5MDHA

Crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
333
structure length
333
Chain Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate specificity in malate dehydrogenases: crystal structure of a ternary complex of porcine cytoplasmic malate dehydrogenase, alpha-ketomalonate and tetrahydoNAD.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 109
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mdhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5mdhA02
4FQ8A 1QV6A 3M1AA 3MJEA 4LCEA 4XD2A 4AJJA 3MOIA 5B4UA 5TT0A 1HKUA 1LSSA 1FDUA 3K30A 4B4OA 4BUCA 1PJCA 4JROA 1HYHA 5ICSA 1K2WA 5KIAA 4YQZA 3CKYA 2V6FA 3TSCA 1Z82A 2OP1A 4J0FA 3C85A 3E18A 1KC1A 1EEHA 2GUGA 5IZCC 2VUSA 3PVZA 4L76A 1N7HA 1F12A 3FI9A 1PJ4A 3S55A 3L77A 1XR3A 3B70A 1A7AA 2Y93A 5ITWA 1VPDA 3JQAB 2X5KO 4BIIA 4J1SA 1ZK3A 2HAEA 3HADA 4BVAA 3WTCA 1A9YA 4CV2A 4IJVA 1PZEA 1HETA 1H6BA 1ORRA 2P91A 3ZWPA 4DC1A 5C5IA 2QRKA 3I9MA 3L9XA 1GCOA 1RKXA 1I32A 2DBVO 3DAPA 3JYPA 1MX3A 2I5PO 3UCXA 4TRRA 4IIVA 1GYRA 1XDWA 4L0QA 5JC8A 2NU8A 5B37A 3CEAA 3GRKA 4XA8A 4U6SA 4Z0PA 1JVSA 3EC7A 3EK2A 1TB4A 3CMMA 2P5YA 1BTOA 1AGNA 1NHWA 4GMFA 4Q9NA 3GEMA 3PJDA 4DL9A 1R66A 2LDBA 1MFZA 3GVIA 4KP7A 4MVJE 2Q2VA 2NADA 1GFSA 1KVRA 1LJ8A 3DZBA 1E3EA 4CMIA 3D3EA 4J1TA 3EMKA 5G0WA 4C7KA 5G2OA 3WJ7A 5CEJA 5IJZA 2RIRA 4IM7A 4KQXA 5A04A 4B3IA 1LLQA 1D7OA 1NQTA 2O4UX 2Y1FA 3NDIA 5GMOA 2JHFA 3F4BA 3WS7A 3WYEA 3NYWA 3P2OA 3A06A 5F3RA 4Y9DA 3GVHA 1IY8A 2GRAA 4WLEA 4CMCA 5LCXA 1BRMA 2IXAA 4J2HA 4E2ZA 1D3AA 3PHJA 4CM6A 4Q3AA 5EQDA 2HK8A 1EE2A 4ILKA 2JD1A 1AE1A 2Y1EA 2CSUA 3JQDA 1YRLA 2YHIA 1B0AA 2Y67A 4HXYA 4ROSA 1N8KA 4N5MA 2NTVA 4PG4A 2AHRA 1U2DA 1Z7BA 3W8FA 3DZHA 4E5KA 5IAAA 4OOEA 1K6JA 4R9SA 4FW8A 4BKUA 5JW6A 1NTOA 1RJWA 3KV3O 1JWAB 5HS6A 3ANLA 3JQGA 2WJPA 3U4HA 2POQX 2YUTA 4B8ZA 2WD7A 1E3IA 1U5AA 4JGBA 1J6UA 1NAHA 3SC4A 3ZWWA 1PX0A 2EP7A 4IDAA 1QORA 2DM6A 4CLRB 2J3KA 3FSRA 1FXSA 5T5QA 1KVTA 2HMVA 4QX6A 3RC9A 1ADBA 1EVZA 3HE3A 3O03A 5EERA 2P9EA 2NNLD 4BMNA 3JQ9A 5IDYA 5DCWA 2FMUA 3PK0A 4GI2A 3BHJA 1PGQA 5AXBA 3WMXA 3D5TA 2EERA 1MV8A 1LRLA 1UJMA 5ER9A 2EW8A 1O5IA 4EJMA 2XXJA 3JQAA 2JCVA 4OL9A 5JO9A 1X15A 2X23A 3ETEA 1DXYA 3RQSA 4I9NA 2ZTVA 2O3RA 4GSKA 4WE3A 3ROKA 3BMCA 1F8GA 5B4VA 5JY6A 3GZ4A 4R5HA 3BMQA 4CM7A 5BSGA 3GOHA 1YXMA 3LYLA 5L4SA 4M86A 2AG5A 3TZHA 4F46A 4ONEA 2FR1A 3D3WB 3AOGA 1FDWA 1R0SA 3KYCB 4JJGA 4MVJM 2Q2WA 1LLCA 4XIYA 5A9RA 2SCUA 1PJTA 3H7AA 3RAJA 5FFFA 4PG8A 2C82A 4RVHA 2VQ3A 3NV9A 3LK7A 3RBVA 1R0KA 1JQBA 4NBUA 1H0KA 4BGUA 5F5NA 1ONOA 3QHAA 4FC6A 4IJUA 3Q2KA 1D4FA 4OXKA 3OICA 4P8RA 4JBIA 4RZHA 3WB9A 4CMJA 1GPJA 1MXFA 4DIBA 2IODA 2C5EA 4J0EA 4M54A 2D2IA 4U6QA 1DFHA 2X9VA 3KSUA 2YHUA 3JYNA 4BO6A 4PRLA 3C7AA 4WLFA 3OMLA 4P4NA 3RC7A 4YRBA 1LU9A 4MVJD 1PR9A 3GK3A 3X2FA 4PLHA 4FBGA 3PEFA 2RHCA 3JQ9C 2FZEA 4ALLA 4BOYA 2D5CA 3ZW8A 1C0IA 2I3GA 4Z9FA 3ZWYA 4BKRA 1X14A 1WDLA 1T26A 3CZMA 2GASA 4JK3A 1LDGA 3H6KA 3WSWA 3OJEA 4E32A 5TIIA 1Z75A 2EP5A 4MO2A 1VKNA 3I5MA 3WGGA 3A14A 3H2SA 1N5DA 1DFIA 1G0OA 1O89A 2VYVA 1E0DA 5AXCA 5U1PA 2V6MA 3NRCA 2J5KA 2FN7A 2AQKA 1ZO8A 3ADOA 5H81A 1O0SA 1LNQA 1JAYA 3QA9A 2BGKA 1CERA 1TT5B 3GPDG 1YS4A 3WMWA 1ZBQA 2WM3A 5THQA 3WWZA 3E03A 2OFPA 4OXNA 3E82A 5L95A 4UREA 3ZWXA 5L7TA 1H9AA 3B6ZA 4KQWA 1QYWA 3ANNA 4PRKA 2WYUA 3BMCB 4PLFA 1M75A 4Q3EA 1EK6A 3DBLB 3I52A 3OEWA 4KOAA 3ZNPA 4YAKA 3KRTA 4FB5A 2AG8A 3RBZA 3MWEB 4RPJA 5DZSA 1E1MA 3BTOA 1H94A 1T2DA 4R68A 5F1KA 5COQA 3S2EA 3DB2A 3TJRA 4B4UA 4CLOA 5IDXA 4GAEA 1SB8A 4J4BA 3ICPA 3E48A 2AXQA 1KYQA 3JQFA 1G0NA 1SEPA 3KYDA 4J3FA 1F14A 1RM4A 2O3JA 3DFUA 4F6LA 4PLCA 5ER6A 3MOGA 2VT3A 3DL2A 3RFTA 5BSEA 1SOWA 3ITKA 4RVSA 2BFOA 1NWHA 5DF1A 5FF9A 1X1TA 4EW6A 1GAEO 4EEXA 1C0KA 1A4UA 4GLLA 4YJHB 5TF4A 4YACA 1EQUA 2Y99A 3KZVA 3AY6A 1I01A 1QKIA 1OOEA 4QT0A 4AICA 1PTJA 2X86A 1GUYA 3PGJA 1ZEJA 3PQFA 4U7WA 3ZDFA 1T24A 2ZB8A 2Y1OA 4ZJUA 1V0JA 3IMFA 1DAPA 2ZQZA 4W99A 4BMVA 1OMOA 5AXDA 3T7EA 4K6FA 4CM9A 4CUJA 3OEYA 4DA9A 3GA0A 1VJ1A 2HQ1A 3GGGA 2WD8A 3ETGA 3D4PA 3RC2A 4L74A 3ONDA 4RPKA 1EFKA 4NFHA 4J49A 4PLYA 3GDFA 4FGWA 1I3NA 4R5MA 1BVRA 1XU7A 4UAGA 4Z0TA 4W7HA 5TS3A 1I33A 4F6CA 4AVYA 3I3OA 4I1IA 2IZZA 4G5HA 3GEGA 1EUDA 1EDZA 2IYOA 2NUAA 3H65A 3JSAA 4RJTA 4EBFA 3F9IA 2W4QA 1U1IA 2V6GA 2Z1MA 2P9GA 1ISFA 4CMIB 3FPCA 5CDGA 1E3LA 4OM8A 4MJLA 3TWOA 3GGPA 3K31A 1AXGA 3WGQA 3LT2A 1OI7A 3DMYA 4IMPA 9LDBA 1PZGA 1PJQA 2HRZA 4M49A 3PHGA 4DUPA 3VTZA 2BFMA 3GFBA 5IDQA 3RASA 4TVBA 3L4BA 1BXKA 4EZBA 3VVCA 2Q46A 3JTMA 1SB9A 2VWPA 2O23A 2DU8A 3SBOA 3CIFA 1YQDA 1PQWA 1T25A 1DAOA 2Q49A 5ES3A 2ZTUA 1KEWA 2CDAA 3AY7A 3MJCA 4M55A 4DBZA 4BNMA 4W4TA 1H93A 4AJKA 1E3JA 4NBVA 2YV3A 1P1FA 4M89A 5G0TA 3ZZNA 1O9BA 4ALMA 5DOZA 5C3MA 3MEQA 2B4TO 4CMBA 5C7IO 4BQPA 1WDKA 5KJ6A 1U3WA 3O9ZA 1SAYA 4J16A 2Y0CA 4KDEA 4CLOB 2VZ0A 4E30A 2X22A 3PWZA 2EF1A 5U9CA 1CRWG 1Z45A 1DOHA 4GX0A 3TPCA 2JAHA 3WR5A 1O8CA 3CXRA 4FFLA 3IC5A 4KDFA 1P33A 2PLAA 3H3JA 1P77A 5AQ1A 4WCFC 2PKQO 4TZKA 1TA4A 3D1LA 3DHEA 2JKVA 1BGVA 1QMGA 3OQ1A 5EIOA 1P44A 1IZ0A 1PWZA 3I23A 2NU7A 