 3PSIA 1ETOA 2KISA 4Z6YA 1FX7A 1K7AA 4HQMA 5J3LA 2L02A 4GRIA 1H0MA 2E2JJ 2JJ7A 3TW7A 4E7JA 2NVQJ 2WAFA 2Y69H 2DA4A 4LFUA 1U6GA 4I98B 1YQAA 4OIPF 3DQVC 3CMYA 2HQNA 4ZYHA 4WK8F 2WB1N 2XASA 2XAUA 2AO9A 1T2KA 4JQFA 1HKQA 5DCMB 3CESA 1WJEA 5JVTA 4PJ0C 4PJLA 3BTCA 1X4PA 1QZEA 4BQAA 1BA5A 4A3MJ 2QSGX 4JOMA 3QYBA 2A05A 2BHYA 3ASOH 5DV5A 4GCVA 2IBDA 2KKOA 2P0WA 2VIXA 2R7OA 3S3MA 4KICA 3KYCB 2LR8A 2V1XA 2GWRA 3T1BA 2R7SA 2ISYA 2HPIA 1WVRA 1WJDA 4IHSA 2NVTJ 4ZZLA 4HV5A 4FE7A 5EGOB 1TWGJ 1SFOJ 3E6DA 2UV1A 5GPCA 1TC3C 4CXFA 3C2BA 4U7BA 2HXIA 4HF0A 2EZLA 1POGA 3M8FA 4F3QA 2HVSA 2L01A 4EM2A 3ROUA 4RAYA 4IRIA 3OS0A 2KDZA 1PP8F 3OR1C 1AOYA 3DF8A 4CYCB 3VOEA 1IO2A 4XK4A 4BACA 1XCBA 1HW5A 1QPIA 1VNDA 4Y33A 4B3XA 1HW2A 4H0EA 5IPAA 2OD5A 1FBUA 5IT3A 5KAFC 3ZQHA 1NTCA 3CUQB 2K9SA 3EYYA 4KJZA 4UB8C 1JI8A 3VWBA 3KP3A 4LB6B 1FIPA 1QRYA 4BJ5C 4LB5A 4IHYA 4F52A 1LFBA 1IGNA 3H3UA 1ZELA 2EA4A 3O2PE 1TT0A 4BJ6C 5D5WB 1X2NA 1TWCJ 4M3EA 3VYRB 2XKOA 1K61A 2L7FP 5DM7F 4OMZA 3GZ5A 1E3PA 4K2EA 4M9ZA 3F0CA 3KP7A 3QPHA 1A04A 3HOZJ 3JRAA 1MW7A 2L7KA 1XMXA 3CUQC 2IGMA 1KONA 4PGGA 4AYBA 3I3LA 2OZUA 2QCOA 2A6EF 2VBWA 1AWCA 1KGSA 1USSA 3LWFA 5DM6F 3K70C 4A3FJ 2BYVE 5HLHA 2L4AA 3IRQA 2FU4A 3A2KA 3K4CA 2IGNA 3HTUA 1YW7A 1MMNA 3O8GA 2XGCA 4I02A 3V4GA 5C44J 1XGNA 2R7XA 2V1NA 1SMTA 2F5CA 2AS5F 2M7AA 2JVHA 2QBYA 2GIVA 2HU9A 3W6JB 3CDLA 2F48A 2Z16A 1FBQA 3BZ6A 3TKYA 3DU6A 5H20A 2M8EA 5JI6A 2M7BA 1GT0C 1B72B 1UG2A 4ZC3A 2HZTA 1V5FA 4XLCA 2R0QC 1YO5C 4ITVA 2PBIA 4WXHA 3BTLA 5FO5A 2ZMEB 3DU5A 5HVQC 4AIHA 5FB2A 3WTSC 2P5KA 3CCLI 4HNTA 3EUAA 4NC6A 2JA8J 1X1CA 1V55H 3H5RA 1I5ZA 5DCFA 1OYYA 3LSIA 4XRMA 2E2IJ 5FLVA 1MH4A 1XSXA 3DBRB 2BVMA 2CJJA 3F72A 3OWTA 3TW6A 4DBQA 1QVTA 2TCTA 5FFXA 3WHCA 3B02A 4E70A 3J7AO 2R5ZB 3OOUA 1BOBA 3GTKJ 4CZCA 1HKSA 4EM0B 1M1EB 3M8JA 2PMZA 2KDOA 2R7TA 2EV5A 5A2QK 1XTAA 3HC7A 3C2GA 4DZPA 1E3HA 1YITI 2FNPA 2QQ9A 2CW7A 2RQPA 5J1UA 2VXDA 1MMGA 1R00A 1R1VA 2XAJA 1AKHA 3MVPA 4C3HJ 1GUUA 4FISA 4D7MA 2M2EA 3WU1B 1T8IA 1ERDA 1AHDP 2H94A 3E5XA 4HDUA 1IF1A 4LK0F 3OYKA 1F1ZA 1U8RA 2MG4A 2NOJB 1MIJA 1TQIA 3QPLA 2Y75A 3LSRA 3L2RA 1NG6A 4HW0A 3GMEA 4CCNA 4ZYEA 3OYMA 1WZ2A 2DLLA 5M5WJ 2DA7A 4R1HA 2DA2A 1JUSA 3OYDA 2MD0A 3OYGA 1RKTA 4E6KG 4EM1A 3FIWA 4NQWB 1R5HA 2FOKA 4L18B 1SVMA 4AWXB 3PUBA 5F04A 1XSVA 3EDPA 3DXJF 2ID3A 3U1DA 1VQMI 1XD7A 1O3SA 3J7AY 4FETA 3DPLC 1RNLA 4F91B 1V5GA 3WTXC 4ANJA 3RCOA 4BNCA 2VQGA 5DCMA 3BCBA 5HS9A 2LG4A 2XGEA 1D1BA 3S8PA 3W2VA 3GEZA 3QOEA 2CW8A 3WGHA 3HG9A 5M5XJ 4B3AA 1ZH5A 2KRCA 1EV7A 1YYVA 2LSOA 3TOBA 1NHAA 1W0UA 3I55I 3FWEA 5GPAA 4XORA 3CF2A 2BY3A 1WJAA 3EQLF 4OMYA 4MO7A 4QPOA 1GXPA 4A3EJ 2W85A 5EGOA 4EJUA 4OIQF 2WAQN 4XONA 2CW0F 1GXQA 1N75A 2D2WA 2L2OA 3PFYA 4IVNA 4HLXA 4KDPA 2VN2A 1DP3A 3DPUA 4KN4X 5E1WA 5JVGF 2XPVA 1ONVA 3LSTA 2GLOA 1XB4A 2XROA 4L9NA 2HI3A 2ESHA 5LEJA 4G8XA 3VSLA 5DD8A 3BP8A 3DTIA 5CQGA 2A5YB 4IEJA 2EQRA 2OZ6A 2E1NA 4KIGA 3HOXJ 3FXQA 3ZN0A 3CUQA 3FXKA 5ILVA 2F4MB 3HL2A 1HXDA 3DEUA 3H9QA 2DMPA 1WJBA 2CRGA 2JPBA 2I10A 3RKQA 3FKJA 2CUFA 1IV6A 1OMIA 3IH3A 2YX7A 1I3AA 2XB0X 2QUFA 3FDYA 4OWRB 2XAFA 4BQOA 4C9YA 3QPSA 4DW6A 1FWZA 2IEKA 4XLAA 1W7PB 4ESFA 2E36A 1E3OC 3RI4A 2IPQX 1W5TA 2ZXHA 3IAS2 2DT7B 2F4IA 5HNHA 1USTA 5BPIA 2K86A 1A35A 3LQRA 4J01A 1WHUA 4IHTA 3IL2A 3CLOA 3CCQI 1X4OA 1VQ8I 3S93A 1WGXA 4XLNF 1Y8QB 5K5QA 2HGCA 4BS9A 4J19A 4KIBA 3I9V2 3HKZA 2IT0A 2HTSA 1ETYA 1OYIA 3TOAA 4KMUX 4PUSA 2I8DA 2DBBA 4MEYF 3GTLJ 4Y3OA 3DEWA 1BI1A 2VQLA 5EDNA 3AKZA 3TL4X 4E7SA 4XL9A 3VEPA 2DMNA 2BEOA 4QLCU 3DKWA 1OYWA 4A69C 2VE8A 1Z21A 2JPCA 1D0YA 2QLZA 2W57A 1ZK8A 3QU3A 2M8GX 1SFUA 4ENMA 2VOPA 2FE3A 4WWCA 5J8CA 4A2UA 1Z1DA 3FBNB 3ZMZA 1G2HA 4IRGA 1HSJA 2W48A 1KU3A 4JYKA 5DS9A 2YS9A 2CV1A 1U0JA 2N8GA 2QKLB 1B72A 2X6XA 2CV0A 3BQZA 3HUGB 4YG2F 2CFOA 1KQ0A 1EKEA 4MEXF 4CUGA 2ETHA 1ORKA 2XRLA 4M3FA 4UY8I 5E17F 1I1SA 2VKDA 3CDIA 2P6SA 5K7ZA 1IUYA 6PAXA 1SAXA 1VQ5I 3LOCA 4RB0A 2JK3A 3JRFA 1B8IA 3V8KA 3HRUA 2XF6A 3S3NA 2FXAA 3F21A 2HQRA 2UXXA 4EATA 2KZVA 2J5OA 4I99C 3HBLA 2R5ZA 4BE1A 4LD5A 4BU2A 1FLIA 1S8NA 1HSTA 2E5NA 4QSHA 2EFWA 4ESJA 2DW4A 3HJEA 3TO7A 4NNJA 4LITA 1YJWI 5A2QZ 3K1MA 3SZPA 3OSGA 1OCTC 3CD6I 2ZJRF 3VSKA 1MBFA 1IXRC 5CVJA 4U87A 5E1XA 4C3IJ 1I6HJ 5HDGA 1QHGA 5CKTA 5FFZA 2KJBA 2ME6A 2W1OA 1BR2A 3TDUC 4HEA2 1BI2A 3RZDJ 1WJ5A 2H09A 4RB1A 1QQIA 2FMLA 2O7OA 5FD5A 3WE3A 2K7LA 3ZQLA 2LP0A 1IN4A 1GDTA 1JKQC 4NUBA 5LRSA 1IV8A 3LFUA 3GXOA 4NQWA 3SFIA 5GAEJ 2DFIA 2E7WA 2K9NA 2R7DA 3NAUA 3B73A 4Y13A 3E5UA 1K78B 1R1TA 2GOMA 1C0WA 3L2WA 4XRFA 4E7KA 2PN6A 2DOAA 1W36D 1WWXA 2FQ4A 3BTJA 4I2OA 3IKTA 1F5TA 4ZZDA 5IT9K 4S0HB 2LF8A 2HPMA 3P9IA 2VJIA 1W0TA 1MMAA 1LVAA 3EUHA 2JUGA 2KIUA 1D3YA 1UB9A 3D0SA 2ZJ2A 3CC4I 1R22A 2HXOA 1WCMJ 3HOWJ 2PQ8A 4HV6A 5BOXA 3GTPJ 2DI3A 5F08A 4DZJA 1F9NA 3ASNH 1X3UA 1UJ8A 2UXNA 2Y0MA 3OYIA 5GADJ 1FC3A 1IRZA 4C2UA 2XGDA 1Z3XA 4QPQA 1IDYA 1Q1VA 4L5IA 2A3SA 1J2XA 1WJCA 4B8XA 1FY7A 1XN7A 1B1BA 2HYJA 2XKPA 1G3TA 2ZBKA 3MD2A 3I0TA 3CO7C 3GTJJ 4BE0A 3OL3A 5IOYA 3JRBA 4IQ4A 2P6TA 3H36A 5J4YA 1Y8RB 4WXCA 1ZRCA 1MBHA 3GZNB 2D45A 2EFNA 3PUFA 1RR7A 3WTYC 1FEXA 2L4MA 1MJAA 2IA1A 3NWSA 2VJ5A 2DPDA 4CGZA 4M6YA 4ZYDA 2OUMA 2R4GA 4UUVA 3CTAA 2XSJC 4GFBA 4OIRF 2WWYA 3FM3A 4OIOF 2R7UA 2GIZA 3FK7A 2QSHX 1X3ZB 3HIFA 1N78A 4PSWA 2J5PA 2M5WA 1D0XA 5LGTA 4E7LA 1Z91A 2ZKZA 1WSUA 3TO9A 2DTZA 1Y56A 1IRGA 5EF6A 3REOA 2LTPA 3E3VA 1LNWA 3BTIA 1W7PA 3OSFA 1FTZA 2WB1A 5CYVA 4XOPA 3PFIA 1OQYA 2Q2EB 3OYEA 3IV5A 4LG0B 2R7FA 1HQCA 3RIRA 1VQKI 3HOSA 2DMTA 3L2CA 3KYDB 2LY9A 4L5JA 2K4JA 5J8FA 5LHHA 2KFDA 4G9YA 2M0MA 4KUMA 1XX5A 4CHUA 3DKXA 1I27A 1S3JA 3MMYB 4MLOA 4ENKA 3MKWB 1Y6IA 3SXYA 3IP4B 1ZAOA 2IA2A 1G3YA 1DPRA 3K1PA 1SD5A 3H1CA 3OL4A 5E79C 3K4JA 3JRIA 3D1NI 1IXSB 3Q5FA 1FP1D 5E8IA 4BXXJ 2Z1DA 1FZPB 3HPHA 1TT5B 3GFLA 1Q1HA 3Q0WA 4ZH4F 3UNGC 1FP2A 3T8TA 4FX4A 2FMYA 5LHGA 4BKXA 4PK4A 2O5RA 4XM3A 3TDZC 4GXOA 4F93B 3ZCOA 1MGTA 4AVZA 4HNUA 3HUGA 3ABTA 1VF9A 4QWQA 1P4WA 5HS7A 4I09A 1UHMA 1RI7A 2IS1A 2Y9ZA 2RQQA 3LL7A 3R4KA 2XF7A 1H89C 3G71I 2X6YA 3WG9A 2RGVA 2ZXIA 3E1SA 1OLTA 5EEHA 4JK1X 2P81A 2V1DA 4U7DA 2F5VA 5B1AH 4BE2A 1MDMA 3AG2H 1BL0A 2RDPA 2CQKA 4HOBA 3JTGA 1ETKA 1FPQA 4FT8A 2PG4A 5CVIA 5M3FJ 1LB2A 1A6IA 4AC0A 2B63J 3ISPA 4HRIA 2B9SA 1RRJA 4XBFA 1DGWY 3PL8A 5IYCJ 3BC8A 1ENHA 3CCRI 3BR2A 3HOVJ 5J4VA 4FASD 1MH3A 2WA0A 2ZSHB 2WADA 5LHIA 5GAGJ 4U0VA 1KQ9A 2YUSA 3E6BA 3HTSB 3H5NA 3UR3C 1SEUA 2Y31A 3WGGA 4G7ZF 2QF7A 3RPUA 4KYWA 4ASNA 2COBA 2Y2ZA 1ITYA 4OU0A 3CP8A 2HTJA 4ESBA 5D5XB 4DBRA 3GX4X 2VODA 1ZGAA 1YHQI 2HR3A 3FHZA 4U0WA 2CWEA 3Q9SA 1B9MA 2VBXA 3ML6A 5D6FA 4HNVA 1G6NA 2O0YA 3RTRA 3U1KA 5F1RA 2XPUA 3MKZA 5IT9Z 3F6VA 2WV1A 1EF4A 3M8EA 2ELJA 3RZOJ 1YIOA
