5MFPA

Human sirt6 in complex with activator ubcs58
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
289
structure length
282
Chain Sequence
b'PFTADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-6
publication title Structural Basis of Sirtuin 6 Activation by Synthetic Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 282
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.5.1.-:
pdb deposition date 2016-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.200 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 5mfpA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 5mfpA01
2JLAA 5MFZA 2OO5C 2OORC 4K9KA 1MCZA 1UPBA 2JI8A 4F4UA 4JSRA 4BN5A 3GLUA 4MZXA 1PNQA 4HD8A 4QQ8A 4GM0A 1YNOA 1POWA 4BV2A 2OD2A 2EZTA 4X3PA 3FZNA 1YC2A 2W93A 3D4BA 2EZ8A 4V1CA 2UZ1B 2BRUC 1D4OA 3GLTA 4BVFA 1XLTC 4J1TC 3D7KA 1U2DC 1YHZA 4MPPA 1Q17A 4MPRA 2EZ9A 2JIBA 1OZHA 2OD7A 5K6RA 5EJ4A 4BUZA 5BWOA 2FWNA 3RIGA 4JU8A 2VK8A 5DGTA 1ZPDA 4UTZA 2H4JA 2VJYA 5FEMA 2Q5QA 4FEGA 1OVMA 4IF6A 3FSJX 4RMJA 2H2GA 2H2HA 1EFVA 5EJMA 1MA3A 3PKIA 4MQ5A 4UUAA 1YTLA 4UTRA 3PKJA 4K9PA 4I5IA 4FVTA 1T9DA 2PANA 5MGNA 2VK4A 1NM5C 4ZP1A 1M2NA 5EJ5A 1ICIA 1SZDA 2WVAA 4UTXA 1Q6ZA 4FEEA 2B4YA 4KGDA 4BV3A 3CLUD 4RMHA 3F6EX 1S7GA 4G1CA 4K9LA 4Y6OA 4GM4A 2VBIA 3GLSA 5DEIA 1Q1AA 4JUAA 4V1CI 2VBGA 4L3OA 3ZGVA 4IAOA 2OD9A 4C78A 4KPUA 5BWLA 3RIYA 3CLRD 1PTJC 1DJLA 3IAFA 1UPCA 4Y6QA 3CF4G 4HDAA 4RJJA 2PGOA 4K9MA 4GG1A 3K35A 3D81A 1J8FA 2H2IA 2IHUA 2WVHA 4UU8A 1O97D 4JD5A 1PO7A 2Q29A 3JWPA 2EZ4A 3EY9A 5DGDA 4FZ3A 2JI6A 1N0HA 2VBFA 1OZGA 1E3TA 1PNOA 2HJHA 2X7JA 2H4FA 5K6TA 2FR8C 2JI7A 4JUBA 1PYDA 1U2GC 4L2IA 5AHKA 4JUFA 2Q5LA 1M2GA 3IAEA 1T9BA 2V3WA 2AG0A 5K2OA 5FYQA 4K9QA 4JUDX 1YI1A 1PT9A 1M2HA 2DJIA 1U28C 2EZUA 3EA4A 4D5EA 1YBHA 3GLRA 2Q5OA 2H4HA 2JLCA 1UPAA 4TWJA 2FSVC 4JUCA 4V1CB 1V5FA 4X3OA 1BFDA 1JSCA 4COKA 1HZZC 1Q14A 4TWIA 1V5EA 4R8MA 3U31A 4O8ZA 4UTVA 2NXWA 4UTNA 4UU7A 2FN3A 4RMIA 3PDHA 2IHTA 2A1UA 5MFPA 4F56A 4J16C 4JT9A 1S5PA 4BVBA 5MF6A 4JU9A 3OE1A 4Q9DA 4BVGA 1QPBA 1POXA 4BVEA 3FLMA 5IMSA 3CLSD 5EJ6A 1M2JA 2PGNA 4MPJA 1OZFA 2QQFA 4IG9A 1V5GA 3EYAA 3CLTD 4JT8A 4RJIA 2AG1A 1EFPA 1T9AA 4K9OA 2A1TR 4Y6LA 1SZCA 1T9CA 4KXQA 5EJ7A 4D5GA 2JI9A 3E9YA 5BWNA 3F6BX 1PVDA 1PI3A 1YI0A 2IHVA 4RJKA 1YHYA 4RMGA 3HWWA 3U3DA 5EJ9A 2UZ1A 2Q27A 2QQGA 2FRDC 4BN4A 1U31A 3HWX1 2VK1A 2C31A 3LQ1A 4QELA 1Z8NA 5D7NA 1Y9DA 4C7BA 4GM1A 4ZZIA 4GP9A 2NYRA 5K3SA 3ZGOA 5EJAA 2Q5JA 4K9NA 4UUBA 1O96B 4BVHA 3JR3A 2Q28A 1M2KA 2WVGA 5EJ8A 2H2DA 1YC5A 4GPEA 3ZG6A 2H2FA 2H59A 4QPZA
chains in the Genus database with same CATH superfamily
4GWKA 5MFZA 1WW8A 4Q39A 2CYAA 3SNHA 2R1TA 2XTMA 5FOTA 1TO6A 2C84A 1Z5NA 2PQ0A 4ID3A 3G1UA 5HIAA 3ESYA 1RWDA 3OZTA 4RORA 3EAGA 1UDAA 4YAJA 5BY2A 1RHRA 2IZZA 2ZPAA 1Y9AA 2WLTA 3BIJA 6ABPA 2PYIA 4JOBA 1O5TA 5H3HA 4BE9A 4X62B 4DNQA 2GA8A 2VHZA 1U81A 4Q3AA 3FUWA 4BX9A 5AI0A 4HADA 5HKKA 5DCYA 3ZIDA 4CMBA 1C30A 3HCAA 4R54A 4ZAVA 5J58A 1C8KA 4PYMA 3H11A 3DEAA 1ZCZA 3DPSA 3S1LA 1PUXA 1ZUNA 2AMYA 3F3MA 5KSWB 1PGJA 2P9QA 3ADOA 2AG5A 4H3HB 3EEOA 3VSBA 1TRHA 4GMFA 1NMZA 1RAIA 2IYXA 2YASA 4DJ5X 1DAOA 2YDYA 3OQIA 5ECWA 2CYCA 4J0KA 5SYNA 1XCLA 2GO7A 2QVZX 4J0DA 3SZ3A 5HKOA 2V7XA 1KZGB 2D2XA 5KJCA 1KZ6A 1WCIA 1BCRB 1T26A 2J7PD 4B17A 1POWA 1X19A 2GEBA 1Z0ZA 4JCCA 3D3JA 5DYNA 3W04A 5JY6A 3U56A 2FWMX 1VRWA 1HOTA 1IY1A 3K5IA 4PQGA 2PUJA 2QUJA 4HNHA 4GSYA 4JB3A 1GNTA 3FPGA 3SBOA 5JNVA 3FVQA 3BS4A 2OYCA 1JAYA 2C54A 3I58A 2P5SA 4MCHA 4WNYA 3TRIA 4WADA 5KWJA 2VPTA 5IX8A 1AE1A 3CMCO 2VP3A 2XXJA 4DUGD 4RYDA 2E55A 1XMJA 2Y1LA 5JWOA 3KEFA 3FOZA 2FLWA 1A9YA 1NVWQ 3RZDL 2A5FA 3FY4A 4G5SA 4Q1AA 5GV8A 1MGPA 4QLBA 4F45A 3KOYA 3LQFA 1CEXA 3W7BA 3T61A 1RCFA 3GGSA 5GADc 2AI1A 2B4TO 2IYVA 4ARCA 4N9WA 1RLOA 5BYKA 2OHXA 2H3HA 4ZQGA 5ULLA 1U2DC 2O3QA 1XFAA 2C2KA 3I9JA 3P9IA 4OSPA 3TLMA 1T9GR 4IF4A 4ZYVA 5IYZA 5CNJA 1G3QA 3H5OA 3TLXA 4MVJF 3AVPA 4NPAA 4X6UA 3THSA 3HJNA 1WCYA 3HI6A 5IKXA 1EHYA 2COEA 4V0OA 3UB3A 2Q2OA 4CM9A 4YT5A 1GYPA 3OPVA 4Y7NL 2GM3A 3TR0A 3UWMA 1ZXLA 4GZLA 3AETA 3NONA 4LWOA 2IIBA 4TMWA 2EZ9A 1TGYA 1Y8AA 3STWA 3WZMA 5MN4A 4NBVA 1Q83A 5EMLA 1QYWA 2XH8A 4FNOA 2O8FA 5C4MA 4BUZA 1JFRA 4UOEA 4RXNA 5LD2B 4OJTA 1KL7A 3KEMA 2OZEA 4ETMA 3A6JA 3ITDA 3AVXA 1J00A 4G5GA 1WDLA 2J4CA 4NMLA 4R41A 3THWB 1P0QA 3BWEA 3NHRA 4W7HA 4Z8XA 2PYDA 4QOGA 1V37A 3N0RA 4EG4A 4LV8B 1DV1A 4UTZA 3N2GA 2NSYA 4AQYB 3S14L 2P1RA 2G80A 3W1EA 4BMDA 4XIFA 4HBGA 5IDWA 2Y0BA 2BHRA 2XUZA 3OIVA 4Q6BA 4AKHA 5F4ZA 4IDHA 4REMA 2WVJA 2JIDA 2XOXA 2RGGA 1YS9A 4D4LA 1XE3A 2R65A 3KR9A 4LEIA 4AK9A 2HRCA 4DDTA 4YIHA 5M5WL 1QG6A 1JKXA 1R3DA 2BGJA 4D8WA 1BJTA 4B35A 2B6HA 2JGDA 1BMTA 1T2FA 3BH0A 3CEHA 4LTDA 4P7FA 4S1TA 4U2EA 2VHEA 3RWMB 3SG0A 1OI7A 2E2IL 4HDKA 3GZ4A 1NW6A 4PZLA 2GWHA 1SBYA 1QAQA 2X8BA 4WLOA 2QMHA 3DOOA 4ALLA 1KMHA 2H18A 5E7QA 4BNIA 1IATA 2A59A 2B0CA 3KTDA 5HJ2A 1P7ZA 3FCYA 3KQOA 2OOSA 2Z2YA 3NBXX 5B5SA 5EZ6B 5CCDA 4LN1A 1HK7A 2WM3A 5TRTA 2I6UA 2ADMA 4X8LA 5FTNA 1XRSB 2FE1A 3FTEA 1PFYA 1NPDA 4RJLA 2XB4A 5CCEA 1LV8A 2JJMA 1GNLA 3NHJA 3C6BA 