5MGBA

Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nad
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
725
structure length
725
Chain Sequence
b'PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisomal bifunctional enzyme
publication title Structural enzymology comparisons of multifunctional enzyme, type-1 (MFE1): the flexibility of its dehydrogenase part.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 265
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5mgbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mgbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5mgbA01
4FS3A 1WAMA 2YHIB 3WJAA 1NPYA 5BQFA 4XB2A 4YT4A 3EDMA 4IDGA 3LKEA 2NLOA 3PJFA 4WLOA 3ZHXA 2YHUA 1QORA 1JTVA 4JYLA 3QW2A 1GD1O 2QX7A 3NDIA 3VC7A 4MI2A 2IXBA 1EUCA 5DCUA 1N9GB 2V6MA 3A1NA 3EZLA 5DZSA 5TRTA 3ZWMA 4FB5A 4NNQA 1P77A 1E1KA 3F47A 3WDSA 1VJTA 4IGFA 3HHPA 2B69A 1F12A 1N5DA 2NTJA 3GGPA 2CZCA 2C0CA 1X7DA 5L3ZA 4Q3NA 4NR0A 2G1UA 1MP0A 1EVJA 3ZDFA 3OQBA 4G2NA 3ZHBA 3ASVA 1EZ4A 4FD3A 4FFRA 1T1SA 1K0UA 2OO5A 3U3XA 5TX7A 3NV9A 5FYDA 1ISIA 1QYDA 1P44A 2Q3EA 4BOYA 1IPFA 1DRWA 2FMUA 4P4LA 1I30A 5K6AA 4OJNA 3TFOA 1ON3A 2E48A 4MOUA 4DBZA 2VWQA 4E5MA 4UREA 4AJLA 3FF6A 4WGGA 4HUJA 1YL7A 3K50A 4JBGA 3UXYA 4CMIB 1ZJZA 3RBVA 1EF8A 1RJNA 3U09A 3ROKA 3VDQA 4W7HA 2DM6A 1XIVA 4GMFA 1ULUA 1LRJA 3IAVA 4G81A 3CXRA 3ZHYA 1LLDA 4JYJA 3RRVA 2P68A 4ZDBA 1OC4A 3KUXA 4DMMA 4L4XA 2IZ1A 3BEZA 3P19A 2VRCD 4IY1A 3RWBA 1WDMA 4XGIA 5A4DA 2QYTA 1ARZA 3VVBA 1Z7EA 3TPCA 1E3WA 2GCGA 5DU8A 3U4IA 4BNWA 4YRBA 3WSVA 2VT3A 3FD8A 3V1YA 4UEJA 4EMMA 2YJZA 3S2EA 3RUDA 5F5LA 5EQFA 3W1VA 1CYDA 1EBUA 5BR7A 1PU2A 3GFGA 1VJ1A 2Q4BA 4QUKA 3G3EA 3IP1A 4J4HA 4R69A 2VWGA 1PR3A 3CMMA 