3GHYA 3FHLA 4GX2A 3K2EA 4FSHA 2OO5A 2QRLA 3ROQA 1DFGA 4W9NA 4D79A 2VWQA 3O4RA 1NPTO 1A72A 5AXAA 5L4NA 3KHUA 3PZBA 1ZMOA 3CH6A 2IE0A 3PYMA 5LC1A 1GL3A 1HDCA 2YZ7A 4XYEA 4PZDA 1JU9A 1O95A 5TC4A 1EVJA 4R3WA 3COSA 2IYPA 2W90A 2A35A 1QYDA 4A5OA 1NYTA 1GZ3A 1YL7A 5L4LA 4J4TA 1LC3A 3PHLA 3H9QA 4R01A 1UDAA 1YBVA 3U0BA 1R4MA 2DFDA 2NQ8A 4CM1A 1ZH8A 1W73A 3PJFA 3AI2A 1E1NA 1XYGA 2GNAA 4WK6A 1U3UA 5TNXA 2G1UA 3MJ4A 4UVDA 1TI7A 1ZJZA 4GWKA 2Y66A 4CJXA 3H2ZA 4RVDA 4RLHA 4HKTA 5JMPA 1VE9A 2PD4A 3AOEC 1PZHA 4CM8A 3BYZA 3GEDA 3GT0A 3JD4A 5ICMA 1LRJA 3FF4A 3Q6IA 2Z1NA 4KTTE 4M8SA 2C07A 1WZIA 3DMTA 1BDBA 4NBWA 3NJ8A 4U5QA 5CDUA 1YOVA 2VHZA 2AMFA 1LX6A 1Y8QA 2JCYA 5JAZA 1DO8A 3WDSA 1T1SA 2VN8A 4M1QA 3GUYA 3S8MA 4OHUA 5A9TA 1HT0A 2UUPA 4I5EA 3WTBA 3SVTA 3IJPA 4JCOA 5CEFA 3VC7A 2JD2A 3GUCA 3JQAD 4NK5A 4ZQEA 4QO8A 3SLGA 3PIIA 2B35A 4LRTB 1R4MB 1V6AA 4ITUA 1YL5A 4FN4A 3GR6A 6LDHA 4L75A 3EAGA 1E7YA 1PZFA 3FD8A 1KERA 4FIZA 4CM3A 3WLFA 4I08A 2ZTLA 3V1UA 3HFSA 4XDYA 1M6WA 1QP8A 1E1LA 5JDCC 3O26A 5AYVA 2FSSA 3OJLA 3NEPX 4E31A 3K96A 3LDHA 3V1YA 4II2A 3P19A 3M1LA 2B5WA 3I9OA 3AUTA 1VJTA 3EY4A 3OETA 1PJSA 4WNIA 5I9LA 3LSYA 4MDHA 4XR4A 4WLUA 2Q1UA 2PZJA 2CF5A 3ZH2A 4JBGA 2FOIA 1Y7TA 1P0FA 4YXFA 2D4AA 4QUKA 2R00A 4RF2A 1N9GB 1HE5A 3GY0A 5C7LO 4C4OA 4CM4B 4YB8A 2XAAA 3I9KA 5A5FA 3IKVA 1J0XO 1NQOA 4MP6A 4YJFB 3JQGB 2O7QA 3U09A 1MXHA 3B1JA 4I9UA 4AJHA 1E7WA 4A26A 3LLVA 3K9QO 1T2CA 1R37A 3WX0A 4IS3A 4CODB 4DLAA 2P2SA 2V65A 3F46A 3NTQA 4N7RA 2P68A 4H7PA 3KUXA 4TRMA 4Y6RA 1JKFA 1QXSA 3AW9A 3TZQA 2PZLA 4YR9A 1ENPA 2JCXA 2NV6A 3ZHZA 4NDNE 3MZ0A 3TQHA 3U9LA 4BNJA 1TT7A 3VDQA 1W8DA 3DOOA 4TWRA 1JAXA 3QW2A 3C24A 4TMFA 2PA3A 4QECA 3I4CA 1DDOA 2XXBA 2AW5A 2V6BA 4DLLA 3OIGA 3KSZO 3JQFC 4D46A 1YVEI 4K28A 2QG4A 3IDSA 4YRDA 2CMDA 1GDHA 3JYOA 4D3DA 1R12A 2I9PA 4RQUA 4W82A 3ZWBA 4BNYA 4CLRA 2C20A 3EGOA 1Q1NA 2RH8A 2O2SA 2VRCA 3QJ5A 3ZU4A 4MIEA 2PNFA 3I6QA 1AN9A 4PIVA 5JDIA 1Y81A 3RC1A 4AJOA 1DIBA 2ZIZA 2Q1WA 1IYZA 1Z6ZA 5A1TA 1JKIA 1LDMA 1DJNA 2X58A 3HHPA 5EN4A 5T8KA 1EK5A 2FHSA 3H9GA 3CSDA 3PDUA 5EL0A 1Q2XA 2WTBA 3FNGA 1V3UA 3GRPA 1GZ4A 1B7GO 3Q11A 4S1VA 2VNAA 1J5PA 4PG6A 4DMLA 4BNXA 3MCVA 5L40A 4AJIA 1QRRA 3B1KA 4XDZA 3FN4A 1IPFA 4BO2A 3UH1A 2X0NA 3PWKA 4IJWA 1JWBB 2BH9A 1LDYA 4NHEA 1CEQA 5AVOA 4MVJI 2PV7A 2Q50A 4B4WA 4J7CA 4JX8A 5ILGA 1H6DA 1Y9AA 2YFHA 4NK4A 5U4QA 3QRWA 3TFQA 3OJOA 2HU2A 4ZD6A 3FR7A 3G3EA 1LSUA 1N2SA 4LW8A 3JYQA 4GWGA 1JA9A 4OJNA 1E6UA 2FSVA 1E7RA 3JQCA 1CQIA 2O48X 2X1HA 1PS0A 2D0IA 2VHYA 2E48A 1B8PA 4S3MA 4TRJA 1ZNQO 3RBXA 5MDHA 4D3FA 3ZHYA 3B1FA 5DOVA 5B4TA 5G4LA 2R00C 4D0SA 1NPYA 3H5RA 4LVUA 3GVPA 3JD3A 3EHEA 4YJHA 2NTJA 4CM4A 1MC5A 4GKVA 4CMAA 3HDYA 2GO1A 3KO8A 3DQPA 5IFLA 2W98A 5K0ZA 1LDNA 1NQAO 4XZ3A 4XYBA 4U0JA 1D8AA 4BO7A 4NJMB 4WJZA 5DCUA 1SCUA 4IDEA 1HDGO 4CQMD 3EVNA 3QWBA 3Q0EA 5F1OA 4FDAA 4ZICA 4XX0A 1BHSA 4D43A 3KYDB 2BFAA 3QVSA 3INTA 3L4BC 1V35A 4FFRA 2FPPA 1RYEA 5T67A 3L6EA 1T2FA 4HV4A 1GR0A 2OL4A 5I9MA 1XHLA 1OC4A 3IS3A 1E5QA 1HSZA 4G65A 2CVOA 4A2CA 5DP1A 3FBGA 4EJ0A 2DTEA 2IEBA 1BXZA 4DPLA 1JN0A 1HZJA 3TF5A 2ZTMA 1IB6A 4OYRA 2VHVA 5CAEA 4E2WA 1B2LA 1VRWA 1Y8RA 3RUFA 5ENDA 4RGBA 2JFFA 4Q3BA 2JFGA 4IDBA 1F8FA 5H82A 1DIAA 3WQSB 1DB3A 4DREA 2A92A 4DQXA 1P74A 3ONEA 4F45A 3HWRA 5KJFA 4AJEA 3ST7A 4ZVVA 1HDRA 2Y68A 1MC4A 1MFPA 1P1JA 2VTDA 2O7SA 1O6ZA 2JHGA 1X0VA 3H9JA 1GADO 5A3VA 4IIUA 3DWFA 3UICA 3ZNQA 4CQMB 5CPBA 3E9QA 2PKQP 2PD6A 4FD3A 4R4JA 1N7GA 4C7JA 1OZAA 3PYLA 4RPLA 3VPHA 4HNGA 1VM6A 4P22A 4MVJF 4BL5A 2QRJA 5BNTA 2TMDA 1G1AA 2EKPA 4IDDA 4KMSA 1E3WB 3G0OA 1W6UA 3PP8A 4HADA 5LDGA 2Q45A 2VUUA 4ALJA 3GNTA 4TVOA 3KTDA 2C0CA 1R4NA 3DOJA 4OAQA 4LMRA 1U5CA 2VYVD 3GDOA 4JLWA 2AEFA 1Y5RA 3DZGA 4QXMA 2GYYA 1DHRA 1P1HA 2VYND 4CLXA 3IKTA 4XEHA 4ZQHA 4XYMA 5CG1A 2JFHA 1NFFA 1RM3A 2B69A 1ENZA 2P4HX 4UULA 4FCCA 3ZHBA 2J5RA 5KKCA 1BWSA 3LC7O 2UDPA 3K2BA 4J1QA 3W6UA 2EKQA 2GZ2A 4W6ZA 1M67A 3ANMA 3F4LA 5IZ4A 3BMQB 3IQDB 1JW9B 1CETA 1XG5A 4WLNA 1MG5A 4AJNA 4DWVA 3RKUA 4Y67A 1LRKA 2QIOA 2QHXA 3PLRA 4L8VA 3G1UA 4GSLA 2DBZA 1UXJA 3SX2A 1L7EA 1E7SA 3UXYA 1NHGA 1WXDA 5GZ6A 5T64A 4D44A 1UAGA 3GF4A 4XJTA 4RV9A 1KEPA 3DBHB 2ZJ1A 5I7FA 3AM3A 4PLZA 4PGFA 4CLHA 1Y6JA 3BAZA 1UZMA 3DBRA 3HQ4O 2ZCVA 4GLOA 1ZK2A 3GVXA 4XB2A 3ENKA 4IZIA 1WMAA 4AJ2A 3OH8A 4J90A 1H5QA 1CIVA 3DHNA 4E5PA 3KB6A 2P4QA 3WOHA 2CDCA 2X4GA 4AJ1A 4CUKA 1YBAA 2EIHA 1EBFA 5EESA 1JDJA 4WKGA 4DQVA 4XYLA 1EUZA 1KETA 4JP2A 1A9ZA 1KY5A 4WCFA 5TQVA 3I1JA 3JQBC 4O0LA 1EQ2A 3IP3A 3PQDA 5DT9A 5T8KC 4CLEA 3UHAA 2I99A 3QWIA 4O59O 5HS4A 3GNSA 1UXGA 4BNLA 3F5SA 1FDVA 2O4CA 3VZQA 5KOIA 3DEYX 1H6AA 1IUKA 4DMMA 2HSDA 1NM5A 4ND4A 1UDBA 3TRIA 1DJQA 5JMWA 4HWKA 1M66A 2FPIA 3DONA 4F3YA 1NR7A 1I2BA 3R3JA 4A10A 4PN3A 1HXHA 4ZRNA 4II3A 3C7CB 1NP3A 2Q3EA 5I7SA 2BF7A 3PQEA 2UV8A 2FP4A 4WOKA 2WE8A 4YQYA 4YAGA 3SXPA 4CM5A 1P31A 2D59A 5JYEA 1PGJA 3OHSX 4MP3A 3KXDA 5L7YA 1MUUA 1V3TA 3PLNA 1KY4A 3RFVA 2VZ8A 4XJSA 3ASUA 4E33A 3VPFA 1B26A 3AOEA 4BV9A 1U9JA 2F00A 1IE3A 4J6FA 3QE3A 4L9RA 5A4DA 2J3JA 1YB1A 4R1SA 5I9NA 3EUWA 