1G3IA 3VZPA 3FGOA 3ZV6A 4GXTA 1N7IA 1QGED 2UVDA 4HLQB 2AGVA 1HQKA 3SS9X 3OUUA 3K70B 5DHSA 3GLHA 3AEUA 1SCJA 1VBKA 3BA6A 1XTTA 4RKEA 4UMDA 5KEIA 3X1ZA 5CDTA 2PMZP 1MMFB 4CR6A 4EENA 4HS9A 3MS7A 2QRGA 3SZMA 1IZYA 1QHHB 2GRAA 1MPXA 4MRPA 1MW9X 1XPJA 3Q9SA 3HO8A 3AO0B 4X1KB 4GLFA 5CJJA 2RGRA 2C3PA 5K3OA 1J5PA 2AQCA 3ICVA 3R0ZA 1MOZA 5EE5B 5TV2A 3RS9A 1I6MA 3UY4A 4CQLA 5CDUA 1C8LA 1G8HA 2EJBA 3GGOA 2AEMA 5L3RA 5JXHA 3COJA 2QLFA 4FIZA 1OX4B 4Y52L 2ORVA 4HDQB 1SIBE 2EV9A 4X7BA 1F60A 3TQIA 4OQQA 5JAMA 3TXXA 2ZJ4A 3JQGA 3KOWA 5FORA 4Q9JA 2PKWA 5JC1A 3NV9A 5KDOA 4QXPA 1V45E 4G36A 4OJMX 5F12A 2J9FA 4IH9A 2W22A 3DO8A 5AW6A 5FUVA 1JIQA 1S2MA 5EHXA 1KI4A 4M1QA 4X6YA 3MRVA 5KPJA 4IAOA 1EWKA 3ABIA 3W5UA 2HIAA 3HYSA 4XWGA 3RIMA 1XYGA 3C1OA 4OP2A 3SF8B 1OAOA 5C8YB 1SOVA 4KBFA 4KQJA 1UKBA 4WX2B 3ASZA 2FAXA 3LDAA 4P81A 3MJEA 1AIPA 5DMHA 4XKJA 2PZAA 3M4YA 1MJGM 3SGLA 2H1FA 3FKSD 2FMTA 2JAOA 4DXHA 4KIGA 4V2UA 4QG3A 4JYZA 1N2CA 2GFIA 1XZPA 4QXRA 1ZXBA 3N5CA 1EJBA 1XZGA 4OREX 1WMEA 3S2EA 1ECGA 4UNQA 5EMJA 3PFCA 3LBNA 1IRNA 2HEGA 4MI3A 2DFKB 3FIJA 3MRXA 2YR0A 5A7FA 2LP4Y 4A6PA 4C1BA 1X0XA 1OFGA 3IIIA 4Z3KA 13PKA 3GJ6A 4A3CL 2ZROA 5ELXA 5AKIA 4AF6A 1XIVA 2Q1SA 2XA1A 2YRXA 3IRUA 2IHBA 4OAOA 4BN0A 4LSMA 9ABPA 3DKRA 4O4HF 5K51A 4CM6A 1M1XB 5GAGc 1KEVA 2WVHA 2HT6A 1AGNA 1O97D 1P2FA 1WQ4A 2G0NA 4LJLA 4RIEA 3UV3A 4CF4A 2VWPA 1VLHA 2WPDD 4NZYA 3FMGA 4KAFA 1YCFA 3KQTA 1Z4MA 2I2AA 1JG2A 1DQNA 4JP1A 1DGQA 4UEWA 1D2AA 3EVGA 5GAEc 4S1OA 3CLUC 2MHCA 3QBVA 1Y6FA 1HFEL 4LVUA 7ADHA 4P2BA 3IBGA 5ICCA 1CQJA 1ISJA 3UMMA 4YA6A 3E9MA 3CPEA 3BD9A 3N2IA 4FGUA 1UOQA 4WXEA 3T5MA 4MS4A 3QJGA 5ESDA 1JIKA 2LE0A 1G21B 1PNOA 3IAM1 4A23A 2FUEA 4R2HA 1QH0A 4R83A 3AUTA 3BGDA 1E3IA 3HEBA 1B6TA 5BQ3A 1B74A 5FWYA 3L0SA 1M9NA 2FG7C 1DL5A 3RSOA 1PV1A 2GLTA 5KTPA 5HQ3A 5KCZA 5JVH1 5BSFA 3KSDO 5KINB 4OHUA 1XAIA 3KWLA 1KMIY 2IXDA 3OI7A 3JQQA 4G5YA 5DF1A 2PBRA 3PDJA 5LUAA 4S1NA 3UWKA 1WB4A 4ENUA 4ZZ3A 1V7PC 1K9VF 3BFKA 3T3PB 3NHSA 4NCHA 2VH5R 4DW8A 3I5YA 3UJ7A 4CZ2A 4MTCA 2QBYB 3CLRC 2AG0A 3GT0A 4DV6B 3H11B 1QOQB 1U0HC 5KQPA 1ZUNB 2QXYA 2P9FA 4YEDA 2XSZD 3RROA 1C7FA 1TZ2A 4FR0A 4J0HA 4C6TB 3NHPA 1A71A 2HA5A 2G76A 1WMSA 1M74A 2OV3A 2J31A 1AN9A 1JZTA 5IFKA 4HAIA 4EFNA 1LTLA 3NYWA 3WISA 1CF4A 4K81B 1YDMA 2DJIA 2WKRA 3WNVA 3SXUB 2H7CA 4JJ7A 1DEHA 3IC5A 3I53A 4IIJB 3QU5A 5GP1A 5FV4A 1A2OA 5IDXA 1WCIB 2HR1A 1U3TA 2FQWA 3I34X 2ZCVA 4HNGA 3QKSB 5AK0A 2B99A 1PLKA 1XG5A 3THYA 3BH7A 3LX5A 3V2UA 3NOQA 2WHXA 1P3JA 1YIAA 2CBGA 3TFQA 1X87A 1ZR4A 2CF6A 3A37A 1HKHA 4YV7A 1G8YA 3TVYA 2DGDA 4PSAA 2G1PA 3A28A 4JJFA 1PRYA 1BZYA 1PUIA 1GD1O 1RZRA 3QUSA 1Y3BE 4TWIA 2VEDA 1WMBA 4Z9FA 1U5CA 2ORYA 4X7PA 5BV8A 4HX2A 1ZNQO 3HYCA 3I39X 3K9QO 2DFPA 1DS6A 2E3JA 1GFZA 4M60A 4ZOQI 5B6PA 2CB0A 3NQ41 3R3YA 5KYKA 1JNXX 1VE3A 2XKAA 4BVJA 4XA8A 1NVUQ 3LBIA 3NTLA 4HLUA 4RMIA 2QTHA 2O8CA 1QF9A 4GOOD 3CZ9A 1VYHA 4G5XA 4O3MA 2QN9A 2YCLA 2CJWA 3CKLA 1W1IA 4G4IA 1A5TA 4FJ0A 3LC0A 4FBLA 1NLUA 5DZSA 5BSWA 2NW6A 1YJ5A 3GJ0A 1M83A 2QG9A 3ADBA 2PEYA 2RDMA 4JU9A 4R71A 1FQJA 3AF0A 5BUCA 1WIWA 3A4VA 3AETB 5EGNA 2OV2A 1ZBDA 1G98A 3U62A 2VCHA 3DE6X 3EW9A 4A3EL 1GPAA 2IL1A 7RXNA 3B5IA 3F98A 1YUNA 3WX0A 4E2XA 3S1AB 4IHJA 4TV9F 1C3VA 2NO9A 3ZU4A 3E8XA 3K5PA 4N9QA 2GEDA 5CCXA 2HPVA 1TMOA 2QZ9A 3PFBA 1TVKA 3DBOB 4GZ3A 1UFOA 4I4CA 4TQUS 3RS7A 1JR3D 1KI2A 3SEQA 5LDHA 1I36A 1A8QA 1ZCBA 5KNCH 1KYQA 1MC8A 3L8EA 4AZ3A 3EQ9A 1NRJB 3KU1A 1VE7A 1IE3A 1P60A 2DR0A 3N2GB 3T3EA 3V5NA 1L7RA 1ZD1A 3WRXC 3D3KA 1H8HA 2VDWA 2YZ2A 1YR8A 5KHLB 1HY3A 1VE6A 3DVLA 1J8VA 1OXSC 4IX9A 4KLCA 4XJTA 5AOAA 5E8RA 4Z3DA 1UWVA 1JQJC 3AEKB 2AR7A 1QMPA 4ICIA 4P3XA 4JC0A 5F5LA 3VR5D 4YPOA 4MICA 3GARA 2FW9A 2FDXA 2V7VA 2YXLA 3IUJA 4H4DA 2QPLA 2HWKA 3K4QA 3LO5A 3LXRA 4NYMQ 4TSFA 3CEAA 2B94A 1KC1A 2GCNA 1N8KA 4ON9A 5F9HA 5IFLA 1E1YA 3DQZA 4JOQA 5UKDA 4ZVUA 2VJMB 2QTMA 4GE0A 1NKTA 2NGRA 4IUCS 1B8UA 4AF7A 4NZOA 1IBLB 3AEQA 2PNJA 4CM4A 1AF4A 4UM7A 4UBOA 2LIVA 3DFFA 4CJXA 4PGAA 1ARZA 4OXRA 2ZJ0A 1CUCA 4GWLA 5BWBA 1QU3A 1GRCA 4L5BA 4TLLB 3EPHA 3VBEA 4B5KA 2DPYA 2N9UA 2I5PO 4KXLA 3NNSA 3VNBA 2NUPB 2W8BA 2QSZA 4EKIA 1DAPA 3U39A 4D0SA 4C43A 2W2TA 2VQ3A 3UMFA 5C37A 2WJHA 1RZ3A 1H4VB 2DX7A 3CRRA 3P2AA 1CUEA 3KYYA 3RS2A 1BXRA 3SFVA 1BROA 3UJNA 3KL2A 3FFTA 3M5WA 2C61A 3MTJA 1Y5IA 2ZI3A 3GLHB 1QG4A 3OC0A 3TVDA 3AEUB 3F6BX 4H0NA 4LISA 5BWNA 5KOHB 2DP4E 4N65A 1Z12A 4NZ9A 3ACDA 3ELBA 1YI0A 2PT5A 4QRIA 1T3HA 2HPAA 2AMFA 3HJWB 5F5NA 4NQRA 1LWNA 3H7AA 5U4QA 1J49A 1Q19A 5HF6A 4WXYB 1U7XA 1KOLA 4D4JA 4DLAA 3NHZA 2ZITA 3ZUGA 4CM3A 1MN6A 3GQBA 1K4YA 4LF8B 5EZYF 3WWZA 5MHTA 4JFAA 4QPNA 3B9PA 3X1DA 5JBIA 3LQQA 2BSXA 4ZV9A 4CM1A 3OP1A 3W34A 1I3LA 2ZUTA 1NYRA 1DTWA 2GN9A 1OXTA 4YVFA 4QGSA 3A58B 5H3LA 2BIFA 4RTQA 4KWIA 3G8CA 3JTMA 1YBAA 1DIOB 4LY0A 4JVOA 1QU2A 3TJZA 4WCFA 3V1MA 1Z8DA 3LHIA 1JIUA 1JAZA 3K5HA 3E22A 4PHCA 4X00A 3SHQA 2BE7A 2PKQP 3QJ5A 3W9BA 4IIVA 2J5XA 1SC6A 3V1LA 5L7WA 2A68D 1Y9DA 2GBFA 3ZC3A 2YFYA 3ZV4A 3QF7A 3E2PA 2PSEA 5I4CA 3BJMA 4JYCA 3OT4A 5DM70 4UUBA 3EGVA 1Z83A 3GJSA 5DB4A 4JVNA 4JAGA 1Q7CA 3B0AB 