5MDHA

Crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
333
structure length
333
Chain Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEEIAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQAKEVGVYEAVKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGIISDGNSYGVPDDLLYSFPVTIKDKTWKIVEGLPINDFSREKMDLTAKELAEEKETAFEFLSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate specificity in malate dehydrogenases: crystal structure of a ternary complex of porcine cytoplasmic malate dehydrogenase, alpha-ketomalonate and tetrahydoNAD.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Oxidoreductase
molecule keywords MALATE DEHYDROGENASE
total genus 109
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 1.1.1.37: Malate dehydrogenase.
pdb deposition date 1998-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mdhA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5mdhA02
1O94A 3RFXA 1Y8QA 3ZHYA 1NFQA 3UUWA 3WS7A 2P4QA 4CLXA 1F17A 4K9DA 1X7HA 3OSUA 5AOVA 3PHIA 1XKQA 4NFYA 1IOLA 3DL2A 5JYEA 4CM9D 2BLLA 2ZQZA 2W4QA 4PLFA 3TN7A 3AW9A 1QV7A 4DUPA 1WMAA 4GH5A 4IUYA 3AY3A 4H15A 4NU6A 5H83A 1T25A 2YY7A 3SJUA 1XA0A 3FTPA 4D3DA 5EERA 1PU2A 4S3MA 3WQQA 1P0CA 1T2CA 3RCBA 1IULA 5A9RA 2PGJA 5TT0A 2D59A 4K6CA 4WEOA 2Y66A 1PJ2A 4A26A 4IDDA 4P4NA 3BIOA 3IJRA 3LLSA 3WGTA 4J6FA 5AXAA 3SX2A 5T8KA 4BO8A 3JQ9A 1NPYA 2HO5A 1EVJA 1TB4A 2BD0A 2DBZA 2FWMX 2RBEA 4OQYA 2Y0DA 2ZTVA 4Q3BA 1MXFA 1NVGA 5F1OA 5CG2A 4OIMA 4ND1A 3CZRA 2AEMA 1N1EA 4J7CA 4N5LA 1FDVA 3EHEA 5G0SA 1B14A 4B8ZA 5L45A 3AWDA 1HDGO 1U3TA 3A28A 4CMHA 4CMEA 3IUPA 2VZ0A 3F9IA 1T4BA 1JW9B 1YWGO 2EERA 3K8ZA 4Y67A 3ASVA 5H82A 3TFOA 4J4BA 5TIIA 4DC1A 3QVWA 4MVJE 2CZCA 4GKVA 3BMCB 3HUDA 1U3VA 1EBUA 3Q0EA 4DLAA 2CDCA 4W6ZA 1FMCA 5CDTA 1B0AA 2D5CA 2Q99A 3HHPA 2NU6A 5JMPA 4A0SA 4CM9A 4CL8A 4LN1A 4D43A 2Y1DA 4YRAA 1H94A 1JDJA 4MIYA 1UXJA 4Y6SA 3K31A 3HDJA 5DP1A 4DMLA 3EVNA 3TZHA 3PJEA 4GVXA 3WB9A 4TMFA 2Z1NA 1HDOA 1U1IA 4ND5A 4ILKA 5F1KA 4YQZA 1NQTA 1GR0A 3T4EA 1YDWA 4UVGA 1B8VA 1KEPA 2GN4A 1K6IA 4Q3EA 2Q49A 2UV8A 4IQ0A 1I10A 4YRDA 2PKQO 3F47A 4J7UA 3PHHA 1VM6A 2YFHA 4L4SA 4HNGA 4R1SA 4BKUA 3NT2A 3TDKA 5KWEA 2E48A 5L3ZA 2BH9A 3BHMA 2DQ4A 3U62A 2G82A 4NPCA 3RC9A 1H5QA 1OBFO 4R3NA 3RFVA 5HRUA 3R0IA 3W4KA 1WLYA 1IPFA 3EDMA 4R3WA 3RUEA 1Q7CA 5JO9A 3FRJA 1TA4A 3FR7A 4N7RA 4IPTA 4EUEA 4YXFA 3LF2A 2I5PO 1VKNA 4QFCA 2DU8A 2WMDA 2ZJ1A 2C2XA 4J7XA 1QXSA 3ADPA 2NWQA 2C5EA 3CSDA 4E12A 4BKQA 4XR4A 3U4IA 1L7DA 3ZH2A 1R4NB 4QFDA 4B7XA 1NQOA 4J16A 3D1LA 4WCFB 4CM5A 5ADHA 1LSSA 4XKJA 3N7UA 3D7LA 4FGSA 4AJIA 5L4LA 2ILTA 4MP8A 4G5HA 1LEHA 4YCAA 1R4NA 4UUNA 1HDCA 7MDHA 5COBA 1IZ9A 2GZ2A 2B4QA 2Q45A 2VRCD 3W8EA 3P7MA 2DC1A 3W8FA 4NK4A 3WX0A 1EUCA 1I3LA 3FSRA 1ZJZA 3FBGA 1PZEA 1UAGA 5ILGA 3GDOA 3TSCA 4OGWA 3M2PA 4ID9A 4XYLA 4B8WA 1JN0A 2PZLA 3CTMA 4WLOA 4XWYA 5COAA 4ND2A 1YOVA 4FFMA 4PG6A 4UEJA 1H0KA 5DCUA 3BA1A 3S8MA 3PEFA 1MC4A 3ZV3A 4E4YA 3DQPA 2R00A 2ZTUA 1ZFNA 1R0KA 1YB4A 4KOAA 4XQEA 3WWZA 4MP3A 2IEDA 4FGWA 1DRUA 4DGSA 1L7EA 1RYDA 1ZK0A 1ADBA 4RL6A 1O95A 3SXPA 4YPOA 2C0CA 1PR9A 3FHLA 4W9NC 1NX6A 2HMUA 4MVJA 5KVSA 1PJBA 4J1QA 4J1NA 1GD1O 4Q9NA 3DC2A 8LDHA 3PQEA 3D5TA 4O1MA 4BGVA 2HKIA 1YBAA 4MPDA 2IRWA 1EE2A 1T4DA 1DRVA 3PRJA 3I9KA 4TSKA 2CUKA 4YJFB 3OJ0A 3ST7A 4N5NA 2BKAA 5ICSA 3QVXA 1BW9B 2X0IA 3ZZNA 2WYWA 4E2YA 4PZDA 3QW2A 1NVTA 3H2ZA 4ALLA 3E18A 2YYYA 4YDRA 5KJFA 3WTBA 5T8KC 1TT5B 2X58A 5JS6A 2FMUA 3COSA 1WDLA 4W4TA 4Y6RA 2VNAA 3U0BA 1I3MA 4YAIA 1CJCA 1BVUA 1ZBQA 2GSDA 1BXGB 3BTUA 1GU7A 4ZVVA 4AJJA 2E37A 1TT5A 3BTSA 1P1KA 3P2OA 4L4RA 4ALIA 2DVMA 1P1FA 1A9YA 1E6UA 3DAFA 3JYPA 3OFSA 3OF2A 3ZWVA 4RF5A 4JIGA 3GRPA 2JD2A 2QRLA 1XR3A 4KUGA 4XGKA 1PS8A 4UEOA 1X1TA 4RV9A 3QE3A 4CMAA 1N8KA 3JQ6A 3SVTA 3H65A 3GT0A 2GASA 4MKZA 3OQ1A 3H7AA 4HFNA 1ULUA 4UREA 2Y1GA 3GN2A 2EV9A 1DEHA 1Y81A 5CEEA 3PQDA 4XYBA 5JMWA 1W8DA 2AEFA 1ZCJA 2GRAA 4P4LA 4FW8A 5T57A 1DDOA 4IDFA 1GUZA 1I24A 2YV2A 5GZ6A 5JE8A 2GR9A 2VUTA 4BVAA 2OHXA 4O59O 2OFPA 4DC0A 3E9MA 2VYND 1Q7GA 3AI1A 4LCEA 4MDHA 1MG5A 4YWJA 2D2IA 1N7GA 4MJLA 2YHIB 4GX1A 1E6WA 1Z75A 1HLDA 3H9JA 1AXEA 1VL0A 4GBJA 3UH1A 3GG2A 3S1LA 4U6SA 2EEZA 2XAAA 3BMQB 2X1HA 4NJMA 4CLHA 4J4TA 2O3RA 1M2WA 3QQPA 5IAAA 1OZAA 2Q1WA 1O0SA 1KIFA 5TC4A 3LC2O 1MX3A 1ONOA 1ZNQO 4LVUA 3KYDA 2RIRA 3HE3A 3F5SA 1EVIA 2VCYA 3BMOA 4E13A 1VJTA 2C7VA 1EDOA 4MIEA 3RBVA 3TL3A 4BB6A 3CZMA 3WFJA 4YAGA 2J3HA 2Q1TA 4CR8A 4CR7A 3BMOB 1N5DA 1KC3A 4GL4A 4HFJA 2F1KA 4R54A 4ND3A 1UZMA 1PJCA 2O4CA 5L95A 1KC1A 2WWRA 1ONNA 3RU7A 4NU5A 4Q39A 1ML3A 1UJMA 4WKGA 4J9UE 3ZDFA 4AJ4A 4MVJG 2HU2A 2I9PA 3B20A 4RF4A 1HF3A 3RVDA 4BNYA 1MC5A 1BGVA 4YB8A 3DZIA 4ZU3A 1XU9A 4BNWA 4F6CA 3M1AA 1LX6A 3DWFA 1UUFA 2OUIA 3PYMA 4BO0A 3KV3O 1PS0A 1UR5A 3F3SA 4FR5A 5K6AA 1KVSA 4J43A 1QV6A 1DPGA 2HUNA 1LJ8A 5L4SA 4L4XA 3B1JA 5DF1A 1Y9AA 1JVSA 5THKA 1ZK1A 1WNTA 3JQ8A 4FSHA 4PCVA 3FTNA 3MJSA 1NHGA 2PGDA 2JD0A 4XQGA 3UCFA 3G17A 1A4IA 2W2LD 4GGPA 5C5IA 1N7HA 4CM3A 1UXHA 1ISFA 3OIGA 1SC6A 1UP6A 2OORA 3TWOA 4CLOA 1ZIDA 2ZK7A 2Q46A 3DEYX 4E32A 5CDGA 2HLPA 1K6XA 4L73A 4NG5A 4OOEA 5TSDA 