4HNHA 4ALNA 5A9SB 1I8TA 2H63A 3VPSA 5BSFA 4ND1A 2VWHA 1DBVO 1LEHA 3I83A 4J9UE 3BTSA 4PFJA 2Q2QA 2FR0A 2D3TA 3H9UA 3IAHA 4FJ1A 3JYLA 5G0SA 3ZV4A 2WYWA 4CV0A 4J9VA 3OF2A 1YDEA 2AEJA 3ROMA 4M87A 5DULA 3AU9A 2NU9A 3EDMA 4IQGA 1NVMB 3K8ZA 3ZWMA 5JFOA 3PXXA 3RFXA 5KCZA 1RM5A 3K92A 1A71A 3KYBA 4R1UA 4HFNA 1R4NB 3A28A 2C2XA 2DUUA 4U8GA 1I2ZA 4XKJA 2W2LA 1OAAA 4PLWA 1H6CA 1WPQA 2R2GA 3LT0A 1HLPA 3DXFA 3VPGA 2DFVA 2J6IA 3RUCA 2O50A 3IUPA 3KVOA 3I9JA 3AI3A 1PU2A 1F06A 5CG2A 1IHXA 2DPGA 2BGMA 1XLTA 4WEQA 4B4VA 4NIMA 5L7WA 1EDOA 4D41A 4YAEA 2I3AA 1GYQA 1ZSNA 2HK9A 1Y8QB 4PVDA 3ZWAA 3WICA 4IMRA 5JDIC 3GG2A 4RF4A 5CHEA 2CNBA 3Q9UA 1KC3A 1C14A 1QLJA 1PJLA 3L0DA 4GX1A 3DMTC 2C29D 3C1TA 4L4SA 4X54A 2X0IA 3LF1A 3JD0A 1SEVA 2EKLA 4CMKA 1CWUA 2WE7A 1F0YA 1TEHA 2WEKA 2ZB7A 5CEEA 1RYDA 2X9GA 4Z3KA 1DLJA 3D7LA 5JY1A 3GMSA 4CR7A 2AQ8A 3KYCA 2BLLA 2FY8A 3MJVA 1WZEA 1BW9B 3C1AA 4YA6A 1U4OA 1PQPA 2ZYGA 3GQVA 3KM0A 2HMSA 1XGKA 4J43A 4JJFA 4RQTA 2HK7A 2ZQYA 3NGLA 4BGIA 3GZNB 5IDWA 3KEOA 4B3JA 4NG5A 5A02A 1PJBA 1X0XA 4Z9XA 2X0RA 1U4SA 1DIHA 2DTDA 2NQTA 3U4CA 1ADFA 4I5DA 3NAQA 2VOJA 1K6IA 3NKLA 5JAQA 2YV2A 5DBFA 4B7UA 2VYNA 5FI3A 3AI1A 1T4BA 5J23A 2XPCA 1K6XA 4NH4A 2H9IA 1CF2O 3PPIA 3FWZA 4XGKA 3ZNOA 3VZSA 3PZRA 2OMEA 1JKJA 1Q7BA 1U7TA 4Q3CA 3PI7A 4BO9A 3NX4A 1B8UA 3H5NA 4B7CA 4LGVA 1C1DA 4BHTA 3E6AA 4B3HA 3OA2A 1PGOA 4WLOA 3VHRA 1ZJYA 2WD7B 3L6DA 3OQ6A 4FC7A 4PLGA 1HF3A 1U3TA 4DPKA 2PZKA 4Q3NA 5F1PA 3H3FA 3RVDA 3LU1A 3ABIA 4MOWA 4DTIA 4RVFA 2O3TA 1SC6A 3AM5A 4ND2A 3WYCA 4YTEA 1ZEMA 1C3VA 4GKBA 1U7HA 3G49A 4BO3A 5KJEA 1HDOA 2I67A 2DPHA 4ND5A 3ITDA 3JD1A 3ON5A 2EXXA 1LDEA 1VKOA 4GBJA 5GY7A 4UVEA 2GF2A 1IPEA 1LSOA 1ULSA 1ZMTA 3ONFA 4N18A 1UP7A 1X1EA 4CMEA 1CJCA 2H1SA 1P9LA 3ZWOA 2PFGA 4ZGWA 3NDJA 3ULKA 3ZV6A 4CPDA 3D5QA 2HMUA 5KJ1A 2RCYA 1X7HA 2ZYAA 3G17A 1H2BA 4W7IA 3D4NA 1GU7A 4XYGA 3DAGA 5GZ3A 3JD2A 4J7UA 1U8XX 4EUEA 2NLOA 1MA0A 4PZEA 1UDCA 1V9LA 5CPFA 5DCYA 4ZRMA 5JXWA 2BKAA 4N54A 3VH3A 1FMCA 4IY1A 2BFPA 2C54A 1P3DA 4BB5A 1ZK1A 3BA1A 4Q3DA 2G0TA 1BMDA 3O8QB 5G4KB 3WFJA 4YJFA 1ZCJA 3CE6A 3U3XA 4A03A 4YT2A 1ML3A 3QP9A 5T6BA 2PY6A 4YDRA 2YV1A 2CUKA 4RDIA 4TKLA 4CR6A 3GN2A 3W6ZA 1A27A 5F21A 1H9BA 1UZNA 1Y1PA 4WLVA 1U8FO 3R3SA 1T2AA 4LVCA 4MVJP 2GSDA 4UVGA 1QSGA 5FEUA 4RVGA 4DRYA 1R0LA 2BI7A 1I24A 2ZKLA 3ZN2A 2YQ4A 4E5YA 1X13A 3DBHA 3K6JA 1IULA 3NDRA 4INAA 2PGDA 5JO0A 3WGHA 1BVUA 1HE3A 3RSHA 1C1XB 3QY9A 3V2GA 3ZCXA 3QVXA 4O63O 4JN6B 4XGIA 1WLYA 1YL6A 2C5AA 1B15A 3VH4A 4HFJA 2CDBA 2HJRA 1JTVA 1PJ2A 2FR8A 3AUUA 4BGVA 4E6PA 3UW3A 4DQUA 3I9LA 2WYVA 4A7PA 3BMOA 5EJ2A 1YH3A 4IQ8A 4QEDA 1DIGA 4CMHA 4CM9D 1LC0A 4KUHA 5KVQA 3RKRA 4BNUA 5I7EA 1PL6A 1VC2A 3FBTA 4XRGA 3OQBA 3O38A 2FPGA 1CDOA 3PFFA 1SO8A 4QFDA 2O2YA 5IN5A 3WBBA 5IF3A 3CZRA 4NI5A 3GAZA 5K6AC 2X5OA 1B3RA 2DBQA 1PWXA 4ZU3A 4L73A 4IXTA 3DZKA 1WNTA 3A9WA 4PZCA 5JAIA 1NASA 2GZ1A 3W1VA 3Q1LA 1CYDA 4XR9A 1BXGA 5JDCA 1LBEA 7MDHA 4A27A 3RU9A 1AXEA 1U3VA 4PLPA 1V3VA 3ZGYA 1NAIA 2E49A 4DIFA 2V7PA 2AA3A 3TOXA 2QQ5A 4J1NA 4QTZA 4BO5A 2BI8A 2R6JA 3W4KA 1L1FA 1X7DA 3P7MA 2EGHA 3VDRA 3WSVA 1SNYA 2J8ZA 3TZ6A 2GPTA 3KLPX 3AFNA 4QSMA 3RJ5A 1DC5A 4EJ6A 3WGYA 1EVYA 2I76A 1XA0A 3S2FA 4FFMA 3RJ9A 3Q3CA 2X0JA 3QLJA 1XWFA 1UP4A 2OZPA 4EUHA 4R16A 5TX7A 1ZZEA 1VL8A 3JV7A 1BXGB 2X5JO 4LCJA 1ISHA 1N1GA 4ND3A 3GG9A 3WFIA 1K3TA 3TFOA 4UEJA 4CV3A 4BKQA 2ZB3A 4QFCA 2C2YA 1UXIA 4XQGA 1DHTA 5G0VA 3CPSA 3OECA 1RWBA 3KSDO 1K89A 1Y8RB 5A9SA 3SEFA 4KZPA 1ZK4A 3EW7A 1IZ9A 1EFLA 2ZATA 1ZW1A 4GVXA 5C37A 2GLXA 4OGWA 3F3SA 4BNTA 4E5MA 1UP6A 2G17A 2A4KA 2DVMA 1DEHA 3QQPA 2VWGA 3ZWNA 4YT8A 1ENYA 3IJRA 4P4GA 4BNHA 5A06A 1QYCA 3LC1O 3OM9A 4AFNA 1YO6A 4CR8A 4G2NA 1Z73A 1GUFA 2B36A 2E37A 3BTVA 4WCDA 3PGXA 4MVJA 4TSKA 3FTPA 5TLSA 2VCYA 4A73A 1NBOA 4XB1A 4XQEA 3BIOA 2UUOA 4QO7A 2VHXA 3PJGA 2LDXA 1ID1A 1Z74A 3CUKA 2NVBA 1MLDA 1B14A 2OBNA 4ZA2A 3ZW9A 1PS9A 3GHHA 4ZQBA 1P1IA 2ZB4A 2ZJ0A 3HB5X 4OH1A 3ZI0A 1ISGA 2OP0A 4LMPA 1P0CA 1MB4A 2PZMA 3HDJA 5BT9A 1SOVA 1YQXA 3N58A 1UR5A 3FTNA 1HSOA 2HKIA 4RO0A 4K1LA 3DZJA 4IBOA 4LISA 3RD5A 5CFZA 2NVWA 5KWEA 3C1OA 1W0CA 2VUTA 4NZ9A 4YEDA 4Z3DA 3SLKA 4OKIA 5TJHA 2QYSA 2JD0A 4TZTA 1I3LA 4EUFA 2NVUB 2I6TA 4AJ4A 8ADHA 4BO0A 4FOOA 1HYGA 3QIVA 4PG5A 1EZ4A 4DVJA 4KWIA 1XCBA 4J7XA 3WYBA 2PK3A 1PS8A 1K0UA 3NT5A 5I8ZA 1DIRA 1NVGA 5THKA 3WJAA 5IXYA 3BMNA 4BO4A 1DRUA 1Q7GA 4IXWA 3W4JA 1QR6A 1I30A 4NR0A 4IS2A 3O8QA 2FRDA 3HSKA 2J3HA 5KVSA 1VJ0A 4J2OA 1V8BA 5JS6A 4RF3A 4Z6KA 1LI4A 3EZYA 3C8MA 4TRNA 1VSVA 4HX5A 1C0LA 2HUNA 3H4VA 2VRBA 5AOVA 1C0PA 3GAFA 1E3SA 2GGSA 4BO8A 4B8WA 2ZK7A 4OO3A 3T7CA 5CDTA 1ZFNA 4L4XA 5KNLA 3HN2A 2NWQA 4L4RA 1LTHR 2RH4A 3I9NA 5HM8A 4Y98A 3AU8A 3IOYA 1OFGA 3VKVA 5BR7A 3OBBA 1PR3A 1QLHA 4URFA 2O3SA 3ZWCA 2DKNA 1XQ6A 5K9ZA 3L9WA 1NWCA 2Q1SA 3LT1A 1YB5A 3VOSA 1Y5MA 4MINA 4ZQFA 3IL2A 3UF0A 4XRRA 4YAJA 4Z0HO 4R69A 5BSHA 2NTNA 5ENVA 3RUAA 4FPXA 4WEOA 1DC4A 1PSDA 2QZ9A 5JCXA 1DLIA 4E12A 4YJGB 4JJIA 4ZQGA 3E5MA 4FJ2A 1Z7EA 2A94A 2Z5LA 1T1RA 1SZJG 4CL8A 3TDKA 3ZU5A 4FFOA 4MIYA 3QVOA 3CMCO 1Q7CA 3C7DB 1DPGA 3E9MA 