2UUPA 5L40A 3D3WB 3SJUA 2X9GA 4MIOA 1JKIA 4E13A 3ETEA 3H4VA 3OEWA 5TS3A 4DPMA 1PX0A 2G0TA 4WE3A 3QRWA 1Z7BA 1LLCA 4XB1A 4H15A 4BNTA 4DC1A 1I2CA 2P9EA 1NHWA 4M86A 3WOHA 3JQ7A 4RF2A 3WJ7A 4IBOA 5DCYA 2X58A 3W6ZA 1B8VA 1I3KA 3H5AA 2W90A 5I9LA 4A7PA 2PFGA 4TVBA 2ZL0A 4OQZA 1BHSA 1ONOA 3BPPA 3P85A 3F4LA 2A92A 4YJFB 3RVDA 2D5CA 1UYTA 5JE8A 1K39A 1GCOA 3K96A 1E3SA 3L9XA 3BMQA 1FXSA 2OP0A 2VRCA 3GR6A 4P4GA 1WMAA 3K6JA 3L6OO 3ZU4A 1EDOA 3PI7A 2AQIA 2PLAA 4LCJA 4RORA 5INFA 3U49A 4INAA 1ISHA 1MFPA 1ON9A 3ZV5A 4LCEA 1H94A 5TLSA 1SZJG 3NDJA 4GVXA 4RCNA 3PQDA 1LNQA 4QO8A 4II2A 4W99A 2PZJA 3CEAA 5AXCA 4H16A 3MWDB 4MVJF 1LC3A 3V2UA 1T25A 3D7LA 1EE9A 1VSUA 1HDYA 1WLYA 5DP2A 2Y66A 2IZ0A 1PS9A 5F5NA 1HEUA 3GVPA 3VOSA 1FF9A 4WZ8B 2A7KA 1ISGA 4ZDDA 4J6FA 1ZXLA 2SCUA 3M1LA 2JAHA 4HNGA 2VTEA 3NJ4A 3PZKA 1I3LA 3EC7A 5C90A 2YZ7A 4FN4A 5BNTA 4K29A 3BMCB 2DFVA 4J0FA 4LMPA 4DWVA 2D4AA 3PK0A 4B8WA 5LC1A 2J5IB 3KTGA 1Y5MA 2DU8A 3KQFA 3DZFA 5L95A 4YJGA 3BTVA 5EJ2A 3STAA 3T89A 2JCXA 1UYSA 3RU9A 1X0XA 4J3FA 4IQGA 1T2EA 1RM5A 4KUHA 4NMHA 5F3RA 2E49A 1WMBA 2NVUB 4BO4A 2HMTA 4LSMA 3KETA 3GH3A 1B2LA 5EPOA 1CETA 2I3GA 2PGDA 1XQ6A 2EKLA 3JD0A 3U5TA 3HQ4O 1EUDA 3FTNA 3VPGA 4DQVA 3T4XA 2Y1DA 2VSUC 3PJDA 1R37A 4LRSB 1GUYA 1K6XA 1UR5A 1PSDA 2CDAA 2B5WA 2P5YA 3DBRA 2X0RA 2O3UA 1ZMTA 3EGOA 4OQYA 4BQRA 1XKQA 3T7EA 3JQGB 4NQZA 5KJFA 3D3EA 1E7MA 4MVJG 2NVBA 2JFGA 2VYVD 3PHIA 1KVUA 1X15A 3H9QA 1Q52A 2HW5A 4UUPA 3WS7A 5JYDA 2X7HA 2J5GA 2PD4A 4J43A 1A9ZA 4L8KA 4LSWA 4XYEA 1DDOA 3OMLA 5DBFA 3Q2KA 4AJKA 4IJVA 2ZB7A 5A9SA 3EMKA 2FOIA 4C7KA 1HDRA 3FBTA 3ICPA 2W2KA 3K8XA 2WDZA 3C7CB 1Y8QB 2X0NA 4RLSA 2TMDA 1T2FA 4DREA 4BV8A 2LDXA 1G1AA 1BW9B 1YWGO 3VH1A 3VZSA 3FNGA 3GGOA 3DBHB 4FCCA 5ITWA 