4PFJA 4YR9A 1P1RA 4BS9A 4Y6PA 4IXTA 2CDAA 4PLHA 1WMBA 2H5LA 3AUSA 3PFFA 4J1TA 1DJQA 4PG4A 4K28A 3I9NA 6LDHA 3INTA 4DYVA 3ORFA 3BHIA 4CV1A 5IJZA 3IL2A 2RH8A 3CIFA 1JKIA 4YAJA 3QVSA 2DFVA 1NHWA 5JAIA 3GC6A 3GGPA 3ZV6A 4AJOA 5F3RA 4RVDA 1P74A 4MVJM 1SCUA 3DBLB 3H9GA 4PN3A 3WQRA 4E31A 5H81A 5TLSA 1WW8A 5JAMA 1YQXA 5IF3A 2VTEA 4R9RA 1S7CA 3GN1A 3H2SA 1KY4A 3PJDA 4RGBA 3IOYA 2O3TA 1JAXA 3IP1A 4ZQEA 3FNHA 3GUCA 5FI5A 2NQTA 3WLEA 2E6UX 4LGVA 3A14A 3NX4A 3EUWA 3CXRA 3D3WB 1IHXA 5CEJA 5CG1A 3ZCXA 3JQ7A 4TKLA 4ZJUA 3EAGA 4BO1A 4GX0A 3GPIA 4JROA 2GGSA 4PLCA 3O26A 3LSYA 1JAYA 3JQAB 1JKJA 2C59A 3KYBA 1Y7TA 1DHTA 4D45A 2ZCUA 5DBFA 3ZHBA 4D3FA 5K9ZA 4Z6KA 3FPLA 5I8ZA 2VUSA 5DCYA 4ZICA 3DBVO 3AY6A 1A27A 5KNLA 3VVBA 4OL9A 1EK6A 3V2HA 1NAHA 2PD3A 2O3QA 3I9OA 4IMRA 1GUFA 2HDHA 1DC3A 1HE5A 3R3SA 1WDKA 1F14A 4Y98A 5JY6A 4CV2A 2W2KB 4EEXA 4EBFA 4Z3DA 2H9IA 5AQ1A 3RBXA 2JJYA 3HN2A 3U09A 1MA0A 1DIAA 2FR8A 1MFPA 1SAYA 3F1KA 3GH3A 4E0BA 1YJQA 1HEUA 3Q2IA 1PJQA 3DHYA 3DMTC 3KUXA 1X14A 3WYBA 1J49A 4A5OA 4IIUA 3D3WA 1QSGA 5A4DA 2NM0A 4EZBA 2X5JO 1DLIA 4CQLA 4XDZA 2B35A 3JQAA 2PK3A 3BMCA 2CFCA 4GLLA 3LC7O 1DIGA 1YH3A 3W6UA 4B4VA 2NU8A 2B83A 2P91A 5LDGA 4E5PA 4RO0A 4OKNA 2Z95A 4GWKA 3G79A 1YQGA 2NACA 4PRLA 2HMSA 4IDBA 3UGKA 3EGOA 4R5MA 4M55A 5ENVA 4LSMA 2WD7A 1X0VA 3L4SO 4OQZA 3W6ZA 3GHHA 4HADA 3TNLA 4XIYA 4BIIA 1QORA 1ONPA 3DBHB 5K6AC 1Q7BA 5LDHA 3KBOA 3UVEA 2WD7B 4BNJA 4IS2A 1P31A 4ONEA 1CETA 3GVPA 3ZU5A 4LMPA 4WLNA 5IDYA 1OC4A 4QECA 4JP2A 3K5PA 3KXDA 3PWSA 4OXKA 1V6AA 1ISMA 3QJ5A 3E48A 4ALJA 2YUTA 3DBLA 5C37A 3QIVA 3AFMA 5LC1A 5COQA 2VTDA 3WBFA 4DTIA 2O2SA 1RPNA 2OBNA 3DZJA 3GDFA 3PLRA 4BNIA 3M2TA 1EMDA 4W7HA 1E3WA 3ASUA 3R6DA 1YVEI 4EUFA 2IZZA 4L75A 1WP4A 1JTVA 2VNSA 1BXKA 1GL3A 1TI7A 1XIVA 5CDUA 1BW9A 4QTZA 3G1UA 3JQCA 2JCXA 2P9EA 1EVYA 1X0XA 2B4RO 2IXBA 3KSZO 4OAQA 2GLXA 1D1TA 2A4KA 3TZ6A 4CV3A 4HP8A 2Q1SA 2NTNA 1XDWA 2UAGA 1PQWA 1PQUA 1YKFA 2WYUA 4KTTE 3WIDA 3WGIA 4CMBA 3ETDA 4AJ2A 4B3IA 3ZWYA 1PTJA 2ZYAA 3G49A 3KVOA 4DYDA 3GEGA 1R0LA 3PDJA 4RQUA 4M49A 2C7GA 3H8VA 1LDYA 3LK7A 2H1SA 4XQ9A 3P5SA 1HZZA 5G0WA 3I52A 1IB6A 3OECA 3W4JA 5JO0A 4TWRA 2NVUA 4L0QA 3PGXA 1NASA 4MO2A 3MOIA 3QVTA 4BHTA 4I08A 1V35A 1GQQA 4HUJA 5IZ4A 3B1KA 1E5LA 1CQJA 4KDEA 1E92A 4FFRA 5KVQA 4BKPA 1DFGA 4IDGA 3NGXA 3GF4A 4INAA 3E9QA 4JBIA 3HSKA 4AICA 3T4XA 1QG6A 4MP6A 1E1KA 4R16A 1HXHA 2DBVO 4A27A 3OJLA 5DT9A 1E7QA 1EE9A 5MGBA 3GG9A 1VPDA 5MDHA 2X7HA 3PXXA 3H9UA 4LCJA 2HJSA 3CUKA 1IPEA 1YDEA 1C1XB 4UVDA 4GX2A 4YYZA 1DHRA 4JBHA 5A02A 1ISIA 3WFIA 4DMMA 1PZHA 2V6MA 2Y68A 3ENKA 4ZHSA 1Y8RB 4BMVA 1IZ0A 3WJAA 2C2YA 3FD8A 4RVUA 5FFFA 3PZRA 4DREA 4IDCA 5KIAA 1PJ4A 4PG8A 4HY3A 1LLDA 1F8GA 4J0EA 3PK0A 5KJCA 4K1LA 3H3FA 3L0DA 1E5QA 1IL0A 1DFHA 1I30A 2FPGA 4ITUA 4UULA 5ER6A 1Z6ZA 4JN6B 3MJVA 3WNVA 4YAEA 1D7OA 1EFKA 3KYDB 3FNEA 3L6DA 2TMDA 5A06A 1MG0A 4GX5A 3JYLA 3JCZA 3OJFA 3S2IA 4EEZA 4TQGA 2AG5A 1SNYA 5IDXA 1CEQA 3KYCA 3HFSA 1R15A 5KVCA 5CPFA 4HBGA 4CMIB 3KEOA 4DLBA 4IJKA 2RAFA 1QYVA 1H2BA 3ONEA 1ADFA 5L7YA 1PZGA 4W7IA 3VZSA 4YACA 4CLOB 4GAEA 3WDSA 3NDRA 4JCOA 4P8RA 5AXBA 2OMEA 2P2SA 5TRTA 1ADGA 5JXWA 4J91A 4QO7A 1E3WB 4WOKA 2PKQP 4FBGA 5T6BA 1GZ6A 1Q0QA 4MVJI 4B3JA 1UDAA 4EJ6A 4LK3A 1NBOA 1V0JA 2FN7A 2VHWA 2VZ9A 4CLEA 1KS9A 4BNZA 3VH1A 5AYVA 4PLZA 2QYSA 4DIFA 3DZGA 2X9VA 3ZGYA 4CLRA 2GF2A 4WLUA 1YO6A 2GYYA 4GVLA 4GMGA 1LA2A 1ZH8A 1IYZA 3BHJA 4OSPA 2FSSA 4DPKA 4YVFA 2GUGA 1RJWA 2OGUA 4FN4A 3RD5A 4KUHA 3KLPX 5BSHA 3JYNA 1DIHA 2FP4A 4RZHA 1VL8A 4EJMA 3Q11A 3PHGA 3QWFA 1DFIA 2G0TA 6ADHA 4NJMB 2Q2QA 3KYCB 1U8XX 4A73A 3FNGA 2B0JA 4ROSA 1HYEA 2NUAA 1BXGA 4CM8B 3UCXA 1WPQA 1YL6A 2FSVA 1ZXLA 5A3VA 4N5MA 5IG2A 4W9NA 1UH5A 3OEWA 4PLPA 2NVUB 3L77A 3U5TA 3K2BA 1GV0A 2D0IA 1A9ZA 4H16A 1ZK2A 4E21A 1PR3A 1LRKA 2P68A 4AJ1A 5TF4A 1GEGA 3TZQA 4UEKA 4RF3A 1PEDA 3ZWOA 5A9TA 3Q6IA 2IODA 3BYZA 3RUIA 3D4PA 5G2OA 1H9AA 2YZ7A 1U2GA 4QX6A 2PTGA 4RQTA 4R69A 2AXQA 2EKQA 4NBTA 4RF2A 5C7LO 5I9LA 1G0NA 2C54A 1XU7A 3RC7A 4O0LA 4EGFA 3UHAA 3FWNA 3Q9NA 1OFGA 1D4FA 1DIRA 4IQGA 3ANMA 4U0JA 1X13A 2X8LA 1VSVA 3RUFA 1NP3A 3F5QA 3VOSA 3LT0A 3RASA 1PJ3A 1E6EA 2VOJA 1W6UA 2G5CA 3H6KA 1EDZA 4JGBA 3VDQA 2EG9A 3C8MA 3NDJA 4ZD6A 5CDSA 1AHHA 1P45A 3QP9A 3R3JA 3JQDA 3STHA 3RC1A 4ALNA 1VRWA 1N1GA 1GFSA 3FCOA 2C20A 4E5MA 4PG7A 1K2WA 3TOXA 5I7VA 4A7PA 1P0FA 3JQ8B 4CUZA 5BNTA 3FPCA 1ZJYA 2DPGA 2GERA 3PWKA 1BDMA 1K0UA 1FDUA 1I2BA 2O50A 4CQMD 5IXSA 3QWHA 3EZLA 5EQDA 2HAEA 1C0KA 4TRJA 4D7AA 4R1NA 4Y8VA 5EL0A 4IIVA 1T24A 2PV7A 3DZFA 3O38A 1MP0A 2D1YA 5L51A 3V5NA 4BO4A 1DSSG 1UXKA 3L6EA 1SB8A 4DL9A 5J23A 5A04A 2NNLD 1LUAA 4I5DA 2W2KA 4FFOA 1NFRA 5BSFA 2G1UA 2D3TA 3L9XA 2BELA 3ETEA 4Z0PA 2Y67A 3E1KA 5L4NA 3AUTA 3PJGA 2LDXA 1QP8A 1B16A 3GFBA 1ISJA 4IJUA 2FR1A 3O8QB 5ENDA 3F4BA 4JLWA 3WGZA 4HNHA 4NFSA 1E3JA 2XF8A 2VHYA 4UUOA 3V2GA 1UXIA 2E4AA 3GDGA 4CMJA 2YDXA 1ZW1A 1EVZA 1BRMA 3NT5A 2B36A 4FQ8A 4EITA 2R6JA 1EUZA 2DBRA 3AI3A 2J5RA 1IE3A 4R9SA 4CQLB 3RI3A 4JP3A 3V2UA 1GPJA 1MB4A 4M87A 4YTEA 5IN4A 2PA3A 3QY9A 2IDZA 4HXYA 5B4UA 1CDOA 3PJFA 1Z74A 3ZV5A 4WGGA 1QYDA 4XA8A 2C07A 2QRKA 3PLNA 1NFFA 4TVBA 