chains in the Genus database with same CATH topology
4I6ZA 3MVPA 4C3HJ 1GUUA 4FISA 4D7MA 2M2EA 5EEAA 1ZQ3P 4A3GJ 1AHDP 2H1KA 2VKEA 4D5FA 1IJWC 2DA5A 3GBGA 2HOAA 2R93J 2MG4A 3I4MJ 2LLKA 3QPLA 2VPRA 3CCYA 1JTXA 4Y7NJ 3LSRA 1WI3A 1I3QJ 5IP6A 2DJNA 1HDPA 5M5WJ 2DA7A 5FKNA 1PUFA 2DA2A 1JUSA 1ZKGA 2D5VA 2EZKA 2YU9J 1RKTA 3FIWA 3GTMJ 3LSPA 4M6VA 1MBJA 2ECBA 3G1OA 5F04A 4JX4A 2ID3A 3BG5A 1RPWA 1RKWA 5EZHA 3GTOJ 5EG0A 4M3GA 1F36A 1JT0A 2NVXJ 2XGEA 2HDDA 3JRDA 3FISA 4UUSA 2DA6A 1JJ8C 4NDLA 5M5XJ 5FKOA 4B3AA 4BBSJ 5FLMJ 2K40A 1T56A 2DMQA 1W0UA 3HB9A 1Z0XA 4XRSG 1ETWA 4X6AJ 1MSFC 2DA3A 4B1RA 1NK2P 5GPAA 3OIOA 4MO7A 2R7ZJ 1IDZA 4A3EJ 5IYDJ 1TWFJ 5EGOA 5K7HA 4QIWN 5E3MA 2MSYA 2WAQN 1U9NA 4RBOA 4A3DJ 3IH2A 2M9HA 1TWHJ 2L7MP 1Z77A 3HGYA 3BR3A 5C4JJ 2FJ1A 2FX0A 2XPVA 3S17J 5JLWA 4Y52J 2GLOA 2VUMJ 2HI3A 3B6CA 5DTDA 2ME0A 3S14J 3B6AA 4FTHA 3S1RJ 3BR0A 5EZGA 4IEJA 3Q0VA 2EQRA 3DCFA 3HOUJ 1U8BA 4W1UA 1U9OA 3L1PA 3HOXJ 5IP9J 1F43A 3HKZN 2DMPA 2CRGA 5HODA 3A03A 1BW5A 1OFCX 1RETA 2I10A 4MFDA 3RKQA 3SJMA 1P7JA 1HDDC 2CUFA 1IV6A 3IH3A 3VPRA 3BG9A 3NARA 1ZR4A 4A93J 2XB0X 2E2HJ 1TWAJ 3G1MA 3QPSA 4DW6A 1MSEC 3CQZJ 3WHBA 4BY7J 4A3LJ 2IEKA 1E3OC 4FCYA 3S2DJ 2H8RA 3ZQIA 1IC8A 2XPWA 3M3YJ 2JA6J 2X6OA 2AHQA 4V2GA 3Q0UA 1FIAA 1X58A 5IP7J 1UHSA 3HDDA 1ZR2A 5F0CA 3H3VK 1WGXA 2IAIA 2GBYA 2JN6A 4J19A 4V2FA 3BR1A 4JX6A 3G1LA 5C3EJ 4XIDA 3JR9A 1ETYA 3ZQGA 2CU7A 3GTLJ 2LVSA 1IG7A 2JA5J 1YRNB 3DEWA 4IHWA 5EDNA 1MBEA 2DMNA 3GTGJ 2ZB9A 2ELKA 2RAEA 4A69C 3JRHA 1ZK8A 2M8GX 3S1QJ 2L9RA 1XC5A 2FD5A 5F27A 1G2HA 3BR5A 3A01A 3HEFA 3QQAA 2EZHA 2W48A 4JYKA 4I76A 5DS9A 2L0KA 2YS9A 1U78A 2N8GA 1B72A 4QTRA 3BQZA 1BJZA 1HCRA 1JKPC 4JP0A 1ORKA 2XRLA 4M3FA 4RDUA 2O8KA 4A3IJ 5K7ZA 1JGGA 4EEFG 2LKXA 2R5YA 3JRCA 1JKRC 1ETXA 3LOCA 1DU6A 2JK3A 3JRFA 1B8IA 3M4OJ 1RESA 4IHVA 3HOYJ 1JT6A 1X2MA 2KT0A 3HBLA 2R5ZA 4BY1J 5FKKA 1BW6A 4QSHA 2OF7A 1VFCA 1WPKA 1H88C 1H8AC 3MKLA 2EH3A 4A3CJ 3FK6A 3HM5A 1WH7A 3E7LA 3UKGA 3OSGA 1OCTC 3S16J 1MBFA 4C3IJ 3K2AA 2HOTA 1I6HJ 1JUPA 2VKVA 3BQYA 2ME6A 2NOGA 2M34A 3RZDJ 4MFEA 1UMQA 4UUTA 4M3DA 2OPTA 1APLC 2O7OA 3PM1A 2HQ5A 5F0HA 4CYCA 4DYQA 1AU7A 3ZQLA 2LP0A 1GDTA 1FJLA 3JREA 1JKQC 3GTQJ 3ZQFA 4B4CA 1K83J 3SFIA 1S7EA 1LE8B 1CQTA 5FJ8J 2K9NA 3NAUA 3HGGA 2JA7J 3PO3J 1D5YA 2NVYJ 4C3JJ 3S15J 4ABZA 2FQ4A 3BTJA 5BNGA 3PO2J 3JRGA 4JX5A 4S0HB 1OJLA 5K7FA 1HOMA 2HOSA 2X9DA 2LD5A 5JLXA 1W0TA 2MW8A 1AKHB 5F1JA 2CUEA 1MBGA 4XRSA 4X1EA 3K7AJ 2HXOA 1WCMJ 2L7ZA 1I50J 3HOWJ 1XS9A 3A01B 1JKOC 3GTPJ 3LSJA 5F08A 4DZJA 1R9TJ 1ETOA 1SANA 5IOZA 5J3LA 1IRZA 1PUFB 2E2JJ 2XGDA 2JJ7A 3TW7A 2NVQJ 2DA4A 1ETVA 1IDYA 1Q1VA 3SDGA 2HYJA 2NS8A 3CMYA 2GM4A 3ZOBA 2Y9YA 3GTJJ 2WB1N 1IUFA 5IOYA 2AO9A 3JRBA 5EG0B 5GP9A 1B8IB 1MBHA 3BTCA 5IYBJ 4UUSB 1RR7A 2Y0SN 3S1MJ 1FEXA 1P7IA 4C2MJ 5M3MJ 2R92J 1Y1WJ 1BA5A 1VI0A 4A3MJ 3I4NJ 2IBDA 2CQXA 3RQIA 5E3LA 9ANTA 2XB5A 1QVUA 3A02A 2E1OA 2LR8A 4GFBA 2M0CA 2LK2A 3FK7A 2X48A 3BT9A 5C4XJ 2NVTJ 4FE7A 5EGOB 1TWGJ 4D7NA 2DTZA 2VI6A 4G12A 1SFOJ 1A5JA 1XG1A 1ZTRA 2K9QA 5EF6A 2LTPA 1GV2A 2Y30A 5GPCA 3BTIA 1TC3C 3C2BA 2XSDC 3OSFA 2HXIA 1FTZA 2EZLA 1POGA 4DYRA 3IV5A 1JJ6C 2KDZA 3BG3A 4CYCB 4BBRJ 4XK4A 2DMTA 1QPIA 1VNDA 2LY9A 4D5CA 2JWTA 5IPAA 1NK3P 4AYBN 4M3BA 1HLVA 4MLOA 4IHXA 3TP0A 1NTCA 3ZQHA 2K9SA 2EBIA 4MIMA 1YRNA 2DMUA 1ETQA 1FIPA 1QRYA 1LFUP 1DU0A 3JRIA 4IHYA 3D1NI 2DN0A 1LFBA 3ZQCA 1IGNA 4BXXJ 1O4XA 1X2NA 5E3NA 3MN2A 1TWCJ 3Q0WA 4M3EA 2TRTA 1K61A 2L7FP 2G0EA 3W6VA 5J1RA 3F0CA 3FKIJ 4BKXA 2EZIA 1JTYA 3TP3A 1ZGWA 3HOZJ 3JRAA 5E3OA 1FTTA 1VF9A 1WH5A 1OCPA 1HF0A 2QCOA 3TEDA 3H0GJ 2Y9ZA 3S1NJ 5F0FA 1H89C 4A3FJ 4A3JJ 4FE4A 2MGQA 2DA1A 2P81A 3LNQA 5EYRA 2O9LA 2NS7A 3LSGA 3O8GA 2XGCA 1BL0A 5C44J 3Q3SA 1ETKA 1GVDA 1Y1VJ 3CDLA 1MNMC 5M3FJ 3BR6A 1A6IA 4AC0A 2B63J 5FKMA 5M5YJ 5IYCJ 1ENHA 1GT0C 1B72B 1UG2A 3HOVJ 3BR2A 2PMZN 3S2HJ 2ECCA 1MH3A 4AUXA 2R0QC 3BTLA 1MBKA 2LFBA 2YUSA 4A3BJ 2JA8J 2R5YB 2Y31A 2QF7A 1T33A 4A3KJ 4XICA 2E2IJ 4XRMA 5FLVA 1MH4A 4LOCA 4W97A 2CJJA 3TW6A 4DYCA 2COBA 2JMWA 2Y2ZA 5J1YA 1ITYA 1QVTA 2TCTA 3WHCA 4L5EA 1LE8A 2R5ZB 3IH4A 3OOUA 1GV5A 3GTKJ 2E19A 3O8HA 2ID6A 2CQQA 4HNVA 1JUMA 2XPUA 1EF4A 2WV1A 5FKLA 4DZPA 5J1UA 3RZOJ 1AKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6Z A;  3MVP A;  4C3H J;  1GUU A;  4FIS A;  4D7M A;  2M2E A;  5EEA A;  1ZQ3 P;  4A3G J;  1AHD P;  2H1K A;  2VKE A;  4D5F A;  1IJW C;  2DA5 A;  3GBG A;  2HOA A;  2R93 J;  2MG4 A;  3I4M J;  2LLK A;  3QPL A;  2VPR A;  3CCY A;  1JTX A;  4Y7N J;  3LSR A;  1WI3 A;  1I3Q J;  5IP6 A;  2DJN A;  1HDP A;  5M5W J;  2DA7 A;  5FKN A;  1PUF A;  2DA2 A;  1JUS A;  1ZKG A;  2D5V A;  2EZK A;  2YU9 J;  1RKT A;  3FIW A;  3GTM J;  3LSP A;  4M6V A;  1MBJ A;  2ECB A;  3G1O A;  5F04 A;  4JX4 A;  2ID3 A;  3BG5 A;  1RPW A;  1RKW A;  5EZH A;  3GTO J;  5EG0 A;  4M3G A;  1F36 A;  1JT0 A;  2NVX J;  2XGE A;  2HDD A;  3JRD A;  3FIS A;  4UUS A;  2DA6 A;  1JJ8 C;  4NDL A;  5M5X J;  5FKO A;  4B3A A;  4BBS J;  5FLM J;  2K40 A;  1T56 A;  2DMQ A;  1W0U A;  3HB9 A;  1Z0X A;  4XRS G;  1ETW A;  4X6A J;  1MSF C;  2DA3 A;  4B1R A;  1NK2 P;  5GPA A;  3OIO A;  4MO7 A;  2R7Z J;  1IDZ A;  4A3E J;  5IYD J;  1TWF J;  5EGO A;  5K7H A;  4QIW N;  5E3M A;  2MSY A;  2WAQ N;  1U9N A;  4RBO A;  4A3D J;  3IH2 A;  2M9H A;  1TWH J;  2L7M P;  1Z77 A;  3HGY A;  3BR3 A;  5C4J J;  2FJ1 A;  2FX0 A;  2XPV A;  3S17 J;  5JLW A;  4Y52 J;  2GLO A;  2VUM J;  2HI3 A;  3B6C A;  5DTD A;  2ME0 A;  3S14 J;  3B6A A;  4FTH A;  3S1R J;  3BR0 A;  5EZG A;  4IEJ A;  3Q0V A;  2EQR A;  3DCF A;  3HOU J;  1U8B A;  4W1U A;  1U9O A;  3L1P A;  3HOX J;  5IP9 J;  1F43 A;  3HKZ N;  2DMP A;  2CRG A;  5HOD A;  3A03 A;  1BW5 A;  1OFC X;  1RET A;  2I10 A;  4MFD A;  3RKQ A;  3SJM A;  1P7J A;  1HDD C;  2CUF A;  1IV6 A;  3IH3 A;  3VPR A;  3BG9 A;  3NAR A;  1ZR4 A;  4A93 J;  2XB0 X;  2E2H J;  1TWA J;  3G1M A;  3QPS A;  4DW6 A;  1MSE C;  3CQZ J;  3WHB A;  4BY7 J;  4A3L J;  2IEK A;  1E3O C;  4FCY A;  3S2D J;  2H8R A;  3ZQI A;  1IC8 A;  2XPW A;  3M3Y J;  2JA6 J;  2X6O A;  2AHQ A;  4V2G A;  3Q0U A;  1FIA A;  1X58 A;  5IP7 J;  1UHS A;  3HDD A;  1ZR2 A;  5F0C A;  3H3V K;  1WGX A;  2IAI A;  2GBY A;  2JN6 A;  4J19 A;  4V2F A;  3BR1 A;  4JX6 A;  3G1L A;  5C3E J;  4XID A;  3JR9 A;  1ETY A;  3ZQG A;  2CU7 A;  3GTL J;  2LVS A;  1IG7 A;  2JA5 J;  1YRN