2E82A 5JPIA 4I5GA 3JQBA 3TL3A 1LXCA 5L51A 3DOCA 3UUWA 1BW9A 1C1DB 3K5PA 2CD9A 3BXXA 3H5AA 4E2YA 4CQMA 1E1KA 1KBZA 2X9NA 4IZHA 2Y1DA 2UAGA 2Y05A 4AJPA 3RU7A 3TOZA 2VRCD 2D5AA 2Z95A 3BHIA 1NVTA 5BQFA 3DC2A 2GZ3A 1A4IA 4MPDA 3EZLA 4HUJA 4LK3A 3HJAA 3WBFA 5TJ9A 1ZKMA 1DSSG 4TROA 4BKPA 3I4FA 1UXKA 4RL6A 4A0SA 3FCOA 4RORA 2RBEA 2DLDA 5JE8A 1I3MA 2W2KA 2CFCA 1FDTA 2B0JA 1S7CA 5A03A 1BG6A 2PH3A 4JQCA 1E6WA 2HRBA 4UUMA 3W4IA 4FR5A 3DDNA 4GGPA 3OIDA 1GEEA 4R1NA 2B37A 2E6UX 2B4QA 3PWSA 3WG9A 5FWNA 5KJCA 1QYXA 2JJYA 2WSBA 3RI3A 3LZ6A 3RUDA 1DC6A 4CL3A 3WXBA 4HFMA 3BTUA 4EITA 3EVTA 2YYYA 3WQRA 3QWAA 3FRJA 4IDGA 3HG7A 1I0ZA 4RPHA 3NGXA 3QVTA 4PCVA 1QG6A 2DAPA 1E77A 2X6TA 1I5RA 3CINA 1YOVB 3LC2O 4CMGA 4EI2A 2NM0A 4Z9YA 3HB4X 3NTRA 4FJ0A 4H3VA 2RHRA 2Y0EA 4DGSA 2YDXA 1A5ZA 3F1LA 4FFNA 1PL7A 4H15A 2VOEA 1ZVMA 4H16A 3C3XA 4IINA 4CM8B 4DBVO 1M6HA 5JYDA 2VT2A 1A7KA 3D4OA 4BNWA 3KBOA 1PQUA 1DC3A 3DAFA 4BQRA 1EMDA 2UYYA 1GY8A 3AK4A 3IIEA 3LVFO 4OSOA 1N92A 5JAMA 2WDZA 2EJVA 2CVZA 4Y6SA 3ZWVA 3GDGA 1LLDA 2OBYA 1ADGA 4KUGA 4GVLA 2DUWA 4YJGA 1KVUA 3DZIA 2TMGA 4NU5A 2PR2A 3U4DA 3EYWA 2O3UA 5KTKA 3GFGA 5ADHA 3RUHA 1B8VA 2PKRA 2Y1CA 4N5LA 2O3QA 3T4EA 1KVSA 1BSVA 3TZKA 4I5FA 3M2TA 5COBA 4MKRA 4Y6PA 1TLTA 5TSDA 4CUZA 4CV1A 3B20A 3MJSA 2W8ZA 1WVGA 3DTTA 2GDZA 3MTJA 4WUVA 3RIHA 4ALKA 1VL6A 2PTGA 3NJ4A 3V2UA 2IEDA 5JSFA 4XQCA 1XQ1A 5T57A 1BDMA 1VI2A 3UKOA 1QYVA 1HRDA 1ULUA 3M6IA 4FFPA 3U5TA 4TKMA 4DPMA 2E4AA 3FR8A 5EQFA 3GN1A 3ORFA 4YT4A 1ZSVA 3NT4A 3U4IA 3VKUA 3DFZA 5JCJD 2YY7A 3F5QA 1GZ6A 4UUOA 3HUDA 4KWHA 2EWMA 3PRJA 1UAYA 3DBVO 5A05A 2D8AA 4BNKA 4NU6A 4GPD1 1XU9A 2H5LA 3UGKA 5DNAA 2EW2A 1R15A 1YBMA 4N5NA 3U62A 2EG9A 3IUSA 5KVVA 2GCGA 3HDHA 1YGYA 4J91A 4RDHA 1R6DA 4BV8A 4K6CA 2FWMX 3E8XA 1ENOA 2F1KA 5CDSA 1LA2A 3FNHA 4DXHA 1E92A 2G5CA 2XF8A 2YQ5A 1NFRA 5JLAA 4MIOA 3BMNB 4WOJA 2BELA 4AL4A 3ENNA 2NSDA 4NQZA 2GR9A 4YRAA 1EE9A 1NR1A 3AFMA 3HDQA 1WWKA 1HE4A 1NFQA 1WDMA 3W8EA 4K26A 4I8XA 4MP8A 3SJUA 5HTOA 2PD3A 1GPDG 2CF6A 3DBRB 1NX6A 2J3IA 4NPCA 5L53A 3P2YA 2CVQA 4ID9A 1N1EA 1ZUD1 2OGUA 5G4KA 1WMBA 4NJOA 4P38A 4LN1A 4BNVA 3R1IA 2B4RO 1ONPA 4GL4A 3K73O 2CY0A 5DBIA 4BB6A 5ILOA 1FK8A 4MVJH 1Y9EA 5MGBA 1HE2A 1ZK0A 1HTBA 3TL2A 4D0RA 3FNFA 4YCAA 3GMDA 2HDHA 4JIGA 4AJLA 3HN7A 3FNEA 4IUYA 4R41A 4PLTA 1NNUA 2Q4EA 3U49A 1UZLA 4OKNA 4TQGA 1N9GA 2JL1A 4BNFA 4BS9A 1Q0LA 3STHA 5BNIA 4HP8A 5IZCA 2OUIA 3GPIA 2P5UA 4B79A 5L45A 2G76A 4GH5A 4IDCA 2H6EA 2NACA 4E2XA 2Q99A 3DTYA 3RROA 1WAMA 2AQIA 3PIDA 1X7GA 1T2EA 1XELA 4OQYA 1YWGO 1IOLA 4IGEA 3SJ7A 1ZXBA 1SMKA 3UAGA 3OJFA 1NXQA 3UOGA 1YKFA 1NPDA 3JQEA 1Q0HA 5HWSA 1D1TA 2A9FA 1HDXA 2B83A 2DBRA 5I7VA 3ZU2A 3TN7A 5KVCA 4RLSA 3VPXA 4LRSB 3KETA 3OIFA 3WGIA 3VZPA 1FDSA 3CTMA 2YW9A 4HY3A 2I66A 4HFRA 2B5VA 3INRA 1W4ZA 3KOUA 1GD1O 3V5NA 1L7DA 3BHMA 2I65A 4RZIA 5F5LA 4E3ZA 1YJ8A 4NFSA 4FS3A 4EEZA 4UVIA 2P9CA 3ASVA 3V2HA 4W9NC 3VTFA 3MWDB 5EPOA 4BNZA 3VH2A 2IXBA 3E9NA 4D45A 4EYEA 2GN6A 3JQ8B 1KVQA 1ARZA 3NT2A 2CZCA 3FWNA 1ADCA 4ALIA 4UEKA 3UVEA 4GX5A 5HRUA 1LSJA 1ZXLA 3WIDA 4I9HA 5HA5A 1U28A 4E4YA 2GD1O 5COAA 5CDYA 4BNIA 1E3WA 2AE1A 2DTXA 5GZ1A 3F47A 3GZNA 4YPOA 4UEOA 1E7QA 2ET6A 1AHHA 3WNVA 2PGJA 4YVFA 2RAFA 3PHHA 3RCBA 3WGTA 2JAPA 2OHXA 3D0OA 2G82A 1PEDA 3PTZA 3R6DA 4UUNA 4E21A 1P1KA 1TXGA 4R3NA 1OBFO 3S1LA 3AUAA 1XKQA 3DHYA 4J4HA 3HFGA 3G79A 3GH3A 4YYZA 4YAIA 1OC2A 3QWFA 1FF9A 1IHYA 4HBGA 3P5SA 4D7AA 1GV0A 1ZIDA 5G0UA 3PDJA 2UVDA 1GCUA 4MKXA 2QX7A 4NJMA 3RUIA 3VZRA 1U2GA 1G6KA 4LSMA 4NFYA 4E0BA 5DBGA 1KIFA 1XSEA 5K6AA 2GN4A 5TRTA 2AEMA 1T4DA 4YJDA 1I2CA 2QYTA 5B1YA 2QZZA 3D3WA 4OMUA 4PVCA 1PIWA 3UCEA 4KTVE 2GN8A 5L9AA 3BMOB 1B3BA 3MJTA 3BZUA 2YJZA 4WECA 4MVJG 2W2KB 2YFQA 2EGGA 2XOXA 4D3SA 1IL0A 3LT4A 4OXYA 4R54A 2QW8A 4DLBA 5A3JA 4IQ0A 4AG3A 3UFXA 4E5NA 3WIEA 3ZV3A 3OSUA 3ROPA 5HBRA 1TVEA 1LQTA 3ETDA 3JQ8A 2HLPA 4PG7A 4EDFA 4BMSA 4CQLB 3UN1A 1I36A 2HJSA 3DZFA 4CMEC 1DRWA 3F6YA 1I10A 2BMAA 5FI5A 4DC0A 2VZ9A 3RUEA 4R51A 1R16A 3QVWA 1VL0A 3AJRA 3QWHA 1YB4A 3PJEA 1YJQA 4OIMA 2HMTA 1J49A 1HWYA 3N74A 2OOSA 3H9EO 5DN9A 3RWBA 3H8VA 3HNPA 4LSWA 2HO5A 3WGOA 2IZ1A 1LQUA 4K9DA 4JP3A 1JLLA 3Q9NA 4WASA 3L4SO 3G1TA 4P4LA 5TGDA 1AUPA 1GQYA 1UH5A 4RCVA 2IZ0A 1RPNA 3L6OO 2Q4BA 4PLVA 5B12A 1EBUA 4Y8VA 5DDIP 4GMGA 4XGNA 5DP2A 3OA0A 4RVUA 3AY3A 3JQ7A 4U0KA 1C1XA 3PHIA 3X2EA 3ZHXA 1PGPA 3VVBA 2ZCUA 4O6VA 2X7HA 1MP0A 1GEGA 2EJWA 4QQRA 4DYVA 3GLQA 1WP4A 1QV7A 3JCZA 3OFSA 3A1NA 4Q39A 5EINA 3TNLA 1SBYA 1EUCA 3AWDA 2BGLA 4BNGA 4RPGA 1KS9A 1VLLA 3DO5A 2D1YA 1HLDA 1RM0A 3GC6A 3S2IA 4JBHA 3ZV5A 2EEZA 4DYDA 1MG0A 1P1RA 2EHDA 2ILTA 1MGOA 1VSUA 3LLSA 3S2GA 1GQQA 1ISJA 3ICCA 4O1MA 3WNQA 4E13A 4O5OA 5JNLA 3QV1A 1E7MA 2WMDA 5IXSA 3PFWO 3JQ7B 1LUAA 3GGOA 4OOFA 4BO1A 1SPXA 1B16A 1PL8A 4FGSA 4XCVA 2IRWA 1F17A 5C7OO 1HEUA 3D64A 4DIOA 3AUSA 3OP4A 9LDTA 1PGNA 4JNKA 1E5LA 5JBIA 1FJHA 4WCFB 2YHIB 3JQ6A 2WWRA 3N7UA 2C59A 4G81A 1M76A 4NBTA 2C7VA 2PWZA 1Q0QA 4B7XA 1GV1A 4YT5A 3LQFA 4NBRA 3TZCA 4XQ9A 5TT1A 4NNJA 2W2LD 3KEQA 1XEAA 3Q2IA 3PYXA 5KKAA 4BNNA 4XWYA 1GYPA 1CQJA 