2B8TA 1ZDMA 1QYCA 1XZKA 1CUXA 2JGRA 2TSYB 1GZSA 3BHMA 4HFNA 1L5GB 1K5PA 1FLAA 3VC7A 4FYVA 5HCNA 1AKNA 1G8PA 1KU6A 4WI1A 2YC2C 5B3LA 2FSGA 1N2CB 2EW1A 2E48A 3DTVB 3FDIA 5J4KA 3PYLA 3DMDA 1UWCA 1T9HA 4BKOA 4XQCA 3QVVA 2G8NA 2AOUA 3ISJA 3U60B 2B2XA 1O94D 3MCWA 1KRXA 4F3KA 3FMVA 4GVXA 4RSHA 1IY2A 1LC3A 3L4BC 2DH6A 5THKA 5LOVA 1D8TA 2QZSA 1B71A 5ERYA 3GU3A 4MI6A 2R8ZA 4E5VA 2MJLA 3KOUA 3W5BA 2VRBA 1YZQA 3JALB 5CX4A 1WKBA 4YPFA 3DAHA 1MRSA 1EFPB 3WK4A 1IVNA 4H6WA 1LV7A 4NPCA 1ATIA 3IH5A 3MF4A 4J94A 2E2WA 4M0CA 4DTIA 2CXXA 4CL0A 1SU7A 3E6AA 4HH0A 2P65A 4WSOA 4TT8A 1JXAA 4FI3F 1UUFA 1XD9A 1P5RA 2QPAA 4IXNA 2NXNA 1UFQA 4C7OA 3HOWL 3KLPX 3CPJB 3A9RA 3FFWA 4JP3A 3OIFA 4MS4B 3MILA 2OV4A 3PEFA 1FDSA 1Q77A 2WHQA 1WB6A 5BMOA 1SQ0A 3Q7RA 3DHYA 2XT0A 1F2DA 2CLKB 3CVJA 4AO8A 3M9WA 1W0JD 2O5RA 1FSGA 3C6MA 4UM8B 1QAMA 1U2EA 1Z4KA 3VYUB 5GOTA 3GLIB 4LZOA 3T7RA 3B70A 5EMKA 3OU2A 3T4EA 5HQ3B 4XD7D 5JARA 2PD6A 2VXYA 2JIPA 2I54A 1GO2A 1CEYA 3CVWA 1YAJA 2WOOA 5I7UA 3ICEA 3RGGA 4L6CA 3HJUA 1Y5RA 3HFJA 4DJJA 3F97A 2O0JA 1QIFA 2HUPA 3AVOA 3ZBPA 1AC5A 2MS3A 1YC2A 1MAWA 2ZOSA 3FZNA 5A6SB 4AZSA 3B2EA 4E5MA 1Z6TA 3P7MA 3B7GA 3O03A 4OHOA 3HH8A 3T1VA 4AMBA 3MWFA 4AHZA 4JVLA 1N2SA 5I45A 4Q5IA 2DUJA 4IQGA 3HA5A 4Y2TA 2HKIA 3LPAA 1NQWA 1WABA 2KQUA 2PRJA 3R24A 2Z9CA 4XFDA 3QLEA 5AI4A 1NF2A 4G9EA 3DZJA 3AVYA 3LWRB 4OQYA 4EO9A 5J47A 1NNEA 3Q3CA 4LVOA 2XBMA 4BHTA 3EZXA 1Q0SA 3DD5A 4MRNA 1CCWA 3HV0A 4HZUB 1GG5A 1MH1A 2CYBA 2O1WA 2R8RA 3R0XA 4XYBA 3SSNA 2HWWA 1E2LA 1AB6A 3T7KA 2C0QA 3IDOA 1B73A 1JWBB 1ZN7A 3FLEA 4JI1B 1OSNA 4D4KA 4NSNA 1PDWA 1MENA 3QVDA 1ZEMA 5K4GA 1DPGA 3UBMA 5EUBA 3S7TA 3GROA 2BFDA 1EQAA 3AV0B 3NDIA 2CY0A 4K88A 5KAPA 5IHXA 1P1RA 4DHEA 2WTUA 1YQWA 3PQ7A 4NCXA 2RHOA 5K5EA 3FXAA 2PS1A 3LHKA 3E5RA 1F38A 4MP3A 4IZ6A 3W6ZA 2O9JA 1NAIA 3RIGA 3P2OA 3ZE0B 1AO0A 5I48A 1Y0BA 3RTEA 4R1PA 1JI3A 3RRBA 4DNOA 3G5TA 2JH9A 3EXG2 1D1PA 1G7SA 1C3OA 4YRQA 5FO0A 3W4KA 2O8CB 3NAQA 4EYKA 3B1VA 1X6VA 1CK4A 2ZSIA 3I2GA 4OG2A 4Y0VA 3SE0A 5JALA 4WFIA 4JASB 5GQSA 3O74A 5BV7A 4Z9YA 2XWSA 1UK9A 4M89A 2QIPA 2QTVA 3PE6A 2QX4A 1ZH0A 4QUBA 2CW5A 3FTPA 5E6UA 3RARA 3JV7A 2XOKD 3I9MA 1KU0A 1WULS 2H2GA 4MJ3A 621PA 1NV8A 4J9VA 5I7FA 4IIGA 4EGJA 5AI9A 3VFDA 4IHJB 4XGHA 1JMYA 2X22A 4JT4A 1H6AA 2MSDB 2A78A 4IDDA 3DOEA 5LYJF 1Q57A 4IQ8A 2HN9A 5MLC3 2LWIA 5SZJA 2H9YA 2QN1A 4LSWA 3DR5A 1H3EA 2HGZA 1L5VA 2C3OA 1PG5A 1SVUA 2OORA 3B1ZA 5HF9A 3D4LA 3HUDA 3K1AA 1KDZA 4ZJYA 1MNQA 2RONA 3FAZA 3LKZA 4XQGA 1WCWA 1T9DA 3M6FA 4K6FA 2I4TA 2ZDGA 1E1NA 1A76A 3FYTA 3IULA 5J40A 2A67A 1BX1A 1NXSA 1LWOA 1EGMB 5EUMA 4F97A 2V74B 3R6LA 3JQCA 4EVSA 3O21A 1PCXA 4DB4A 4C0JA 1AKTA 3FZYA 4F2PA 3L6RA 4KAJA 3IP1A 1KBZA 5D3MB 1LZLA 4Z4EA 5B64A 5CVTA 2Q3MA 4G41A 1Y1KE 2VO1A 4DA7A 1U4OA 1UFRA 5ALJA 4II7A 3N0VA 3DBHA 4EHIA 3JATA 1Z2DA 2VJLA 2JW5A 5BNIA 1NN5A 2R11A 3B3FA 1FJXA 1IWOA 2VF7A 4R84A 4HEA1 3SU8A 2H08A 1LSJA 1B2OA 4MAMA 4MGEA 3B20A 1MOPA 5J5VA 1XVUA 1GRNA 4AZ0B 3GCZA 3WK5A 2HC9A 1ZC3A 4IOMA 2IVFA 3AG5A 1TT5A 3VDNB 2W8BB 5HRAA 1PEKE 1E77A 3I5MA 4IDPA 2D1FA 4EKNB 1ECFA 5G53C 3J7TA 1NVBA 4QOEA 5DGXA 1BXRB 1LFDB 3ZCQA 4LECA 3L4KA 3HYRA 5AVJA 3PUJA 5CFOA 1UJBA 3ZGNA 2PX5A 2PAFA 2JA1A 2RHBA 4OX9B 5CNKA 2IPMA 5G02A 2ERXA 3ABZA 2F3SA 5G3YA 1UC9A 5E1BA 4XXHA 2ZM5A 4POGA 3L1JA 1EFLA 1UJNA 1IZ8A 4XSVA 3MJTA 3EVFA 1TA9A 2IZOA 4E7OA 1ZONA 1KMNA 2VKQA 1KFBB 4LNUB 2R7ZL 3GELA 4WKGA 2HXSA 4KRXA 2Q5CA 2QRNA 1FNSA 3RF7A 4RWZA 4F4JA 5JADA 3DEZA 1JALA 2P0EA 1CIVA 1JYEA 1YIDA 1USUA 2IS1A 5CX1A 4MH0R 1Y4AE 4M1ZA 1WBJB 3Q5EA 1RWOA 4HUJA 2G08A 2IA5A 1XNRB 5FKJA 1LEHA 1Y98A 2CBXA 3TE7A 2Z5FA 2P2NA 1DP4A 4YP5A 1M7HA 5FBLB 2WTAA 2N42A 4RTJA 2EWWA 3E22B 1I2ZA 3C3YA 3NBZC 5C34B 4MGZR 3KVRA 1UAYA 1CHDA 2FMKA 3DTTA 1OLUA 4H7FA 4KSBA 4EY5A 3STHA 2A5GA 2HF2A 4DV0B 1BSVA 1C7QA 1J0XO 1ORRA 4BO1A 2QX6A 3OZCA 2IV7A 4QIWP 2JNWA 4UU8A 2BP7B 1ZW6A 3MW8A 4HTFA 4X6LA 5HYVA 2P9HA 4LUCA 1RFGE 2PO7A 3DWFA 1Q1BA 3QYJA 1SUDA 4HKTA 5JLJA 1Z13A 4IH1A 2O14A 2YWGA 3ZX4A 1NQ5A 4MYUA 2BTQB 1GCIA 4QDZA 2M98A 4TQAA 2CVZA 2G40A 3Q7TA 5CH3A 5LQKA 1D1QA 2V1UA 4GQAA 2G1JA 5AOBA 4GL2A 2ZVJA 4HEJA 1RPNA 2AXNA 2DAPA 1E3TA 2ISQA 3LP5A 1RC0A 2IDJA 2RB5A 4WZAE 4OQPA 4DZZA 2HFKA 1JQKA 2PMEA 1II8B 1KH3A 3WMFA 5F7JA 1Z0SA 4QEKA 1P7YA 3GA5A 3V1KA 4OHYA 4KLAA 3MJSA 4YBZA 4EYOA 1DBSA 4ZOLB 2D3TA 5B53A 3AP2A 4UBJA 1E5QA 1N2HA 3ABOB 2Q4BA 1YQQA 2GYWA 3QZUA 3BBPA 4IV0A 3W7VA 1J9GA 2WFZA 1MB4A 1T8UA 1VFPA 3PFFA 4KO2S 2O2SA 1TIPA 4EFLA 2J5BA 5L95A 1WA5A 2RGEA 1LTHR 1SMWA 4CKCB 5FTWA 1KWGA 4RF4A 1ONBA 2E6UX 3KZMA 5DM2A 1PFGA 4NIMA 3WQQA 1T15A 3IESA 1SUSA 1O9GA 3SDSA 3HJHA 3WGTA 4MWTA 3TMKA 3EGXB 1NLFA 2JAHA 5IM5A 3PWKA 4PX5A 4XCXA 1FP4B 2OO7A 3F7TA 3KWMA 2Y66A 2IXGA 3EWNA 3PIO1 1QVRA 5T6BA 1E2BA 2KHZA 1BNCA 2DH5A 3F6CA 4TKVB 2VUML 5DNEA 1FIUA 3L92A 2YV5A 5CGZA 3U7QA 3VGPA 2C9CA 5EMNA 5F7OA 4RNCA 2PRZA 3AM4A 1YBHA 1HMPA 5BOVA 4PLWA 2X0FA 2BT4A 3ND8A 4OGGA 4RYLA 1GADO 1DJQA 3LECA 1NUHA 3MOSA 4DLBA 3OPMA 1UPAA 3MLBA 1ENZA 3QGMA 2Y2UA 1O6ZA 4WV3A 3OPQA 3BILA 2G8LA 3R3ZA 4G5OA 4YQEA 5KYYA 3CUVA 1AQUA 1J22A 