2PFGA 1C0IA 4TKMA 1YQDA 3VTZA 1UAYA 2DKNA 3PI7A 4YRBA 3UKOA 5HTOA 4OH1A 1P33A 4ZRMA 1KVUA 4WLFA 1NR7A 4NQZA 3WWYA 4FB5A 3I9LA 4WECA 1YJ8A 3HG7A 4RVFA 1XWFA 1WZIA 2J5KA 3CKYA 2Y1FA 3A1NA 4GWGA 3DO5A 4J2OA 2IZ1A 1LC0A 4BNTA 4BO3A 5BQFA 2J3JA 1AGNA 4ALKA 1O89A 3JQBC 2XXBA 4A10A 3WSVA 3F6YA 2QHXA 5JPIA 2HMVA 3H5AA 1ZK4A 3MWEB 3K92A 5KKCA 4II2A 5IZCC 1A72A 2BFAA 2H63A 2UUOA 3WR5A 3W1VA 4RDHA 1ZVMA 2ZB4A 3LT4A 4XRGA 4RCVA 5JDCA 3Q9UA 3R1IA 3L07A 1GQYA 4L9RA 2V6GA 4QO8A 1FXSA 5HS4A 1V3UA 2A9FA 4I9UA 1LNQA 3WMXA 4FC6A 4YBZA 4JJIA 4NHEA 2V6FA 3ITDA 4QUKA 3UAGA 1DC4A 4YQYA 3C7DB 3ZHZA 4XD2A 4CODB 4U6QA 1HZJA 2J3IA 1HYHA 3JQ9C 5ITVA 3FR8A 2BI7A 4ZQGA 3WYCA 3HJAA 1NWHA 1NYTA 3U9LA 1DJNA 3IKTA 3I3OA 4OM8A 1XYGA 2PNFA 3DTYA 3BMNB 1PWXA 1SZJG 3JSAA 5BT9A 3DAGA 4WCFA 5I9MA 4FIZA 1E1LA 1U7TA 1R6DA 3DBHA 5TGDA 1EBFA 2B69A 3RC2A 3DOCA 3S55A 1L1FA 1C1DA 4AL4A 1HDXA 1ORRA 3I83A 5K0ZA 5KCZA 1M67A 3K6JA 2P5UA 1HE4A 2HRBA 3AI2A 4AG3A 3VVCA 4MVJH 1GV1A 1EEHA 2GN9A 2FR0A 2R2GA 5A05A 3H5RA 3WICA 2DLDA 2NADA 2X0NA 1GDHA 5EN4A 1RM3A 1C0LA 1EQ2A 2GO1A 4WCDA 4R41A 5G0TA 1C14A 1E7WA 4PRKA 2AA3A 5GMOA 1JWAB 3M6IA 3GEMA 4E33A 1QYCA 3GY0A 3ONFA 1B15A 3RU9A 3I1JA 1WZEA 1ZEMA 2Y99A 2O23A 3K30A 4OMUA 1KEWA 2QG4A 3FN4A 3HFGA 5JCJA 3ZU4A 1LRJA 1LDMA 1X15A 3VZQA 1BDBA 1G0OA 4EW6A 4YEDA 3HWRA 4JK3A 4F3YA 3NTQA 4BL5A 2CDBA 2VRCA 1KETA 1S6YA 4L8VA 1F12A 3AOGA 2Y93A 3IMFA 1KVQA 4M1QA 4IM7A 2DBQA 2PY6A 2W8ZA 3AU8A 2EW8A 3PDUA 4Z0HO 4XJSA 3WMWA 3P2YA 3V1YA 3EY4A 4BNHA 1KYQA 1ZO8A 1FK8A 1YRLA 3HN7A 5DP2A 1VC2A 1HLPA 2X86A 2Y0CA 4J2HA 2Q4BA 2PZMA 2FPPA 2OO5A 3GRKA 4BGIA 2O7QA 3QHAA 3U49A 5LCXA 2VWPA 2NTVA 4RVHA 4DRYA 4JX8A 1C3VA 3HADA 2O7SA 1UZNA 2BGLA 1V3VA 3VH3A 1UXGA 5G4KA 4B79A 2P9GA 1PGOA 3WQSB 1VE9A 3DMTA 2Q2WA 2C29D 1JLLA 2W90A 5GY7A 3DB2A 4YT5A 3GLQA 5T64A 4DXHA 4QQRA 1R16A 4RJTA 1DBVO 2GN8A 4BKRA 4DIBA 2CNBA 1NQ5A 5U9CA 3SLKA 3OIDA 3BTVA 3ZW9A 4AJHA 1GQ2A 5FEUA 1GYQA 2A92A 4R5HA 5I7EA 1PGQA 3OETA 4B7CA 3F1LA 4R1UA 3MWDB 5FYDA 2D4AA 2QW8A 2Y0EA 3GNQA 3QLJA 4B4OA 1BSVA 1SB9A 2ZB3A 4DQVA 4DLLA 1VKOA 4YT4A 3I9MA 3ADOA 2ZYDA 3G3EA 1P1JA 4LMRA 3U4HA 3PHLA 1W0CA 2JCYA 4QSMA 4J49A 3PYLA 5TS3A 2XXJA 1U8FO 2WJPA 2HQ1A 3VPXA 4OO3A 3RAJA 1HDRA 4WK6A 5JDCC 1SEPA 1NPTO 3TF5A 1GYPA 1SEVA 1Z7BA 4KDFA 2E82A 4XGIA 3OHSX 1LSJA 2VHXA 4M54A 1ADCA 4R4JA 3LT2A 5AXCA 3MJEA 3PVZA 4XYEA 4BO9A 5JDIC 3WLFA 4OJNA 3AU9A 5G4KB 5A9SB 5JCXA 3KB6A 1TT7A 1R66A 2EGGA 1E3SA 1AN9A 4GSKA 4TRRA 4CMEC 3VZRA 8ADHA 3NGLA 5JFOA 5A1TA 4IGFA 1U7HA 5AXDA 2VZ8A 2O3JA 1N92A 3NEPX 3ETGA 4Q3CA 1B8PA 1Q0HA 4LISA 3PFWO 1J4AA 1GPDG 1NWCA 1E7SA 1PL7A 2AW5A 4D44A 5THQA 3WNQA 3HNPA 3I6QA 4RVSA 4CUKA 1H6BA 4E5YA 5C7OO 3JQAD 3KTDA 3ZW8A 1M6WA 1H6DA 4WNIA 1DB3A 2ZIZA 4JQCA 2ZJ0A 4AVYA 1RM4A 1TXGA 2ZKLA 3K73O 1MUUA 1NPDA 2HMTA 2EGHA 1ULSA 3VZPA 4U0KA 1P44A 3TZCA 2BFOA 4PZCA 3HDYA 4F6LA 1DIBA 2VYVA 2CF5A 2J5QA 3JTMA 3VH4A 3NT4A 3ZWCA 5DBIA 1B3BA 1F8FA 3X2FA 3NV9A 2BGKA 5KTKA 2RCYA 3GPDG 2HCTA 3KO8A 1QRRA 4CMCA 4JBGA 3C1TA 5BNIA 5BNFA 4NMHA 1VLLA 3VPHA 1DLJA 2JAHA 1CWUA 3LC1O 2YHUA 2B5VA 3PP8A 4FS3A 4HX5A 1NR1A 4IDAA 3WSWA 2VT3A 1GYRA 5HM8A 3NTOA 2EHDA 1Q1NA 2NTJA 4RDIA 2B37A 1PSDA 3DZHA 1HSOA 1PIWA 3BAZA 5KKAA 4O63O 4BUCA 3AOEA 3RUAA 4C7KA 1DRWA 3NTRA 1BG6A 1D3AA 1J5PA 3DOJA 4BNXA 3DZKA 3DBRA 2I99A 3UFXA 1FF9A 1TEHA 4A03A 3ON5A 3IIEA 2WE7A 3AM3A 4K26A 4NBWA 5DCWA 3LZ6A 2DTEA 2ZB8A 2G76A 3BXXA 3I6IA 5TJ9A 5L7WA 1C0PA 3I5MA 4H7PA 2HRZA 4EYEA 3L6OO 3VTFA 2JAPA 4BQRA 3DFUA 3I9JA 5JC1A 3I4FA 5HA5A 3GK3A 1VL6A 3ENNA 1NAIA 4WEQA 4CLRB 4CUJA 2I67A 2VQ3A 4YJHB 3JD4A 4GQAA 3WGQA 3GFGA 2P5YA 3KHUA 3QSGA 3ZWXA 2YW9A 2DUWA 2VWHA 1P1IA 3P19A 3UICA 5FI3A 4BQPA 2XOXA 3JD3A 4KQWA 3UCEA 1OOEA 2HMWA 3LVFO 1QLHA 2UVDA 3GVHA 3OQ6A 3RROA 3MOGA 1E7MA 4HFRA 1Y1PA 2EIHA 1QYWA 1CERA 2J3KA 5JSFA 4CM8A 3DXFA 5A3JA 3I23A 3IAHA 1A7AA 1YONA 5DBGA 1E77A 4HV4A 2O4UX 3AUAA 5L9AA 2Q4EA 2FY8A 1ZMOA 4X54A 2VYNA 4Q3NA 3KSDO 1T2FA 3E5RA 5CDYA 2CD9A 1VJ0A 1YBVA 3TZKA 2CVOA 2DTXA 1JVBA 3DONA 1XSEA 2JFHA 4FC7A 4XB1A 4AFNA 4DVJA 3DR3A 1LDBA 1O6ZA 2YFQA 4P38A 3BMNA 1LLCA 3C7CB 4TRMA 2Z1MA 1KVTA 2EWMA 1I01A 2PZJA 3GVIA 1LDNA 3OEYA 4I8XA 3M1LA 2HK9A 3UXYA 5B1YA 1MV8A 4MVJD 3UF0A 2RHCA 2DAPA 2EP5A 5I8WA 1HE3A 4NH4A 1BHSA 4RVGA 1FDSA 1NM5A 4FJ1A 3GVXA 9LDBA 1LQTA 4AJLA 4BNFA 5C3MA 1RYEA 2VHVA 4YJGA 1SOVA 1X7GA 3WGYA 3ZNPA 5DULA 2NQ8A 1ENYA 3HQ4O 2AQIA 2BHLA 3LYLA 4KMSA 2JFFA 4AJEA 1T26A 1N9GA 3ITKA 1SBYA 2PKRA 2W98A 4ZA2A 1NTOA 1XQ1A 3A06A 5EINA 1D1SA 2V65A 4N54A 4URFA 1YE3A 1I32A 1LQUA 5TNXA 5A03A 3ANNA 3CEAA 2OBYA 1I0ZA 3HDQA 3ZU3A 1O5IA 1F0YA 4E3ZA 3K9QO 1FDTA 1SOWA 4R01A 4EUHA 4BNLA 4XIJA 1B3RA 4TRNA 2GD1O 3NKLA 2OL4A 3QWAA 3VKUA 4NI5A 3KRTA 3OJOA 4D41A 2QIOA 2PWZA 3W4IA 1UDBA 4PLTA 2Y1CA 1LDGA 1OAAA 1R4MB 3D4OA 1I8TA 1T2EA 1E7YA 5DOZA 4CM6A 2X5KO 3GNSA 1BMDA 5JLAA 3VH2A 4ESOA 1ZZEA 2BFPA 4FCCA 2I6TA 3PWZA 2GN6A 2PD6A 3O8QA 4UVIA 3PIIA 1GZ3A 1I3NA 1LRLA 1W73A 2IYOA 3RUHA 1XGKA 2DT5A 4ZQFA 1W4ZA 3VKVA 4AJKA 1PL8A 4D3SA 1YGYA 2DUUA 2HK8A 4M8SA 1K6JA 3MZ0A 4GPD1 5CPBA 4IZHA 4B3HA 4F45A 3RWBA 3PPIA 5B37A 4BMNA 