2VNSA 3R0IA 3A4VA 3INGA 1E6EA 2BHLA 2NVUA 1PJ3A 1ZSYA 4R1TA 2FZWA 2GN9A 4GGOA 3ADPA 3MTGA 4OSPA 2PH5A 4OQZA 5JCJA 1JVBA 4NMHA 3GVCA 1ISIA 3WLEA 3M2PA 2OXIA 4BKOA 5JC1A 1KEUA 1P45A 2EV9A 3L07A 3OJ0A 3T4XA 3WQQA 2YDYA 3IP1A 1YONA 4UUPA 2X8LA 1UXHA 1DRVA 1XIVA 4IDFA 5EMHA 3DR3A 4ZN6A 1HYEA 1NQ5A 2VTEA 2AQHA 2ZYDA 4ESOA 1M2WA 1KEVA 4WPGA 1HDYA 4ZHSA 1TT5A 1GTMA 4WGGA 3E1KA 4CLDA 1O94A 4IPTA 5I8WA 1GQ2A 3KLMX 2GERA 2VHWA 4FOSA 5BNFA 5FYDA 1LLUA 3V1TC 5IN4A 3ZNNA 1ISMA 2AE2A 1HZZA 4CQLA 1KOLA 5ITVA 2PGLA 3E5RA 4KUEA 1HDZA 4WNCA 1S6YA 3VAZA 1D1SA 2OORA 4YBZA 1AHIA 3GNQA 4IGFA 1YE3A 1K5HA 2NU6A 4R9RA 2DC1A 3LF2A 1YDWA 4BGEA 1GUZA 3DBLA 3I6IA 1J4AA 3W8DA 2HMWA 1UUFA 2DT5A 1YQGA 2C7GA 3WWYA 3F1KA 3WGZA 1WW8A 3QSGA 3ZU3A 2J5QA 3HZZA 4YWJA 4EGFA 1EVIA 3NUGA 3NTOA 5CP8A 2Q1TA 3V8BA 4JXKA 7ADHA 2DQ4A 2IDZA 3AM4A 3SC6A 5LDHA 3FPLA 5L3ZA 5IG2A 4UVHA 2BD0A 5A5EA 2Y1GA 1HL3A 1LDBA 6ADHA 2HCTA 4XIJA 3UCFA 4D42A 1H2HA 4RF5A 4MKZA 4IJKA 3VH1A 1ONNA 2BRUA 1I3KA 2Y0DA 8LDHA 4GQAA 5H83A
chains in the Genus database with same CATH superfamily
1DU4A 5LNK1 4JLNA 3FDJA 5G3YA 4TX1A 5TT0A 4JLUA 3C43A 3SXUB 3BRWD 2WKRA 2A0WA 4K8OA 3OMWA 1HYHA 2XEXA 4JROA 5EUCA 4KFSA 1EXNA 5KO2A 1L7RA 3OE7D 3KQLA 3M3PA 4CGYA 4AQYB 1JHPA 5IZCC 4GQIA 3QF7A 1BFDA 5ALSA 3RAEC 2VJPA 2A6PA 2GEVA 3MRTA 5IK2A 2NSJA 3A10A 4RE5A 4HWRA 4YREA 1KQNA 4EATA 1GQSA 1PO7A 3LUBA 5JCOA 1ZGZA 2D1QA 1XR3A 2H07A 2YY5A 4AKIA 1VPDA 2QT9A 3QMMA 4X3PA 1HMYA 4HATA 4C4AA 1QIGA 2IPLA 3HADA 4JOQA 4RZ2A 1RPJA 3VNSA 1C4KA 3WTCA 5B7NA 2PFSA 1WETA 1M2VA 2YWCA 4UFPA 1H6BA 1U7ZA 3KQPA 3LC0A 5GONF 3I9MA 1KDZA 1TO2E 3U6KA 3G9XA 4G5OA 2DBVO 2O9JA 1SCUB 1CV2A 3AH8A 4JFRA 4E4TA 2R6HA 3LY8A 1U0FA 2I3DA 1XDWA 3OZXA 4LGMA 4FKBA 3AW8A 2NU8A 4BRZA 5JC8A 3CEAA 3HN6A 2YOFA 3U1TA 3W7VA 1TB4A 3RTGA 2JGMA 2VO1A 5KTPA 2P5YA 3TGLA 2B7BA 2ZBPA 2ZWAA 5JARA 2YS7A 221PA 2GESA 3CNLA 1QDLB 3SDSA 2XKKA 2PO7A 2QPOA 2DHRA 4Q9NA 1JGTA 3PJDA 5D86A 4I1SA 4DL9A 1N2EA 1R66A 2QRHA 1KI8A 4EKNB 4AQ7A 2OOKA 4FDMA 3HUTA 1FUUA 1DAHA 1OT5A 4ZEVA 1EGHA 3GVIA 5EWJA 2Q2VA 2C7BA 2C58A 4JGIA 3TLYA 1DADA 5K09A 2I7VA 4IZ6A 5DX1A 3S0JA 1G8SA 2IGBA 3DZBA 2O8DA 5CNKA 1RHQA 4RD2A 2IS2A 3RV3A 3FGPA 2OXRA 3H4MA 3OU2A 4C7KA 5CEJA 1VTKA 2RIRA 4IM7A 2FX5A 4HRAA 1NQTA 3CJRA 3U3RA 1TZ2A 2IH5A 3E05A 4OREX 2O8NA 3P2OA 1DARA 1I6KA 4QYMA 1XZDA 2LE0A 3UK2A 1OI3A 4Y9DA 1CCWA 1ZN2A 3D0QA 3T7DA 4CKCA 4ZCRA 1LNZA 1TRHA 3EXHB 3INNA 1R4ZA 2IXAA 4KGZA 4O4HF 5LCXA 1XVIA 3C7KA 1Y8AA 3E9DA 4J2TA 2O54A 4E2ZA 3LM8A 1S2NA 8MHTA 3HGQA 1QGZA 2ZI6A 3PHJA 4OQXA 2B6NA 2HK8A 1EE2A 2QAGB 4U02A 3WLTA 2Y1EA 4O5AA 1Y6QA 1YRLA 4ZOEA 1AZLA 1Y9JA 5KMGB 1B0AA 1ZWKA 2H52A 2OILA 2Y67A 5HIMA 1JLSA 1KJ9A 4GLBA 2QKYA 5E2IA 3QE2A 3VRHA 2B30A 1IBMB 1QHNA 2NTVA 2V7EA 1G19A 1T0IA 2GPWA 4EG3A 5HNKA 3KL2A 1J8QA 1NUAA 2P6PA 2I34A 4OOEA 4IHAA 4R9SA 1VHJA 3OLYA 3R20A 3NR2A 4GR5A 5P8WA 1PHRA 5JW6A 1NTOA 3TD9A 1SKYB 2EYQA 4FM9A 3ANLA 3B3AA 2V1XA 2YUTA 4YXWA 3E22B 1UDXA 3AEUA 1E3IA 2GM9A 3E70C 5ESXA 1J6UA 3I5YA 2POCA 1XP5A 1PX0A 4L72A 3G5MA 3JTEA 4AF7A 3GLGB 2V1UA 3FSRA 2P6NA 1N1MA 2VDJA 3FROA 2VEOA 4OB6A 4QX6A 3WZMA 1GIAA 1BVYF 1EVZA 1GA6A 1MJFA 2FF5A 3BFKA 2ZANA 2P9EA 2VKTA 3O03A 4KO2S 5F2KA 4DR7B 5DCWA 4YRZA 2ZGVA 1N4DA 3MA0A 1KSHA 3AJEA 1YR2A 3CZCA 2VDRB 5DMHA 4FB4A 1KDPA 2EZ8A 3OQOA 4AS1A 1CQXA 1CY8A 4TMTA 3VYTB 5K6RA 1NV9A 3O1HB 3UK6A 1I4OA 1KTIA 2GD2A 5ER9A 2EW8A 3ZCVA 4YP0A 2XXJA 1GG9A 4DZTA 2BLNA 2WP8J 2JCVA 3A6KA 4Q4CA 1X15A 1WLSA 2AC4A 3ETEA 3HKBB 2MYUA 2EF0A 4JD5A 3RQSA 3LGSA 4I9NA 3WADA 3ZK7A 1Z5PA 4W1SA 3TVYA 2O3RA 3TR6A 4LRQA 2JLXA 5JJKA 2V9ZA 2ZIUB 2L2QA 4MRNA 1Y6GA 5L3RA 1NU6A 1ZBDA 1P73A 1PR0A 2COKA 1PEAA 4CHGA 4YI5A 1KXJA 3F7TA 3RRXA 4RD1A 2AG5A 3PR2B 4F46A 1Y8ZA 3G9TA 3WZLA 1OU0A 2QNRA 3D3WB 4REMA 4TMWA 2O7NA 2BMJA 3GA5A 4FLFA 1R0SA 2IZOA 4PM4A 5HUQA 1LS6A 1IOVA 1VHDA 1SVMA 4XVUA 4DCUA 3JALB 2SCUA 1PJTA 3H7AA 3RAJA 5FFFA 2ZJYA 4YMWA 1TQ6A 2BCEA 2FSUA 2YYZA 3AO0B 5JZMA 5F9HA 3LK7A 2GCPA 3UJ7A 4Z54A 1N0UA 3LWZA 3RBVA 4E11A 2IP4A 3D81A 4NDAA 5G53C 4UU0A 5MFZA 1ONOA 2AIRA 2GPBA 5FA6A 4BFLA 5CFLA 3OICA 3BM5A 4EPWA 3R6GA 4KHZA 1ONSA 3W2HA 3VI4B 2JBWA 4DIBA 1GPH1 2YXNA 1CUHA 3Q3JB 2IODA 4MQUA 5AW4A 2OEPA 1YFLA 5MGNA 4AUNA 3E81A 1HEIA 1NF2A 1AKQA 3RRJA 4BEVA 1DFHA 3FLMA 3G2HA 3KHTA 1YHNA 3QMPA 4IR7A 4WN9B 5DTIA 4PTLA 4PRLA 1X87A 3OPQA 2MMGA 3KZOA 1VMKA 1LU9A 5J1TB 3T61A 2J0EA 5CGZA 2JI7A 3REQB 4CLOA 4KWEA 2HU5A 4FUTA 4PLHA 4LYJA 4BLOA 2RHCA 1QQ6A 1RACA 4IFBA 4M8IA 4N9QA 5C46F 1WV0A 4JXZA 1KYVA 2I6GA 3AR5A 4TQUS 5HK8A 1C0IA 3TD2A 4DSZA 3HFRA 3UBTA 2AFIB 1V2GA 3SQMA 2B92A 1Z15A 1G8KA 3CZMA 4Z51A 1X39A 2EBWA 2YIMA 1O97C 3AGPA 4MV9A 1U0EA 3W3AA 3VDXA 3SU8A 1LS1A 3VZBA 4E32A 5A4AA 4QG3A 5K99A 1VKNA 1RJEA 2JIMA 3TCXB 4B6FA 3GLFE 3ABSB 3EBOA 2JLYA 3EAFA 1N5DA 3A8TA 2ZBUA 2QW1A 4Q4AB 5G40A 1YBHA 1SVNA 3QM1A 2YWRA 2F3UA 1CT9A 3ASZA 3ADOA 3V97A 3DV9A 7REQA 5JMTA 1SVWA 2I4IA 2HA3A 5BSRA 4FE3A 5UKDA 4RBNA 1CERA 3DWEX 3JPWA 3P4XA 1T0BA 1YS4A 1N9ZA 1ZBQA 1JJVA 3KQVA 2YWXA 4M1OA 3WWZA 3ZDDA 3HXMA 5C4MA 