4ZGWA 5F3DA 3O75A 4QREA 3NTRA 4JBIA 4EJSB 1JL3A 1FUUA 3FI9A 3W6PA 3OLQA 4LE2A 1L4NA 5IKOA 4CT4B 3GTOL 2Q1WA 4GGMX 4D99A 4RH3A 1EDZA 1V5EA 1NP7A 4I81A 3V2HA 5LIPA 4TVSA 2PQ6A 3PXGA 4O8ZA 4Q66C 2NXWA 2QLMA 3OY7A 2JGNA 4Z86A 3VH2A 4OQLA 3SXJA 3VKUA 7YASA 1WPRA 2PLFA 3P0EA 4FEAA 5BSRA 4F6CA 3GZNA 2IHTA 4XQEA 1ZIOA 1TFUA 4N49A 4MVJA 3VU3A 3WBBA 3EC7A 1PWYE 3GEPA 3ASVA 3B7WA 2QN8A 3BJRA 4JLDA 1MA0A 1DPFA 2ZYDA 4OA5A 1FFSA 3P2MA 2BEVA 2PGDA 3P45A 1E89A 3ZXYA 1JSZA 2VLBA 4EUEA 2CLMB 1KEKA 4DM4A 2HRZA 2PY6A 2OAGA 2BFDB 1AHIA 4NFHA 4XVRA 1UOPA 3UWPA 1N77A 1DAKA 3B85A 4AO6A 3TTXA 2ZSUA 4LHNA 5IT4A 2Z1MA 5ECYA 4BQRA 3TLJA 1JX6A 3M82A 2ZYUX 4JL5A 3QE0A 5JQGF 3IMFA 1K6JA 1JLLB 3JYLA 5IC6A 2IV3A 1P0IA 4LYEA 3UPTA 5BN4A 1NW9B 5ILQA 2QX7A 1Y81A 3TLEA 5I4KA 4Q3LA 1BD3A 3L93A 1IN7A 2IU3A 3O6VA 4I5FA 2ZR0A 4HQKA 1C29B 2WAAA 2OZPA 3IMKA 3T5TA 5BSVA 2FOLA 1C3OB 2W2OA 5AIBA 5IZCA 3DXZA 3HZRA 5F7XA 2CLFB 3ZCTA 1OLSA 2ASEA 2Z08A 3KYDA 5JS8A 3BKXA 3AV3A 1XFDA 1W19A 2PFKA 1QANA 2VNKA 4WZBA 1JEOA 4GMGA 1TEVA 1UKZA 3KEQA 4NECA 3RV3A 2WJ3A 4GPZA 4YJ3F 1YE5A 3RSLA 4BX3A 4QT4A 4RTRA 4LF9B 1E7WA 1M6YA 2VZEA 5BUSA 2ZB8A 1FF9A 3EYAA 3UGQA 3WNZA 3CLTD 1FSFA 2NZWA 3DDUA 5E6UB 3WRYA 2FEPA 3QMWA 4UAVA 2QVGA 3HBAA 3LF2A 1I2DA 1VE5A 1C4OA 1YRQA 4PZDA 2PO5A 4J4HA 1K86A 1IPHA 4O3FA 4JITA 3PNMA 3R0VA 4IRXA 2C4KA 2QT1A 5DBHX 5G4KB 3EW7A 1MAUA 2L17A 2YIDA 3CXRA 3FVTA 3LUJA 4LZJA 3Q0IA 2P9GA 5I9TA 1Y8QA 2Q7DA 1A72A 2HV9A 3HOUL 1GAEO 3IIMA 1WPQA 3QX7A 3RDPA 1NMSA 1HF3A 2CXUA 4DIMA 2Y05A 1EA5A 3GJTA 3G88A 4ZEVA 3HGQA 2MSKA 1SXJA 1A2QA 3G2OA 4BNGA 1WD7A 3KETA 2B8JA 3U09A 3DEJA 5B1EA 4CDGA 2CNLA 3UA3A 1OJ7A 2H9AA 4DM3A 1XVAA 1FUKA 2DVMA 1G55A 3FZQA 3T7DA 4B3HA 2GH1A 3DDNA 2V0FA 5BOSB 1H94A 1UPUA 1I7QB 2Z43A 4Q4JB 3H2KA 2LV8A 4HGYA 4ACAA 2ONZA 1SKBA 3DZHA 5KNDA 2G9VA 2B8NA 5DM61 1NSTA 3DBHB 1XEXA 2PXCA 2ODTX 4KE9A 5LZ4A 2O2YA 1YDGA 1ZYUA 2BMWA 2BN4A 1N2BA 3HB5X 3O2QB 2YJ5A 4MW1A 3ZI0A 1NHWA 4YWLA 2X7HA 4TYMA 5HZGA 3DV9A 4BFWA 4EW3A 2O1EA 4DCPA 2R8XA 2F48A 3OJCA 4CU5A 4KODA 2M6RA 4LXGA 4QUAA 4D9EA 1Z0JA 3Q98A 4AJOA 3LRXA 4WXMA 3S2DL 3MRTA 1WBDA 1CJKC 2QR3A 1NMEA 5C4XL 1TT5B 3JU3A 1YQTA 4A5SA 3NJ8A 4DPKA 4RL4A 4QTZA 4RPCA 4XVCA 4P0TA 3CUWA 1YAHA 3R5SA 1RJDA 2IUSA 3FOAA 5ALOA 4D8VA 3TJRA 3CMMA 3L0CA 4NICA 2ECOA 2GRJA 4PRZA 4ZVRA 1KP2A 1Y6ZA 5CLJA 3ZNQA 2VK2A 3BL8A 4LJKA 1KEEB 1Q74A 3C3PA 3QXHA 3ISTA 2VSOA 4NEHB 2VSQA 3AFHA 2QS9A 2FHPA 2R84A 4QPDA 3N2NA 5BQPA 3ZVLA 2O1SA 3PBKA 2FGKA 2L18A 3QM1A 3VTAA 3CZQA 1LSSA 4EITA 2H00A 2NYRA 2RIPA 1GNSA 1L6RA 1W0CA 2D2VA 1DVBA 2Q5JA 2YFHA 1AV7A 4U39A 1QORA 1JKIA 2GGSA 1PNTA 3SI7A 1VE9A 3AR8A 3FNRA 4YX9A 3I4ML 3TD9A 4F1JA 2NO7A 3NHBA 2DY0A 2ESRA 2WIDA 1ZQ1A 3MWGA 2Q28A 1SJ9A 2O8EA 4CL8A 3SJCA 4XSHA 3ETLA 1ML4A 1PFKA 1XUOA 4X1YA 4ARSA 1DOAA 1CJCA 1GGEA 5FH9A 3ZGZA 1JXOA 5C1OA 1BN6A 3THRA 4DAOA 1W35A 3FYCA 3WWLA 2C2HA 3T99A 4HRAA 2VSNA 3AIMA 3IX7A 3RFCA 2P3LA 4Q12A 1FFYA 1RVDA 2DUUA 3CO5A 2XJUA 2PV7A 4HPXB 1Z5PA 3ZCVA 4CCSA 2FEAA 2VC2B 3I72A 4M4SA 4MV5A 3WYGA 5FPHA 3IERA 4G67A 1YB5A 4QSHA 4UEOA 3K9NA 3T3HA 4L4YA 4O4HA 4BYMA 3MWEB 1NPYA 2JI8A 4RVHA 3ZWCA 2ZPTX 1U3VA 5FA5A 3Q2IA 3DAOA 5CA0A 3MGGA 3T38A 1AQNA 2BI4A 2OZVA 3O8QA 4A8JC 1DT5A 1WTCA 5F1OA 5EJGA 3ZTYA 3WLTA 4XLTA 3EZ6A 1J42A 4KJZA 1REQA 1P2GA 2H5IA 3L05A 2D1TA 4LCEA 3BJZA 3RYIB 1Y8RA 1MHTA 3ONNA 1QTQA 3TZHA 4A3SA 4IJWA 3EUFA 3JPWA 2I9KA 1TO2E 2ZYSA 1AUOA 2C96A 5DM1A 3P32A 2ZJ8A 3DW1X 2CZQA 3IDFA 3NC1C 3KYXA 4L8GA 4R6XA 2Q2QA 2R48A 1UOOA 3H0EA 3FVVA 1NSYA 4TTTS 1ORHA 4UM9D 4X60A 4H08A 4Q9HA 5H83A 3UIEA 4D4IA 1UMBB 2GJ4A 3QQ5A 2VRCD 4HNAB 1GKLA 3RRYA 5TPZA 2BVNA 3H2JA 2Q2VA 3H5RA 5GTDA 1DXOA 1UXGA 3DBRA 4Q48A 4M9UA 3I6YA 3FB4A 3NVDA 3FA2A 4PSCA 1UZUA 3SNKA 4Y2RA 3IOCA 4NF2A 4A3ML 4EQ6B 4AI3A 3IE2A 2YXNA 1I01A 1YUBA 3TB4A 1NSFA 2O7RA 3Q9UA 4AS3A 2WOJA 4JYAB 3NDBB 4YC7A 2I2FA 5F1PA 5TS2A 3V80A 5CXUA 4Q21A 1IB0A 3W77A 2B8EA 1I13A 3WL3A 4Q3OA 1MW8X 3ZS9A 4XH9B 4YJGA 3VMFA 3VH3A 1T3LA 3GLTA 5K0SA 3GG2A 3I4FA 5CT9A 3I92A 4L4UA 4YMIA 2O3RA 4EVQA 4R2XA 4LJSA 1ONNA 2C3UA 1ZJJA 2PD4A 3F3SA 4RK7A 4WT7A 4O25A 5K8IA 1X94A 3C3XA 1S96A 4ZI2A 4O63O 1Y1SA 5D7BA 1LK7A 4BLQA 1GN9A 2QMZA 5J63A 1XKQA 1KDYA 4MUFA 3SFTA 4D8TA 2AXQA 2YW9A 1L5MA 1X9IA 3TLGB 2RAVA 2Y0CA 3TZLA 1SHLA 2F3TA 3PUWA 1Q17A 2H7VA 4EI9A 1P3Y1 1GZHB 3M3YL 4J0QA 1WXFA 1JPVA 3QHQA 1E60A 1IBKB 4PNPA 3H0GL 2PS3A 2ODQA 1RWWA 1W2WB 1TE2A 1ZL2A 3DEFA 3NCHA 3EHEA 4B73A 2CV2A 3Q88A 1EE9A 3FIUA 5FWXA 2C59A 1MAHA 2M1ZA 2ZBGA 3KDAA 4A5OA 1TL7C 1XQXA 3KUCA 3GY0A 1ZI8A 1C80A 2BY4A 3A6FA 4JFRA 3OTOB 1VCOA 4LE1A 2E37A 1GKKA 1C1HA 4YJ2F 2Y1EA 4I3GA 1OX5A 4RVDA 1Z4JA 5GMOA 2R6R1 5DHQA 1N8NA 1Z47A 5I7HA 2UYYA 2RH9B 3VOBA 1GG9A 1TADA 3MWDB 1DJNA 5IEBA 1P9WA 3WJ7A 3R77A 2ZW9A 3A2KA 3FN4A 1WZUA 2BEVB 1K0FA 3GJQA 3PJDA 1URPA 2X5KO 4FEGA 5DTRA 1KAQA 4C3OB 2G63A 5IUJC 3CUYA 2P6MA 2QY9A 5LQCA 3D3EA 1Z2OX 2VCEA 5GM1A 1WE2A 2OY0A 4KSYA 7GPBA 3BH6A 2NVUA 3U3KA 3HV2A 3IAXA 5YASA 4BBAA 4D4HA 4YRCA 1UBHS 2XEXA 3QIAA 4TV9A 4B76A 3SEAA 1JEJA 2ID7A 1L6IA 1QZ3A 2B35A 4MRMB 4FFBA 