2POQX 3CMCO 1GZ4A 2I3AA 1HE2A 3U4CA 2WYVA 5JYDA 2ZATA 4E6PA 1D8AA 3WYEA 3V8BA 3WG9A 3QV1A 4JNKA 2FOIA 3NAQA 4CMKA 3LQFA 1XELA 2YJZA 2C5AA 2B4TO 2C82A 3L4BA 1KBZA 1ZSVA 4JJGA 4XB2A 4CM7A 3ICCA 3ROQA 1U4OA 1LTHR 3AOEC 4AJPA 4CV0A 1LC3A 4BOYA 2ZCVA 3OA0A 2Z5LA 1DAPA 1OC2A 3HB4X 4CM4B 3DFZA 2ZTLA 4NZ9A 4WASA 3SBOA 3WGOA 3JYOA 1PZFA 4IS3A 3DDNA 2OXIA 1XLTA 4BGEA 3ROKA 3SLGA 1B7GO 1K3TA 5BSGA 2RHRA 1G6KA 1ISHA 1LBEA 1OMOA 4XEHA 1R12A 1EZ4A 5F1PA 4D0RA 3K96A 1LU9A 2Q3EA 1H93A 1DAOA 3HZZA 3PQFA 3IS3A 1C1DB 2EP7A 4ZGWA 1RKXA 1YL7A 2DPHA 3GR6A 3LF1A 4Q3AA 2EKLA 1HWYA 3D3EA 3UN1A 4R51A 1A71A 4OHUA 4BMSA 3B70A 1PX0A 1FJHA 3IKVA 3O9ZA 4HKTA 2O48X 3AK4A 3ROMA 3IC5A 4PLYA 5DN9A 4OSOA 2AE1A 2CF6A 2I76A 3RUCA 3VPGA 2WM3A 4D79A 2NVBA 5L7TA 4D0SA 3C24A 1M75A 2NLOA 1E7RA 3N74A 1BTOA 1TLTA 2ZYGA 3NJ4A 2X23A 4Z9YA 3I4CA 1A4UA 5JAZA 3S2FA 3DHEA 3PIDA 4CJXA 3ZWPA 3S2GA 1U2DA 3MTGA 3SC4A 1KY5A 2PH5A 3TOZA 4LRSB 1Y5MA 1X7DA 2Q2VA 4EI2A 1X1EA 1Y8RA 4UUPA 4Z0TA 4A2CA 2XPCA 2YHIA 3H9QA 5DDIP 1O8CA 3LU1A 3UW3A 4WE3A 3E03A 5GZ3A 4IY1A 2Q1UA 1AUPA 4XGNA 1ZUD1 1YBMA 3RSHA 2NSDA 2I65A 1KEUA 3G1TA 2JHGA 1R37A 4RPLA 4D42A 3JQBA 3JYQA 1H6CA 3DHNA 4IDEA 4MOWA 4E2XA 1U5AA 5CP8A 1GAEO 3X2EA 5B4VA 5CAEA 5JW6A 5F5NA 3EW7A 1OI7A 2PR2A 5I7SA 1XEAA 4C4OA 2O3SA 5DZSA 1YS4A 1I3KA 2OP0A 2OOSA 2UUPA 2BI8A 3H4VA 4RLHA 3D5QA 3PTZA 4HWKA 3MJ4A 1Q2XA 4XZ3A 4TZTA 4OXYA 5KJEA 5BSEA 3A9WA 2YV3A 4RLSA 3EK2A 2TMGA 2WDZA 5A5EA 4GMFA 1KEVA 4NJOA 3MJTA 3Q1LA 1ZK3A 2Y1OA 3NRCA 4CQMB 5B4TA 1WXDA 3EZYA 3RJ5A 4BGUA 3SC6A 3JV7A 3DBRB 5AVOA 2BRUA 3C3XA 4NIMA 3NJ8A 5CHEA 3IUSA 2GCGA 2A94A 5C7IO 3WGGA 4AJNA 4BO5A 1VI2A 5KJ1A 7ADHA 4MVJF 3CPSA 1CRWG 4TZKA 2B5WA 3MEQA 2VN8A 2Y1EA 1U3WA 3E6AA 3OJEA 5JCJD 1VSUA 1YB5A 4IINA 2YV1A 4WNCA 4WCFC 1Q0LA 1LXCA 5JAQA 2AG8A 4W82A 3D4NA 3E8XA 5L40A 4RZIA 4BO2A 2HJRA 4PVDA 5BR7A 1PGJA 1MXHA 1E3EA 4G2NA 4YJHA 4I9NA 2X9NA 1MLDA 2AEJA 1IY8A 3KZVA 1H6AA 2PH3A 1HL3A 2J8ZA 3JQEA 4FFLA 5T5QA 1ARZA 4UVHA 2VOEA 4J3FA 1JQBA 1TVEA 4QXMA 2ZTMA 5JY1A 3B1FA 3G0OA 4U8GA 5CEFA 1M76A 3JQFC 1E3LA 1UP4A 3JD0A 3ZWMA 3IP3A 4E5NA 2NU9A 4FPXA 1U4SA 2JD1A 2FZWA 1FDWA 1PL6A 3F46A 3PGJA 3KLMX 4CPDA 3AM4A 1ZXBA 4IJWA 1PS9A 1J0XO 5G4LA 1ZMTA 3VPSA 4NNJA 2VYVD 4EJ0A 4P4GA 3DAPA 4GKBA 3U3XA 1DXYA 3ZU2A 4KP7A 1CYDA 1HKUA 3EMKA 1H9BA 1GADO 2UYYA 2YDYA 4XQCA 3ZNQA 5IFLA 3MCVA 4G65A 1PWZA 2QYTA 3LLVA 1KERA 3AM5A 4BV9A 2QX7A 2GDZA 4DPMA 1I5RA 2X0JA 4BNNA 3EVTA 3C1OA 3CE6A 5L53A 3Q2KA 4DBZA 2OZPA 3WTCA 3O03A 3BTOA 4P22A 4PLGA 1HT0A 2ET6A 4BKOA 4LW8A 1G1AA 4WJZA 3MTJA 1I33A 1Y8QB 2J6IA 4ZQBA 1GEEA 1Z7EA 3ROPA 2EKPA 3WIEA 1PJTA 3JQ7B 2X9GA 1BWSA 1CF2O 2P9CA 4MKRA 1AHIA 2G17A 5A9SA 3NUGA 1ZEJA 4L76A 3DZBA 5IDQA 2CSUA 5CFZA 4I1IA 1RWBA 3DTTA 4QEDA 1RM5A 4DWVA 5IN5A 4UVEA 5KVVA 4R68A 1XCBA 1ZSNA 2WD8A 4E5KA 3NDIA 5ER9A 3GA0A 2WE8A 2NV6A 4IZIA 1EUDA 3DOOA 2Q50A 3VC7A 4YAKA 1GTMA 1DO8A 3WJ7A 2QRJA 2SCUA 3GMDA 5G0VA 1QR6A 2F00A 3AUUA 3ONDA 1PGPA 1QLJA 4JJFA 3T7CA 1T1RA 2QZZA 3BZUA 5ILOA 4RPJA 2IE0A 3VPFA 2RH4A 5FF9A 2AQ8A 2VUUA 4ALMA 1Z45A 3WBBA 3TPCA 4FJ2A 3S2EA 4MKXA 3WXBA 2VWQA 4XX0A 1E1MA 1R4MA 4O5OA 3OA2A 4YJGB 5DNAA 5EESA 3QA9A 1XG5A 1U9JA 4H3VA 2UDPA 4WLVA 3RUDA 4PIVA 5B12A 4NBUA 4ZQHA 3RKUA 4FOSA 3ULKA 1E1NA 4R1TA 4EDFA 4F46A 4Z3KA 5F21A 1Y9EA 5IXYA 2FRDA 3GZNA 3KEQA 4I9HA 4BNVA 4J1SA 3WOHA 5ICMA 1Y5RA 2VWGA 2V7PA 2JCVA 4XDYA 1LSUA 3FBTA 2H6EA 4FD3A 1ENZA 1ISGA 1JA9A 4TROA 5F5LA 3LT1A 3TRIA 3ZN2A 3ZNOA 4II3A 1YL5A 2WSBA 3U4DA 1AXGA 1XHLA 1U5CA 1PJSA 4GGOA 5KJ6A 3F4LA 3TFQA 3V1UA 1MFZA 5TX7A 4IGEA 1P3DA 1JWBB 1EFLA 1BXZA 4BO7A 1B8UA 3FNFA 2X6TA 4J4HA 3E9NA 1UZLA 3H3JA 5JNLA 4OKIA 5A5FA 1P9LA 1Y6JA 1EK5A 4QT0A 1E3IA 3RKRA 1B26A 1VJ1A 3GOHA 3HB5X 4YT2A 1UDCA 3PZBA 3VHRA 5I7FA 5ITWA 1SPXA 3DMYA 3FI9A 2P4HX 1IHYA 4BNKA 2NU7A 3GVCA 1YOVB 2AHRA 1ZSYA 4J9VA 4CL3A 3QWIA 4TVOA 3CH6A 4CMGA 4ZRNA 3Q3CA 4WLEA 2DFDA 2HK7A 3N58A 2JKVA 1T2DA 3GAZA 3GZNB 1V3TA 5U1PA 3GGOA 1NXQA 5T67A 1EQUA 1I2ZA 4CLDA 1UP7A 4IQ8A 1V8BA 4BO6A 4DA9A 1M66A 3RIHA 4I5EA 1N9GB 3GUYA 4XYGA 4MINA 3L9WA 3JQGA 2BF7A 3CMMA 3C1AA 4D46A 4LSWA 1PJLA 2FZEA 3H5NA 3ZWNA 2YQ4A 1GUYA 4YA6A 1PGNA 4HFMA 4YJFA 3ZNNA 3JQFA 4CM4A 5JC8A 3SEFA 2I3GA 3ANLA 3K2EA 3IQDB 1HDZA 4WUVA 4E2ZA 3FWZA 3PYXA 3INGA 1K89A 3IJPA 4NFHA 4FFNA 1NQAO 3IDSA 5EIOA 1HETA 2X4GA 3TL2A 1YXMA 3BMQA 3GNTA 3QVOA 3OP4A 3RQSA 4XCVA 2EJVA 2IZ0A 4YT8A 2QZ9A 4O6VA 4ZN6A 1K5HA 5JDIA 4GI2A 4IXWA 1HYGA 2FHSA 4PLWA 1ENOA 1I36A 1LSOA 3OH8A 1P77A 1JU9A 4XYMA 5TQVA 1T2AA 3JD1A 2D5AA 1I2CA 5EMHA 4B4WA 1HTBA 2WTBA 5HS6A 1Z73A 5G0UA 1O9BA 1KVRA 3ABIA 4UAGA 1QKIA 5I9NA 4M86A 2D8AA 2CVZA 2VHZA 1WVGA 3B6ZA 3OQBA 4RPGA 2ZQYA 1MGOA 2X0RA 2IYPA 3RFTA 4OOFA 1LLQA 1U3UA 2X5OA 3PHJA 4RPKA 1JKFA 3OBBA 4WPGA 4NK5A 3GGGA 1N2SA 2AQKA 5DOVA 1DOHA 3GHYA 1GCOA 1C1XA 3W8DA 4C7JA 2GPTA 4ND4A 3VAZA 2IXAA 4FOOA 4J0FA 2Y05A 1CQIA 1U28A 2BFMA 1R0SA 2IEBA 3GEDA 4MVJP 4UUMA 1LDEA 4BNGA 1LI4A 2BMAA 4NDNE 5HWSA 1KOLA 4NBVA 4KZPA 3EC7A 3AJRA 4Z9FA 4KWHA 4WOJA 3ZHXA 3CINA 3LDHA 3NYWA 1GY8A 5IZCA 2CMDA 1WDMA 2HSDA 5U4QA 4BV8A 2OP1A 2FPIA 1WWKA 3JD2A 4OXNA 4U7WA 