B;  3DEW A;  4IHW A;  5EDN A;  1MBE A;  2DMN A;  3GTG J;  2ZB9 A;  2ELK A;  2RAE A;  4A69 C;  3JRH A;  1ZK8 A;  2M8G X;  3S1Q J;  2L9R A;  1XC5 A;  2FD5 A;  5F27 A;  1G2H A;  3BR5 A;  3A01 A;  3HEF A;  3QQA A;  2EZH A;  2W48 A;  4JYK A;  4I76 A;  5DS9 A;  2L0K A;  2YS9 A;  1U78 A;  2N8G A;  1B72 A;  4QTR A;  3BQZ A;  1BJZ A;  1HCR A;  1JKP C;  4JP0 A;  1ORK A;  2XRL A;  4M3F A;  4RDU A;  2O8K A;  4A3I J;  5K7Z A;  1JGG A;  4EEF G;  2LKX A;  2R5Y A;  3JRC A;  1JKR C;  1ETX A;  3LOC A;  1DU6 A;  2JK3 A;  3JRF A;  1B8I A;  3M4O J;  1RES A;  4IHV A;  3HOY J;  1JT6 A;  1X2M A;  2KT0 A;  3HBL A;  2R5Z A;  4BY1 J;  5FKK A;  1BW6 A;  4QSH A;  2OF7 A;  1VFC A;  1WPK A;  1H88 C;  1H8A C;  3MKL A;  2EH3 A;  4A3C J;  3FK6 A;  3HM5 A;  1WH7 A;  3E7L A;  3UKG A;  3OSG A;  1OCT C;  3S16 J;  1MBF A;  4C3I J;  3K2A A;  2HOT A;  1I6H J;  1JUP A;  2VKV A;  3BQY A;  2ME6 A;  2NOG A;  2M34 A;  3RZD J;  4MFE A;  1UMQ A;  4UUT A;  4M3D A;  2OPT A;  1APL C;  2O7O A;  3PM1 A;  2HQ5 A;  5F0H A;  4CYC A;  4DYQ A;  1AU7 A;  3ZQL A;  2LP0 A;  1GDT A;  1FJL A;  3JRE A;  1JKQ C;  3GTQ J;  3ZQF A;  4B4C A;  1K83 J;  3SFI A;  1S7E A;  1LE8 B;  1CQT A;  5FJ8 J;  2K9N A;  3NAU A;  3HGG A;  2JA7 J;  3PO3 J;  1D5Y A;  2NVY J;  4C3J J;  3S15 J;  4ABZ A;  2FQ4 A;  3BTJ A;  5BNG A;  3PO2 J;  3JRG A;  4JX5 A;  4S0H B;  1OJL A;  5K7F A;  1HOM A;  2HOS A;  2X9D A;  2LD5 A;  5JLX A;  1W0T A;  2MW8 A;  1AKH B;  5F1J A;  2CUE A;  1MBG A;  4XRS A;  4X1E A;  3K7A J;  2HXO A;  1WCM J;  2L7Z A;  1I50 J;  3HOW J;  1XS9 A;  3A01 B;  1JKO C;  3GTP J;  3LSJ A;  5F08 A;  4DZJ A;  1R9T J;  1ETO A;  1SAN A;  5IOZ A;  5J3L A;  1IRZ A;  1PUF B;  2E2J J;  2XGD A;  2JJ7 A;  3TW7 A;  2NVQ J;  2DA4 A;  1ETV A;  1IDY A;  1Q1V A;  3SDG A;  2HYJ A;  2NS8 A;  3CMY A;  2GM4 A;  3ZOB A;  2Y9Y A;  3GTJ J;  2WB1 N;  1IUF A;  5IOY A;  2AO9 A;  3JRB A;  5EG0 B;  5GP9 A;  1B8I B;  1MBH A;  3BTC A;  5IYB J;  4UUS B;  1RR7 A;  2Y0S N;  3S1M J;  1FEX A;  1P7I A;  4C2M J;  5M3M J;  2R92 J;  1Y1W J;  1BA5 A;  1VI0 A;  4A3M J;  3I4N J;  2IBD A;  2CQX A;  3RQI A;  5E3L A;  9ANT A;  2XB5 A;  1QVU A;  3A02 A;  2E1O A;  2LR8 A;  4GFB A;  2M0C A;  2LK2 A;  3FK7 A;  2X48 A;  3BT9 A;  5C4X J;  2NVT J;  4FE7 A;  5EGO B;  1TWG J;  4D7N A;  2DTZ A;  2VI6 A;  4G12 A;  1SFO J;  1A5J A;  1XG1 A;  1ZTR A;  2K9Q A;  5EF6 A;  2LTP A;  1GV2 A;  2Y30 A;  5GPC A;  3BTI A;  1TC3 C;  3C2B A;  2XSD C;  3OSF A;  2HXI A;  1FTZ A;  2EZL A;  1POG A;  4DYR A;  3IV5 A;  1JJ6 C;  2KDZ A;  3BG3 A;  4CYC B;  4BBR J;  4XK4 A;  2DMT A;  1QPI A;  1VND A;  2LY9 A;  4D5C A;  2JWT A;  5IPA A;  1NK3 P;  4AYB N;  4M3B A;  1HLV A;  4MLO A;  4IHX A;  3TP0 A;  1NTC A;  3ZQH A;  2K9S A;  2EBI A;  4MIM A;  1YRN A;  2DMU A;  1ETQ A;  1FIP A;  1QRY A;  1LFU P;  1DU0 A;  3JRI A;  4IHY A;  3D1N I;  2DN0 A;  1LFB A;  3ZQC A;  1IGN A;  4BXX J;  1O4X A;  1X2N A;  5E3N A;  3MN2 A;  1TWC J;  3Q0W A;  4M3E A;  2TRT A;  1K61 A;  2L7F P;  2G0E A;  3W6V A;  5J1R A;  3F0C A;  3FKI J;  4BKX A;  2EZI A;  1JTY A;  3TP3 A;  1ZGW A;  3HOZ J;  3JRA A;  5E3O A;  1FTT A;  1VF9 A;  1WH5 A;  1OCP A;  1HF0 A;  2QCO A;  3TED A;  3H0G J;  2Y9Z A;  3S1N J;  5F0F A;  1H89 C;  4A3F J;  4A3J J;  4FE4 A;  2MGQ A;  2DA1 A;  2P81 A;  3LNQ A;  5EYR A;  2O9L A;  2NS7 A;  3LSG A;  3O8G A;  2XGC A;  1BL0 A;  5C44 J;  3Q3S A;  1ETK A;  1GVD A;  1Y1V J;  3CDL A;  1MNM C;  5M3F J;  3BR6 A;  1A6I A;  4AC0 A;  2B63 J;  5FKM A;  5M5Y J;  5IYC J;  1ENH A;  1GT0 C;  1B72 B;  1UG2 A;  3HOV J;  3BR2 A;  2PMZ N;  3S2H J;  2ECC A;  1MH3 A;  4AUX A;  2R0Q C;  3BTL A;  1MBK A;  2LFB A;  2YUS A;  4A3B J;  2JA8 J;  2R5Y B;  2Y31 A;  2QF7 A;  1T33 A;  4A3K J;  4XIC A;  2E2I J;  4XRM A;  5FLV A;  1MH4 A;  4LOC A;  4W97 A;  2CJJ A;  3TW6 A;  4DYC A;  2COB A;  2JMW A;  2Y2Z A;  5J1Y A;  1ITY A;  1QVT A;  2TCT A;  3WHC A;  4L5E A;  1LE8 A;  2R5Z B;  3IH4 A;  3OOU A;  1GV5 A;  3GTK J;  2E19 A;  3O8H A;  2ID6 A;  2CQQ A;  4HNV A;  1JUM A;  2XPU A;  1EF4 A;  2WV1 A;  5FKL A;  4DZP A;  5J1U A;  3RZO J;  1AKH A; 
#chains in the Genus database with same CATH topology
 4I6Z A;  3FXO A;  1V4R A;  3F8C A;  3BZC A;  5ILS A;  3KP6 A;  2H1K A;  2VKE A;  4D5F A;  2R7R A;  1VQ7 I;  2DA5 A;  3GBG A;  1OKR A;  4O3M A;  1KU2 A;  3I4M J;  2VPR A;  2E1M B;  1IW7 F;  1I3Q J;  2DJN A;  1HDP A;  1TLH B;  2DXI A;  3KIO A;  2CUZ A;  4BEH B;  5B1B H;  5FKN A;  2D5V A;  1P4X A;  5AIQ A;  5GTI C;  2DTR A;  2HOE A;  4R8H A;  4G7H F;  4M6V A;  4V19 K;  2ECB A;  2RKH A;  4RB2 C;  3IKV A;  3H9J A;  2KRH A;  2E1C A;  2XVC A;  3L9F A;  1T39 A;  2DAO A;  4ZDP A;  4A5M A;  2EK5 A;  4NC8 A;  4P1W A;  2VB6 A;  1ZG1 A;  3FXJ A;  2HDD A;  4PFP A;  2FBI A;  3BY6 A;  1YOV B;  2DA6 A;  3GLX A;  4XQF A;  1BM9 A;  3CMM A;  4NDL A;  1FYL A;  5FKO A;  1S6L A;  2QVO A;  2P5V A;  2K40 A;  1T56 A;  4NB5 A;  1Z0X A;  3M7G A;  4BGD A;  3JW4 A;  1CGP A;  2ZNY A;  3K70 D;  2M4K A;  2M87 A;  1QBJ A;  2HVQ A;  4OOI A;  2ZO4 A;  2MSY A;  4YIF A;  1U9N A;  4M9X A;  1A6Q A;  2LRD A;  4RBO A;  1YJ9 I;  1DDN A;  4A3D J;  1STZ A;  1FYK A;  1VQL I;  2M9H A;  3IRR A;  3CP2 A;  2KP6 A;  1HKT A;  1BR4 A;  3WOD F;  2FJ1 A;  1FNN A;  4D9J A;  4LG0 A;  3ZMU A;  5JLW A;  3QU6 A;  1UAA A;  4Y52 J;  4DIQ A;  3V7R A;  2VUM J;  2GA2 A;  3RQ4 A;  4YFX F;  5DTD A;  4RGU A;  5DUI A;  2CQ7 A;  4U0Y A;  1KU9 A;  1DUX C;  2L3D A;  3H5A A;  4BQN A;  2NAZ A;  5EZG A;  2P7C B;  3DCF A;  3Q0V A;  1OR7 C;  1U8B A;  1MMS A;  2PLY A;  1PJR A;  3CJQ B;  2QA4 I;  1MKM A;  2WY8 Q;  3A03 A;  2DFH A;  2WAQ A;  1OFC X;  4MQV A;  1ZRF A;  1BW5 A;  3G2B A;  3LQQ A;  2P8T A;  3OYF A;  1J59 A;  2KPM A;  1KYW A;  1ZR4 A;  1O7F A;  3AG1 H;  2E2H J;  2VLA A;  3G1M A;  4AU7 A;  2X4H A;  2RN7 A;  3WHB A;  4A3L J;  4FCY A;  4L9T A;  1PYV A;  2H8R A;  2EIM H;  5E1Z B;  3ZQI A;  1G3W A;  2VL8 A;  2PMU A;  1IC8 A;  1OCR H;  3M3Y J;  5D8L B;  1ZN2 A;  1VQP I;  4RMN A;  1RZ4 A;  1OCZ H;  2JA6 J;  1KYZ A;  2FRH A;  2AHQ A;  3CDH A;  2DOD A;  3KLN A;  2TDX A;  5IP7 J;  3IAM 2;  2LH9 A;  4HX8 A;  3HDD A;  4XN0 A;  2I5U A;  1BN5 A;  3ZP5 A;  4OIN F;  2IAI A;  3OR2 C;  4V2F A;  4JX6 A;  5C3E J;  1FMW A;  1Y0U A;  2CU7 A;  1TNT A;  4XSZ F;  4CYD A;  2LOO A;  2OU2 A;  2OQR A;  4XKV A;  4ZYG A;  5HDK A;  4IHW A;  2ZME C;  1O57 A;  4Y17 A;  5J6X A;  2ZB9 A;  3PJR A;  2ELK A;  3G4S I;  2E7X A;  2QKM B;  4XN3 A;  3MCZ A;  1J09 A;  2WAE A;  4OAZ A;  