3H5IA 3ZWXA 4RYDA 3HCPA 4U8HA 5DASA 1ZR2A 5L7TA 1H9AA 1QYWA 4PRKA 4WZZA 2WYUA 2H17A 4TV8B 4FS8A 5JNWA 3H6HA 1OFIA 3LOUA 3I52A 1C4XA 4ETWA 1XZPA 1BOFA 2C9BA 4H6VA 2IZ6A 1SHTX 4FFVA 4QLBA 4TL9A 4NBLA 1E3DA 2ZM5A 3PPWA 1ESNA 3NBZC 1E1MA 3AQIA 4Q15A 5LWHA 3CGWA 1XD8A 2AX3A 2I4LA 3AF3A 1VFPA 2F9FA 2FSVC 1EX1A 1X1DA 3EGXA 1G0NA 4Y1FA 5HMLA 1X7YA 2O3JA 2P2NA 4NXMB 4LGCA 1E59A 5IUKC 3MOGA 2VT3A 3DL2A 3RFTA 2FWRA 5BSEA 1QIKA 4DEXA 3ITKA 1Y89A 1MC8A 3PGA1 3HRKA 4C5CA 5DPMA 2BFOA 4I9GA 3CUYA 4EW2A 1X1TA 4V39A 3U40A 1KJZA 5C4IA 4WNYA 1GAEO 5E0KB 3LH5A 4FNMA 5TQ0B 1M34B 1JBQA 2B8WA 5D85A 4BFTA 2Z56A 3CLRC 1XYYA 3BXFA 3TQSA 3THWA 3USCS 4G07A 5DHFA 3SFTA 3MWYW 3VFDA 2Y99A 3AEUB 4Z8XA 2YJ5A 1V41E 3KZVA 4F11A 3DHVA 1MO5A 1NW4A 3CCFA 2CFOA 2MMCA 3JZDA 1OOEA 1IEVA 2AJBA 3R44A 3VOTA 3TLAA 3KS9A 4KBFA 1GUYA 1O9HA 3PGJA 5EYPA 1ZEJA 3M49A 4G3XA 4GE3A 1XMJA 5T3UA 4DLSA 5AVSA 2Y1OA 3IMFA 1DAPA 3QE0A 1AUVA 2C2OA 3FUCA 4C7OA 5B2EA 4RLQA 3GRUA 4CUJA 2PG3A 1C3XA 2HQ1A 4TTRA 2WD8A 1DMRA 2QRQA 4C0SA 5A5VA 4YLYA 2O5CA 2NIPA 2PBFA 3FDXA 1SKMA 3ONDA 2ZIGA 1Q21A 1CS0B 2PUGA 3EIFA 4UW9A 2WJZB 4W7HA 2BAGA 2NZVG 2A5YB 5TXGA 3UAWA 4NWIA 4I1IA 2VSNA 1EFRD 3BIWA 2V7BA 4TV8F 1DKQA 4RVNA 1DRJA 2VQSA 3PC8A 4OQLA 1X42A 1EUDA 2BSXA 3H65A 2ZJ4A 5FUVA 3IAFA 2AFIE 5BUQA 2V5AA 1K4MA 3F0TA 2P9GA 1L4KA 3AFIA 3AKCA 1Z0AA 2XWJI 2CKMA 2GWRA 3C16C 4GZ3A 1AKWA 1Z7GA 5JD5A 1P2GA 4IX9A 5EGSA 4IMPA 1DUVG 5IJWA 3N07A 4N7BA 3MB8A 3UJAA 1Y0BA 1SD2A 3BK1A 5E6SB 2EX4A 2NO7A 2ZSIA 3V3TA 2HHAA 3O8OA 2UYGA 5FCDA 5KNDH 2AOVA 4PZZA 2W9XA 4BWFB 3SM3A 5H5JA 3C6YA 3BC1A 5LLSA 3LKVA 4LVOA 1JDPA 3QFFA 3VVCA 4B87A 2QAGC 1OHHA 1XQ9A 2PSHA 3HKDA 4BYMA 1QH0A 3TX6A 1HDIA 1EM8B 1RWPA 2ZTUA 2A58A 2ONZA 4G1BA 3PX2A 3MJCA 4WXHA 4ARZA 4KO3S 5BO5A 3T3EA 4WKOA 4ER7A 3BWXA 4EVQA 3G0HA 2F9MA 1U1GA 2FOLA 3BRCA 3OMXA 4IJ5A 4EMBA 3U44B 3RK4A 4LF6B 1G55A 1U7WA 2DUJA 2P5TB 1MA3A 4IH4A 4UTXA 4QU8A 4D9MA 3KEFA 1QQBA 2AG1A 5DOZA 4F38A 2O8FB 4Q12A 5C7IO 1I1OA 3CA8A 3OQIA 3PNLA 2XIQA 3Q3VA 5ERYA 3BQ9A 3SXJA 1EX9A 3AFOA 1QTQA 4KDEA 4ESVA 1JF8A 1R5JA 1YR7A 2X22A 3BXOA 4V3CA 5JXIA 2R68A 3AIIA 2QX9A 4N0QA 3W7BA 1DOHA 1L3CA 3OOSA 5H3LA 2JAHA 3TNYA 4X1IB 4JOCA 5AJWA 1P9WA 3N0TA 1SBZA 4N47A 4D8WA 3MJHA 2BMVA 5JR3A 4H1VA 4JU9A 3MCAA 2I2DA 5ESWA 3YASA 1P33A 3U7QB 4P80A 1QRSA 2X40A 2PS0A 3IQGX 2NO5A 1PK8A 2H00A 4WCFC 2CK3A 1RWVA 2PKQO 4Q18A 1IAVA 1XZQA 1QMGA 3K3PA 4MYRA 3WLAA 2IEIA 5EIOA 1UKZA 4Q34A 1Q12A 3JWHA 1L8LA 1P44A 1NGSA 1PWZA 4A6DA 2G9VA 3HS3A 5D51S 3D2CA 7REQB 4NPAA 4FSHA 2BE9A 2O0MA 2QRLA 3QW4B 3OQPA 3ITNA 4L9WA 4W9NA 2CV0A 2NO6A 2VWQA 1ZUNB 4MULA 3ZS8A 1MAUA 3HEBA 3OU6A 3PZBA 1FP1D 2BHTA 4X93A 2IE0A 3PYMA 5E6RA 1JEDA 1K88A 4KXNA 3RRNA 1FDOA 1Z4KA 2GB4A 4PZDA 1V8DA 4K2AA 2ISSD 5TC4A 3LBNA 4D9IA 3GLFA 1QVAA 4Q03A 1QYDA 5DTJA 1GZ3A 2J85A 3BQMB 1YL7A 4Y6QA 3KZXA 4HN4B 4JASB 4J4TA 4ZT6A 2L19A 1Q77A 1ID8A 4KGVA 4KR2A 4IP0A 4F7DA 2I2AA 3A3YA 3H2BA 5HF5A 4HVAA 2NZUG 1BD4A 5EA2A 3U0BA 5IRCD 2ZDGA 2JGDA 4CM1A 4MJ7A 1ZH8A 4BXOA 3KDSE 5L3QA 2D06A 2C78A 3IMGA 2G1UA 2AUNA 3STTA 3D43A 1A9OA 1JXMA 1SBHA 4CJXA 3H2ZA 4RVDA 2P41A 5HCNA 1BQ3A 1NVXQ 2QQ0A 2LW7A 4HKTA 1RYZA 4PAQA 1Z8NA 2PD4A 3GRYA 4H7JA 4QYSA 4P0PB 3BYZA 4DY4A 1VYVA 5ICMA 2WJWA 1LRJA 2QN6A 4C3ZA 2GF9A 4RTKA 5DSTA 4M8SA 4KTTE 1NF3A 1RI4A 2PRYA 2C07A 1C7IA 1K9VF 3DMTA 4PNZA 4PHFA 5KDLA 5JNVA 1R6VA 4WDQA 1LBQA 4C3VA 1HFKA 4U5QA 1E94E 1KSFX 3RVBA 5CDUA 5HR5A 1ATZA 3T1YB 4CG1A 1YQQA 5AK4A 1Y8QA 2P2YA 5HUHA 5JAZA 1QKJA 1X1RA 2Q28A 1DO8A 1P80A 2VN8A 4NJEA 1YI1A 3DF7A 2D8MA 3KKMA 5A9TA 4I1PA 5IJAA 3CNHA 2JDID 3CVOA 3JS5A 4NK5A 3B3FA 2W6JA 3R3XA 4YRPA 3PRHA 3T9CA 3JZMA 4S1OA 2E2WA 4ITUA 2FEMA 3DDHA 6LDHA 4L8FA 5BOSB 3KXKA 5AXCA 1KERA 4X1IA 3WLFA 3V1UA 5CH3A 1EHIA 3P2JA 1ZWLA 1L5FA 2H92A 4WN9A 2JBHA 4TN5A 4BE4A 3S3TA 3QUBA 2P6UA 3SF8B 1N34B 4FLEA 4JBWA 1KKMA 2J4FA 1RC1A 4URWR 5EHZA 3NEPX 1ZESA 1G4UR 2J7KA 3LDHA 1RZRA 2AN1A 3P19A 1I7LA 1C2TA 1WPXA 2XCUA 5F3DA 1R74A 3ZI7A 4M9UA 3K0FB 1D2GA 3I2HA 3OETA 5I9LA 3LSYA 4MDHA 2Q1UA 2PZJA 3CPJB 2WUGA 2O06A 3CG4A 3KQWA 2FOIA 2I6SA 4L4UA 4P4SB 3W5IA 3FYHA 2D4AA 4QUKA 1Q20A 2KW5A 5FBLB 1I5OA 1UPTA 5CB8A 1QQ5A 3EBPA 5BVGB 3HLKA 3I9KA 1DAEA 4N49A 3SQOA 3IKVA 1NQOA 1QQAA 4BTVA 4FWBA 3LBFA 1D2RA 4RENA 3AHEA 1CUSA 1MXHA 2BOVA 4RK4A 3ZTWA 3TLMA 4NNPA 4TZ0A 4KPYA 2V4ZA 1QGYA 1T2CA 4CODB 2CMFA 5ERGB 4JVNA 4LE1A 4P7FA 3F5FA 3PE3A 4F5WA 1B6TA 3ESDA 2ZPUA 3H1PA 4ZC8A 4J75A 4YP5A 3B5IA 2VF5X 1BEZA 2PZLA 3EXHC 3BVPA 3I8SA 4YR9A 5ES4B 3IQIX 4BWYA 3ZHZA 1NKTA 4NDNE 3S8YA 4H6PA 1ZGAA 2MINA 2JIRA 3FNRA 1Y1RA 2QTZA 2VHQA 1TT7A 1OIXA 3CU5A 2XUOA 1JAXA 1GTSA 4P34A 2GCEA 3C24A 2A7XA 1TQ2A 5LOVA 4ZYXA 4L4YA 4AAYA 3OIGA 4EY8A 1U6JA 3T9AA 3LYUA 2A0UA 2IOYA 4R2IA 1EA7A 2G9RA 2CMDA 5E2BA 2IXFA 3TBHA 3TNDA 1GKKA 2B99A 4BNYA 1LH0A 1USVA 2OZEA 5FOSA 4CG0A 4PS1A 4C6RA 4EZEA 1KE2A 2AWNA 3OZWA 1M1XB 3QJ5A 3NHMA 1ZGBA 5J4VA 1M2JA 2HLHA 4ASUD 3KKKA 1AJEA 1G63A 2UU9B 1RQ2A 2E4XA 1ZHOA 2VLIA 3MTBA 4XWAA 2Q1WA 3UQZA 1G2IA 1LW7A 2OMKA 1VMDA 3G0IA 4XPIA 5I7WA 1Z6ZA 3WA6A 1YMUA 