4MIOA 4N18A 4Z9XA 3TQHA 4DQXA 5EPOA 1YB1A 2WEKA 2EF1A 4OYRA 3OIFA 3V1TC 3AY7A 2PGLA 1XQ6A 4IBOA 4LRTB 5IDWA 4U5QA 1NNUA 3KETA 4DBVO 2VRBA 3VDRA 4PZEA 3UOGA 3O4RA 4Y9DA 4K6FA 1CIVA 3OICA 4CMIA 3FF4A 4GLOA 5EQFA 1AE1A 2AMFA 1DC5A 5JBIA 3A4VA 1T1SA 4YJDA 2NVWA 5TT1A 4DPLA 4E30A 4JXKA 3GAFA 2R00C 4RPHA 4CQMA 3RJ9A 4CM1A 1NVMB 1ZKMA 2VT2A 4PLVA 2AQHA 2O2YA 4I5GA 4PG5A 3GZ4A 4I5FA 3OMLA 2BGMA 4PVCA 3WGHA 1RM0A 1ENPA 5KOIA 5EJ2A 2ZB7A 3GQVA 3JQGB 3E5MA 4S1VA 2X22A 4GSLA 3KM0A 3GMSA 5ES3A 1QMGA 1A5ZA 5HBRA 2PLAA 3T7EA 1SMKA 1WAMA 4FJ0A 3TJRA 1QYXA 2AE2A 4FDAA 3ZWWA 2PZKA 4KUEA 4B4UA 2E49A 5TJHA 1J6UA 3MJCA 1A7KA 1HRDA 3D64A 3KSUA 4Q3DA 4NBRA 1F06A 1V9LA 5FWNA 1SO8A 3INRA 3ZI0A 1PQPA 1GCUA 3ICPA 4M89A 4NR0A 9LDTA 4W99A 2JL1A 3RBZA 1IUKA 1LLUA 2GNAA 3QWBA 4BB5A 2PD4A 3ZWAA 4J90A 3H9EO 3HDHA 1BVRA 3C85A 3C7AA 1P1HA 1H2HA 2DTDA 2A35A 4KQXA 4IMPA 3EYWA 4BNMA 1HSZA 2EW2A 4PGFA 4KWIA 3SJ7A 1HDYA 2GZ1A 3E82A 4LVCA 4B7UA 4CR6A 1B2LA 3L4BC 4BNUA 3ZV4A 2W2LA 2DM6A 2QQ5A 2YQ5A 1ID1A 3QRWA 4XRRA 2CVQA 4DQUA 2EXXA 2CY0A 4DIOA 3AFNA 1Z82A 4G81A 1DC6A 2JHFA 4E2WA 3ZWBA 5GZ1A 3KOUA 2V6BA 1E0DA 2O3UA 4KTVE 4XJTA 2JFGA 3D0OA 4IJVA 2LDBA 1M6HA 4XR9A 2GZ3A 4L74A 2EJWA 4RORA 2I66A 4FFPA 3OM9A
chains in the Genus database with same CATH superfamily
3ZHYA 3S2UA 1OTHA 3OOJA 5DGXA 4JJEA 3WS7A 2WTAA 1NUUA 3WVNA 2RGDA 2P4QA 1ZVKA 4OI4A 9ATCA 1X7HA 1EK0A 2R62A 4KPFC 4KRFA 4US0R 3AF4A 5AOVA 3TKLA 1OWOA 4IRUB 2QDXA 3C6QA 3FZGA 3IQEA 4NTZA 1T8UA 5EKXA 1I1NA 4QDOA 1XKQA 4NFYA 5JQGA 3GP5A 1KDZA 1WULS 1IOLA 2AR9A 3DL2A 3TLYA 5FAKA 2XMBA 1TKCA 1E5XA 1US8B 4FCTA 4CM9D 5JSUA 3KQHA 2AYXA 3TN7A 2IIVA 1KARA 1T4GA 2PJUA 2LWIA 3GA7A 4WKPA 3AY3A 4N4AA 4YDHB 1D2RA 2QUHA 3AUYA 4H15A 4NU6A 4UD6A 3UMGA 4CI0B 1J1ZA 3C8HA 4UOZA 3ECCA 4D3DA 3H1AA 3BXFA 3ABZA 1JILA 4PHTA 2CYCA 1SUIA 3CJTA 3TZLA 4M8IA 5A9RA 5TT0A 4K6CA 5JEDA 3P9RA 3UMMA 5B3LA 1BQ3A 4Q05A 3L93A 3R2JA 2OCYC 4NZZA 4O2AF 4YAWA 2VAMA 3BA6A 4BDTA 1RJEA 2L42A 4DRXB 3B5EA 1TADA 4M4SA 3SY8A 5I8PA 4EHJA 5T8KA 4BO8A 2I9KA 4P33A 3THXA 2RHHA 3W5JA 3E9ZA 3DFMA 3RBAA 2RBEA 2FWMX 4CIDA 2PJDA 2WBLC 4UPVA 1DJLA 2GBCA 3B78A 4Q3BA 1NVGA 1UANA 2A1IA 2TSYB 2D1TA 4ND1A 4O5AA 4PBTA 5I6DA 3WK5A 1WABA 2HN9A 5ITZA 1GZHB 1VYTA 3MWFA 4F5DA 5HJ5A 5T6MA 3M1YA 4JI5B 2DCUA 4GUAA 3OZAA 5HKAA 1Z9BA 2WOJA 1JMYA 1JPNA 2ZEJA 1X7WA 3G7UA 4MV8A 1H2AS 2FLKA 2ZE6A 2ETXA 4PXYA 1MH1A 3UK2A 4CMEA 2CB9A 5ALXA 2XEDA 4PZUA 2Z8YM 3OJWA 5AIBA 1YWGO 2R8BA 3K8ZA 3TFOA 3ASVA 1NG1A 2RONA 5JD5A 4DC1A 1PR6A 1R3DA 1CSEE 2P9ZA 1XRJA 1KK2A 5ALLA 3L4JA 1NN0A 4Z4EA 3UHPA 2BTEA 3GJQA 3VU9A 5E6SA 4A2PA 4DLAA 5A3QA 4AUKA 1Z2OX 1FMCA 2YS6A 3DEAA 4WX2B 2ZUWA 2Q99A 3B82A 1BCSA 2IK8A 4MLPA 4PFQA 1E1DA 5IANA 4J29A 4RK0A 1XCOA 3E3OA 4D43A 4MUFA 5AW4A 1LPBB 1P5ZB 2XCUA 4KWEA 1JDJA 1ZCAA 1CEXA 2AOTA 2XKBA 3CE9A 1P4AA 3E5HA 3P2MA 4H3KB 4KU4A 4OTZA 5DP1A 5CHYA 3GDHA 4XJXA 3PJEA 3AHIA 4NP6A 1SU4A 4ILKA 5F1KA 4R84A 2A3RA 1NQTA 1IJBA 1GR0A 4HJRA 4UU1A 1PFWA 1QIIA 4S1TA 3AVVA 3BEDA 1Z56C 2UV8A 4KO1S 3OU6A 4H7KA 4WI1A 1L5FA 3U56A 1J2RA 2PU7A 3LHDA 3B51X 1CUDA 1Z5NA 3P2KA 1ZD1A 4QDUA 4YRDA 4QPCA 5F5XA 4EFNA 4J7UA 2EEPA 4MULA 2GD6A 3CZPA 4E1AA 1BD4A 3MGBA 1O3YA 1XKTA 4HNGA 4C7MA 4HNTA 5LP6A 1YE5A 1HK7A 5H70A 2VH5R 3VKFA 4BVLA 3SQOA 2FPWA 3NT2A 3TDKA 2Z2JA 1TUEA 3WK9A 3TCKA 1YC5A 1L5YA 5AR1A 3IBTA 3LUKA 3W6NA 3K9WA 1B0PA 1QH9A 3RC9A 3AMVA 4GT1A 1PSZA 4HS9A 1ZJ6A 1ABFA 1Y6ZA 4GR5A 3AB3A 4HWPA 2GQ0A 1H69A 1T0HB 4R3WA 2LBPA 5B30A 1MO6A 3DH0A 3CVWA 4YXFA 5AVJA 3ZYCA 1G7RA 4ANFA 2CEAA 3RYIA 3A27A 4M3NA 1ZD2P 1O54A 2DU8A 3NUQA 3EN0A 1RP7A 1L8LA 2H7YA 3AHHA 4Q1DA 5KWVA 4J7XA 3OLYA 1Y42X 1ZICA 3ADPA 3BVPA 3B9BA 1L7NA 1FSSA 3CSDA 4J07A 5I45A 1DO2A 5TVKA 1L7DA 3LGAA 2FQWA 1U6IA 5DI3A 5CCBA 1NSFA 4QFDA 4M21A 1G98A 3TDNA 1RXIA 2KE5A 1NQOA 3G82C 3OD1A 4XM2A 4J16A 3LDAA 3OZIA 4A0GA 1Q11A 4XX1A 4FFSA 2EIXA 1LSSA 2X41A 1THMA 4EENA 4FGSA 4NE2A 4XH9B 2ILTA 4MP8A 3T3NA 1PR4A 3KNZA 5HF5A 3KJGA 5DK4A 2Q9BA 5SYNA 1XU4A 1JWLA 2GZ2A 1WO8A 1Y8AA 3CX8A 3P7MA 1KZYC 1R3UA 3W2TA 1DKLA 1BDJA 3EIEA 2F2TA 1LWOA 4PQYA 5IYZF 3RS8A 4KYIB 5FTMA 5CNIA 1IY9A 1OUMA 3MK31 1SELA 4K7JA 4G5GA 2HQOA 2EF0A 3M2PA 1IBCA 5ITZB 1X7ZB 5COAA 4Y9UA 4WLOA 1JV2B 3DMRA 1NP6A 3EIHA 2QD5A 4IHQA 3DGFC 1YOVA 4FFMA 4KN8A 3C8ZA 4PG6A 3EQZA 1ZOPA 2H2WA 1A8UA 3PEFA 5J4YA 5CLGA 3DQPA 2R00A 3CKKA 4XQEA 3T4UA 1PKXA 2MINB 1CG6A 3RC3A 3FM9A 4DGSA 1ZK0A 2IOFK 5B2EA 4UM7A 5EYPA 4ZOCA 4IOKA 5HQTA 3D43A 4R2IA 3ZJ4A 1ZHOA 4YPOA 3I0MA 1PR9A 3O0TA 2C1XA 5E3IA 3TGWA 4W9NC 1NX6A 5FJIA 1HL7A 1YI1A 1GD1O 2CXOA 2RMKA 3D5TA 3K0FB 1NW7A 4B6SA 2D1QA 2HKIA 1YBAA 2ZAIA 3AG6A 2IRWA 3EQ7A 4QXAA 1EE2A 3PRJA 4XXHA 3RVPA 3NMUF 1ES9A 2HFJA 4POOA 4YJFB 4NPAA 1T2VA 3F5DA 4N5NA 1FYFA 3SU8A 1AA6A 3KYJB 2O0LA 2X0IA 4WCVA 1G291 1ZWLA 4HWGA 3ZZNA 1PDWA 4ENVA 4V0ME 2WYWA 3BD6A 3THOA 4WJLA 1JX6A 5EXPA 4DKJA 3OIVA 2YKGA 3A04A 1WUKS 2YFYA 1XZLA 1BEUB 2V54A 5JANA 2QM7A 3WTBA 5T8KC 3F2IA 2X58A 3BUSA 4RZUA 3COSA 4DDTA 5JS6A 2X2OA 4QD3A 2ERYA 2ZE8A 3W5BA 1BVUA 2FW1A 1BXGB 3ASYA 1X70A 4YRPA 2GCEA 2IPMA 2W9XA 4KQEA 3OX3A 3SCZA 1U3FA 3VO1A 4F5ZA 