3OYN A;  3VDX A;  3WTV C;  1XC5 A;  2PJP A;  2DDB A;  1TTY A;  2X6W A;  5F27 A;  3HXL A;  3CCV I;  3BR5 A;  3A01 A;  3GW2 A;  2LMD A;  1ZGJ A;  4FHT A;  1V54 H;  2ZXJ A;  5CVU A;  3DBL B;  3MZY A;  4QTR A;  4PCQ A;  3KLO A;  5E18 F;  2WBM A;  4XKW A;  1JKP C;  4JP0 A;  4PGH A;  4MQ9 F;  2JRM A;  1ZHF A;  4RDU A;  2O8K A;  5FRO A;  2AQF A;  1JGG A;  4EEF G;  3HRM A;  3JRC A;  1TQP A;  3HSR A;  4MGR A;  1CF7 B;  4EJT A;  2VON A;  2HKO A;  3U9G A;  3I71 A;  1K79 A;  1GLN A;  3P9C A;  4IHV A;  1YTY A;  3HOY J;  1JT6 A;  1X2M A;  2KT0 A;  2STT A;  3KET A;  4ENJ A;  1JXS A;  2EFO A;  4HX7 A;  1H88 C;  2OQG A;  1FSE A;  1MJB A;  3MKL A;  4P55 A;  3P9K A;  4YIR X;  4A3C J;  2OAZ A;  1T98 A;  3UKG A;  1EJ9 A;  2NNN A;  3QYF A;  5GAH J;  2HOT A;  2K02 A;  5IY5 H;  2XC7 A;  2VKV A;  5L3F A;  4E7Z A;  3JAM K;  4IOA F;  2EIN H;  3GFJ A;  3K9T A;  3CME I;  2R7Q A;  5ED4 A;  3K4B A;  1B59 A;  3EUH C;  3PNT A;  4UV8 A;  3ECO A;  2KHM A;  2BV6 A;  2JVG A;  2A68 F;  4UUT A;  3QAH A;  4CYC A;  1AU7 A;  3OYL A;  4DYQ A;  1U2W A;  4IL6 C;  1S9H A;  3WU2 C;  4BEH A;  1FOX A;  4C2T A;  2K4B A;  3I59 B;  3MKY B;  3GTQ J;  1LDJ A;  1Z3Y A;  3KP5 A;  1K83 J;  4B4C A;  4NBQ A;  1XCV A;  2UZK A;  3I53 A;  1LE8 B;  3HGG A;  2JA7 J;  3LSM A;  4LMY A;  5CPR B;  2MD5 A;  2LKS A;  1I6X A;  3IUO A;  3RSN A;  2NVY J;  1O3Q A;  2ISZ A;  1PVE A;  3J7Y J;  5TGT A;  1YIJ I;  4RA2 A;  5BNG A;  4JBA A;  4XSX F;  2IJL A;  4KN7 X;  2FUG 2;  1VTN C;  3X2Q H;  1OJL A;  2ZFU A;  1BJA A;  2ICW G;  2HOS A;  1HOM A;  2LYC A;  1N77 A;  3H0D A;  5JLX A;  3K0L A;  2W24 A;  3DFG A;  3KP4 A;  2RNG A;  2L7Z A;  1I50 J;  3DLL F;  1V5E A;  2MAB A;  1DQU A;  3RKY A;  2R7W A;  3LSJ A;  5DYM A;  2OBP A;  1OR7 A;  3ELK A;  1SAN A;  2O6G E;  2JA2 A;  5EEG A;  2VC0 A;  2ZJP F;  3GVA A;  4EJO A;  1ETV A;  3SFZ A;  1KA8 A;  3QP6 A;  1YE9 A;  3I4P A;  5D5U B;  3SDG A;  1NG7 A;  2NS8 A;  2O61 A;  2GM4 A;  3KE2 A;  3ZOB A;  2FBK A;  2Y9Y A;  1BI3 A;  3K4N A;  3KZZ A;  3FXU A;  3OV8 A;  5TIS C;  2Y0S N;  4LIV A;  3S1M J;  1P7I A;  2ZXW H;  4C2M J;  5M3M J;  2XGX A;  5D6E A;  2R92 J;  1QNT A;  3DP7 A;  1P4A A;  3M1E A;  2XB5 A;  1QVU A;  2KMU A;  3A02 A;  4B44 A;  2STW A;  3U21 A;  2M0C A;  1FOW A;  2LK2 A;  5L3B A;  2RC4 A;  2YR2 A;  2X48 A;  3HSE A;  3BT9 A;  3EET A;  2UWM A;  3GO5 A;  1L3L A;  2Q8K A;  4D7N A;  1YX3 A;  2VI6 A;  4KMF A;  1A5J A;  1XG1 A;  2OCE A;  2VJJ A;  1ZTR A;  4PFO A;  1QGP A;  1GV2 A;  2Y30 A;  2ZME A;  4HST A;  3G73 A;  3ZQQ A;  5AIP A;  4DYR A;  5KK1 A;  5HLG A;  3BG3 A;  3OS1 A;  2V26 A;  3OOP A;  4BBR J;  3GZ6 A;  1D0Z A;  3ECH A;  3GYH X;  2RNJ A;  2RV8 A;  4UV9 A;  4Q48 A;  2MFZ A;  1DPU A;  4D5C A;  1XPX A;  1KQ8 A;  4GYG A;  4UVA A;  3FF5 A;  3ZMD A;  3MFK A;  4E7I A;  1O7L A;  2CSO A;  1HLV A;  3TP0 A;  3PNY A;  5HNF A;  3F9K A;  2EBI A;  4IOC F;  3HSF A;  2DMU A;  1ETQ A;  1NH3 A;  1LFU P;  1OCC H;  3GF2 A;  4DQ2 A;  2KQR A;  3SYT A;  5JHU A;  2F5D A;  3CO6 C;  1R6R A;  3MN2 A;  2BVL A;  2TRT A;  2AQE A;  4AIK A;  4WXD A;  2GOX B;  1VQ9 I;  3CMA I;  4PJN A;  3W6V A;  1SAU A;  4LK1 F;  4ZYA A;  3FKI J;  2PI0 A;  1BIA A;  2ZNZ A;  2EZI A;  1JTY A;  3M9A A;  3J81 Z;  3VYS B;  1QPM A;  2H8W A;  3HPG A;  2PJR B;  4P96 A;  3PQK A;  5HOO A;  4B47 A;  3LMM A;  1FTT A;  1JE8 A;  2QEX I;  5FGM A;  4EGY A;  2K3F A;  1HF0 A;  5L3C A;  1JHF A;  5K5O A;  3IWZ A;  2LDU A;  5F0F A;  2KIF A;  3F6O A;  4XR6 A;  1MMD A;  5E20 A;  4FE4 A;  4A5N A;  3OYA A;  3D5S C;  2DA1 A;  4M71 A;  2ADU A;  3RYP A;  2ZFW A;  3HOT A;  4L0Y B;  3W2W A;  2EV6 A;  2DYR H;  2X0L A;  2EIK H;  5D5V B;  1Y1V J;  3C18 A;  4E7H A;  4XLF A;  4UHT A;  3ABM H;  1T0F A;  3BR6 A;  4IQJ A;  4H4K C;  3A1Y A;  2PEX A;  5D8K B;  5AON A;  2VT2 A;  3CC7 I;  2IXS A;  3ESW B;  5FD6 A;  1SFK A;  3DTK A;  2VBZ A;  4RAG A;  2GA1 A;  1EH6 A;  1R58 A;  3KFW X;  3JAM Z;  1DGR M;  4IF4 A;  2MC3 A;  4RM2 A;  3F8N A;  2CQN A;  5H6R A;  3S2W A;  3NWT A;  4EMS A;  4DOZ A;  1MBK A;  4P5O A;  1L0O C;  2LFB A;  2UUZ A;  3CF5 F;  3G6E I;  4CDG A;  2WY7 Q;  3SEZ A;  1MJ9 A;  2CGP A;  1HW1 A;  1ZG3 A;  4A6D A;  3DWL E;  4A3K J;  2EFP A;  3T5X A;  4XIC A;  1ZG5 A;  1ZLK A;  2XRN A;  3LA2 A;  3C2H A;  1YFH A;  2LY1 A;  3ERM A;  1G3S A;  5FLX K;  4LOC A;  5FRN A;  1MND A;  3CJN A;  3OMY A;  1YW9 A;  2IS6 A;  2VQC A;  3ONQ A;  1PUE E;  1DP7 P;  5L3G A;  3EYI A;  1LE8 A;  3CC2 I;  2M1B A;  1WKM A;  1GV5 A;  1TNS A;  3IHU A;  1T95 A;  1XGS A;  1RR8 C;  2V4J C;  5LLQ A;  2E19 A;  3DTE A;  2HFH A;  4O6J A;  2Z3Y A;  3I56 I;  5BMZ A;  3H9G A;  2P5L C;  2CQQ A;  1B9N A;  1LUJ B;  3BJA A;  3CCE I;  4UXN A;  1JUM A;  1ZAR A;  4EJV A;  3GUD A;  4BDY A;  2BZT A;  2E34 A;  3RDI A;  5ERI A;  3E5Q A;  5L3D A;  4HX4 A;  5DD4 A;  3VB2 A;  1IJW C;  1VQO I;  3LAJ A;  2CFX A;  2FOW A;  1JTX A;  2BY1 A;  2DT5 A;  2DU9 A;  4CCL A;  5IP6 A;  3FMQ A;  2HKX A;  2R3S A;  4PSX A;  2FNA A;  4BXF A;  1LKX A;  2FA5 A;  3D5R C;  3F22 A;  1RUN A;  2EZK A;  1I1G A;  1BBY A;  3GTM J;  1LDD A;  4XMY A;  4HYE A;  2CG4 A;  2DOF A;  1XDU A;  2VC1 A;  1YS6 A;  1E17 A;  4AVP A;  2DCE A;  2DO7 A;  3BG5 A;  4KIT B;  1N25 A;  3R0J A;  1SVO A;  1U5T B;  5DUK A;  3V7S A;  1UZC A;  4P9U A;  1RKW A;  5EZH A;  4IZZ A;  3PIO F;  4KT6 A;  3E0J B;  4M3G A;  1F36 A;  2L9N A;  1JT0 A;  2NVX J;  1W4M A;  4ZTF A;  3JRD A;  2P7V B;  4KT5 C;  2XDV A;  5K1Y A;  2HZD A;  1WFX A;  3ERE D;  1D8J A;  4MTD A;  2EFQ A;  2X1D A;  1J7K A;  3GLL A;  4BBS J;  5FLM J;  3E6M A;  2DMQ A;  1ZLJ A;  4II2 A;  3HB9 A;  4AID A;  4X6A J;  1MSF C;  2IW5 A;  4B1R A;  5LBQ A;  1Z05 A;  3JSO A;  3GWZ A;  2HDW A;  1T38 A;  4L9V A;  1HC8 A;  2B0L A;  1LEA A;  1IDZ A;  2Q0O A;  5IYD J;  5E3M A;  3R6S A;  1ULY A;  5H2F C;  3R61 A;  1FSH A;  1TWH J;  1Z77 A;  2C6Y A;  3HGY A;  2LRE A;  3WTT C;  4RLQ A;  5C4J J;  3ZPL A;  2HYG D;  1XMA A;  3K10 A;  2KIM A;  1R36 A;  4KFC A;  2DK5 A;  3H3Z A;  3B6A A;  4LGW A;  1LVK A;  3WTW C;  1WI9 A;  2MH2 A;  2KL4 A;  4N4O B;  2ZC2 A;  3DBH B;  1U9O A;  4W1U A;  2NVU B;  2EIJ H;  5BS6 A;  1I39 A;  1XGM A;  2CS3 A;  5IP9 J;  2L9V A;  1P2F A;  2XAH A;  4ZDL A;  5HOD A;  4IJA A;  1RET A;  3FM5 A;  3RJP A;  1SFE A;  1P7J A;  4A0Z A;  5B3S H;  1FBS A;  2K9L A;  2DQL A;  3NAR A;  3ZMV A;  1R5G A;  1SD7 A;  1TWA J;  3ZMT A;  1R7J A;  3CQZ J;  3BDD A;  4BY7 J;  3ZGK A;  1QO0 D;  1SFX A;  4BL0 B;  3S2D J;  1QA6 A;  3M07 