4NEKA 1LDGA 1Y7TA 2QQ3A 1W8DA 2EW8A 5DT9A 2Q99A 3L07A 3G1TA 2X0JA 3GNSA 5JCXA 4E12A 2YYYA 2UVDA 2X24A 4GLOA 2Y0EA 3B20A 1P1JA 4K9DA 4BV9A 4J7CA 2O2SA 4ALMA 1NQOA 1HT0A 1J0XO 1LSSA 2A9FA 3VTFA 1CIVA 1IULA 1KETA 4KNPA 3DFZA 4W6ZA 4R51A 4EBFA 1SB9A 3WGGA 5ENVA 4D46A 3ETDA 1X7HA 2VSUA 4GMGA 5CAEA 1YBVA 2X4GA 3W4IA 1NWHA 5COQA 4A26A 1JXZA 2DEOA 3WTBA 4G5HA 2YFHA 5I8WA 2HK7A 5CFZA 5FWNA 2ZB4A 2ZCUA 3ZNNA 1QLHA 1L7EA 4NFHA 1F8FA 2HKIA 1ZSYA 3C8MA 2Y1CA 1NBOA 1C0IA 3WGQA 2CD9A 4I08A 2QZ9A 4D3DA 2Q34A 4XKJA 2Y1OA 4CLOA 1U28A 1SBYA 1Y6JA 4Q9NA 1XG5A 4Z9FA 4MO2A 5AVOA 4I4ZA 3TRRA 1XHLA 2O3SA 5HRUA 1DHTA 4XGNA 4MXIA 4BL5A 2HUNA 3DWFA 2Q45A 4N18A 4PCVA 1DAOA 4O0LA 3ONFA 4D42A 3FNFA 1NQTA 3F46A 1XNYA 2I3AA 3BMNB 3CUKA 1P0FA 3LF1A 1EUZA 2FPIA 3SLLA 5B12A 3H9EO 1PL6A 4HFRA 4IS3A 4MVJM 2VREA 5CHEA 5CPBA 4D45A 2RCYA 3KO8A 1PTJA 2FR0A 3C1AA 4YPOA 1MXFA 5TNXA 3B1KA 1QKIA 3AI1A 4YAGA 3WMXA 4DLLA 4JVTA 2VUUA 2W4QA 3BYZA 4OOFA 4A2CA 1UP7A 4JQCA 3QVOA 3WQRA 4BNGA 4MOWA 3DZBA 3IUPA 5CDGA 2GSDA 1YBAA 2WM3A 4K3WA 4GX0A 4W9NC 5I9MA 1YBMA 3IC5A 4NFSA 3CPSA 5AYVA 3K2EA 3TT6A 1VKOA 3JQ9C 1E1LA 1DLJA 3CSDA 4BVAA 1RM3A 3T3WA 3MJSA 1GV1A 4Z0TA 5T57A 4CV3A 1VL6A 1IL0A 2HLPA 4BKOA 4DTIA 3GF3A 3FNHA 4ZDCA 1YRLA 2PGJA 4PLCA 2CF5A 2QRKA 3D4NA 1QP8A 1WVGA 1UZMA 2IEDA 4ALLA 2HK9A 1VE9A 5JAQA 1HXHA 3GZNB 1ZVMA 3D64A 4J9UE 4CV1A 4R1TA 1CJCA 4CMEC 4U8GA 3JQ8A 5JXWA 4OKIA 2JCVA 1N6DA 3C7DB 3QA9A 4I5FA 4J90A 5DCWA 4BKRA 1WNTA 5JLAA 1ML3A 4WKGA 4DMLA 4QFDA 5I8ZA 3U62A 3PHHA 5KWEA 3R6HA 3GLQA 2BGMA 2F00A 3DONA 3N58A 4XA8A 1R4MA 3HDYA 3RUIA 3GUYA 2Q1SA 1EK5A 1J5PA 4D7AA 1LA2A 3KSUA 2PGLA 1Z74A 4NIMA 4Z0MA 3JYLA 4XQ9A 2X6TA 4E2YA 3MOYA 3I9OA 2ZL3A 1P1KA 4HNHA 1Q7BA 2R2GA 3NJBA 3ZW9A 