4FR2A 3JZAA 3FDJA 2G4CA 4RCVA 5HA5A 5JTTA 3SYMA 3N8KA 1LQUA 3VHXA 1Q0PA 5EUCA 2QAJA 4PIVA 1T6ZA 2C2WA 1M1NA 1XI2A 1IIRA 4LZLA 2F3QA 4TKLA 1M34E 4FYPA 3P8ZA 3WGKA 3RRJA 2VQSA 4RCYA 3W05A 4FNAA 4Q15A 3NJ4A 4PXSA 4WLVA 5FNVF 2VYVA 2H5LA 1CZOA 4KPFC 5EJ5A 2P1DA 1L4FA 3FRHA 4J7XA 1RJEA 2XUFA 4Q4AA 1M2VA 3GRRA 1TM1E 2GSDA 3OO1A 1RHJA 3S1SA 4BMCA 5IRCD 2WVAA 4DPMA 1G0OA 1M67A 2HGSA 3B6KA 5AVZA 2AE1A 4Y2VA 3RFFA 1UJ4A 3RF6A 4LHVA 2ZBVA 3R5TA 3DJFA 1Z33A 5DLYA 2UUAB 2R86A 1M33A 4DKXA 1ID8A 1ZITA 2FP3A 3M5PA 4MWBA 2AI2A 5EP1A 5AVQA 4YACA 4A0SA 2VRWA 3F67A 3EB9A 3SWWA 4AJ9A 3QVSA 1XN4A 3E1GA 5F23A 4IXWA 4Z4CA 4WZBE 1EXVA 3KR1A 4ZYZA 2YXDA 3HN2A 4PHHA 1SNYA 5AJUA 5I3CA 1L7OA 1AUPA 3BIOA 1CUAA 1SXJB 5FOVA 2H3EA 1J0AA 3ZHUA 4EX7A 5AJHA 2ZAGA 3N9IA 5J9FA 1BWSA 3KJZA 3QUTA 3I1FA 1RRCA 4I5GA 3CQZL 1W1WA 2GD1O 1HDEA 4ZC1A 4L0QA 2P0YA 1UMKA 5E6SA 3JX9A 1K6EA 4OMDA 1LX6A 1H9BA 3C3BA 3O8OB 4Z9XA 4C3IL 1WLYA 1N5IA 1XMVA 5DEIA 3OEEA 4ZMBA 4QM7A 4S35A 3T9AA 2QN3A 1Q1GA 4V1CI 4B75A 3DBIA 4YAUA 2JFBA 2O50A 1GEGA 3VJRA 4OAPA 4IEIA 3SJ7A 1B6RA 1E9BA 1GPYA 2PSHA 2QQ0A 2XY4A 3PNYA 2B69A 4NONA 1AT1A 4BEVA 2HJRA 4RVFA 1NI5A 1V6SA 2REQB 1G6OA 4O1IA 3SK0A 1DBVO 4DY6A 3MELA 3A1TA 2PWPA 2XE7A 1C4KA 2ZR9A 2CCGA 4PLCA 3KM0A 4RAQA 1PTJC 3LC1O 3PNOA 4PGFA 2HJVA 5KTSA 1TQDA 1ZD8A 4WZZA 4DA0A 1U2DA 1HKUA 1RYYA 3F47A 3L5OA 1I8TA 2QT0A 2FMXA 1FYWA 5BR1A 1PJAA 3CF4G 4NBUA 4Q3NA 1U0RA 3ED5A 3E3OA 4JLKA 4M87A 1A8PA 5EAIA 4PAGA 4NL4H 5DLPA 2CVPA 5JCOC 2C95A 4MMYB 1NAHA 1C2YA 1NLMA 1PR9A 2Z04A 2VDRB 3E8SA 3L0DA 1MXHA 3SQLA 4BMVA 1W0KA 4TWBA 4EY4A 1HNZB 1UXIA 4AZTA 4UCWA 5IARA 4IOKA 3HKBA 5FUBA 4B2LA 2H2IA 1NU6A 1WXWA 2AFIE 2QLLA 3F8TA 2Q29A 3IO3A 2O20A 3OE7D 3JWPA 4O2BF 4ZQFA 3U4QA 1C0EA 4AT1A 2OHFA 1IULA 1J06A 2XNJA 2OLEA 3HCPA 3MNFA 4CIBA 2FRVA 3QHAA 4HCJA 1GNPA 4MUYA 5DWDA 2R5NA 5TQ0B 3OOSA 1MO4A 4KQ1A 2VHWA 1UJMA 2YMMA 1N0WA 5LB2A 5KYGA 4LY9A 3OX4A 4JYPA 1JLRA 3MCTA 4RF5A 3OAAD 3EXHC 5TLSA 1XCOA 1XO1A 3U19A 2HJHA 1E3LA 3F74A 2X7JA 1PHRA 4B32A 3L4JA 1VCXA 3F73A 5G4LA 3BX1A 2ZB7A 3U81A 5A4IS 3UJCA 5I7AA 4BY9E 3TUIC 4FDMA 1QS0B 2JEZA 4O4HB 3IEKA 4YYEA 1XTUA 3PNVA 5T4FA 5ALUA 4I8IA 2YWFA 3MAJA 4E31A 4EW6A 3PX7A 1WF3A 1BXGA 4JELA 4DE5A 3JQPA 3QXJA 3KAJA 2PZEA 3PC8C 2E4XA 3TQSA 3CVYA 4IZOA 1QHYA 2A7XA 2Z4SA 4H60A 1L9XA 5C0OE 2J3QA 1SBNE 3H42B 4Q00A 4DYDA 3W1VA 1Y8RB 5IVPA 3SIRA 1VOTA 2PMKA 1J24A 1NBEA 1Q0LA 2K7ZA 5J2TF 1BE1A 4DMRA 1AU9A 5BP7A 1J0DA 2AYZA 1G20A 5FXMA 1OV6A 5A4AA 3ZNPA 4EMSA 2J7KA 5IU6A 1DWPA 1L5OA 3GHHA 4N5MA 2GFQA 4CQMD 4BNLA 1DKOA 2BI7A 1WMAA 3K6SB 1FDWA 1T3GA 3R8CA 1G9TA 2IOFK 2ODEA 3NPMA 1X42A 2PGJA 1H2WA 1IG3A 3BHIA 1N4DA 4D2IA 2CDNA 1Z18A 4C9BA 2GZMA 4J0FA 4LC1A 4QUDA 3H1AA 3KALA 1U28C 2ZSBA 3HKDA 4UM5A 5FOWA 1BCSA 5CYPA 2IDKA 2ZS9A 4LI0A 5AK5A 3H5IA 1YB4A 2PQ2A 3GLRA 5SZKB 3LKVA 2P2SA 1HZZA 3SJAA 3G13A 3HCWA 3OIYA 4U7FA 5D3ZA 4TWJA 3TOCA 3C6QA 5J4YA 2BPOA 2ZE6A 1WNFA 3G2MA 4LJYA 1T9KA 4EPXA 2WU4A 4YMUA 1BMDA 4KQEA 5E9JA 1N25A 1RJ9A 3CZCA 3ETHA 4COKA 4DF3A 1F51E 3KHKA 4GBMA 2PMDA 2GUGA 1VJTA 1XEWX 3M9XA 3LLCA 4D1YA 5BVGA 2OCDA 2WJPA 1LDBA 1U7OA 2DSTA 2YVUA 3HFRA 2ID8A 4UTNA 4A36A 4FZVA 2RHCA 2Z6AA 2QUHA 1BS1A 1VZ3A 3TYXA 5LP1A 4B34A 2Z30A 4RHEA 1CPYA 2OKGA 2SECE 1J8DA 4G8CA 5MGBA 5IVDA 1O8BA 1SC1A 2I3AA 1UDRA 3FUXA 2YWHA 3BGIA 2QV7A 4JT9A 5AXAA 9GPBA 3RVBA 4P86A 5T3YA 4HV4A 1OH8A 2YIVX 4ZVSA 1DBWA 4CDRA 4M7RA 2NWQA 3ZZNA 2CCJA 2QRPA 2ZT8A 3K6KA 3LUAA 1VG0B 2GM5A 4Q9DA 1FQWA 1NKVA 3DM9B 3JAMA 3HFGA 1CZHA 4LBZA 1UMCB 1E9EA 3RADC 1PJRA 2L69A 3AKDA 1VHQA 3Q72A 3UOWA 5T5QA 3W06A 2YRFA 5KREA 5AN9H 1YK5A 4HNSA 4MS1B 1ZSNA 3W5SA 3BAZA 4ZO6A 4Z6KA 1W44A 3HUEA 3AHIA 1XXHA 1ISMA 3CLSD 1KSGA 4POFA 3JQ8A 4AJIA 4NR0A 3CX7A 2ZRFA 4KFTA 2CXSA 1GAQA 1GJRA 2I3BA 1Z08A 3MT0A 2N47A 4YRNA 1W34A 5C80A 4K0KB 1U1GA 4ARBA 4IIUA 5BQOA 5KYNA 1OZFA 2DTXA 3TL2A 1W94A 3GNSA 3LQKA 1MDBA 5H68A 1PV4A 2CFSA 1EXWA 2FZCA 1XKTA 1EHIA 1CIPA 1QLWA 1YJAA 2XUHA 3SYNA 4KIFA 3HBJA 4YJHB 1IG0A 1DQZA 3V6MA 4PBRA 4ZAXA 5T4BA 5A1JA 3RHFA 1Y4ZA 2QU8A 3C98A 4DBVO 4Z1MA 4RTNA 3R7AA 2C8LA 3HDHA 1F8YA 3ABRB 5F78A 4YWMA 3ONVA 4D92A 1WUKS 1ISRA 4IVPA 5C8VA 3T3OA 3KUDA 3WQBA 5AKEA 4B45A 5KYUA 3W78A 1MD9A 4KQHA 1Q16A 1K27A 3QWFA 5D3KA 1QFZA 3G9UA 4D98A 4ETWA 2ACKA 5BN3A 3RB8A 4I6GA 3X1WA 3CH5A 5CIYA 2C2GA 2YYAA 3KSMA 3MXTA 4AWAA 5B55A 2EL9A 5C81A 5J23A 4Z7NB 1T9CA 3V2GA 1HRDA 1X3SA 1Y37A 4ER7A 2O0KA 4D3ZA 4KXQA 4ZVTA 1T5OA 1KQNA 5IP7L 3FYDA 3UT5A 3V48A 1G3MA 2VA9A 3ETNA 1EZZA 1FFHA 1Y7LA 4LSZA 5PGMA 4LF7B 4CLXA 4UBMA 1NNI1 1L3CA 5CA1F 5JAOA 3P19A 3WGHA 1PR6A 1QMGA 3N58A 4BZQA 3IR7A 1CSEE 1YR9A 3QW2A 5E6RB 4M36A 3RC9A 3ZX5A 4U0JA 4AMUA 4CT5A 1WOYA 4L15A 3L6EA 3HI4A 1GY8A 1L1EA 4G8JA 5FUMA 4X90A 1G7CA 3NBYC 3SLGA 3WHKA 4GR4A 3U5TA 3QX3A 2Q41A 2QQGA 1DEXA 3D7RA 4NOLA 4ZZ2A 4EY8A 7REQA 4ED9A 4G1FA 4OV6B 2ZPUA 3MA0A 2C31A 3OTWA 4L85A 2HEIA 2J9UB 1NRXA 4KR3A 1F8UA 1OPRA 4YAWA 1X70A 2ERYA 3O38A 3GXOA 3HVRA 4RAOA 4M8KA 5E6SB 1T2NA 3U9LA 3D3WA 1JJFA 5ALDA 4F60A 1YRLA 3C15C 1Z2PX 1RPZA 2P2ZA 4ZQBA 1WZCA 2O7QA 3A6HA 1XRPA 3SC3A 