A;  1K4T A;  3SZT A;  3TQN A;  4N4N B;  1IN7 A;  2XPW A;  2VT3 A;  1J0R A;  4CA0 A;  3LA7 A;  4NC7 A;  2K85 A;  4V2G A;  3Q0U A;  2EPF A;  2Z9O A;  1X58 A;  2V6C A;  3BJO A;  5FRM A;  1X1P A;  1ZR2 A;  3H3V K;  4WCG A;  1UG0 A;  1R1U A;  1YS7 A;  2GBY A;  1S5L C;  1TQM A;  3BR1 A;  3JR9 A;  1K78 A;  4MTE A;  1R4M B;  3FXL A;  2LVS A;  3L2V A;  1YRN B;  1ON1 A;  2BGC A;  1R4N B;  4CCM A;  4G94 A;  4L0Z B;  1BC7 C;  5DDG A;  1MBE A;  3WU0 A;  3GTG J;  5DEQ A;  3A0H C;  3JRH A;  2LC2 A;  4A0Y A;  4ZTJ A;  2GQQ A;  3I54 A;  4BXU A;  2D1H A;  2L9R A;  4BH9 A;  2FD5 A;  1OCO H;  4ETS A;  1J5Y A;  3HEF A;  3G3Z A;  3QQA A;  2EZH A;  4BHC A;  2JTV A;  4I76 A;  2A6H F;  2ZCW A;  1U78 A;  4YFK F;  1LEB A;  1Y0N A;  2XF5 A;  3SZG A;  1W5C C;  1Z67 A;  1HCR A;  3QOP A;  3DKY A;  1D1C A;  4C30 A;  3QOD A;  2VE9 A;  4UVC A;  5KAI C;  4BYY A;  1GVJ A;  3F23 A;  1FT9 A;  2YU3 A;  1EH8 A;  1JKR C;  3VFZ A;  5FLX Z;  2A5W A;  2W82 A;  2E1M C;  2M45 A;  1RES A;  3BWG A;  4F55 A;  2XAQ A;  5JHF A;  1QHH D;  4HQE A;  1YG2 A;  2VQH A;  1X19 A;  2LBF B;  3DV8 A;  4BY1 J;  2RVC A;  4S04 A;  1BW6 A;  4LLL A;  2OF7 A;  1X1A A;  1WPK A;  1VFC A;  2W00 A;  4HZF A;  3QYE A;  4RAZ A;  2F2E A;  3T0Y A;  2D1V A;  3AAF A;  1LJ9 A;  1TP4 A;  3GCM A;  4IPA A;  3ULQ B;  3SHF A;  5ICE A;  3BRO A;  3FK6 A;  3E7L A;  3I64 A;  5LD2 C;  3K2A A;  4OAY A;  2CO5 A;  3A4C A;  3P5J A;  3GFI A;  2NOG A;  2EA2 A;  3ZMS A;  2OTL I;  1J9I A;  4CH7 A;  3RYR A;  2Q2E A;  1B6A A;  2DJI A;  1H9T A;  5B66 C;  1UMQ A;  4B48 A;  2GXB A;  1X1D A;  1VQ6 I;  2OPT A;  5TRD A;  3F8F A;  3PM1 A;  4CSW A;  1WRJ A;  4DNC A;  3NQO A;  1MZB A;  3JRE A;  2OCC H;  1G59 A;  5GTH C;  3BZK A;  3ZQF A;  5CVR A;  2QQA A;  2CMP A;  1CQT A;  5FJ8 J;  2IP2 A;  2M3A A;  5BPD A;  3PO3 J;  1D5Y A;  1LPQ A;  3S15 J;  2KJC A;  1U5T A;  2BBY A;  2MYS A;  1X1B A;  4ABZ A;  3LSK A;  2LF7 A;  4G6T B;  1WJF A;  1RC9 A;  3KPH A;  2JSC A;  4E4H A;  3JRG A;  5K7F A;  5HLT A;  1K4S A;  4KIS A;  2MBF A;  4A0X A;  2X9D A;  3LSH A;  5F1J A;  2ZJQ F;  2WV0 A;  3QP5 A;  1FOK A;  4X1E A;  3K7A J;  2MC4 A;  2Z2S B;  4LLN A;  2JQ7 A;  2FBH A;  1R9T J;  1YW8 A;  1PDN C;  3Q9V A;  2G7U A;  5IOZ A;  4WF2 A;  2QQB A;  1PUF B;  4DGW B;  2W4S A;  3R0A A;  2A6T A;  3IWF A;  2BXZ A;  1TL8 A;  4HLY A;  4PJJ A;  5HLI A;  1RIO H;  3R60 A;  3TGN A;  3HHH A;  3MWM A;  4A6E A;  3H92 A;  5ICG A;  1R23 A;  4HAM A;  4XLE A;  1BIB A;  5F6F A;  2IGO A;  4F92 B;  4HA8 A;  5LEK A;  4I01 A;  1IUF A;  3BJ6 A;  5EG0 B;  5GP9 A;  1IN5 A;  4PDK A;  1B8I B;  4EQQ A;  2W7N A;  2E71 A;  3PNV A;  5IYB J;  4UUS B;  1YX5 A;  2B7E A;  5KNL A;  4N9H A;  1Y1W J;  1VI0 A;  3I4N J;  3AG4 H;  1YI2 I;  4P9F A;  2CQX A;  3RQI A;  5E3L A;  9ANT A;  1IRX A;  2XHK A;  4G7O F;  5KHD A;  3TO6 A;  2E1O A;  5H6Q A;  3QPT A;  2MA3 A;  2YSR A;  4YRV A;  1A31 A;  2K9M A;  2LY2 A;  4BQQ A;  1UHW A;  2W25 A;  3OYH A;  3J81 K;  4AM3 A;  4Y4R A;  3OYJ A;  2BY0 A;  1Y39 A;  5C4X J;  4M72 A;  3FMS A;  2ESN A;  1E2X A;  3CCM I;  1QU3 A;  4GYI A;  2F5F A;  4G12 A;  2K9Q A;  2P4W A;  1EH7 A;  4BDZ A;  1FYM A;  2DYS H;  2XSD C;  1ACI A;  2LKP A;  3TMO A;  2FF4 A;  2CV2 A;  4GDF A;  2M4G A;  4IRH A;  1XGO A;  1JJ6 C;  2F4O B;  2VPL A;  4XKB A;  2Y0S A;  2KZG A;  3HHG A;  2EIL H;  1IXC A;  1AA7 A;  2VOO A;  1U3E M;  2QGU A;  3CLQ A;  3CCJ I;  2YPR A;  1VZ0 A;  4D0P A;  2JWT A;  1NK3 P;  3E97 A;  3CCU I;  2HYF A;  4M3B A;  4AYB N;  1Z9C A;  4IHX A;  2Z99 A;  1LDK B;  3O6B B;  4MIM A;  4IXA A;  1YRN A;  1HA8 A;  1TW2 A;  3OIQ A;  2XIG A;  4YEL A;  1P6R A;  2KRF A;  1DU0 A;  3V42 A;  4IO9 F;  2A07 F;  2DN0 A;  3ZQC A;  3MZH A;  3L00 A;  1UCR A;  5L3E A;  2RRE A;  1O4X A;  4B43 A;  1SD4 A;  1IN8 A;  5ILU A;  5E3N A;  3KZI C;  3N97 A;  2LNB A;  5CVV A;  1ZRD A;  4G6D A;  1SD6 A;  5CLS A;  1WQ2 A;  2G0E A;  3FMR A;  5LFA A;  3J80 K;  3J7Z I;  2CUJ A;  5J1R A;  3HYI A;  3TP3 A;  4TV7 A;  1T0F C;  3PSF A;  1ZGW A;  2EWN A;  3KEO A;  5E3O A;  4RS8 A;  1WH5 A;  1OCP A;  3TED A;  3F8B A;  5JFR A;  3H0G J;  1TZL A;  4L9J A;  3WE2 A;  3S1N J;  2H1L A;  4PJM A;  1F4K A;  4A3J J;  3W6K B;  2MGQ A;  4XOT A;  3LNQ A;  5EYR A;  2O9L A;  2NS7 A;  2V9P A;  2PFB A;  3LSG A;  1VQ4 I;  4Q4Z F;  3C1D A;  3Q3S A;  1GVD A;  1S29 A;  1OIS A;  2XUB A;  2PMH A;  4LJZ F;  4YEJ A;  2QM3 A;  2LBF A;  3L2Q A;  1MNM C;  1MD0 A;  5FKM A;  5M5Y J;  2GXG A;  1A36 A;  3HZJ A;  3EPZ A;  1OPC A;  4RM3 A;  3ZRG A;  1ZYR F;  3K1N A;  2PMZ N;  4PZJ A;  4WX9 A;  1W7P D;  3S2H J;  2ECC A;  2BY2 A;  2NS0 A;  4AUX A;  3I5U A;  4I7H A;  1ZRE A;  4I0B A;  3MZ8 A;  4BUP A;  2X51 A;  1SC7 A;  2OA4 A;  4A3B J;  2VKH A;  3PQJ A;  2WC2 A;  2R5Y B;  1G4D A;  2PX9 A;  3OIP A;  1T33 A;  1XSD A;  5CQE A;  1D1A A;  2E5Z A;  1MNE A;  1REP C;  4W97 A;  5HS8 A;  5J1Y A;  4DYC A;  2JMW A;  5D4R A;  1IAW A;  3C7J A;  4BAY A;  4B09 A;  4L5E A;  1T08 B;  2FSW A;  3CZ6 A;  4M74 A;  5ICF A;  2OTJ I;  2OV7 A;  3IH4 A;  1JHH A;  2AXL A;  2A69 F;  1XDS A;  2CH0 A;  4ENN A;  5HDN A;  3O8H A;  2MH9 A;  1Z7U A;  2ID6 A;  3U2R A;  3ZR8 X;  3K2Z A;  2L5Q A;  2DPU A;  3T8R A;  5FKL A;  1R49 A;  2DFF A;  1SMY F;  3LAP A;  2HVR A;  2JRT A;  3F3X A;  1ZQ3 P;  5EEA A;  3FX3 A;  2HEO A;  4A3G J;  4CZZ A;  2V6E A;  2G7H A;  2HOA A;  2QYO A;  2R93 J;  2LLK A;  3RKX A;  4KIF A;  3CCY A;  4Y7N J;  4HF2 A;  3BCA A;  2VBY A;  1WI3 A;  2BE5 F;  2DFE A;  2V9V A;  3D5L A;  1BOA A;  2QEN A;  1PUF A;  1ZKG A;  3AL0 B;  2YU9 J;  4KA4 A;  1P9Q C;  2MLG A;  4XNF A;  3LSP A;  2Q1Z B;  1MBJ A;  1GHC A;  2W84 A;  3G1O A;  1LQ1 A;  3FXR A;  4JX4 A;  3K4L A;  4KNY A;  3RPQ A;  2Z5U A;  4CIC A;  4UNO A;  1RPW A;  4UB6 C;  3HRS A;  2NYX A;  2HDC A;  3FBI B;  4GGG A;  2ACJ A;  3RKW A;  2BW3 B;  3GTO J;  5KCM A;  5EG0 A;  2IS4 A;  1XMK A;  3KEY A;  4EVI A;  2BXY A;  2JZY A;  5B5E C;  3FIS A;  4UUS A;  1MDM B;  1HBX G;  2IA0 A;  4ZJZ A;  1RUO A;  4AD9 A;  2E60 A;  1BI0 A;  2X1E A;  1JJ8 C;  2GXA A;  3V8J A;  5LGN A;  3AL0 C;  1E0E A;  3ZN1 A;  4LG3 A;  4XRS G;  1TW3 A;  3COA C;  1ETW A;  4YII A;  2DA3 A;  1NK2 P;  2EB7 A;  2QZ8 A;  4IX7 A;  3OIO A;  2OJE D;  3OY9 A;  2GAU A;  3QRF F;  2R7Z J;  2OC6 A;  3V7C A;  4Q5S F;  1TWF J;  5K7H A;  4EV0 A;  2JUC A;  3KX2 A;  3L09 A;  4QIW N;  1BR1 A;  2BHZ A;  3IH2 A;  4ZDO A;  2ZSI B;  2L7M P;  2QQ8 A;  4M73 A;  1LFP A;  2HQA A;  3BR3 A;  3LFK A;  2NRA C;  4UVB A;  2DT6 A;  