5FX2A 4Q3LA 4TYNA 3U4QA 3GQBB 1RYYA 2FKAA 2C88A 3B9QA 1GFIA 1BFDA 3OF2A 3ZWVA 4M1OA 4DLSA 3TSAA 5KB3A 4B6JA 4JIGA 1SPBS 3GRPA 3Q6MA 1XR3A 1KAGA 2X9LA 4G1MB 3OI7A 3SFTA 2NU7B 4RV9A 1PG2A 5EZ5A 3T5BA 3QE3A 1L4UA 2FLWA 4JQYA 3SFVA 2JJ2D 1SKUA 1L7OA 2VDWA 5IAOA 5LMNB 1YA6A 3GT0A 1NF9A 1R18A 5KOHA 3HJBA 2NZ8A 2Y1GA 1JQ3A 2HADA 2VDRB 3E84A 5CEEA 1G18A 1XZFA 4JUAA 3U81A 2SHKA 2H8GA 1BMQA 2ISQA 3NG1A 4LHWA 4B73A 4BDSA 3EEQA 3MWLA 3QYPA 2H4JA 1MW9X 1QVAA 1N2ZA 5GZ6A 5JH7F 5EWMA 2GR9A 3BQNB 4S2UA 3KD2A 4NPHA 4QE3A 4YBRA 4O59O 1I0LA 1WCIA 3N2KA 2JGEA 5D5HA 1JSRA 2CHQA 2OFPA 4AX4A 4DC0A 3G68A 3CT4A 3E9MA 3E7DA 1U8TA 2PGXA 3WLIA 3AI1A 1IM5A 1N7GA 4V24A 1OBHA 4MJLA 2YHIB 1PAUA 5HUHA 3ZG6A 1DBQA 1E6WA 3H9JA 4MQ5A 1H2YA 1FTYA 1VZ2A 3V4PB 3UH1A 2DFNA 4NYJR 4TT8A 1U2QA 5LZ7A 3K70B 4WJKB 1MVLA 3LHIA 1Y3IA 3I04A 1IBLB 1X9IA 2H1RA 2QG6A 2X1HA 3FWYA 4UFOA 5AVYA 1OH8A 1NZJA 1LZLA 1XTUA 3VSAA 3GARA 3MM4A 4XFKA 4X60A 2O06A 1YKGA 3AV3A 1JDTA 2O3RA 2Q1WA 1M6VB 1HQKA 1KIFA 1TK2A 2BEJA 2WIKA 3KHTA 4RHTA 1QUFA 1Y1TA 3LC2O 3C1UA 4BMZA 4BU1A 5BVHA 3WKBA 2BE7A 2HIMA 2RIRA 2RGEA 3HE3A 5BV8A 2Q2OA 2WKQA 3NH9A 5ULLA 1KZGB 1VJTA 1Z36A 2C7VA 3TL3A 3RSQA 1TPZA 5JMPA 4MUKA 4B75A 1R5BA 1I1QB 3ZQJA 4R2MA 1KC3A 1KFBB 3PNSA 3GCGA 3QUTA 5A5VA 4M9UA 4CKZA 3HDGA 4R54A 4ND3A 3VR2A 5BSKA 5F12A 3IHWA 1S3SA 4I1PA 1ZLXA 4G67A 1TM1E 1HFJA 2HGSA 2WWRA 4OMFG 4UHFA 2N75A 2XNDD 3OBIA 2O7RA 1IHPA 4I81A 3RU7A 5A7GA 2ATVA 2FG6C 2O14A 3DAOA 2P0AA 3LVBA 4JGIA 3FPGA 1LI7A 1EX6A 2Z56A 5CLIA 5EMJA 4AJ4A 4B45A 4DWWA 2HU2A 2I9PA 1WKCA 3IRUA 5AW8A 3W2GA 4A8HA 4X62B 2BR3A 1XQXA 1ZN7A 2LP4Y 5CVUA 4BNYA 1QK4A 3QLTA 4OFXA 4WY8A 4YB8A 2IWHA 1DEXA 3G02A 4BNWA 1KK1A 1UMDA 3DVSX 3M1AA 4BX3A 3DWFA 4FB4A 3ZBTA 5IVPA 3IULA 4WBNF 1UOEA 4OFZA 2OHFA 4LJ8A 4ZMRA 2WJYA 1P60A 5A4MS 3PQ3A 5F33A 1DARA 1UR5A 4FR5A 1XO1A 4QVIA 3TBHA 2VHTA 1GUDA 3DE7X 2OBMA 2AOUA 3L0BA 4NS4A 2B78A 4OHFA 2GEUA 3W9UA 4EFMA 3U5ZB 1CUFA 2FSGA 2HMYB 5DHPA 4BQFA 1Y9AA 1JVSA 4XFJA 4IV8A 5C2JB 3K0KA 4EO9A 3ZGXA 3JQ8A 1ZLYA 2E5WA 1KMHB 3OZWA 3UY4A 1NVFA 4YN3A 2UZ0A 2W4MA 3EBLA 1H23A 1U0SY 2ID8A 2QRVB 2W2LD 3FMFA 5A7HA 5C5IA 1N7HA 4CM3A 4IMJB 1ESMA 1X42A 2R6CA 2H57A 3AETB 1P1BA 1JZQA 3KSBC 3D3NA 2Z3ZA 1KXJA 3ZWQA 3RFUA 4L73A 4L6CA 4P4SB 2YJ4A 4YFVA 3R7NA 3ZD9A 3AYXB 4OOEA 1GG2A 1GN9A 1GAXA 2QW1A 3PXDA 4IGIA 1E61A 4IXTA 4PLHA 5ISMA 1JFFB 3BH6A 4D2IA 3O94A 3BS4A 4J1TA 3CUYA 4FMPA 1QH1B 5CDGA 5CMLA 1C3OA 2WU8A 1XTBA 1W87A 1O4VA 1Z4MA 4HG2A 4UPEA 3I9NA 3RAPR 5FPQA 6LDHA 1AKEA 3ORFA 3IMCA 1LBIA 4M8KA 2ODEA 1W7AA 1JEAA 4YMHA 1JKIA 3EC2A 3KKLA 1CXZA 3QVSA 1RRFA 2YWJA 1NQXA 1NVBA 2ZB2A 3GGPA 4UEWA 5KAMA 3ZV6A 4BBJA 3BAFA 4RVDA 4MI6A 1DBWA 2O8EB 1KZ9A 3OOHA 4ZOEA 4IHJF 1PZXA 4HTAA 5TLSA 3LSTA 3BB1A 3CHYA 5EHXA 3U17A 4Q34A 5IF3A 4R9RA 1DTWB 3MCTA 5KYKA 3GN1A 3Q7TA 4LX8A 2BY4A 3V1MA 3DKVA 2L19A 2B1RA 1KY4A 1U0EA 2RARA 1BE0A 4PIPA 3URKA 2WTUA 2O2EA 1HRKA 2FB9A 1RWMA 4PAOA 4YK7A 5FI5A 2NQTA 4MI9A 5D3QA 4JS0A 1YZ3A 4LGVA 5JNWA 2YZNA 3NX4A 1KJIA 2OXFA 2YW2A 3KL4A 4G84A 4MKGA 3TM5A 5BW8A 3EEFA 1J24A 1M34A 1U7WA 1IHXA 4OV6B 1TEVA 5BUSA 4TKLA 1VLMA 2ATXA 2UUCB 1OH5A 1KDOA 1Q91A 2GK7A 2QA5A 3KOXA 4GX0A 4KSBA 5ALGA 3SX0A 5HZKA 1KA9H 3LSYA 5JTUA 2O0JA 2C59A 2R5FA 3QU4A 4YRFA 1QNFA 4WZBE 2Q28A 3HUFA 4ZAWA 3V1LA 2RKWA 2P7IA 4IEFB 3GFSA 3MC1A 3T4PA 2WJAA 3ZHBA 4N5IX 3ILVA 5TEWA 1BMFD 2B2CA 2VJBA 1GDTA 4E5SA 3CEHA 2VUSA 5EP2A 4PSKA 2WJ3A 4CFZA 1A27A 4ZQCB 3AQ4A 4ZCLA 1C7QA 4EHNA 3FSJX 4YONB 4OL9A 3W5CA 4XWWA 1DUVG 2VO1A 1JEOA 3C70A 3RARA 3FG9A 4AKTA 5B2FA 3KKZA 2AW3A 2HDHA 3GYBA 1DTSA 4KFCA 4AKIA 3D3QA 2IDMA 4PWZA 4RPCA 1WDKA 4Y98A 1ODTC 5FRDA 5JY6A 4G0UA 3ZY2A 2PX0A 1BMTA 3OFNA 1XF1A 3N6RA 3IKMB 5AHXA 4EBFA 2JJYA 3HN2A 3TRHA 2V1UA 1DQSA 4IIYA 4BVKA 3U09A 1TPYA 3R20A 1OYYA 2VTKA 1SAYA 5D01A 4QOEA 3SMVA 1XPUA 3EC1A 1YJQA 3L1JA 5FTNA 3K9LA 1AIPA 4JITA 3PJRA 1V2GA 2I71A 2QAGB 2UZAA 1BFKA 5IYZA 3K9FC 3HACA 3IR7A 2YL2A 3D3WA 5B5SA 1JHAA 1DAGA 1XCGB 1XMSA 3K5HA 3GJ0A 4XD7A 2QEQA 4DJJA 4EZBA 2X5JO 4AXBA 4CQLA 3AO0B 2W5UA 4ZGGA 2B35A 2DECA 4R8SA 5LQNA 2HSWA 2J9YB 3DZDA 5FBKA 1YJ5A 2CDRA 3NHUA 4GLLA 1RJ9B 4TMYA 1PBNA 4Q7LA 3BF7A 1R8YA 1ZD5A 1SXPA 1JHPA 2C99A 1FSZA 2O2XA 2Q7DA 5BW5A 1AC5A 1YH3A 2J0EA 1DQNA 2NU8A 4CXMA 2VYCA 5LDGA 5CVTA 3VHQA 1UOOA 4E5PA 1BFUA 2FPOA 3V8EA 1BS9A 2N47A 3GFPA 1ECFA 1RAHA 3QQ5A 3WYAA 2WNHA 2E9SA 3LP5A 3FW1A 4LZPA 4RFVA 1GNRA 5KTTA 2HMSA 2J0UA 3LPDA 3EGOA 3A4LA 3QFRA 2IPNA 2W2VA 1OHHA 2WD7A 1JQEA 4LSMA 3R9XB 3W6ZA 1ZVVA 5BMVB 3A7EA 3HRIA 4HH3C 4BIIA 3LPMA 2VQSA 4EHBA 2I33A 5EVCA 1E1QD 3DBHB 3GIDA 4TOIA 1Q7BA 5LA6F 2ZBVA 3KBOA 1J2EA 1E0JA 1QF9A 2HXGA 5DEIA 3UVEA 4ZTUB 3O9MA 1PL0A 4D4GA 3VA7A 2DMRA 1CETA 3DO6A 1TYBE 2AKEA 3AEQB 4FUQA 3AUFA 1SU8A 4EKYA 1JHOA 1E64A 3D0QA 5IDYA 3RYFB 4JP2A 3MTEA 3K5PA 3R3UA 4DCMA 1V6AA 2MSDB 2FN4A 4FE7A 1ISMA 3QJ5A 4K88A 4O1IA 1ZRNA 5DGDA 4AZ3B 2P6UA 3KFVA 3QIVA 1NU8A 1F1JA 5LC1A 3NBQA 4GP9A 3T3MB 4O1HA 1J8YF 2FN8A 4YP9A 4A3SA 5MN6A 4DV6B 1RPNA 2EDAA 4LFCB 4AMGA 5HNKA 1EXDA 4D92A 5F78A 3ZE1B 4C2BA 4U7JA 3GDFA 4DIEA 1Q22A 1XTPA 2WIAA 1DOZA 1NMSA 2ERXA 4GYYA 