4IL5A 1LDMA 4KLRA 3LLCA 3Q12A 4MV6A 2ECFA 2CMKA 3CSDA 5DW0A 2IIPA 1ZM4A 2WTBA 3IQZA 4W7SA 5IU6A 4B75A 4A15A 1B7GO 3B5EA 3ETHA 1JIXA 2OORC 3EPLA 3OTWA 5LZ2A 3ESXA 4DMLA 2WIJA 3UAZA 2Y77A 3NGMA 1K6MA 3ZI4A 1ZM9A 4LXQA 4M0LA 3B1KA 4NULA 4XB6B 4AJIA 3LVQE 1GKUB 1OFHA 4TSFD 5HP4A 2X0NA 2VK8A 5D3KA 3E3MA 1U63A 3KU4A 3NZEA 2VZLA 4TQ9A 4RM3A 1YULA 4IJMA 3W8NA 2AH5A 3DEFA 4DLKA 5AW7A 4RV4A 2FDCA 2ZXFA 1ZS9A 3DJYA 3EHDA 4D9BA 2PV7A 2WF7A 3IHKA 4KN6A 5DSZA 5ILGA 3BF8A 1GQFA 1LTKA 2BP7B 2F8SA 1RBMA 1NJGA 3IEVA 5CB4B 1G7TA 4NCXA 3D6VA 1DBQA 3FR7A 4R0VA 1KMQA 1LSUA 1N2SA 1ZIPA 4LHXA 4GWGA 2QWXA 4I36A 3VAYA 3CRW1 3H2JA 1RKQA 4RU1A 4PXSA 4B6OA 1QOPB 5IAJA 2JHAA 5DE3A 2O48X 2X1HA 2PQ2A 2ZRKA 2D0IA 2L42A 2HQOA 4U4AA 5GWXA 2AN9A 1B8PA 2BN4A 5C0OE 4KIJA 5CT6A 1W5SA 1S1CA 3AEZA 2WVHA 3E7FA 3KC2A 2M6KA 4D3FA 3ZHYA 1ICEA 2P3LA 3B1FA 3DE6X 4LYAA 5DOVA 5ERXA 4ZKEA 4E7PA 1S0UA 2I33A 1QPGA 4MW5A 3F67A 5B4TA 2ORED 4D0SA 3H5RA 3EHEA 4WFQA 5BN5B 1OX4A 1R0CA 4QBFA 5E1OA 1OTXA 2GO1A 3KO8A 4JQZA 2CLLB 5B1SA 4E5DA 5IFLA 1B23P 3CKMA 1C1YA 5A5DA 1HO3A 5HE8A 2CJPA 3D8SA 4XZ3A 3SC3A 1D8AA 2B5OA 3QH4A 3T7IA 1IBRA 5DGIA 4LY3A 3RW9A 3A2NA 2W93A 2G88A 2F9LA 3V4FA 2V6IA 4KHPB 2ECQA 1KRXA 4B46A 3RVLA 2LCFA 4XX0A 4D43A 3KYDB 1ZGJA 5ALYA 4H0FA 5D1HA 3B8HA 1CR0A 1V35A 2HGZA 2VP4A 3P9ZA 1R8QA 1C1HA 4KXXA 1AK2A 4P3OA 4CKWB 4PIMA 1G6OA 4Z9BA 2JJ8A 3V1KA 4MUYA 1RKBA 3PEEA 1KZGB 1THTA 1PWEA 2IEYA 1HSZA 4TT3A 1KJYA 1M6YA 1GPMA 1REQB 4QTXA 4UDXX 5ALKA 3W9BA 1K4YA 4S0XA 4DPLA 1N9KA 5FBHA 2YUIA 3SPXA 1F8XA 4C08A 2FPLA 4G4SP 2GBIA 2Z2KA 2ZTMA 4OYRA 4PYMA 4LQLA 1ZN9A 1B2LA 2WG2A 2JLRA 4X91A 3ZD8A 5ALVA 1JV2B 3VR3D 3D6UA 3QKIA 4FMDB 4MLDA 1RS0A 4RGBA 4Q3BA 5FOWA 4YRMA 2FF7A 3I2YX 4ZT2A 1N5IA 1TAQA 5G1OA 1CIJA 4B6PA 4QDOA 3PR1A 2Q07A 5AI8A 2PSJA 3V4SA 4DREA 4DQXA 4WHMA 3TRFA 1W19A 3HWRA 5EUQB 3DGEC 5FUXA 4AJEA 3R5JA 5F9MA 1GPNA 1OASA 2WWYA 1Z6GA 1NA5A 3GELA 3LMKA 1OBOA 1JQ3A 4OQFA 5H80A 3SYLA 3BRWA 1V7CA 5HIKA 3ICQB 3IILA 2R751 2VUHB 4INJA 2OBFA 1PAUA 1U7PA 4PWZA 2K6GA 1G3QA 3LPMA 4RK1A 5CPBA 4JP8A 4ADSG 4R4JA 3SLRA 2FPGB 4AZ3B 2UZIR 1RAFA 3AQ4A 4C7JA 1JAIA 3PYLA 3QBDA 3R0QA 5DHSA 4EM6A 5CFPA 2L18A 1FNBA 1QE3A 1VM6A 2GZAA 4AW9A 4M0FA 3ZW7A 5I6DA 2GK4A 3S1AB 4JKOA 4RK6A 5JZVA 1FQWA 3B13B 5IKXA 1XDZA 2QTHA 5BNTA 4KB5A 2IHVA 4MXDA 1Z36A 3KEGA 4Q7JB 3UGJA 1VYTA 4MAAA 2I54A 1W6UA 2ZRCA 5FPQA 5LDGA 4EUSA 3LUKA 3N7TA 2WU4A 1GNLA 1RDFA 3U48A 5D5PA 3GNTA 4QOJA 4TVOA 3KTDA 4X7PA 4ALJA 1UPXA 4OUDA 5EE1A 3DOJA 3T4PA 5IW8A 1GTG1 1SUPA 3SOZA 4HTFB 1FYFA 2Q3JA 2QI9C 2ZUCA 4MUGA 5AW6A 1XROA 1CVIA 1DHRA 1Y3FE 1ZUNA 4XEHA 3RUPA 4ZQHA 1X19A 1A9XA 5THXA 3N2EA 2X9LA 5DK6A 2HT1A 1NFFA 2VRNA 4DJEC 2WIGA 1ENZA 3PUXA 3WK8A 3N86A 2ZYIA 2RKWA 4FCCA 3MWLA 2J5RA 4JIMA 2I87A 5CLLA 1BWSA 5KKCA 5M34A 2XODA 3IRVA 3E7WA 4EKIA 1TF5A 5A0FA 5T4EA 4PHGA 1NBHA 4ARVA 3ANMA 4FX2A 4QULA 4WGFA 1WBBA 2X8JA 1G5HA 1PNTA 3BMQB 1EUYA 3TXXA 1JW9B 2ATCA 3UMVA 1G6HA 1CETA 2BHSA 4P35A 4MJXA 1OI4A 3KOXA 1MG5A 5LVAA 2Q3CA 4AZVA 3DMHA 1LRKA 1MNAA 1BMFA 2QIOA 1DTSA 1E20A 2Q6LA 3IELA 4F93B 4CQJA 3G1UA 4GSLA 3A0UA 3L8EA 1L7EA 4ZREA 3ILXA 3I0NA 3UXYA 2XNHA 1F6WA 2H4HA 2Q9BA 2XUJA 2OPHA 3QPWA 1F38A 1KRHA 2R79A 1NHGA 1UJBA 2RHMA 3BD8A 5FA5A 4JLDA 1UAGA 4URVR 1RYHA 2OFFA 2LD4A 2M9MA 1BFUA 5TPWB 3DOEA 3ONNA 3NHSA 4PGFA 4PLZA 4CLHA 3T7RA 1YDMA 1TW2A 3DTVB 5CA1B 2Z09A 4ZYTA 3CVVA 4DR5B 4IF4A 1ODKA 3GVXA 1Z0JA 3RYIB 2Z0MA 4XB2A 4I9FA 3E2PA 1E2FA 1ZI8A 5AHXA 5HZMA 1JT9A 3T99A 1CIVA 1NLMA 5M29A 3DHNA 4JJZA 2O52A 3KB6A 4WUTA 2QMQA 3KL4A 3OFKA 2B9EA 2RE8A 1BDHA 2HGSA 4JQSA 1E6KA 2X4GA 1YBAA 5EESA 5FPHA 3MT9A 5B1IA 4XYLA 3IUMA 3PQ8A 2ID4A 2A1TS 3VI3B 2OPBA 2RK4A 2PX8A 4MJ3A 3I09A 5CVVA 4G1FA 2YRWA 4JLBA 3JQBC 4NY1A 5JT1A 1SG0A 3CX7A 3L7CA 4CLEA 4RKQA 4Q4JA 2I99A 3QWIA 3KR1A 4O59O 1XNQB 3EEQA 3GNSA 5HS4A 3HVIA 4MCJA 1U9IC 4XWOA 2O4CA 1RQGA 5KOIA 2AX4A 4HR7A 4BTLA 2JHCA 2OFWA 5H7XA 1TPYA 2ZYVX 1H1TA 4LQDA 4DMMA 1U3GA 2BEWA 2WD9A 2XMZA 1NY6A 1J06A 3NHKA 1UDBA 1DJQA 2JK0A 1RXIA 4KR0A 4HWKA 1M66A 4D9JA 4LF5B 2FPIA 2GEUA 2O8VA 4FI3F 2XH8A 4F3YA 1I2BA 1Z17A 4JL6A 4ZOLA 1HXHA 1P39A 1X9GA 2E4VA 2R84A 4U9HS 1PT7A 3RNOA 5KNDA 6ADHA 3C7CB 5I7SA 4ZEXA 3R8FA 2UV8A 1ABEA 1WMFA 2FP4A 3SDZA 2WE8A 2JFZA 2YVQA 3N3BC 2AC7A 1L4HA 4AWAA 1XN1A 1J0EA 4OA8A 1EAMA 4X95A 3MRXA 1BKYA 1R8JA 1ZOOA 2PRKA 2BV3A 2X3YA 2RHHA 2XBLA 2H1IA 4AX4A 1XJWA 3GCGA 2C42A 4X61A 1FFWA 3MT0A 1IMJA 1UWVA 4Q47A 4M9ZA 1JSCA 2G1AA 4WVLA 4OTZA 5L7YA 3UV7A 2ZRAA 3GFTA 3QU9A 1JB1A 3SS7X 2VZ8A 5BVHB 2DCMA 1QVWA 3A1DA 3ASUA 3NIWA 1OXTA 3O4VA 1MAWA 4MS4B 1AS3A 5B7GA 1C50A 2Z8ZA 1G66A 3U56A 3MELA 1B26A 1BJRE 3G9QA 2D2FA 4FVTA 4NVRA 1U9JA 3HCRA 3SEZA 3C5CA 2B4AA 4JVOA 4LZOA 5I9NA 4JB0A 3EUWA 4HNHA 3RANA 5BSFA 2H63A 5HJEA 4LZNA 1UWKA 1POXA 3ZJTA 1VSBA 2XQJA 4MARA 2FZVA 2CCJA 3BJRA 3BTSA 2BFEA 1SD1A 2WAOA 3MCZA 1NQWA 3NJRA 3AEQA 4D8TA 1DGQA 3NLLA 3R0JA 4FJ1A 4FZRA 4IEFB 4JX9A 4XUCA 3VZCA 1C0EA 3F8TA 4CV0A 4J9VA 4LOIA 2ZKIA 3UOWA 4C2AA 5DULA 3SOPA 3EDMA 9GPBA 1JHXA 1CSEE 4DCOA 5KCZA 4XSGA 3HV2A 2REQB 