4FX0 A;  4DJA A;  3RPU D;  2FX0 A;  2COM A;  1CF7 A;  1IZ1 A;  2O8X A;  3S17 J;  3JSP A;  2DK8 A;  1W5S A;  3B6C A;  2ME0 A;  3S14 J;  4F7Z A;  4FTH A;  4BJT A;  3S1R J;  4N0B A;  3BR0 A;  1JGS A;  3VYT B;  3C3W A;  3HOU J;  1VQN I;  2CYY A;  2X85 A;  1G8X A;  3L1P A;  2F6C A;  4Z2Y A;  3EUK L;  4RGR A;  1F43 A;  2XAG A;  3BLY A;  3W3C A;  5JR3 A;  3E6C C;  3HKZ N;  5TJJ A;  5LRR A;  5K5R A;  3KYL A;  5BQT A;  4MFD A;  1ON2 A;  2AXT C;  2YX4 A;  3SJM A;  2E35 A;  1HDD C;  3QWL A;  2NNY A;  3VPR A;  3BG9 A;  1Z7L A;  3L2U A;  2M30 A;  2GZW A;  2EJR A;  4LLG F;  4CCJ A;  4A93 J;  3I58 A;  4MNU A;  1K6O A;  2Y48 A;  1MSE C;  3OS2 A;  1W36 C;  4RAF A;  5J40 A;  1Z6T A;  3J80 Z;  4HSR A;  3KEQ A;  1T6S A;  2L54 A;  1P92 A;  5EJC A;  3AFH A;  1UFM A;  1V3F A;  3S32 A;  5KVR A;  2X6O A;  3ZXS A;  4A12 A;  1FIA A;  2V7F A;  1D5V A;  1IRF A;  1UHS A;  2X1C A;  2VJ4 A;  3N4M A;  2Z33 A;  3CJT B;  3I59 A;  5F0C A;  3OYC A;  3AG3 H;  3ZQ7 A;  2HWV A;  2JN6 A;  3VYU B;  1ODD A;  2JT1 A;  3G1L A;  4XID A;  3ZQG A;  2QWW A;  4RLF A;  2HS5 A;  4HBL A;  2EV0 A;  2IVM A;  1IG7 A;  2JA5 J;  3PIP F;  3SQN A;  2G9W A;  3KZY A;  2ELH A;  2XV4 S;  2KIQ A;  2RAE A;  1YJN I;  5LGU A;  2L9S A;  3BG6 A;  4GO1 A;  3L7W A;  3S1Q J;  3CCS I;  4II3 A;  3H35 A;  2R7V A;  3SEQ A;  2IRF G;  3JCU C;  4FQG A;  3GFM A;  1QZY A;  2L0K A;  2WTE A;  3WGI A;  1S7A A;  3BPV A;  4I0A A;  4ON0 A;  4YFN F;  2QSF X;  1BJZ A;  3NRV A;  3K4K A;  1YLF A;  2H27 A;  5J47 A;  3KCC A;  1BC8 C;  3K6G A;  3HRT A;  4CCK A;  3F8M A;  3V8L A;  3K4M A;  4HDV A;  3OYB A;  4A3I J;  2F5E A;  2H6B A;  5ICC A;  1S72 I;  1R71 A;  2LKX A;  2R5Y A;  3DLA A;  3KP2 A;  1ETX A;  1DU6 A;  4HPQ A;  3M4O J;  2O3F A;  2JSP A;  3MAJ A;  1O3T A;  2H6C A;  1EA3 A;  3BOQ A;  3LA3 A;  2VXZ A;  3N05 A;  1K6Y A;  2QBY B;  4XLP F;  2MLK A;  5FKK A;  4M9S A;  3FHN A;  1B4A A;  4HG2 A;  3WTU C;  1IN6 A;  4XLH A;  3DPT A;  1FOY A;  1H9G A;  2FQ3 A;  3BPX A;  3CJR B;  3MQ0 A;  4J00 A;  3O3K A;  1H8A C;  1KU7 A;  3ABK H;  2EH3 A;  2A61 A;  4XKC A;  3HM5 A;  1WH7 A;  3S16 J;  4BHB A;  1U5T C;  4O5V A;  3SDB A;  1PP7 U;  4G6Q A;  4RB3 C;  1JUP A;  3ABL H;  3K69 A;  5E8G A;  4RGX A;  3BQY A;  4Y15 A;  4N9I A;  1Z6R A;  2BOL A;  4IKF A;  2M34 A;  4R79 A;  3CUO A;  3NEU A;  4MFE A;  4D1Q A;  2FEZ A;  3WTZ A;  1R5I D;  4HF1 A;  1J75 A;  3TBI A;  4S05 A;  4M3D A;  1SVL A;  3JTH A;  1S7O A;  4BHP A;  4CCO A;  1APL C;  2K3P A;  2HQ5 A;  2DOE A;  5F0H A;  3DEE A;  1QZZ A;  2DDA A;  1FJL A;  1TBX A;  2V1U A;  4U88 A;  4Q47 A;  1X3W B;  1D8K A;  1FMV A;  2NXN B;  2V79 A;  1KZH A;  1S7E A;  3FXM A;  4EJW A;  4CO8 A;  3W2A A;  2VAS A;  3M1C A;  3P7N A;  3WG7 H;  4C3J J;  3IC7 A;  4EGZ A;  2IS2 A;  3VOD A;  3MEX A;  2BW3 A;  4AIJ A;  3PO2 J;  1W1W E;  3FZV A;  4JX5 A;  2DQR A;  2IGK A;  3BG7 A;  2LD5 A;  1AKH B;  2MW8 A;  4NHJ A;  2CUE A;  4MHG A;  1MBG A;  4X0G A;  2V9K A;  3ABU A;  4XRS A;  1O3R A;  2HNH A;  5CJ9 A;  5F64 A;  2K5C A;  4RGS A;  1UEL B;  2K27 A;  2O03 A;  5D4S A;  4M6X A;  1XS9 A;  3A01 B;  4LIU A;  1JKO C;  2PJR A;  3S3O A;  3A0B C;  2KLO A;  3PSI A;  1ETO A;  2KIS A;  4Z6Y A;  1FX7 A;  1K7A A;  4HQM A;  5J3L A;  2L02 A;  4GRI A;  1H0M A;  2E2J J;  2JJ7 A;  3TW7 A;  4E7J A;  2NVQ J;  2WAF A;  2Y69 H;  2DA4 A;  4LFU A;  1U6G A;  4I98 B;  1YQA A;  4OIP F;  3DQV C;  3CMY A;  2HQN A;  4ZYH A;  4WK8 F;  2WB1 N;  2XAS A;  2XAU A;  2AO9 A;  1T2K A;  4JQF A;  1HKQ A;  5DCM B;  3CES A;  1WJE A;  5JVT A;  4PJ0 C;  4PJL A;  3BTC A;  1X4P A;  1QZE A;  4BQA A;  1BA5 A;  4A3M J;  2QSG X;  4JOM A;  3QYB A;  2A05 A;  2BHY A;  3ASO H;  5DV5 A;  4GCV A;  2IBD A;  2KKO A;  2P0W A;  2VIX A;  2R7O A;  3S3M A;  4KIC A;  3KYC B;  2LR8 A;  2V1X A;  2GWR A;  3T1B A;  2R7S A;  2ISY A;  2HPI A;  1WVR A;  1WJD A;  4IHS A;  2NVT J;  4ZZL A;  4HV5 A;  4FE7 A;  5EGO B;  1TWG J;  1SFO J;  3E6D A;  2UV1 A;  5GPC A;  1TC3 C;  4CXF A;  3C2B A;  4U7B A;  2HXI A;  4HF0 A;  2EZL A;  1POG A;  3M8F A;  4F3Q A;  2HVS A;  2L01 A;  4EM2 A;  3ROU A;  4RAY A;  4IRI A;  3OS0 A;  2KDZ A;  1PP8 F;  3OR1 C;  1AOY A;  3DF8 A;  4CYC B;  3VOE A;  1IO2 A;  4XK4 A;  4BAC A;  1XCB A;  1HW5 A;  1QPI A;  1VND A;  4Y33 A;  4B3X A;  1HW2 A;  4H0E A;  5IPA A;  2OD5 A;  1FBU A;  5IT3 A;  5KAF C;  3ZQH A;  1NTC A;  3CUQ B;  2K9S A;  3EYY A;  4KJZ A;  4UB8 C;  1JI8 A;  3VWB A;  3KP3 A;  4LB6 B;  1FIP A;  1QRY A;  4BJ5 C;  4LB5 A;  4IHY A;  4F52 A;  1LFB A;  1IGN A;  3H3U A;  1ZEL A;  2EA4 A;  3O2P E;  1TT0 A;  4BJ6 C;  5D5W B;  1X2N A;  1TWC J;  4M3E A;  3VYR B;  2XKO A;  1K61 A;  2L7F P;  5DM7 F;  4OMZ A;  3GZ5 A;  1E3P A;  4K2E A;  4M9Z A;  3F0C A;  3KP7 A;  3QPH A;  1A04 A;  3HOZ J;  3JRA A;  1MW7 A;  2L7K A;  1XMX A;  3CUQ C;  2IGM A;  1KON A;  4PGG A;  4AYB A;  3I3L A;  2OZU A;  2QCO A;  2A6E F;  2VBW A;  1AWC A;  1KGS A;  1USS A;  3LWF A;  5DM6 F;  3K70 C;  4A3F J;  2BYV E;  5HLH A;  2L4A A;  3IRQ A;  2FU4 A;  3A2K A;  3K4C A;  2IGN A;  3HTU A;  1YW7 A;  1MMN A;  3O8G A;  2XGC A;  4I02 A;  3V4G A;  5C44 J;  1XGN A;  2R7X A;  2V1N A;  1SMT A;  2F5C A;  2AS5 F;  2M7A A;  2JVH A;  2QBY A;  2GIV A;  2HU9 A;  3W6J B;  3CDL A;  2F48 A;  2Z16 A;  1FBQ A;  3BZ6 A;  3TKY A;  3DU6 A;  5H20 A;  2M8E A;  5JI6 A;  2M7B A;  1GT0 C;  1B72 B;  1UG2 A;  4ZC3 A;  2HZT A;  1V5F A;  4XLC A;  2R0Q C;  1YO5 C;  4ITV A;  2PBI A;  4WXH A;  3BTL A;  5FO5 A;  2ZME B;  3DU5 A;  5HVQ C;  4AIH A;  5FB2 A;  3WTS C;  2P5K A;  3CCL I;  4HNT A;  3EUA A;  4NC6 A;  2JA8 J;  1X1C A;  1V55 H;  3H5R A;  1I5Z A;  5DCF A;  1OYY A;  3LSI A;  4XRM A;  2E2I J;  5FLV A;  1MH4 A;  1XSX A;  3DBR B;  2BVM A;  2CJJ A;  3F72 A;  3OWT A;  3TW6 A;  4DBQ A;  1QVT A;  2TCT A;  5FFX A;  3WHC A;  3B02 A;  4E70 A;  3J7A O;  2R5Z B;  3OOU A;  1BOB A;  3GTK J;  4CZC A;  1HKS A;  4EM0 B;  1M1E B;  3M8J A;  2PMZ A;  2KDO A;  2R7T A;  2EV5 A;  5A2Q K;  1XTA A;  3HC7 A;  3C2G A;  4DZP A;  1E3H A;  1YIT I;  2FNP A;  2QQ9 A;  2CW7 A;  2RQP A;  5J1U A;  2VXD A;  1MMG A;  1R00 A;  1R1V A;  2XAJ A;  1AKH A;  3MVP A;  4C3H J;  1GUU A;  4FIS A;  4D7M A;  2M2E A;  3WU1 B;  1T8I A;  1ERD A;  1AHD P;  2H94 A;  3E5X A;  4HDU A;  1IF1 A;  4LK0 F;  3OYK A;  1F1Z A;  1U8R A;  2MG4 A;  2NOJ B;  1MIJ A;  1TQI A;  3QPL A;  2Y75 A;  3LSR A;  3L2R A;  1NG6 A;  4HW0 A;  3GME A;  4CCN A;  4ZYE A;  3OYM A;  1WZ2 A;  2DLL A;  5M5W J;  2DA7 A;  4R1H A;  2DA2 A;  1JUS A;  3OYD