5CAEA 2KJQA 3REQA 5AM3A 4QJ5A 4HAVA 1SFOL 1ELOA 3QFTA 3T9DA 2VI5A 2B7CA 4BFXA 1OY1A 5IKPA 5K0CA 4K9NA 4NE2A 3RAGA 1E2IA 1CUHA 3WO1A 4D9FA 3K1JA 1L5KA 4KPEC 5EZYB 5MN6A 5C8XA 3AM1A 4N8EA 4UQPA 1STOA 3QOFA 5CFNA 4GE3A 4AKSA 4ER3A 2JBWA 5K0NA 3KKEA 4URUR 4YRPA 1N9KA 5AKYA 3MTAA 4L76A 4NYIR 2IPXA 4JH0A 3NH6A 1P62B 5KHOC 4IILA 1P74A 1YC5A 3MMSA 1VFNA 2JVJA 5A3QA 2J46A 4J2OA 1BVUA 3QLVC 2DHCA 4NAVA 1S2ZA 1P9LA 3X1JA 5LJLA 3JVVA 3LGSA 1QE3A 2AYXA 4QXAA 2CB9A 3N0WA 5G0UA 3UK0A 5LP6C 2C1XA 2FX5A 3OEHA 3W7AA 4D56A 4DIDA 5KX5F 1LLDA 2R1VA 4J03A 4TL8A 4Y0AA 2W58A 5CLIA 2Y1CA 3E53A 2X15A 4YUWA 4LKOA 3RO7A 1PW7A 3DOFA 2V98A 1ORTA 3AI3A 5C35A 3U4QB 2KX7A 3BE8A 3TTWA 4PFJA 4KNWA 3MUEA 1A77A 3VTZA 4LDZA 2JLZA 3H9QA 1DIRA 3C70A 1FYEA 3D2AA 4G0MA 4R51A 1JEYA 3IVMA 1PZEA 1Z7BA 4G65A 4ZPJA 5JJIA 3V8RA 2K2QB 4HVLA 3AY3A 4RD3A 4G2NA 3LLUA 4CMKA 3I6BA 2VTBB 1CDDA 1H85A 2R6CA 4L07A 4H6VA 1Y48E 3B6MA 2Y1FA 3I28A 4KWEA 3ZOZA 3FF4A 3HVIA 2W0MA 4YCBA 3ESQA 5JPCA 5K8VA 3JW8A 1OWCA 5CK5A 1QWSA 1R00A 1CNEA 3KHUA 2QW1A 1G66A 2J3EA 3H6GA 3PNBA 4C4XA 2B1JA 3BM5A 3G23A 3L84A 5DIZA 3UANA 2L2QA 4JI6B 1L8AA 3II6X 1BXGB 2WU0A 4YUAA 3UCEA 1SMUA 5AM0A 2VAXA 3WGIA 5JVDF 3T9FA 3CKKA 1E94E 3WOVA 3D4BA 2EZ8A 3UXHA 1EGAA 3QVUA 2GK6A 1N6NA 2YS7A 5FPKA 4YRIA 4UU0A 5H4HA 2V1XA 2JJ1A 2PBZA 2IYRA 2UZ0A 3MHPA 1ZIYA 1CY4A 1G20B 1QCDA 1YOVA 2EFJA 3B6JA 3L79A 4WASA 5DSZA 1XZMA 4EEKA 1HORA 3BD8A 4MK4A 3AYXB 4J8PA 5K9ZA 2JLBA 4WFQA 4NH0A 2NYDA 2PT6A 4KUEA 5CD1A 5GONA 1XLTC 4BRUA 3NRBA 2W43A 4J1TC 3ZDCA 1DMSA 4LOHA 3CZ4A 4HEA6 1HL7A 2A0YA 3CUEF 3RC3A 3AJ8A 4CN8A 1HTTA 4R16A 4CIWA 3IODA 4X65B 4OO3A 1G5HA 4X45A 2HLHA 1U8ZA 3P4YA 3KYJB 4ERXA 3KJNA 1C2TA 2C5BA 3LD9A 1SU6A 1FTQA 1A1SA 1N4AA 2NN3C 2C00A 3BC1A 3DA8A 4NTZA 4WCDA 3RYHA 4AN0A 4D43A 1SQSA 2OLKA 2QTCA 2CHUA 1EDBA 2HSDA 2OD7A 1SOUA 3ACCA 3HBFA 3LVRE 4RSRA 4AYXA 3D6NB 4ENRA 2QHXA 4P9NA 1W2HA 3WGZA 4BNYA 1E4YA 1G21E 2HHAA 1QP0A 3U3RA 1CDOA 3GQVA 3HRHA 3PDUA 5BVGB 2NZUG 3VVBA 5CB4F 2EKBA 4AD8A 2C83A 4KC0A 2QRLA 2N75A 4Q7LA 3AILA 1S9DA 1QG2A 3BJEA 3TGPA 2DYKA 3H1FA 1ZX1A 4DR6B 4HQRA 2VYFA 2I7CA 5AVYA 2PSMC 5BYAA 1KO8A 1NNSA 3DVSX 5M5XL 4BP3A 2DBQA 2BBTA 2I1WA 1B16A 3I76A 2PUEA 3L1KA 4IF6A 5TJ9A 4JI5B 4DUGA 5KYWB 5G40A 1J4AA 1JU9A 2R5WA 5ALKA 1O0BA 5KNLA 5CM9C 1RD4A 4KGZA 1KPGA 3O0TA 5HIJA 4P22A 1MXFA 3RZ6A 1N3BA 2D2IA 2GPSA 4LOKA 1XLUA 4KOAA 1L5RA 1Q7TA 4GKBA 2RHTA 1OQAA 1EGQA 1EGHA 1M0WA 4HLNA 3VPBA 3KTFA 3P9ZA 2CJPA 4D9GA 4ZN6A 1A9OA 4L08A 4M99A 4URVR 4GOKA 4OYRA 2B1IA 2IEZA 3E0XA 4IIYA 5E7MA 3BFVA 3HO1A 1KR5A 2H29A 3L4BA 2JFYA 1FXWA 2QX8A 3ZU6A 3ZWKA 4DDWA 4ZAYA 4UDNA 4U7HA 3S8EA 1KQ3A 1MU0A 4UATA 2HSJA 3TD6A 5K6AC 5E3HA 1G38A 1P1JA 2GXSA 1JPNA 1DG9A 2WDZA 3RAJA 1IUKA 4AY4A 1X7XA 2HA2A 4M37A 3IBFA 1W9HA 1AHPA 1RM3A 4Y1GA 5HFJA 5IZ4A 1ONOA 4FHEA 4YCSA 1EK0A 2EBWA 3SYRA 5KSOA 2ILVA 2ERJA 2AYYA 3G0BA 4Y98A 2UU9B 3LCVB 5AVTA 4KYTA 5LYJB 5CLGA 1CW2B 4KUHA 4QA9A 1RTKA 3ZK7A 3WWCA 4KVAA 2B4RO 4O0LA 4HNTA 1E32A 4PG4A 4CFZA 1IY0A 1I6LA 2VAMA 2ODWA 4UBIA 3TE6A 2K2DA 1J70A 2NUTA 3K94A 2M6PA 3HCOA 5TJHA 5AW0A 5ESRA 4EG0A 1MQSA 4JXKA 1WO8A 3DV0B 5BNFA 3EY4A 2EP5A 2CLIB 3FUUA 3WLQA 1OIVA 4QZVA 5JT1A 3L06A 3WLOA 3O0DA 1XA3A 1YXMA 1Z68A 2O8VA 2NV2B 1EFRA 1C7ZA 4U3JB 3SXPA 2J30A 3OT1B 4L74A 3IP3A 1ND5A 2LCIA 1AQJA 1GUAA 4IEEA 1KEWA 2VPQA 3VKWA 4V2IA 3DHEA 2Q49A 4RLFA 3AT1A 3BIXA 3MPOA 3TG2A 4DR4B 2QV0A 1E20A 1JH9A 1E7SA 1H4SA 5HMMA 3E9DA 2DR3A 3ZD9A 2Q3EA 1BMFA 4RVOA 2PA3A 5EHGA 2CHGA 4E1AA 1O54A 2H51A 5I8ZA 2JK0A 3JD0A 5KWVA 1FYFA 1ZKMA 4BFCA 3GH3A 5A9RA 1FZQA 3JD1A 3DGFC 4V0LA 3FYUC 2ZTSA 4QGAA 2VATA 1GUZA 3KWJA 3TOVA 4XPZA 2NIPA 1NRWA 5ALZA 4RF3A 1ZVKA 5DO9A 4QE3A 1FNBA 3BZBA 5FFMA 1RKVA 2P7HA 2RK3A 3P52A 4MUBA 4B80A 2OILA 3H3FA 3H18A 3GLFB 1NNQA 1QM5A 2FZLA 1JFSA 4DSOA 4HWTA 1UR5A 5EY5B 5T57A 4L1KA 4E08A 4ZZ1A 4Z3OA 2ACWA 4L8WB 5CDSA 2CLLB 1HQYE 2G70A 2ZRHA 2UV8A 3V97A 4IY1A 3B78A 4K9MA 1E0KA 1XD2A 1A2KC 2EY4E 1I4TD 1L4YA 1MIOA 1X1QA 2IXAA 1NLYA 2IW1A 4ND2A 1NBMA 2D1YA 2HH9A 3Q9LA 4XJSA 1GG2A 1X1SA 2APOB 1MVLA 4B1FA 1TD9A 2V97A 3QY0A 2GVZC 2VH2A 2QRVB 1X1CA 3OF3A 1QPGA 2RH5A 3H87A 4G9GA 2ZRDA 2XMBA 2AMJA 3N53A 4OQZA 5FO1A 5FLEX 4C4AA 5FWDA 2FWJA 2VYCA 4NG5A 4B8ZA 1SVWA 4CKBB 1GUDA 5M04A 2AKAB 3LT5A 4RPGA 4TTSA 3I2JA 3RVQA 2NO0A 3SHFA 2B8WA 1KKUA 1X86B 2C7PA 1JA9A 3TTVA 1R10A 4YI5A 1QFSA 3OTQA 5DN9A 3LGXA 1E3WA 3NM4A 1E98A 1XPUA 1XP5A 3PUIA 2P6NA 3VR2D 1RLJA 2FFRA 3WLHA 2BR3A 4YR7A 5HGXA 1RI2A 3C45A 4TKUA 4E1VA 3MC1A 1V8OA 4ZHQF 4V39A 2DPHA 5JCJD 1O6CA 2EARA 1L7AA 4R9SA 5KVSA 4PY2A 5IASA 2BSQA 1A9ZA 4MDHA 2V7UA 2W2MA 4TMFA 3NASA 5DTEA 1MP0A 4FKBA 4BP1A 2BM1A 4UEJA 6PFKA 1U7DA 1YD7A 2F3PA 2P9JA 4G09A 4L3WA 4IYRA 4DQKA 5E7IA 3MUFA 2GI4A 2HDOA 3OZRA 3IAEA 5KYVA 1I1QB 3NGLA 4X1IA 4BXOB 2OUKA 1ZGGA 2BGIA 4FD2A 3U3ZA 3AOEA 3LNLA 1M7GA 3H5VA 1AK1A 3ZY2A 3HP4A 1JEYB 1H9AA 2CKAA 5FYQA 2Y0PA 4FHGA 1P4HA 3TI9A 4XWAA 4OB7A 1NQTA 3WWNB 3S2FA 1FJHA 1TJYA 4JUDX 4D02A 4E07A 3ZDBA 5HKKD 1XWIA 2I66A 3ANTA 3AEYA 4P31A 1P6XA 1QC5B 3GIWA 4Z9AA 5KOIA 4JLWA 1RQNA 5AM2A 5KNBH 