1KY4A 4F6CA 4BNZA 3I9MA 5HTOA 5DKPA 5IDQA 5L4SA 2ZYGA 4GI2A 4HKTA 3K8ZA 5KJPA 2B37A 2F6QA 4EEZA 1T24A 4UEOA 4OYRA 4W9NA 4FB8A 1KEUA 2GZ3A 3WYEA 3K73O 1Q0HA 2B36A 4E32A 3P5MA 1LUAA 3QXZA 3JQ9A 2OORA 3GN1A 3DZIA 4AJOA 1JU9A 2ZYDA 4PLFA 4XRRA 3H0SA 4J7UA 4CMAA 3O26A 1Q7GA 3PQEA 1G6KA 1TVEA 3KYDB 1SEVA 1U4OA 1WWKA 2E4AA 3EHEA 3JTMA 3JYNA 4ZHSA 2BH9A 2VRBA 2I5PO 1LRLA 1OBFO 4E2XA 4DIBA 5T6BA 1V8BA 2HJRA 4WCFC 4DGSA 4NBVA 5IZCC 1FDTA 3R0IA 5T64A 2I66A 4JSBA 5DL1A 2I9PA 3QSGA 4JCOA 4FBGA 2ZQQA 4CMEA 2H5LA 4QEDA 4CV0A 4JP3A 1JQBA 5B1YA 3E8XA 1Y9EA 5L51A 4CM8A 5JCJD 1FC7A 3H9UA 4PG4A 4CQMD 3E5RA 2CMDA 2J5SA 4BNVA 3VAZA 5G0TA 4AJNA 1IHXA 1I2BA 2VZ8A 3QLJA 4ELXA 3AUAA 1H5QA 5E0NX 3DAFA 4TROA 4GSKA 3B6ZA 4TVOA 1E6EA 1NP3A 1HLPA 2DTDA 1I24A 1C0PA 5BSEA 2PH3A 5TT1A 2DQ4A 1K2WA 2EERA 3MJ4A 4NK5A 4BNNA 2JFFA 1GYPA 1ZK1A 3E5MA 3TJRA 2EV9A 5TSDA 5KCZA 2NV6A 5ER9A 1NTOA 4BNYA 1HE5A 1N8KA 1LDEA 3HE3A 3EK2A 4JN6B 2D1YA 3UN1A 2CE3A 4E33A 5IKLB 4UUMA 3D0OA 4D79A 4EW6A 3GPIA 4J1TA 1E7YA 5C3MA 3L6EA 2ZTVA 4HXYA 4E5YA 4N54A 2R6JA 3NJDA 4OHUA 3V8BA 2G17A 4R01A 4Y6RA 3TL3A 2Z95A 2NUAA 3HSKA 3TZHA 4DUPA 2POQX 3ON5A 4DPKA 5CEJA 3AFMA 3VPHA 3BMOB 1QV6A 5ICMA 1DFIA 4Q3DA 2Y1EA 2HJSA 5THKA 4CPDA 1ZO8A 4UULA 4DRYA 3TFQA 2BZRA 1UP4A 2DBZA 3EW7A 4OM8A 5IXSA 4GGPA 4RL6A 3DOJA 4WCFA 1GL3A 3UAGA 4CM4A 5IZCA 4QIIA 1MJ3A 4OG1A 2AQKA 3O9ZA 3NJ8A 5TIIA 5JBWA 4TZKA 3K2BA 4GX5A 1BGVA 1NR1A 3CZRA 4JOTA 1NASA 2C5AA 1NNUA 3P7MA 4FNDA 4XWYA 3LYLA 3PFFA 4KUGA 1N2SA 4R54A 3SC4A 2IXAA 4XQGA 1E3EA 1Z75A 1BXKA 1NAIA 3OICA 4DPLA 4AG3A 1ZFNA 4MVJI 4CMCA 1EFKA 4EMLA 2CVOA 3WNVA 4RDIA 3ZWBA 1ZSVA 1UP6A 3OJOA 3QWHA 3C85A 4DQXA 1EY3A 4F45A 4KD6A 3Q3CA 2EF1A 1BVRA 2VHVA 4P8RA 1CQJA 2HMUA 2B4TO 