5JAHA 2DQYA 1GZVA 1R5NA 1VPEA 2C3MA 2JDIA 4L5IA 1UEXC 4OBWA 5NULA 3RVKA 4XKJA 1I2ZA 1KJQA 3I73A 1OAAA 1UBSB 1WPQA 2NZ2A 2R2GA 3AB7A 3EZFA 1HLPA 1I4EB 3DXFA 1XJ5A 2OAQ1 1D2CA 4IVQA 2PTHA 4LJ4A 3L5OA 5FUQA 3GT7A 4XD7A 3NXKA 2PIDA 1PU2A 3AI3A 2C9YA 4FBMA 1G21E 2XCIA 1IHXA 2DPGA 1PK9A 4W1PA 1C8VB 1ND5A 3FMGA 1U2PA 4FW9A 5TQJA 4ZJPA 5L7WA 2VLBA 3ZD6A 1EDOA 3QVGB 5TQ2B 3ASYA 2QMOA 1JIJA 4RJIA 1KEKA 2I3AA 4Y2TA 4YJ3B 1DAGA 1Y8QB 2GLUA 1WF3A 1Z18A 3T4UA 4I0WB 1H4QA 5JDIC 4HNQA 1E4EA 1HTWA 2W6CX 1CUBA 4RF4A 5C8YA 3QGMA 4DDKA 2IY8A 3Q9UA 5CFRA 1TTPB 1RWOA 1ZIOA 5KNCA 4L0DA 3VUFA 2X0IA 4YCMA 1ZCBA 2EKLA 1LBHA 1CWUA 2WE7A 3P94A 5EP4A 1F0YA 1S9DA 2C94A 1HC7A 1UFRA 1G8FA 4MGIR 1NUQA 1WPRA 2A33A 2X9GA 1POWA 2Y6UA 4UDNA 1ZUIA 3ED1A 4Z3KA 4Z4CA 3D7LA 5AW8A 3GMSA 4I7EA 1AQ6A 1PD0A 5L3SB 2VR1A 2I4MA 3ZOKA 3MJVA 1WZEA 4A1OA 3G5UA 4OAOA 5JSUA 1YRHA 4R9UC 3D4BA 2ZYGA 2EYUA 3MTAA 4UJ3A 4J43A 3ZHVA 4BFZA 3W9SA 1IN8A 3P2EA 4YMSA 4KODA 1OWMA 2OHGA 4W8OA 5IDWA 4D02A 1GSHA 2DWPA 3KSAC 1FJXA 4CCYA 1Q95A 2D3WA 2QBYB 1X0XA 2OY0A 1II8B 4BLWA 4D9GA 5DRYA 4W5RA 2UYOA 1L5YA 3G68A 1SUIA 2IHYA 5ALDA 2XUIA 1DIHA 2D00A 3NP7A 4BX0A 1K7XB 1OTHA 1FTYA 3I5AA 2PNJA 5DBHX 3T15A 3U4CA 4GIBA 4I5DA 1BZYA 5H02A 1GGKA 2GBLA 4HH3C 4D56A 5JAQA 2IUEA 2YV2A 1KPGA 2O8CB 1EFRA 1N2ZA 5U4XA 3TEFA 2QMHA 5LP6C 5KINB 5D00A 1V7PC 3RSSA 4BQNA 5FI3A 2C7OA 2OGZA 4BBPA 3AI1A 3OM0A 2XPCA 5ED4A 4OXIA 4KRXA 4NH4A 3WJ1A 2H9IA 3TKAA 3VOAA 4RK0A 2ACWA 3FWZA 3PPIA 4COOA 1FL9A 3VZSA 1XTSA 3PZRA 3KLBA 2OMEA 4C6TA 1DAIA 4HN9A 1V8PA 1YQ9A 4G4SO 4EHNA 1VIMA 4MQLA 3QU7A 5DLYA 1OH8A 2GSWA 1E18A 3G9ZA 1DKLA 3OQMA 1O4WA 1PGOA 2C88A 4X0EA 5AKXA 5KU1A 2WD7B 2JGRA 3VO1A 2EFGA 3T1QA 1V95A 1UMDA 1J1ZA 5F1PA 1SPBS 2I78A 3RVDA 4DJJA 3LU1A 2R7MA 3ABIA 4MOWA 5CW2A 3GJ5A 4GZLA 1SC6A 3A1VA 3S44A 3PKIA 4FYKA 1T1GA 1ZEMA 1FUIA 3KZCA 3ME5A 2C00A 4GKBA 4YRQA 5FA8A 3ZLUA 4BLRA 1QP0A 2GCOB 2MHCA 1KBOA 3K35A 4BO3A 2I67A 1AH2A 1TTHA 1RFLA 3EDRA 1E2KA 2EXXA 5KU7A 1IATA 3QIAA 3DXZA 3C15C 5C1DA 1W4LA 2QN1A 2N0SA 3L8DA 3OE7A 4H35A 5FTNA 1C2YA 2FOXA 3F7NA 3ZE6A 2HQSA 2H7VA 2VSXA 4B76A 3R7WB 2ZIXA 2P3SA 1GGMA 4BZWA 4TLAA 2FW6A 1P9LA 3ZWOA 2FW1A 3NDJA 3LFUA 2BM8A 3DE2X 2A0YA 3K6KA 1US8A 3PD1A 4MV5A 2HMUA 3KBBA 5K3CA 4UM9B 2SBTA 3D3NA 2BCJQ 3EARA 1JHAA 1H2BA 3DAOA 4W7IA 2ST1A 4G89A 1U02A 2ZR9A 3D4NA 3R5FA 4G8DA 3D4LA 4EL0A 1GU7A 4RHTA 4IFIA 2R8PA 4EUEA 3OI7A 1MA0A 1SHZA 4X6YA 4ZRMA 5BV1A 3S1SA 3I6BA 3PEYA 1YCHA 2H4YA 2BKAA 2Z2ZA 3KUCA 1UDRA 2H5JA 1YR1A 3FF1A 5KVAA 1ECBA 1XP8A 3ND9A 4DSUA 1ZVVA 3ROXA 4IKPA 1EVKA 1YS2X 1L4FA 4WTOA 1ZK1A 3UAOA 3URMA 4ZZ0A 4J3NA 4OM7A 1J0BA 2QL7A 4ZOQI 1YR8A 4XM0A 3TPZA 1WXIA 2CVPA 5G4KB 3WFJA 3QPCA 4JI0B 2H9AA 1VL1A 3U3XA 4A03A 5A3QA 3QP9A 2VCEA 4AUMA 1JB9A 5T6BA 2CXRA 1QPZA 3R9XB 1TCCA 4HHEA 2I7CA 3L6RA 1LPBB 2IH4A 3GN2A 1AHNA 1I0IA 4GE0A 2XTNA 4GOND 1VQ1A 4GRIA 1H9BA 4LBVA 2ADMA 4DANA 1YA6A 1EFCA 1NE7A 3IEIA 1U8FO 4WLVA 1K6EA 3Q7EA 1SCIA 3R3SA 4MVJP 3L7NA 3HK2A 1Z08A 1ZVJA 2GSDA 4B3TB 1J09A 5FEUA 2Y8EA 4RVGA 3DWIA 1CS0A 1PFWA 4LBZA 2WHPA 4GM4A 2GHRA 4DRYA 2P2ZA 4KNYA 4RWZA 4AKSA 3ZN2A 1KZ4A 2HV8A 3NWEA 4LOJA 1J8FA 1WY7A 1UFQA 3KVNA 4WZAA 3ND5A 1EVEA 3CH5A 4QL3A 4R1MA 5M5BA 2PL1A 2PGDA 1JMYA 4DG8A 3RSFA 1BVUA 1D09A 2AMLA 3OLCX 2WA2A 4KQHA 1EG7A 1P4RA 1QKKA 2ERYA 2JIOA 3HNRA 2JCGA 3TQCA 5DTEA 3ZCXA 3QVXA 1JJAA 3ZOZA 1KOGA 4O63O 2HY7A 2X7JA 3N39C 4XGIA 4AK9A 4DYHA 1B15A 3ELUA 4L6IA 2J59A 3PA6A 4V3BA 3SKVA 4ARAA 3VR4H 2FR8A 2I8AA 3WJ2A 4E6PA 4DNOA 1ZY2A 3OPYI 3PICA 3BMOA 1LZKA 3G5TA 4JEUA 4F5DA 4GS5A 5JANA 3JVVA 4QEDA 1A5AB 2QZ4A 2O7RA 1RQXA 2GKSA 2ZUVA 3FMFA 5KVQA 4GECA 3R74A 3RKRA 4EARA 2JVIA 4F4CA 3IRUA 2KBFA 1MAVA 4YQFA 1Y82A 3OQBA 5IXJA 4D26A 3FSGA 3O38A 5BVGA 3MMZA 3P9IA 1BOOA 1CDOA 1ZM7A 1TYCA 4F92B 1M34A 3GLKA 3QHQA 4FKMA 2F59A 4YRIA 1WD5A 4BLQA 3LXRA 3CZRA 1U0NA 3KVYA 3GAZA 2DBQA 4B0PA 1QB7A 4IXTA 1WNTA 3A9WA 2FSGA 2VJNA 1NASA 4PZCA 1V8FA 1K8YB 3L7OA 4HDMB 2O2ZA 3K70D 1Z2EA 5CVUA 1NNEA 1C8BA 4Q9HA 3QA3E 1SXJC 3WLMA 1LBEA 4PO8A 4S1PA 3EA5A 2OE2A 2QV7A 4HD8A 2BR3A 1EI9A 3DW3X 1JE1A 2W6OA 4JWTA 1Y4SA 2EAUA 2R6JA 4AF6A 3W4KA 4M1YA 1L8AA 1UM9B 3UV3A 2DLCX 3TLGB 2J48A 1OY1A 1GPBA 2IVFA 4G23A 2GHQA 3H4TA 1G8AA 1KY2A 4YP7A 1XDGA 1Q50A 4EEKA 3QKTA 4I1VA 4L9SA 4S12A 5GIOE 1Q3TA 1NJ2A 1KDRA 1ZL2A 5JZSA 2IEAA 2N42A 4TS4A 3WGYA 1EX7A 5D3MB 1KAGA 1W25A 4RJJA 4Y9SA 4ENUA 4AZ3A 4CKEA 1Z7YA 3WA7A 3BB3A 3FVRA 4R16A 1NI4A 3JR7A 3LIPA 4JUCA 3IURA 1ZZEA 4ZPJA 2VQEB 2QTNA 1BXGB 3JV7A 2PH1A 3RDPA 4LCJA 4QKQA 1Q19A 1W1UA 4UEJA 5K3FB 3SN6A 4CF7A 5EZQA 3G0DA 5C81A 3C14C 1CU1A 1N57A 2ZB3A 3FVWA 1H2AS 4QFCA 2NUTB 2JJQA 4BKQA 3N6RA 2QR3A 2C2YA 3ANSA 4Y18A 2FX2A 4UMEA 5G0VA 4LXHA 1K97A 4YJ3A 4GYKA 2KM1A 1KL7A 1KO4A 2ZJ7A 1SXGA 3KSDO 2JAOA 1XVUA 4U2EA 4IIYA 4EJSC 3SJBA 1Y8RB 5A9SA 1DKNA 3SEFA 4FQ5A 4ND8A 5F1YA 3REGA 2FKNA 4MQFA 2FPMA 1ZW1A 1D9ZA 2GLXA 3KSRA 1OV4A 3KSBC 3G7SA 2EDCA 3F3SA 1P5RA 2I1WA 2RB5A 4QNRA 3WRXC 4EFMA 2EW1A 3KSMA 1SWWA 3L1KA 4FHDA 1B43A 1RWKA 1XD9A 2YXPX 3RRZA 3Q7TA 3KB8A 3ZWNA 3QQPA 3TLZA 2E5LB