2GM4A 1T0IA 4MKIA 3KQYA 1HE3A 1U5BB 2H4WA 1CVRA 3DWGA 3U44A 4X9XA 3IOBA 4PICA 3RUHA 3HG7A 4DIOA 1XZCA 4JWKA 3RYTC 1ABEA 4XLLA 4GOND 5CXQA 3FWKA 4D5EA 2FOIA 3GVCA 2GQ0A 3RUPA 1TZCA 4RFSA 4BO2A 4GEKA 1Y89A 4W5QA 2R8EA 4LPSA 3WDKA 2D06A 2GPNA 3VC3A 4NARA 2PVCA 4E22A 2Z1DA 3IV9A 1L7PA 3LVFO 4B44A 3PYMA 4TMYA 2OXCA 3W2TA 2HJGA 1I5OA 3NFYA 3ML1A 3SX4A 3QSYA 3VUFA 4IL5A 1BFDA 1D9XA 3CO0S 4LQ4A 4AI6A 1AKEA 3ZZ0A 3H04A 5TMBA 4F5DA 3KK0A 2GERA 3QUCA 3KXKA 3O92A 1T6YA 5GINE 3OJ0A 3HCEA 4FR5A 3FRJA 1KOGA 3JASB 1XEFA 2Y77A 3I6IA 4UU7A 3WL7A 3R7WA 2A5DA 3BIFA 2BKAA 2JGKA 4ZO8A 4DR5B 4F5ZA 1B0UA 4N0PA 4LMPA 2IYYA 1O2DA 2A5YB 3WL4A 1LLUA 4TS4A 2YMQA 2ZU0C 1L8OA 3AWDA 3GEHA 5DXFA 2JLSA 1FVHA 1U9ZA 3E05A 1QKIA 1TEHA 1CJTC 1GR0A 1PQYA 2XYPA 4A0QA 2HCBA 3EZ9A 3RC1A 1EAMA 5C7IO 2I2DA 1R8JA 3AEZA 4IG4A 1N9GB 1P7WA 3GD5A 1L1RA 1NW3A 3M1YA 1CEEA 3G5LA 1E5VA 5FOSA 5EKTA 4CEJB 2QSUA 3INGA 2PL9A 3CW8X 4DVGA 1M1YA 5KHAA 1N3YA 2R66A 4AY3A 4G8BA 2B37A 2VNAA 2WG1A 4K40A 2MYPA 5M34A 1ZVVA 4URHA 4YJ2A 1GM5A 1S7CA 1P91A 1TKAA 3GRKA 3UAWA 5ADWA 2DHRA 5HSGA 4MJ7A 4G6ZA 4G97A 2RC6A 5DLQC 3AESB 2JHFA 1JJAA 3KX2A 4MUNA 5CH5A 4DXDA 3U16A 1VLZA 4KE6A 4RGQA 1J07A 3ODPA 1FDUA 2OFOA 4Y9TA 2PCLA 3AF3A 2VNSA 3VGJA 1FW6A 3DF9A 4BNVA 1CP3A 1MRNA 1RWXA 1MJ5A 1FVOA 2IZ5A 4QDUA 1TWAL 1UF9A 1ZZGA 2PZLA 3C7KA 1KY3A 4MI1A 1ODCA 2C42A 2PJDA 2K2WA 4QUJA 1NIPA 2W6NA 2JCYA 3D43A 3K2BA 1Z2AA 3ELWA 4AMGA 1RXSA 4KIUA 2V3BB 1C81A 2QJOA 4XCQA 2XCIA 5I7RA 5JQGB 2JA7L 2JFZA 1UQTA 2HF9A 2LCFA 2ZETA 2PFSA 3CTMA 1RWMA 3IBCA 3O3CA 4G0PA 4IW3B 4MGIR 4YRZA 4P08A 4BFUA 4BEWA 3K9WA 2CFIA 5TY0A 3R7FA 1SZCA 1VLLA 4JBYA 4N7RA 4CKYA 3IS3A 1QYBA 4N54A 1TWCL 4EMTA 3MCVA 2ZCUA 1G19A 4R2JA 1ULTA 1NT2A 1Y3AA 3PICA 3PUKA 1RW4A 5A7GA 2ZUEA 3DZGA 1ZY2A 1ADYA 3PXXA 2OHGA 4I2NA 2KN9A 4LG1A 2Z98A 4YJ3B 4N4AA 4NJMB 3MPSA 1F2TB 1TM3E 2XT6A 4UFNA 2JVIA 4CMAA 5EIXA 2N0SA 3ZCSA 5EJ7A 2UXCB 1UJ6A 1NRIA 5AVOA 2JJ2A 3LG2A 2ZYWX 4KXUA 5E2BA 3BA1A 3MBKA 4ZOBA 4NRDA 3Q8MA 3J81A 4J3JA 1UBOS 1VMKA 4YAOA 3ZIUA 3IP5A 2X5NA 3QEJA 4JY7A 4CF5A 1EXNA 2XKJE 4GRIA 1SXIA 2QQ5A 3JPYA 3HXKA 1Q20A 1YHYA 4IIBA 3FDFA 4PLGA 2HREA 2IEDA 2PUCA 2PUFA 1Y1PA 4BQPA 3NXKA 3EF3A 3AHJA 3FKIL 1PR2A 4EBBA 5JSUA 1XK6A 3IP6A 1OXXK 4MS3A 3VZRA 2FRDC 1C3XA 1XTJA 2B4AA 2YQZA 2UUCB 3H9CA 4A3DL 3INRA 3VZCA 2OCYC 1DX9A 1V26A 2X77A 4FX5A 5THXA 4KDEA 4XB1A 1B2LA 3LVQE 1J2TA 3JYQA 5K3FB 2PVSA 3G2JA 3T9EA 2RGXA 4FONA 2HIGA 4M1KA 1CQIA 4AN1A 4UHFA 2BEWA 1BH2A 1XHFA 4DUYB 3SIXA 1BQEA 4J43A 3KKQA 3JVEA 1JEDA 2K87A 3RYCA 3AM5A 3H9GA 4INAA 3G79A 3QPAA 4RH0A 3GW8A 3QF4A 2ZBUA 4YPVA 2IZ0A 1PNVA 4M46A 1TZJA 3EUAA 4EVIA 2V6FA 2Z6UA 2PSDA 2WD8A 1JPJA 3SM9A 4UNRA 5AICA 3H8VA 1ZHHA 5KKNB 5IH7A 4AICA 5DSTA 1GAJA 2OHHA 4OYHA 2AC4A 3O91A 1P33A 3DCYA 4MA5A 3NAGA 2DF8A 4JB2A 4E30A 3BK7A 1J56A 3NFPI 1DUIA 3LI2A 1P0PA 4B0PA 4QUEA 4G8DA 4F84A 2PX3A 3B48A 4LTNA 1BKSB 4ZVKA 1S8NA 1J8QA 1QG0A 2C2OA 4F71A 3MPUA 2A9OA 3FSGA 3G8BA 1GZ4A 2D4AA 3DYIA 4YCCA 1A98A 4LWPA 2I80A 4BKPA 2WMOB 1PZMA 4P7KA 3ER9A 3CNNA 2EBFX 4K9KA 1EKXA 3OQHA 1IK6A 1MZVA 1G41A 1MQ8B 3HHEA 1MIOB 1FP7A 5JBNA 3R23A 4B8WA 2IBMA 2JAUA 3EDOA 3OQVA 1OV4A 5B1SA 2IYAA 4F46A 3UB2A 1SB8A 4ZT7A 3HXQA 1IEWA 3FDZA 1RADA 3AUUA 3E7FA 3EVNA 4I1VA 5CW1A 3WLSA 5I5GA 4WBNF 1ILEA 3MTQA 3LWDA 3HWSA 3OQ6A 1C9YA 4RLQA 1TCCA 1KFCB 1ZL0A 3GNLA 3JQAD 5FNZA 2DTEA 3BMQB 2GTPA 4BN5A 1DWQA 4D9CA 4BZZA 4K9FA 1HEUA 1H65A 1KIAA 5CEEA 1SG9A 1E3WB 3UMBA 5BXQC 3B8HA 4WXPA 3H5NA 1KI7A 1RRMA 1FVFA 2VA8A 1J2JA 3PNKA 1FNNA 1WP4A 2YYSA 1E9FA 2ZTMA 1GNRA 3ES9A 4UUPA 1E1CB 2KSQA 5EL0A 1HLPA 3DLPX 1NE2A 1IM5A 3BB1A 4P4UA 2JLWA 1M6NA 2ONKA 1LBQA 3ECSA 4QQ8A 1L5NA 3JQFC 4EMBA 4XUEA 2P2CA 3EG9B 4R4JA 2ZWOA 2VUHB 5HZHA 1JSRA 1NJ1A 3LUBA 3MMZA 3G0GA 2V6GA 3KAPA 3QFRA 2EJWA 2YINC 4I50F 4MGYR 3PUYA 5CJPA 1OFVA 4LNAA 1QIKA 1HSZA 4P3PA 3KXLA 4JXZA 3E4DA 3EQ6A 1E0JA 2ZAMA 2G71A 2WM2A 3EF1A 2WY2D 1C7JA 2UZ1B 1SUCA 1M66A 4BRWA 3UXMA 1WPGA 4MW6A 4TL6A 1R37A 2Q46A 4DEVA 2XMDA 1W36D 1U7WA 2HX1A 2H4YA 3D8HA 4IIDA 4CM8A 3GTGL 4DZRA 3COPA 3F5FA 4UBNA 3DWIA 2HK7A 3LOQA 2E5LB 4GX0A 3VC2A 2EHDA 5AUQA 2C7RA 2W4MA 4PZ0A 1IM8A 3PUHA 5IJ9B 3KHSA 3FR7A 1L4GA 1NXGA 2O5VA 1UDXA 1I0IA 2YN2A 1ISIA 3HN6A 1N5RA 4KG7A 2AE2A 1GPUA 4A3IL 1DINA 2GWRA 4Y9UA 4Q7JB 4HAWA 3DVAA 1KXJA 3A9CA 1P73A 4XQ0A 5LQAA 1N36B 3R5JA 2ZWAA 1IJKA 1NN3A 5HQJA 4UOZA 4LVNA 3PIP1 1SH7A 3WKBA 2QGFA 3JVDA 5CB6A 1KA9H 2C03A 4YRGA 1K7FB 5AXBA 3TZ6A 5JV5A 3LKDA 2D3WA 1KVTA 4G0OA 1PN3A 1KJZA 3FG9A 4W6ZA 4ZIRB 5K6RA 2AX4A 4FKMA 5KTOA 4FXOA 3TCNA 2O19A 2CXHA 4GSLA 4Q1CA 2ICAA 1Z07A 3GDOA 1ADBA 1R0WA 4GBED 1W76A 1U8CB 3BCHA 3RFVA 1I7SB 1Z4IA 3OZAA 5E4FA 3GGCA 4G0ZA 3TTUA 3LUPA 2YHIA 1LBHA 1RZRD 2WNHA 4Q03A 1DVRA 5LZ2A 1Z17A 3JARA 4BO4A 3BK2A 3F71A 3QVLA 3O7WA 2BOVA 3AHDA 3EIHA 1R74A 2I6FA 1QGUA 2GVDC 4UXHA 3W6UA 2R9VA 3VAZA 1EZ4A 2YV1A 3BRSA 1EBBA 2XUJA 3WI7A 5EIOC 4TLAA 1FA9A 3V1YA 1W4AA 3U7RA 3E18A 3WLMA 2XCUA 4N12A 3C8DA 4P8RA 2P2GA 1MA3A 2EKLA 4NBWA 4CUZA 3J81k 5KTMA 2JIOA 1DT3A 1WDKA 2GDZA 4GX1A 4OLHA 2HMAA 1HT0A 3QNMA 1I24A 