1E92A 1NHGA 3AY6A 1I10A 2WD7A 2E6UX 3FF4A 1FK8A 5JAZA 5KVSA 4JJGA 2O4UX 2VTDA 4YJHB 1B14A 3RBZA 2AE2A 3Q0GA 3X2FA 4CMBA 1LDMA 4KOAA 2GZ2A 1GQQA 5A5FA 3SC6A 2J3IA 1QR6A 1Z73A 4CMGA 4MVJA 3RC2A 4ZICA 4Y8VA 4JJTA 3TF5A 1HYGA 1O95A 4J0EA 3L9WA 2EIHA 4EDFA 4TSKA 4L6WA 4CMHA 4R16A 1AGNA 4XIJA 4LK3A 1D8AA 4BB6A 5MDHA 1H6AA 4XYMA 2VZ0A 1UDAA 3I6QA 5E0SA 2I99A 2JL1A 5EIOA 1GFSA 4FFOA 1Y9AA 3K9QO 4HFMA 4CMKA 4XYBA 2NTVA 2NP9A 4TKLA 3VTZA 5CPFA 3B70A 5FI3A 3AI3A 3VZPA 2VCYA 4R1SA 3ONDA 5G0WA 5I7VA 3SVTA 5KOIA 1U8XX 1EBFA 4JIGA 5DZKH 4J9VA 1XNVA 4BMSA 3JQAA 1BDBA 1P45A 1KS9A 1LQUA 4LMRA 4WLUA 5G4KA 3MFMA 3LDHA 5KVQA 4XYGA 3UCFA 1HTBA 1ADGA 1PZEA 5B37A 5KJ6A 2P9GA 1XCBA 3TLFA 3BTOA 1TEHA 4D44A 1VI2A 3PGJA 4YR9A 3ZU5A 5IF3A 3Q7HA 3DZHA 5AOVA 1LTHR 1EQUA 4JX8A 4GWKA 2AG8A 4ID9A 2ZTLA 3DMYA 4IZHA 4RPHA 1FDWA 1MB4A 4M54A 3WYBA 1NZYB 1SG4A 5DN9A 3I9NA 3IP3A 3AWDA 5A05A 1B0AA 5LCXA 1GUFA 2IDZA 2OOSA 2QZZA 3GY0A 1ISMA 2B5VA 4W7IA 4NZ9A 4BMNA 3RKUA 1PQWA 4BHTA 3NDRA 3I1JA 9LDTA 1HYHA 1U2GA 2Q50A 1GEEA 1V9LA 2H6EA 3UFXA 3WGHA 3TVUA 5KIAA 1GUZA 4WLEA 3AUTA 3W4JA 1PZGA 5A04A 2D59A 2VT2A 3DL2A 4R68A 3IUSA 3PQFA 3NTOA 3V2HA 3UH1A 1PS8A 3BHMA 1GR0A 1O94A 2VN8A 3IJRA 1R16A 3VH2A 1HETA 3TZQA 4QQRA 1J49A 1ENZA 1JDJA 2X9VA 4NU6A 5IN5A 3U4DA 2VSSE 1I33A 4A03A 1B8PA 3RJ5A 3RJ9A 4KZPA 4IJKA 4WLFA 1S7CA 3RFTA 5DULA 2IEXA 1E6WA 1O89A 4S1VA 3H0JA 2Q46A 4IMPA 3EUWA 4BNLA 5CDTA 5IDWA 2F9YB 3NAQA 3KYCB 1YJQA 3NX4A 1B7GO 2Y67A 3GVXA 4W4TA 4J4TA 5A06A 2IYOA 5CDYA 1MFZA 1E6UA 3TOXA 2AG5A 3A06A 1WPQA 3O8QB 3BF0A 5L7TA 1PQPA 1TT7A 2A4KA 3BTSA 4NPCA 3S2IA 3G17A 3I47A 4YXFA 3WMWA 4ZQBA 4UUNA 2FWMX 3ANLA 3K30A 3PVZA 3GC6A 4XR9A 1E7RA 3OBBA 2VYNA 3G64A 5TJHA 3WICA 2ILTA 4Z9YA 4UVGA 