A;  2MD0 A;  3OYG A;  1RKT A;  4E6K G;  4EM1 A;  3FIW A;  4NQW B;  1R5H A;  2FOK A;  4L18 B;  1SVM A;  4AWX B;  3PUB A;  5F04 A;  1XSV A;  3EDP A;  3DXJ F;  2ID3 A;  3U1D A;  1VQM I;  1XD7 A;  1O3S A;  3J7A Y;  4FET A;  3DPL C;  1RNL A;  4F91 B;  1V5G A;  3WTX C;  4ANJ A;  3RCO A;  4BNC A;  2VQG A;  5DCM A;  3BCB A;  5HS9 A;  2LG4 A;  2XGE A;  1D1B A;  3S8P A;  3W2V A;  3GEZ A;  3QOE A;  2CW8 A;  3WGH A;  3HG9 A;  5M5X J;  4B3A A;  1ZH5 A;  2KRC A;  1EV7 A;  1YYV A;  2LSO A;  3TOB A;  1NHA A;  1W0U A;  3I55 I;  3FWE A;  5GPA A;  4XOR A;  3CF2 A;  2BY3 A;  1WJA A;  3EQL F;  4OMY A;  4MO7 A;  4QPO A;  1GXP A;  4A3E J;  2W85 A;  5EGO A;  4EJU A;  4OIQ F;  2WAQ N;  4XON A;  2CW0 F;  1GXQ A;  1N75 A;  2D2W A;  2L2O A;  3PFY A;  4IVN A;  4HLX A;  4KDP A;  2VN2 A;  1DP3 A;  3DPU A;  4KN4 X;  5E1W A;  5JVG F;  2XPV A;  1ONV A;  3LST A;  2GLO A;  1XB4 A;  2XRO A;  4L9N A;  2HI3 A;  2ESH A;  5LEJ A;  4G8X A;  3VSL A;  5DD8 A;  3BP8 A;  3DTI A;  5CQG A;  2A5Y B;  4IEJ A;  2EQR A;  2OZ6 A;  2E1N A;  4KIG A;  3HOX J;  3FXQ A;  3ZN0 A;  3CUQ A;  3FXK A;  5ILV A;  2F4M B;  3HL2 A;  1HXD A;  3DEU A;  3H9Q A;  2DMP A;  1WJB A;  2CRG A;  2JPB A;  2I10 A;  3RKQ A;  3FKJ A;  2CUF A;  1IV6 A;  1OMI A;  3IH3 A;  2YX7 A;  1I3A A;  2XB0 X;  2QUF A;  3FDY A;  4OWR B;  2XAF A;  4BQO A;  4C9Y A;  3QPS A;  4DW6 A;  1FWZ A;  2IEK A;  4XLA A;  1W7P B;  4ESF A;  2E36 A;  1E3O C;  3RI4 A;  2IPQ X;  1W5T A;  2ZXH A;  3IAS 2;  2DT7 B;  2F4I A;  5HNH A;  1UST A;  5BPI A;  2K86 A;  1A35 A;  3LQR A;  4J01 A;  1WHU A;  4IHT A;  3IL2 A;  3CLO A;  3CCQ I;  1X4O A;  1VQ8 I;  3S93 A;  1WGX A;  4XLN F;  1Y8Q B;  5K5Q A;  2HGC A;  4BS9 A;  4J19 A;  4KIB A;  3I9V 2;  3HKZ A;  2IT0 A;  2HTS A;  1ETY A;  1OYI A;  3TOA A;  4KMU X;  4PUS A;  2I8D A;  2DBB A;  4MEY F;  3GTL J;  4Y3O A;  3DEW A;  1BI1 A;  2VQL A;  5EDN A;  3AKZ A;  3TL4 X;  4E7S A;  4XL9 A;  3VEP A;  2DMN A;  2BEO A;  4QLC U;  3DKW A;  1OYW A;  4A69 C;  2VE8 A;  1Z21 A;  2JPC A;  1D0Y A;  2QLZ A;  2W57 A;  1ZK8 A;  3QU3 A;  2M8G X;  1SFU A;  4ENM A;  2VOP A;  2FE3 A;  4WWC A;  5J8C A;  4A2U A;  1Z1D A;  3FBN B;  3ZMZ A;  1G2H A;  4IRG A;  1HSJ A;  2W48 A;  1KU3 A;  4JYK A;  5DS9 A;  2YS9 A;  2CV1 A;  1U0J A;  2N8G A;  2QKL B;  1B72 A;  2X6X A;  2CV0 A;  3BQZ A;  3HUG B;  4YG2 F;  2CFO A;  1KQ0 A;  1EKE A;  4MEX F;  4CUG A;  2ETH A;  1ORK A;  2XRL A;  4M3F A;  4UY8 I;  5E17 F;  1I1S A;  2VKD A;  3CDI A;  2P6S A;  5K7Z A;  1IUY A;  6PAX A;  1SAX A;  1VQ5 I;  3LOC A;  4RB0 A;  2JK3 A;  3JRF A;  1B8I A;  3V8K A;  3HRU A;  2XF6 A;  3S3N A;  2FXA A;  3F21 A;  2HQR A;  2UXX A;  4EAT A;  2KZV A;  2J5O A;  4I99 C;  3HBL A;  2R5Z A;  4BE1 A;  4LD5 A;  4BU2 A;  1FLI A;  1S8N A;  1HST A;  2E5N A;  4QSH A;  2EFW A;  4ESJ A;  2DW4 A;  3HJE A;  3TO7 A;  4NNJ A;  4LIT A;  1YJW I;  5A2Q Z;  3K1M A;  3SZP A;  3OSG A;  1OCT C;  3CD6 I;  2ZJR F;  3VSK A;  1MBF A;  1IXR C;  5CVJ A;  4U87 A;  5E1X A;  4C3I J;  1I6H J;  5HDG A;  1QHG A;  5CKT A;  5FFZ A;  2KJB A;  2ME6 A;  2W1O A;  1BR2 A;  3TDU C;  4HEA 2;  1BI2 A;  3RZD J;  1WJ5 A;  2H09 A;  4RB1 A;  1QQI A;  2FML A;  2O7O A;  5FD5 A;  3WE3 A;  2K7L A;  3ZQL A;  2LP0 A;  1IN4 A;  1GDT A;  1JKQ C;  4NUB A;  5LRS A;  1IV8 A;  3LFU A;  3GXO A;  4NQW A;  3SFI A;  5GAE J;  2DFI A;  2E7W A;  2K9N A;  2R7D A;  3NAU A;  3B73 A;  4Y13 A;  3E5U A;  1K78 B;  1R1T A;  2GOM A;  1C0W A;  3L2W A;  4XRF A;  4E7K A;  2PN6 A;  2DOA A;  1W36 D;  1WWX A;  2FQ4 A;  3BTJ A;  4I2O A;  3IKT A;  1F5T A;  4ZZD A;  5IT9 K;  4S0H B;  2LF8 A;  2HPM A;  3P9I A;  2VJI A;  1W0T A;  1MMA A;  1LVA A;  3EUH A;  2JUG A;  2KIU A;  1D3Y A;  1UB9 A;  3D0S A;  2ZJ2 A;  3CC4 I;  1R22 A;  2HXO A;  1WCM J;  3HOW J;  2PQ8 A;  4HV6 A;  5BOX A;  3GTP J;  2DI3 A;  5F08 A;  4DZJ A;  1F9N A;  3ASN H;  1X3U A;  1UJ8 A;  2UXN A;  2Y0M A;  3OYI A;  5GAD J;  1FC3 A;  1IRZ A;  4C2U A;  2XGD A;  1Z3X A;  4QPQ A;  1IDY A;  1Q1V A;  4L5I A;  2A3S A;  1J2X A;  1WJC A;  4B8X A;  1FY7 A;  1XN7 A;  1B1B A;  2HYJ A;  2XKP A;  1G3T A;  2ZBK A;  3MD2 A;  3I0T A;  3CO7 C;  3GTJ J;  4BE0 A;  3OL3 A;  5IOY A;  3JRB A;  4IQ4 A;  2P6T A;  3H36 A;  5J4Y A;  1Y8R B;  4WXC A;  1ZRC A;  1MBH A;  3GZN B;  2D45 A;  2EFN A;  3PUF A;  1RR7 A;  3WTY C;  1FEX A;  2L4M A;  1MJA A;  2IA1 A;  3NWS A;  2VJ5 A;  2DPD A;  4CGZ A;  4M6Y A;  4ZYD A;  2OUM A;  2R4G A;  4UUV A;  3CTA A;  2XSJ C;  4GFB A;  4OIR F;  2WWY A;  3FM3 A;  4OIO F;  2R7U A;  2GIZ A;  3FK7 A;  2QSH X;  1X3Z B;  3HIF A;  1N78 A;  4PSW A;  2J5P A;  2M5W A;  1D0X A;  5LGT A;  4E7L A;  1Z91 A;  2ZKZ A;  1WSU A;  3TO9 A;  2DTZ A;  1Y56 A;  1IRG A;  5EF6 A;  3REO A;  2LTP A;  3E3V A;  1LNW A;  3BTI A;  1W7P A;  3OSF A;  1FTZ A;  2WB1 A;  5CYV A;  4XOP A;  3PFI A;  1OQY A;  2Q2E B;  3OYE A;  3IV5 A;  4LG0 B;  2R7F A;  1HQC A;  3RIR A;  1VQK I;  3HOS A;  2DMT A;  3L2C A;  3KYD B;  2LY9 A;  4L5J A;  2K4J A;  5J8F A;  5LHH A;  2KFD A;  4G9Y A;  2M0M A;  4KUM A;  1XX5 A;  4CHU A;  3DKX A;  1I27 A;  1S3J A;  3MMY B;  4MLO A;  4ENK A;  3MKW B;  1Y6I A;  3SXY A;  3IP4 B;  1ZAO A;  2IA2 A;  1G3Y A;  1DPR A;  3K1P A;  1SD5 A;  3H1C A;  3OL4 A;  5E79 C;  3K4J A;  3JRI A;  3D1N I;  1IXS B;  3Q5F A;  1FP1 D;  5E8I A;  4BXX J;  2Z1D A;  1FZP B;  3HPH A;  1TT5 B;  3GFL A;  1Q1H A;  3Q0W A;  4ZH4 F;  3UNG C;  1FP2 A;  3T8T A;  4FX4 A;  2FMY A;  5LHG A;  4BKX A;  4PK4 A;  2O5R A;  4XM3 A;  3TDZ C;  4GXO A;  4F93 B;  3ZCO A;  1MGT A;  4AVZ A;  4HNU A;  3HUG A;  3ABT A;  1VF9 A;  4QWQ A;  1P4W A;  5HS7 A;  4I09 A;  1UHM A;  1RI7 A;  2IS1 A;  2Y9Z A;  2RQQ A;  3LL7 A;  3R4K A;  2XF7 A;  1H89 C;  3G71 I;  2X6Y A;  3WG9 A;  2RGV A;  2ZXI A;  3E1S A;  1OLT A;  5EEH A;  4JK1 X;  2P81 A;  2V1D A;  4U7D A;  2F5V A;  5B1A H;  4BE2 A;  1MDM A;  3AG2 H;  1BL0 A;  2RDP A;  2CQK A;  4HOB A;  3JTG A;  1ETK A;  1FPQ A;  4FT8 A;  2PG4 A;  5CVI A;  5M3F J;  1LB2 A;  1A6I A;  4AC0 A;  2B63 J;  3ISP A;  4HRI A;  2B9S A;  1RRJ A;  4XBF A;  1DGW Y;  3PL8 A;  5IYC J;  3BC8 A;  1ENH A;  3CCR I;  3BR2 A;  3HOV J;  5J4V A;  4FAS D;  1MH3 A;  2WA0 A;  2ZSH B;  2WAD A;  5LHI A;  5GAG J;  4U0V A;  1KQ9 A;  2YUS A;  3E6B A;  3HTS B;  3H5N A;  3UR3 C;  1SEU A;  2Y31 A;  3WGG A;  4G7Z F;  2QF7 A;  3RPU A;  4KYW A;  4ASN A;  2COB A;  2Y2Z A;  1ITY A;  4OU0 A;  3CP8 A;  2HTJ A;  4ESB A;  5D5X B;  4DBR A;  3GX4 X;  2VOD A;  1ZGA A;  1YHQ I;  2HR3 A;  3FHZ A;  4U0W A;  2CWE A;  3Q9S A;  1B9M A;  2VBX A;  3ML6 A;  5D6F A;  4HNV A;  1G6N A;  2O0Y A;  3RTR A;  3U1K A;  5F1R A;  2XPU A;  3MKZ A;  5IT9 Z;  3F6V A;  2WV1 A;  1EF4 A;  3M8E A;  2ELJ A;  3RZO J;  1YIO A; 