4TSFD 4BJ1A 2OZLA 3FDZB 3H2KA 1OGIA 1IRXA 2OE2A 3FNBA 1YVEI 4PYIA 4BP1A 2AI1A 3IX7A 3KLOA 4KXYA 1WSDA 3PT5A 2ZT8A 1TI7A 3FHCB 2FRXA 1BW9A 3JQQA 3G5AA 3G1UA 3I9FA 1FNBA 2DY0A 2JCXA 3O8NA 2XOKD 3R77A 4LK2A 3TE7A 4EYKA 1VJDA 1YNOA 2B4RO 2JA2A 1TZKA 3AZQA 1YVRA 3T9DA 4ED9A 2GLXA 2YNMC 2A4KA 3PPYA 3TZ6A 4N39A 2Q8PA 1IIBA 3HNOA 4HP8A 1VKJA 4Q9AA 2Q1SA 1VG1A 1UWVA 1XDWA 5IT4A 2UZ1B 3VC2A 3LMKA 5ERGB 2JFBA 4C5AA 1NULA 1YKFA 4KTTE 5IEJA 3FFAA 5C8ZA 3ETDA 4FYJA 3R5TA 5ADVA 2JB9A 2Z2XA 3HXTA 2IL1A 2ZU0C 4B3IA 3OKAA 3TD6A 3ZWYA 1A9XA 1M9NA 2HK6A 1Q20A 1R0LA 3F3MA 4RQUA 1XBTA 4UARA 1YRBA 4QJIA 5DT2A 4XQ9A 4D74A 1J8MF 1UKBA 4KQJA 1V1MA 1JT9A 4TGLA 2AZDA 4RTPA 1JFVA 4IIJF 3ZDAA 3Q3GE 1M0WA 4MLDA 3PGXA 1KRXA 1BHO1 1NASA 2CD7A 2PYIA 4EP1A 2ZLBA 4BHTA 3O3CA 1T8SA 1V35A 4L4ZA 5AHWA 2AR0A 3LD9A 4KPGA 3B1KA 3MBOA 4A36A 3M81A 1CQJA 4KDEA 1CY8A 3D2AA 4MKIA 4CKWB 3L49A 4DQLA 3O84A 1X80A 4INAA 5TPZD 1KJ9A 2B5OA 1XTZA 5FT9A 1TTTA 3DSRA 4RVNA 2OFFA 2ZRBA 2R7NA 1NI4A 3L7OA 3LLMA 3D2BA 2J4CA 2QX4A 3NVDA 5J43A 4ND8A 2N42A 3IOMA 2ETVA 1SUBA 3RHFA 2X7HA 3VZDA 3WYDA 4YMTA 2YY6A 4MR8B 4XSGA 1XXLA 5KTOA 4UVDA 1IPEA 4Y1EA 1C1XB 2HF9A 2WIGA 4ZEWA 5IUJC 5DX0A 1NOJA 3T7TA 1J56A 3GFRA 4G1FA 1XRRA 4P7GA 2AOXA 5LWQA 4M0FA 5FTLA 2C2YA 1S2OA 4GR9A 2YNMD 5FFFA 3TVDA 1TFRA 1WUIS 4IO0A 2BGUA 1PJ4A 5D51S 1VKHA 4C1BA 4DGQA 4X1KB 1B8NA 5FWYB 3FOEC 4K1LA 4Q24A 1L4LA 1NSYA 4KMOA 1TVKA 1R5JA 2WHQA 4R0NA 1E9DA 1E5QA 2V9PA 1IL0A 1I30A 4ENSA 4ITUA 1XEXB 3HWX1 4DBLE 2XYRA 2IYAA 2YC4C 4EPVA 4Q4LA 1IUOA 4X3OA 1Z08A 3SZLA 3MJVA 4C0LA 4IIDA 2DQYA 1EFKA 3ZDZB 3KYDB 3QVGA 1DP4A 4B6EA 2QLLA 5KEIA 3BERA 3PFGA 4DY6A 2A1UB 1X8KA 5EJEA 1K98A 4D3ZA 3JCZA 2A0UA 2OORC 5F2KA 1GSAA 1JPJA 3N2LA 3ZY4A 1QG0A 1PZNA 3E1SA 4ZZ2A 1VXOA 1QANA 3FCEA 4PV7A 3PNLA 1XTRA 3FDIA 1YCGA 4HBGA 4DLBA 3IPYA 1TUBB 5E4TA 1N2EA 4J0IA 2OAQ1 5LQKA 4KR6A 4W7IA 5JD3A 1WUJS 3NGMA 4GAEA 3WDSA 1NXOA 1SCQA 4I3HA 1FZTA 2P2SA 1ADGA 4OD0A 3UPDA 4IFEA 2EKBA 1E3WB 1RLUA 2EFGA 3G5MA 1UPFA 1GZ6A 4U9HS 1CY2A 1CUUA 1EXMA 1Q0QA 2Z98A 3GFQA 4MVJI 4MS1A 3JASB 4B31A 4EJ6A 1MOSA 2NO6A 4LK3A 5F3DA 4EQ6A 1V0JA 2VHWA 3NTLA 2FJ0A 2WFLB 3G9TA 1T5HX 4OGKA 1KS9A 1T9GR 3FYTA 4WOPA 2QYSA 1IVYA 3VHXA 3ZGYA 1QVZA 1MO3A 2GF2A 1YS9A 2PH7A 1YO6A 1PNVA 2BFCB 2EZ4A 2GYYA 3G8CA 3I2JA 3RG8A 2W6NA 4GVLA 2EWVA 4AP6A 5K3FB 4NF2A 4C4AA 2XUFA 4OHXA 1K86A 1ZU5A 2OILA 1MOPA 2FSSA 3CY6A 1AQYA 2JIZA 3NIGB 1V25A 2PRZA 4OI2A 1UC9A 1RJWA 1J90A 4DE5A 2ST1A 4KUHA 1ZM3A 2PUWA 2A0KA 3KLPX 4YMGA 4EO7A 5C5DA 4D25A 1JFSA 5ESDA 3JYNA 4RZHA 4KLAA 1VL8A 3WQBA 3GFFA 3UJ7A 1QGZA 4U5XA 4HPJB 3TNYA 3TXXA 3PHGA 3PNVA 3B6JA 2OGTA 2XVXA 4NJMB 4WWHA 2OCDA 1U8XX 3KYCB 4XLTA 3W04A 1LK7A 1DOAA 1CLEA 1MJGA 1HYEA 2VF7A 3BE6A 3CNBA 3R41A 4FEGA 4ROSA 1CU1A 1J8VA 3ES9A 2G7MC 2FSVA 2VJKA 4I50B 4N5MA 1NI5A 3E9CA 3MTQA 4N40A 4W9NA 3A1EA 1F4PA 3EFBA 2NVUB 2FH5B 3U5TA 3HL4A 4F5EA 4WACA 3UNXA 3PSHA 1GV0A 2D0IA 1A9ZA 5PNTA 4IWNA 1A98A 3BB3A 1V9SA 4I50A 4CT0A 4DSUA 3V6LA 2ZS9A 5LQMA 3WP0A 2VK4A 4E46A 1LRKA 5TMPA 3RIMA 3ETCA 1E99A 5TF4A 1H42A 3TZQA 4KYVA 4COKA 1PEDA 3TX2A 4UATA 2XGGA 3LT5A 3RUIA 3WA6A 1P8AA 4RXTA 4Z51A 1AS3A 1H9AA 4QX6A 1NI4B 1DKNA 2AXQA 2BMFA 4P98A 2PAFA 4YQFA 2K7ZA 1KFCB 4G4IA 3V4ZA 4O0LA 1L7BA 4EY5A 4EGFA 3FWNA 4KR3A 1P7VA 4X84A 4IQGA 3DA8A 1SBNE 4QRDA 4EUSA 1H3EA 4WK4B 1RABA 1Z68A 3PQ6A 1F0PA 1XOIA 3EH1A 4N65A 4GI1A 4MW4A 3GU3A 3LT0A 3QLUC 4WTOA 3NI2A 5KMGA 3KL2A 3GA5A 1V37A 2EX1A 2DHEA 2FPLA 4ZO9A 4KOEC 3N70A 4JIMA 3REQA 5BV2P 3GAMA 4QFMA 2B4AA 2DFLA 1ELOA 1I13A 1EDZA 3P9PA 4JGBA 3VDQA 1W29A 4M0UA 5A1JA 4AS1A 2WM2A 1YACA 3NDJA 2GFQA 1PTJC 1GP2A 2PUVA 4M0CA 3I45A 4MYSA 1KJNA 3VVLA 5I01A 4Q4DA 1FPMA 3DEJA 721PA 1VJ5A 2XA1A 3PFHA 3GCXA 3DOFA 3FCOA 3DTVA 3H11B 4J0GA 4NEHB 1CB0A 1CUWA 4QXRA 2AVDA 2JBAB 2XJ4A 4CUZA 1TW3A 2Z4RA 1ZJYA 1G3IA 3PWKA 5KVAA 3ET5A 3EEBA 2OT3B 1QWOA 2ALJA 2CCKA 2O50A 3UJAA 4PF1A 5EQDA 4Q15A 2X3YA 3KXKA 3ND6A 3QTBA 5EC8A 4D7AA 1WSWA 3CRQA 1JDUA 2A0FA 3LJKA 1SQSA 4IIVA 3CX4A 4Y8VA 3DZFA 5EL0A 3RYHA 1GLGA 5E1OA 3FLMA 3RE1A 1HG0A 3K16A 4PHHA 5AUPB 5MFPA 1HI9A 5L51A 1SU6A 2XHEA 2B92A 1UXKA 4LJYA 2G5PA 1JFTA 3C5WP 3TMKA 5A04A 1Y1SA 1CS0B 1PEKE 1KSJA 1UPUA 4PANA 1QIJA 1W0KD 1BQ4A 1FW8A 2W2KA 3NKFA 5B53A 4ISCA 2G1UA 2WINI 2D3TA 1Y5LA 3CZ5A 3OESA 2WU3A 1FYWA 1IDOA 2LDXA 2PL5A 2R6GA 3HPRA 4HDQB 4HRAA 4MR9A 1B16A 2CB0A 1R00A 1IJKA 3TJZA 5IC4A 3GRCA 4F2DA 3FYHA 3PA6A 4NFSA 4B43A 4KODA 3EDCA 3PEUA 4NBLA 2W2OA 4EZEA 1ZW1A 5C4MA 3X44A 1IBMB 4EG6A 5JHHB 1H65A 2B36A 1FMFA 3WLNA 2YRXA 5H4HA 2C4HA 1IE3A 1N75A 5BSMA 5HFJA 1Q83A 2HJVA 2ONKA 3A4IA 4YTEA 4MQUA 1H22A 1GPH1 3G0BA 4KIUA 3ZQKA 3FTQA 1UPXA 3R5JA 1VMDA 3KKEA 4UNIA 3LZDA 4X90A 2QSUA 3THYB 2H7CA 4O33A 1Z74A 4QU5A 2W8BB 4JVNA 3ZDEA 1IY1A 5EJ6A 1KH3A 4N7MA 1RWWA 2QRKA 3COVA 3PLNA 4PPGA 5LWHA 2QNBA 3ABRB 5IU6A 3GLGE 4W5NA 1C0IA 2COKA 2CVPA 4JD5A 4RA9A 1YQDA 2MT9A 5EZYB 2D0PB 3UPTA 3P9SA 3NHLA 4JOBA 1ORVA 1CIPA 1P33A 2YVUA 3CS3A 3EFEA 1YQTA 3OG9A 5EJFA 5LDDC 1I7DA 2GM4A 1NR7A 1Q0PA 3IVXA 2PRKA 1QU3A 3T5DA 4O08A 4RKFA 3EXFB 4EUNA 4F8JA 4FB5A 3FA2A 1KQNA 2VT6A 3V48A 3EF3A 