1O4VA 3GN1A 3RC2A 5FQNA 3EX7C 4YJ2B 1EFHA 2C07A 2Y93A 2MYTA 4I5IA 4JVSB 3SX0A 1SPXA 1JKFA 1T1GA 2ODBA 4QWWA 2H63A 4WKOA 1KBOA 2PANA 4CM5A 4ESVA 1D09A 5C1IA 4HDCA 3PZAA 1MKYA 1N5MA 4U1RA 4PYJA 1SXGA 2C20A 2O2EA 1KEPA 4JDPA 2LKDA 3CT6A 3GJ4A 5DYWA 3KCQA 4FOTA 4K9SA 3CRZA 3IJEB 4HQNA 4I3FA 3D2BA 5DX8A 3WK6A 4MITA 4Y6PA 2XNCA 1GFIA 4A8JA 5FDFA 3T5PA 3SR0A 4DREA 2P8JA 3DL2A 3N8DA 3L1UA 3P0FA 1IAQA 2FPSA 1H8HD 2O0MA 8ATCA 3OQOA 5K3CA 4L22A 1N5KA 1U8TA 2BM9A 1RXEA 1P4RA 1DRVA 3OJWA 1EI9A 3R6GA 4ISCA 4JC5A 4BZPA 1UZNA 2GPBA 3CE6A 4EPTA 1GRVA 3HJFA 5FX2A 3FLBA 2FP4A 2NPFA 1XZJA 3FD8A 1IY9A 4YJKA 1Y7TA 2O48X 4AMYA 4AYTA 4PHGA 1VPWA 3DOHA 2P6RA 4CL3A 4IGKA 1AQLA 2JFQA 4RHXA 3OIDA 4RMHA 3IYLW 3PPIA 3F6EX 1DTSA 4NE9A 2ZBQA 2ZDQA 1L1FA 1G8SA 2GRUA 2VT3A 2D5LA 1SCNE 2Z2ZA 4FXPA 1EDEA 4MV9A 4GC5A 4X1OA 2XOKA 5GM2A 4BLPA 4F3TA 4IFTA 1AH2A 4L50A 2AFHA 2EFEB 4ZYYA 2V4ZA 2EIXA 3K0SA 4NP6A 1AURA 1GTMA 1GXSA 1EWTA 1SVNA 1ORDA 1UZMA 4RS4A 5EE0A 4D9NA 2H52A 4JDUA 5CH8A 5AHRA 2ID4A 4LQDA 1KQGA 4W5TA 3EAFA 3I9OA 4O4IF 4M9XA 3CG4A 2FFBA 1ZINA 1IN5A 2RAFA 3W2HA 4DARA 3AINA 3AUXA 4WKNA 4JLUA 1Q7EA 2PTHA 3GTQL 3NM6B 3W90A 5JYCA 4JWTA 3QE9Y 1KVRA 3LOUA 5M2QA 4E5NA 3AF6A 1KS9A 2NYAA 3QKUA 5JNUA 1L7MA 1U3GA 2XGSA 4NFSA 3WB2A 2WILA 4B40A 3L6CA 5FR2A 5JJBA 5AQEA 1CUBA 3ORQA 3KTAA 4YT8A 1D2CA 4LHZA 1DJLA 1OC2A 3MWYW 4XAQA 5MDHA 1PT5A 1F6DA 2FWRA 2PT7A 4HAXA 4BOYA 2FR0A 4L8YA 3B5EA 1C9NA 1CYDA 1I6KA 1RDVA 2VFAA 1KJ9A 1T8TA 2ZS8A 3FBWA 1L1QA 1U1IA 4HAUA 4HDAA 4HB2A 4GVPA 2X1HA 2VPZA 4HUQB 4J2TA 5DM4A 2JLUA 4GS5A 4O29A 4IIEA 3ERCA 4CW7A 4OI4A 3VI3B 3RYCB 3ZLJA 4U00A 1GVNB 3A6GA 4ZVOA 3AFMA 3GP3A 2F3RA 1ADFA 4G4SO 4GS7D 1RKXA 5KCMA 2HW8A 3G0HA 2J9XB 2P4HX 1LNQA 5KDDA 2Z1NA 2FWAA 3IELA 1J8FA 1IHPA 2P5UA 4BNUA 4S05A 3CLKA 2IHJA 4G1EB 1BOFA 2I03A 4CKEA 3ABQB 5T3UA 4M1SA 1HNNA 4MV3A 4KQWA 1IBRA 2XODA 3LBHA 3LQYA 3NBMA 5J5CA 2NP7A 3L8FA 4B4DA 4GOMD 2LBPA 1UM9B 5LMUB 4Q9LA 4MVCA 3GUHA 5A9SB 4CMEC 1QIGA 2OCXA 4D3XA 4CG2A 3EXFA 3NEYA 4C6HA 2BCJQ 2O4UX 2RBEA 2AV6A 1C41A 4M21A 1MO3A 1N9ZA 1QRSA 4ZYLA 4RD1A 1J5XA 3SHOA 1EJ2A 1TU4A 1W4LA 1OJLA 3LYHA 3I01A 5DT9A 3C5EA 2DU8A 5J59A 1MQAA 3ENNA 2WUDA 3NBKA 3LIIA 3P2YA 1JG7A 3IAS1 4MYHA 1OT5A 5KX5A 3FPFA 4YO7A 2WYHA 3JAKB 2V0NA 5BYBA 2PUGA 4DGQA 3PNQA 4JA2A 1JXMA 2WJWA 3BRWA 4YAIA 2FA9A 4O2BB 1XJQA 4BCBA 1TU0A 4AHYA 1BMQA 2HA3A 4M0MA 2Q5LA 1UKVY 1IIBA 1L7XA 4JQSA 5F51A 5FBZA 2IYQA 3WGJA 4YV2A 1GA4A 1PL6A 2ORWA 4M86A 4PLYA 1T2EA 1NBAA 2M9MA 2P67A 3HOXL 4PM4A 2PRSA 3BMNB 4P83A 2XVMA 5IANA 5HHTA 1Z2CA 5CP8A 1Z74A 3MJRA 2PMWB 1ZBQA 4ITVA 2PGLA 4BKQA 2VQ6A 2SICE 3KOXA 3OHPA 4JODA 2PS9A 4F0JA 4OHCA 4FLEA 4AIIA 4F2DA 5KBYA 2ZXUA 4OP1A 1M2HA 1MABA 3P20A 4CQNA 1YHNA 9ATCA 3UHAA 3WGGA 1EUYA 2CXNA 5BT8A 1NG9A 2F59A 4JGIA 4BNXA 1CULC 1RAHA 1DEOA 1IUNA 4DCOA 1N2GA 1Y6RA 1OBFO 3RRNA 1MTOA 5ALFA 3AI7A 4LWZA 1TMKA 1KPIA 2GESA 2VSFA 3GOHA 4YP9A 1J6UA 1E8NA 3EWAA 1U8FO 3DSRA 4PYRA 3RUEA 1Y3IA 4M0FA 5J2TB 3PIRA 4N6GA 1K7CA 2GZ1A 5ADVA 3S2GA 3G5AA 2G28A 2H1HA 4UAGA 1L5HB 4PPGA 3IJ5A 1PW5A 3EUWA 3C7CB 5A03A 3Q4GA 5EIAA 5BV1A 4NLLA 1BE6A 1NQXA 3G8YA 2GN2A 3UQZA 1ZWKA 2CL7X 4N3BA 4TMKA 2BJWA 3C6KA 3A26A 4CM8B 4CKWA 1ODIA 1Q7BA 1XZIA 3OQMA 1J90A 1YU6A 4IIFA 3LL4A 4X6AL 3ZD6A 1XTQA 2HRBA 1R8XA 3N8NA 4G3XA 4IGEA 5EJFA 1R0BA 1JU3A 3EXEB 1XB2A 5MFPA 3TM5A 1V8BA 3ZCXA 3PJRA 1PU2A 4F56A 1YZNA 4M49A 1QRRA 3VPHA 1SPBS 5L3QB 4Z4FA 1QGDA 2LVBA 3Q8LA 2O2XA 1ENYA 1QHXA 2IHKA 2J9YB 3CW9A 4FCVA 4KX5A 1H0KA 1YDFA 5DLEA 3SLRA 4BVBA 3TMAA 1QRUA 4RY8A 1R27A 1EMDA 2QN6A 1PQ4A 3WLLA 1JU4A 5TQ2B 1PTJA 2RGDA 1Y3FE 3PQDA 4MQ6A 3WGYA 2ZJ7A 1FDTA 1WCML 2D2EA 1YR7A 4IZIA 4NV0A 5DASA 1KZYC 2GYYA 2CEKA 1P1HA 4WY5A 1FDIA 3LH5A 2XRMA 4G1UC 1NX6A 3TW4A 3WSWA 2B34A 3ESBA 5JCOA 3N8GA 2YYYA 2GMGA 4OJYA 2O7NA 4NJEA 4V0KA 4CWAA 4WDRA 3ZLBA 4LMBA 4LZAA 2YHIB 4TGLA 4DLVA 1QH8A 4QOHA 2QP4A 2JATA 1RKQA 3JARB 3JYNA 5FLKA 5K0FA 2HF7A 4M6WA 2QQFA 3IMGA 1ORIA 4LRWA 3CVUA 4JLOA 2VJOA 3ACBA 4NZMA 4XGKA 4J0JA 2A9FA 1WVIA 2OM6A 1Y1RA 4ZOCA 1FP2A 4UZFA 5JXWA 1K7SN 2MU1A 1YGYA 4RJIA 4BC1A 2EF0A 3COVA 5E0KB 1EU1A 5FPPA 1YIOA 1HZJA 1SMKA 1JAIA 3OU6A 3E7DA 3QITA 3QOYA 2CMFA 2G4VA 5DU2A 1RQLA 4OI1A 1IZZA 1IN8A 2CK3A 3C4QA 4LV6A 4QOSA 2H48A 1DKUA 5DK4A 5CHYA 3EA0A 3EXHA 1FDOA 2JH8A 3ANMA 3E0QA 3KKOA 4MVJP 2XZTA 3KOOA 2BC9A 3V55A 1HXHA 1UQRA 2GAAA 4M8SA 4Y2SA 3IMEA 4AR4A 4UHKA 4W8GA 4RZIA 5FUXA 4ME6A 2EWMA 3Q3IA 4JIGA 4JAVC 2ZTUA 3M3PA 4DNPA 5M3FL 1GSIA 4DPLA 3HVUA 1GKUB 2PA0A 4Y2PA 3ZZMA 1EK1A 1ZI6A 5AMXA 1E4EA 2WABA 3QLTA 4A8JB 3E3LA 3PC8A 4BLVA 2HSZA 2FPGB 4HQOA 4UBLA 3HM2A 4KO8A 2QLJA 1E3QA 3KPWA 2DBVO 4GPAA 5C32A 4MHOA 1JA0A 3FB1A 5TMPA 3BL5A 1H93A 3I6QA 2AJTA 3V00A 2D0DA 5BNTA 2NVTL 4UY81 3KPUA 1J2UA 2PLRA 3W79A 2C4HA 4RJKA 2YNMC 3BCRA 3C41J 1YK1A 5H70A 5G1PA 2Y0SP 3O9VA 2NU6B 3QKWA 1RYTA 3U3DA 2P8SA 2EEZA 4AJKA 4US2R 1AQ6A 1LZKA 4ADSG 3DEKA 3F4BA 1CS4C 1G4HA 4PYKA 3V7WA 4RY2A 3A04A 4I55F 2H31A 2E9SA 1NVTA 1UZLA 3PA6A 1U28A 4BMZA 3HBMA 2VJKA 1PWZA 4CIVA 1BGWA 1W6UA 2AFHB 4C6SA 1X8JA 3K0KA 1TTPB 3NBQA 1G16A 5EKSA