#chains in the Genus database with same CATH homology
 4I6Z A;  3MVP A;  4C3H J;  1GUU A;  4FIS A;  4D7M A;  2M2E A;  5EEA A;  1ZQ3 P;  4A3G J;  1AHD P;  2H1K A;  2VKE A;  4D5F A;  1IJW C;  2DA5 A;  3GBG A;  2HOA A;  2R93 J;  2MG4 A;  3I4M J;  2LLK A;  3QPL A;  2VPR A;  3CCY A;  1JTX A;  4Y7N J;  3LSR A;  1WI3 A;  1I3Q J;  5IP6 A;  2DJN A;  1HDP A;  5M5W J;  2DA7 A;  5FKN A;  1PUF A;  2DA2 A;  1JUS A;  1ZKG A;  2D5V A;  2EZK A;  2YU9 J;  1RKT A;  3FIW A;  3GTM J;  3LSP A;  4M6V A;  1MBJ A;  2ECB A;  3G1O A;  5F04 A;  4JX4 A;  2ID3 A;  3BG5 A;  1RPW A;  1RKW A;  5EZH A;  3GTO J;  5EG0 A;  4M3G A;  1F36 A;  1JT0 A;  2NVX J;  2XGE A;  2HDD A;  3JRD A;  3FIS A;  4UUS A;  2DA6 A;  1JJ8 C;  4NDL A;  5M5X J;  5FKO A;  4B3A A;  4BBS J;  5FLM J;  2K40 A;  1T56 A;  2DMQ A;  1W0U A;  3HB9 A;  1Z0X A;  4XRS G;  1ETW A;  4X6A J;  1MSF C;  2DA3 A;  4B1R A;  1NK2 P;  5GPA A;  3OIO A;  4MO7 A;  2R7Z J;  1IDZ A;  4A3E J;  5IYD J;  1TWF J;  5EGO A;  5K7H A;  4QIW N;  5E3M A;  2MSY A;  2WAQ N;  1U9N A;  4RBO A;  4A3D J;  3IH2 A;  2M9H A;  1TWH J;  2L7M P;  1Z77 A;  3HGY A;  3BR3 A;  5C4J J;  2FJ1 A;  2FX0 A;  2XPV A;  3S17 J;  5JLW A;  4Y52 J;  2GLO A;  2VUM J;  2HI3 A;  3B6C A;  5DTD A;  2ME0 A;  3S14 J;  3B6A A;  4FTH A;  3S1R J;  3BR0 A;  5EZG A;  4IEJ A;  3Q0V A;  2EQR A;  3DCF A;  3HOU J;  1U8B A;  4W1U A;  1U9O A;  3L1P A;  3HOX J;  5IP9 J;  1F43 A;  3HKZ N;  2DMP A;  2CRG A;  5HOD A;  3A03 A;  1BW5 A;  1OFC X;  1RET A;  2I10 A;  4MFD A;  3RKQ A;  3SJM A;  1P7J A;  1HDD C;  2CUF A;  1IV6 A;  3IH3 A;  3VPR A;  3BG9 A;  3NAR A;  1ZR4 A;  4A93 J;  2XB0 X;  2E2H J;  1TWA J;  3G1M A;  3QPS A;  4DW6 A;  1MSE C;  3CQZ J;  3WHB A;  4BY7 J;  4A3L J;  2IEK A;  1E3O C;  4FCY A;  3S2D J;  2H8R A;  3ZQI A;  1IC8 A;  2XPW A;  3M3Y J;  2JA6 J;  2X6O A;  2AHQ A;  4V2G A;  3Q0U A;  1FIA A;  1X58 A;  5IP7 J;  1UHS A;  3HDD A;  1ZR2 A;  5F0C A;  3H3V K;  1WGX A;  2IAI A;  2GBY A;  2JN6 A;  4J19 A;  4V2F A;  3BR1 A;  4JX6 A;  3G1L A;  5C3E J;  4XID A;  3JR9 A;  1ETY A;  3ZQG A;  2CU7 A;  3GTL J;  2LVS A;  1IG7 A;  2JA5 J;  1YRN B;  3DEW A;  4IHW A;  5EDN A;  1MBE A;  2DMN A;  3GTG J;  2ZB9 A;  2ELK A;  2RAE A;  4A69 C;  3JRH A;  1ZK8 A;  2M8G X;  3S1Q J;  2L9R A;  1XC5 A;  2FD5 A;  5F27 A;  1G2H A;  3BR5 A;  3A01 A;  3HEF A;  3QQA A;  2EZH A;  2W48 A;  4JYK A;  4I76 A;  5DS9 A;  2L0K A;  2YS9 A;  1U78 A;  2N8G A;  1B72 A;  4QTR A;  3BQZ A;  1BJZ A;  1HCR A;  1JKP C;  4JP0 A;  1ORK A;  2XRL A;  4M3F A;  4RDU A;  2O8K A;  4A3I J;  5K7Z A;  1JGG A;  4EEF G;  2LKX A;  2R5Y A;  3JRC A;  1JKR C;  1ETX A;  3LOC A;  1DU6 A;  2JK3 A;  3JRF A;  1B8I A;  3M4O J;  1RES A;  4IHV A;  3HOY J;  1JT6 A;  1X2M A;  2KT0 A;  3HBL A;  2R5Z A;  4BY1 J;  5FKK A;  1BW6 A;  4QSH A;  2OF7 A;  1VFC A;  1WPK A;  1H88 C;  1H8A C;  3MKL A;  2EH3 A;  4A3C J;  3FK6 A;  3HM5 A;  1WH7 A;  3E7L A;  3UKG A;  3OSG A;  1OCT C;  3S16 J;  1MBF A;  4C3I J;  3K2A A;  2HOT A;  1I6H J;  1JUP A;  2VKV A;  3BQY A;  2ME6 A;  2NOG A;  2M34 A;  3RZD J;  4MFE A;  1UMQ A;  4UUT A;  4M3D A;  2OPT A;  1APL C;  2O7O A;  3PM1 A;  2HQ5 A;  5F0H A;  4CYC A;  4DYQ A;  1AU7 A;  3ZQL A;  2LP0 A;  1GDT A;  1FJL A;  3JRE A;  1JKQ C;  3GTQ J;  3ZQF A;  4B4C A;  1K83 J;  3SFI A;  1S7E A;  1LE8 B;  1CQT A;  5FJ8 J;  2K9N A;  3NAU A;  3HGG A;  2JA7 J;  3PO3 J;  1D5Y A;  2NVY J;  4C3J J;  3S15 J;  4ABZ A;  2FQ4 A;  3BTJ A;  5BNG A;  3PO2 J;  3JRG A;  4JX5 A;  4S0H B;  1OJL A;  5K7F A;  1HOM A;  2HOS A;  2X9D A;  2LD5 A;  5JLX A;  1W0T A;  2MW8 A;  1AKH B;  5F1J A;  2CUE A;  1MBG A;  4XRS A;  4X1E A;  3K7A J;  2HXO A;  1WCM J;  2L7Z A;  1I50 J;  3HOW J;  1XS9 A;  3A01 B;  1JKO C;  3GTP J;  3LSJ A;  5F08 A;  4DZJ A;  1R9T J;  1ETO A;  1SAN A;  5IOZ A;  5J3L A;  1IRZ A;  1PUF B;  2E2J J;  2XGD A;  2JJ7 A;  3TW7 A;  2NVQ J;  2DA4 A;  1ETV A;  1IDY A;  1Q1V A;  3SDG A;  2HYJ A;  2NS8 A;  3CMY A;  2GM4 A;  3ZOB A;  2Y9Y A;  3GTJ J;  2WB1 N;  1IUF A;  5IOY A;  2AO9 A;  3JRB A;  5EG0 B;  5GP9 A;  1B8I B;  1MBH A;  3BTC A;  5IYB J;  4UUS B;  1RR7 A;  2Y0S N;  3S1M J;  1FEX A;  1P7I A;  4C2M J;  5M3M J;  2R92 J;  1Y1W J;  1BA5 A;  1VI0 A;  4A3M J;  3I4N J;  2IBD A;  2CQX A;  3RQI A;  5E3L A;  9ANT A;  2XB5 A;  1QVU A;  3A02 A;  2E1O A;  2LR8 A;  4GFB A;  2M0C A;  2LK2 A;  3FK7 A;  2X48 A;  3BT9 A;  5C4X J;  2NVT J;  4FE7 A;  5EGO B;  1TWG J;  4D7N A;  2DTZ A;  2VI6 A;  4G12 A;  1SFO J;  1A5J A;  1XG1 A;  1ZTR A;  2K9Q A;  5EF6 A;  2LTP A;  1GV2 A;  2Y30 A;  5GPC A;  3BTI A;  1TC3 C;  3C2B A;  2XSD C;  3OSF A;  2HXI A;  1FTZ A;  2EZL A;  1POG A;  4DYR A;  3IV5 A;  1JJ6 C;  2KDZ A;  3BG3 A;  4CYC B;  4BBR J;  4XK4 A;  2DMT A;  1QPI A;  1VND A;  2LY9 A;  4D5C A;  2JWT A;  5IPA A;  1NK3 P;  4AYB N;  4M3B A;  1HLV A;  4MLO A;  4IHX A;  3TP0 A;  1NTC A;  3ZQH A;  2K9S A;  2EBI A;  4MIM A;  1YRN A;  2DMU A;  1ETQ A;  1FIP A;  1QRY A;  1LFU P;  1DU0 A;  3JRI A;  4IHY A;  3D1N I;  2DN0 A;  1LFB A;  3ZQC A;  1IGN A;  4BXX J;  1O4X A;  1X2N A;  5E3N A;  3MN2 A;  1TWC J;  3Q0W A;  4M3E A;  2TRT A;  1K61 A;  2L7F P;  2G0E A;  3W6V A;  5J1R A;  3F0C A;  3FKI J;  4BKX A;  2EZI A;  1JTY A;  3TP3 A;  1ZGW A;  3HOZ J;  3JRA A;  5E3O A;  1FTT A;  1VF9 A;  1WH5 A;  1OCP A;  1HF0 A;  2QCO A;  3TED A;  3H0G J;  2Y9Z A;  3S1N J;  5F0F A;  1H89 C;  4A3F J;  4A3J J;  4FE4 A;  2MGQ A;  2DA1 A;  2P81 A;  3LNQ A;  5EYR A;  2O9L A;  2NS7 A;  3LSG A;  3O8G A;  2XGC A;  1BL0 A;  5C44 J;  3Q3S A;  1ETK A;  1GVD A;  1Y1V J;  3CDL A;  1MNM C;  5M3F J;  3BR6 A;  1A6I A;  4AC0 A;  2B63 J;  5FKM A;  5M5Y J;  5IYC J;  1ENH A;  1GT0 C;  1B72 B;  1UG2 A;  3HOV J;  3BR2 A;  2PMZ N;  3S2H J;  2ECC A;  1MH3 A;  4AUX A;  2R0Q C;  3BTL A;  1MBK A;  2LFB A;  2YUS A;  4A3B J;  2JA8 J;  2R5Y B;  2Y31 A;  2QF7 A;  1T33 A;  4A3K J;  4XIC A;  2E2I J;  4XRM A;  5FLV A;  1MH4 A;  4LOC A;  4W97 A;  2CJJ A;  3TW6 A;  4DYC A;  2COB A;  2JMW A;  2Y2Z A;  5J1Y A;  1ITY A;  1QVT A;  2TCT A;  3WHC A;  4L5E A;  1LE8 A;  2R5Z B;  3IH4 A;  3OOU A;  1GV5 A;  3GTK J;  2E19 A;  3O8H A;  2ID6 A;  2CQQ A;  4HNV A;  1JUM A;  2XPU A;  1EF4 A;  2WV1 A;  5FKL A;  4DZP A;  5J1U A;  3RZO J;  1AKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...