3CN9A 3GV0A 2I2AA 1WPXA 4DUGD 1WZIA 3NATA 2J5KA 3CEMA 2Y1FA 3A1NA 3BRQA 5KC8A 4IYRA 4DA7A 1Q7EA 5GJCA 4I6JA 4J2OA 4JOQA 5AKKA 5BQFA 2AUTA 1AV7A 3KLNA 3QBTA 3SBDA 4B6RA 2IOFA 3OOSA 2DB3A 5KNDH 3A37A 4HN9A 4WBSA 5DRYA 3FJ1A 5JASA 5KQLA 1L5RA 1ZK4A 1XC7A 2C42A 1RQ2A 3DEIA 1MPTA 4PR3A 4XJVA 5IZCC 3WR5A 3W1VA 2R1TA 3U4GA 1N5MA 4P5EA 1M2VB 2ZB4A 4HYYA 4ZARA 3JALB 1VECA 1NMQA 2C3MA 1W5FA 2ID7A 1YULA 2YWXA 2H2DA 3IDFA 4HLQB 3R1IA 4UD2A 5LA6A 5JDCA 2C4NA 3GRZA 3OO1A 1YUBA 3K32A 1V3QE 3PXBA 3A9VA 2ECKA 2Z6VA 4KZKA 4L9RA 4U9UA 4QO8A 4U1RA 2ORYA 3WWOA 4POAA 1SA0B 4IIGA 1MU0A 2GPYA 2FUG1 3MTDA 2REQB 4MEJA 4RDXA 1CKEA 3CGGA 3FCXA 4I9UA 1PUXA 2IELA 2IXGA 4RU1A 2F8MA 3DTVB 3N8IA 4UC0A 4YBZA 4GD3Q 5AK4A 1C81A 1DAMA 1DC4A 1WZUA 1D04A 2P6NA 3C7DB 3KB8A 3IVCA 3MS7A 1NOIA 4L8FA 4MYTA 4CODB 1ZL2A 4U6QA 1DVRA 3CUTA 3ZPXA 1HZJA 2X2PA 3ER9A 1S0UA 2I2XB 3CLRC 4ZRDA 1I51A 3U7EB 1CUXA 2BI7A 3FR8A 5DSXA 3SEZA 1E9RA 5KQRA 1NWHA 3U9LA 1DELA 1DJNA 1W581 1Z3CA 1Z6AA 3I3OA 4OM8A 3WIVA 4LQDA 3PNQA 5DV9A 4EG3A 4K6GA 4RUKA 5DI3B 2P6MA 3K5IA 1RE0A 2BMWA 1ETHA 3QUSA 3DAGA 3QUCA 5I9MA 4DQ0A 4FIZA 4YIHA 2WICA 1WTCA 4HSGA 2MSLA 4CKCA 3FPFA 2WJ6A 4N8SA 3M4YA 4C0JA 4NZOA 2B69A 1B42A 3DOCA 2XWJI 5K0ZA 3AFHA 1HDXA 3I83A 3MW8A 4YLGA 5KCZA 1BROA 1RKQA 4ZO4A 3JWPA 3BSFA 3SK0A 3WNBA 4BMPB 1P7PA 3VVCA 1AKQA 1EEHA 2XV1A 1XEXA 1C50A 3LUCA 4A0FA 4ZK6A 4PSVA 1ZQ1A 1OLXA 1RAIA 2GWHA 4Q9LA 3W2IA 2DWCA 2R2GA 1GGFA 3I0ZA 3H5RA 2X0NA 1GDHA 3FKQA 2HBQA 1EQ2A 1HFKA 4LWZA 5KS2A 3HDTA 3EGDA 1C14A 1CUHA 1E7WA 1E89A 2DGDA 2H48A 1Y3HA 2HA5A 2JW5A 3P97A 1JWAB 4CVNA 3M6IA 4EHIA 1H1TA 3LRTA 3N76A 1GNQA 4DFDA 1B15A 3B7PA 3LBAA 5AJWA 1CUYA 1K7XB 3K30A 2Y99A 2O23A 3ROXA 4NU0A 3A6FA 2C04A 1P7ZA 4L5IA 4JGGA 5HOQA 5AKIA 4MUAA 1YZFA 5ALSA 3ZVLA 3ZU4A 1T1EA 4CDMA 1SCNE 1G0OA 3QLVA 2J09A 3HWRA 1TTQB 2HF2A 2OY0A 1QB7A 2BKXA 4XPZA 2PNJA 2IV2X 3G23A 2XBLA 4JXJA 3GRYA 2AD1A 3F78A 3NTQA 1NBMA 3IIJA 3OLWA 2VRCA 1P1CA 1VL1A 5EZYA 2V5VA 3ZR4B 1F12A 1G17A 3AOGA 3B7WA 5FKJA 2VPQA 3HCWA 4JBNA 3FYUB 2PKCA 3IMFA 3WL8A 3AVQA 2QVGA 4H7DA 3JPWA 2OHJA 4CIVA 2FR8C 3VPBA 1AXRA 4O25A 4TLBA 2H1HA 3PDUA 4Z7JA 1GNTA 2AJBA 5AVQA 4BNHA 4LY6A 4FE4A 2QMQA 3VJRA 1YUNA 4Y2PA 1YRLA 4L02A 3HN7A 2WTMA 3N5CA 1PX2A 5DP2A 4ZI7B 3UB2A 2Y0CA 2FZ5A 1Z0FA 3V3TA 1X1CA 2HSGA 4ZV9A 1Q17A 5CTAA 4X66B 1FSPA 1N3LA 4DLRA 1NW9B 4GPEA 1AV6A 2V0NA 3ESCA 4DRYA 5LXTF 3WY9A 2FEPA 1LBQA 1Q16A 1C7RA 2FPSA 2N3ZA 2O7SA 2C7BA 5IBRA 3URMA 4LBVA 4UTPA 4KR2A 2OM2A 4NNOA 1GPLA 1UXGA 5G4KA 1E1QA 3SQDA 4G5XA 1PGOA 3MTBA 1FNNA 3RS7A 1CNMA 3KQLA 2Q2WA 1QUEA 1E79A 4GRAA 3WL6A 4DXHA 1NQVA 1NBME 1W52X 1QC5A 2R8OA 2YN0A 4F38A 1DWPA 1M2FA 1RVV1 1AUOA 1AQLA 1TZ2A 3UENA 4Z53A 2XR1A 3ZH9B 1D2EA 2NNWB 3TLMA 1GYQA 2LE0A 3CVUA 1PGQA 5LP6F 4B7CA 3EFOA 4R1UA 3TCXB 3ELUA 3DDCA 4QBIA 5ALOA 4DQVA 2ZTHA 5ALUA 4R8MA 4DLLA 1I3OA 1GQFA 1VKOA 2I29A 1V9CA 1QNLA 1KDYA 2FQ1A 3ADOA 2ZYDA 3C4JA 3FHOA 5K09A 3E22B 4KI7A 4O4IA 4QEZA 1RZUA 5D84A 5IM4A 4QSMA 2XB6A 3HBAA 1T0BA 1ZNWA 3BWXA 2XXJA 3NUZA 5E8RA 3KDPA 1NC3A 5FBLB 2HQ1A 4J6EA 4MW9A 1B23P 2FMHA 2GRUA 4WUTA 3U7IA 1QRUA 1OH7A 1DMSA 3RAJA 1HDRA 5KOJA 3U9TA 4HPXB 5IT9A 1QG4A 2QB5A 4E5DA 2AD5A 1EKXA 1R8QA 3IQGX 2F9FA 2BHNA 2OXRA 4HNRA 4D9JA 4ZTZB 1N2CA 2RSLA 4UBLA 5AJXA 3AUXA 2LNDA 4ATNA 3V9AA 3LT2A 3UFBA 3PVZA 3E5NA 3UV3A 1O97C 1T13A 2X1LA 1I7PA 1JZTA 3ENWA 2FRVA 1RQRA 2QJOA 3DVRX 3ROZA 1BIFA 3GRAA 1RR6A 2WSSA 4R6XA 3QYAA 4XCQA 2P2GA 2PX6A 4P08A 1E4EA 3WIOA 3RVOA 4I4LA 3L18A 5A1TA 1T5OA 1B8OA 1ODFA 1U7HA 4JSRA 3GUVA 1YASA 1AGYA 1WSAA 4DXAA 1M7GA 5FA5A 1NJ5A 2Q6IA 3ETGA 1Q0HA 1SKBA 3EIOA 4P7BA 4P3NA 1I0IA 4X6LA 5D3MA 1NWCA 2HZBA 1E7SA 2FZVA 3K8QA 1RC0A 2G40A 3N8KA 3HNPA 1FVHA 4FHZA 3PUHA 1SU7A 4RVSA 1H6BA 1IM8A 2P5TB 4L08A 3FROA 3ZOKA 4D9FA 4F60A 3TG8A 5HKBA 2AZMA 3CW9A 1Z5VA 1H6DA 2VI5A 3DVLA 1DB3A 2ZIZA 4JQCA 1RM4A 2A9OA 3HL0A 5P8WA 3KIPA 1MX5A 2HOQA 3EZ2A 1MUUA 2FSUA 4I50F 4EF4A 3B3GA 3R7WB 3C97A 2ASVA 4G1EB 5FL7A 3VZPA 1AB5A 4QTXA 3MSCA 5CBKA 1PVOA 1OXTA 3SEAA 1KH2A 3NHBA 3V4RA 3VH4A 3AEUB 2J5QA 5EJAA 2BEUB 1A50B 4N0DA 3NT4A 4MICA 2AF3C 5IW8A 4CDGA 5DBIA 1QHHA 3VR3A 1JYEA 2PGIA 4D9CA 3W90A 2BGKA 5KTKA 3SQWA 1USWA 3OFVA 2WWFA 2RCYA 4WN3A 3SM9A 4ARUA 4CGZA 1WW2A 2H0RA 4WXPA 2PQ2A 5CAEB 2ZJAA 1BNCA 3EQ8A 4R1OA 3ZX5A 3K71B 2PYZA 3HUTA 1DBPA 4WBNB 4EMUA 2OV8A 4TZ6A 2JAHA 5FNVF 1AKTA 3K0BA 3AONB 1A5SB 1GGJA 2FTKE 1JHXA 1KNQA 1EGVB 2PSFA 5IM4F 1Q2UA 4D4MA 4ZTBA 4IDAA 5FOWA 2F43B 4NONA 2QROA 4G56A 1RNLA 3NDPA 4GI5A 4JBWA 3GJXC 4H0CA 1Q1NA 2A0XA 2NTJA 2B37A 2W2NA 2XTZA 1PSDA 1JEQA 3CG0A 1KPGA 1Y80A 2QRQA 1LQ2A 4HMPA 2JANA 5E0KB 1K6EA 2XDQB 4BAGA 6REQB 1OX6A 2ZI3A 1GPAA 4ZP1A 3ND8A 1PSWA 2QJFA 3AETA 3HVJA 3NORA 4XM1A 3BFPA 4RA9B 2ZUTA 4O8ZA 3GRRA 3KPVA 4MVCA 2JFPA 5FBZA 2ZIAA 6REQA 1AH2A 3D59A 1Z4IA 4LPKA 2FSIA 2L17A 2I99A 3N86A 4U2DA 4OQXA 3T5AA 4N41A 1FF9A 1SZDA 5DWDA 4FHDA 4FT2A 5BO5A 4A03A 2NU9B 3TECE 4D98A 2FEOA 4EABA 3VDNB 4DDHA 3EXFA 5DIFA 1PVVA 3TQRA 3AM3A 3OTIA 4K26A 4NBWA 1Q15A 4RJJA 2C77A 1U65A 3S8YA 3PGKA 3RVMA 1M7HA 3I6IA 1C0PA 2PZ8A 5H1YA 4A6PA 4YAFA 4QT4A 5C51B 3ACBA 2WB2A