1KY5A 5HA5A 3SLGA 2NSDA 1PR9A 5H81A 2CNBA 2NNLD 3H5RA 3HNPA 4AICA 5C37A 5GZ3A 4QIJA 3ITKA 4A73A 1H9AA 4IQ0A 4IZIA 4BGUA 5U9CA 4HP8A 4H7PA 3QVWA 2YV3A 4J16A 4N7RA 4ZQHA 1Y8RB 2V65A 2Y93A 2AQHA 2DUBA 4GAEA 1YG6A 4TKMA 2WMDA 2HAEA 4FFLA 3F9IA 4NH4A 3PJEA 3OETA 3QHAA 1H9BA 3ICCA 4R1UA 5IJZA 5ENDA 1MG0A 2VWPA 3ROQA 4YQYA 1X7GA 2LDBA 3UCXA 4RF5A 3WYCA 1LBEA 1H2HA 1UJMA 3CTMA 1F14A 3GEDA 4FJ0A 4GGOA 3RUCA 5CP8A 4CQLB 4CLRA 4BKUA 4RPJA 3MZ0A 2ZB3A 2QRLA 3QJ5A 4IGEA 7MDHA 1VRWA 3DBLB 4E5PA 1FC6A 4EEXA 1CRWG 4BKPA 2GYYA 2X9NA 3LT0A 4YYZA 3V1UA 3UUWA 4IS2A 1C1DB 4ZD6A 2W8ZA 3I9KA 1I5RA 4JJIA 1PZFA 3NT5A 1A72A 2BGLA 2UDPA 1F8GA 1EEHA 4GSLA 4OGWA 3WLEA 3GNQA 4B7CA 1UUFA 4NBRA 4H3VA 4CV2A 2C8TA 4WLNA 3E9MA 3NYWA 2BFOA 2PV7A 4HV4A 4O59O 4OKNA 1IZ9A 3FWZA 1GAEO 2EW2A 1DIRA 1HE2A 1YDWA 4J91A 3T7CA 2YUTA 1YB1A 3F4BA 1O6ZA 3HN7A 5KJCA 1KVTA 1PQUA 1YJ8A 5KKCA 2NU7A 3ZWAA 3RQSA 1Z6ZA 1MC4A 5C9GA 3H8VA 2HMWA 5DF1A 3KBOA 4LVCA 1JWAB 2ZJ0A 3PHJA 1ZH8A 4BB5A 2VUSA 4IZBA 5DOZA 1PWXA 1E1NA 1ZJYA 3E18A 3DZKA 2ZIZA 4GBJA 5DZKA 2PZLA 4QXMA 3B1FA 3FI9A 3H9GA 4F3YA 4DC0A 1EFLA 3C3XA 4FR5A 4JP2A 3ZWNA 3MOGA 4BGIA 1A4IA 3VPFA 4BNUA 4IXTA 5IFLA 1U7TA 3H2SA 2J5GD 1Q7CA 4IIUA 1XA0A 3GK3A 5DU4A 1PIWA 3TZCA 5C5IA 2GERA 1SB8A 4WYOB 4O6VA 1PGOA 4JFCA 2BD0A 3GG2A 4AL4A 5IDXA 2GGSA 1DBVO 4TRRA 5T5QA 2RHRA 1B3RA 3M6NA 4CL3A 2VNSA 4PRLA 3LQFA 2UYYA 2B0JA 2NWQA 4WOKA 2EG9A 1E5QA 1G0OA 1Y1PA 1XU7A 3WX0A 2UUOA 4CR7A 5B4UA 3IKTA 4YDRA 2FN7A 4IZDA 1DHRA 1NPDA 2XPCA 3GLMA 2FRDA 4J2OA 4PIVA 4J7XA 3L77A 1N7GA 3GNTA 1N1EA 3GOHA 4E30A 1HE4A 4YAIA 4OLQA 1YG8A 1JVBA 2IODA 2VHXA 5C7LO 2Q1WA 2R00C 1PL7A 3C1TA 1LXCA 4YEDA 4A10A 4UAGA 4YCAA 2DUWA 1ENYA 1XEAA 5AXDA 4JBIA 4L76A 3V5IA 3AM4A 4Y6PA 2XF8A 2DPHA 4BS9A 2HDHA 2O7QA 4PLZA 3ZZNA 4EYEA 5G1QA 4OAQA 2DC1A 2EGHA 4U0HA 3GG9A 1H6BA 4BO7A 1HRDA 2EP7A 3L0DA 3QWAA 4TRJA 1LC0A 5KNLA 1YB4A 1XYGA 1AN9A 2VX2A 1R4NA 3ORFA 3BTUA 1HZZA 5IZ4A 5EMHA 4MKXA 5AXAA 3TNLA 3ZW8A 2EP5A 3PGXA 1AHHA 4L8VA 3ZNOA 1TLTA 4D3SA 5JMWA 4PVDA 1HDCA 4R9RA 1WXDA 1B8UA 4I9UA 2GDZA 2EWMA 2P91A 3WIDA 2W3PA 5KDRA 4AJHA 2CUKA 3DHNA 3E9NA 2FW2A 3OSUA 2PR2A 3OT6A 4I5DA 3S2GA 5LDGA 4ZGWA 4FFPA 3AY3A 1F06A 4KMSA 3HN2A 4L4RA 1ZMOA 1T2DA 3ETGA 2YHIA 4A5OA 3HFGA 1S6YA 1GPJA 2A7SA 2Q49A 2BLLA 1TT5B 2FSSA 2JHFA 4IJUA 5I7SA 5F1KA 3ZI0A 3KTJA 2WE7A 1X1TA 4FIZA 2TMGA 1NVTA 3G1UA 3G49A 3E1KA 1M76A 2I65A 1FDVA 2Y68A 3DTTA 1C0KA 3KYBA 1N9GA 4BO5A 5JFOA 2BF7A 1NFQA 3VZRA 4DIFA 1YXMA 2J6IA 3DR3A 4D0RA 2PKQO 4Q39A 1LEHA 4Y6SA 4KP7A 4KWBA 1DC6A 1GDHA 3AI2A 3OJEA 2R00A 4E4YA 2RIRA 5I7EA 4U0JA 1JWBB 1X13A 4O63O 4PLTA 4RZHA 3ZCXA 3ZNQA 1NR7A 4FFMA 4FN7A 4XIYA 3WBFA 1NFRA 3OIFA 5DBIA 4KWIA 4CQMB 2CFCA 5JBXA 1VPDA 2PG8A 3GN2A 1UZLA 3RFXA 1ONPA 2OP1A 3E48A 3MOIA 1GV0A 2E37A 2Q4EA 3LSYA 3LT1A 1OOEA 4XDZA 1LLUA 4Y9DA 5AQ1A 5ILOA 4JCQA 1YKFA 3R3SA 3DJAA 4U0GA 2UV8A 1A7KA 3S55A 4CMIA 2GASA 1HDZA 5HBRA 3H02A 4I9HA 3KTDA 3AUUA 4B7UA 2FZEA 1R12A 2CVZA 4AJPA 1QRRA 4ND4A 3PRJA 3MJVA 3WR5A 4E5NA 3H3JA 1SO8A 3EAGA 4FPXA 4RO0A 4KPKA 4MDHA 3F5SA 1HDXA 2EJVA 3PTZA 2DFDA 4XJTA 3A4VA 3WNQA 3LC1O 3GA0A 1Y7OA 4I42A 2B35A 3AK4A 5IXYA 2J5KA 3L4SO 4NJMB 1YDEA 3WGYA 3T8AA 1HYEA 3M1AA 1PJSA 3FPLA 1FJHA 1XWFA 2FPGA 3IOYA 4FC6A 4TQGA 1DIHA 3TWOA 3RSIA 3ASUA 3DHYA 3PIDA 1PZHA 2FP4A 3VZQA 4N5MA 4A27A 2VZ9A 2CDCA 1P1RA 3JQBC 4ND2A 1K89A 2P4HX 2GN9A 3I9JA 3ULKA 2VSSF 4FGSA 5HM8A 3WG9A 1ONNA 5DNAA 4MKZA 4RDHA 4GKBA 4PLHA 3PLNA 4LW8A 5DDIP 1PJ2A 3D3WA 2BFPA 3N7UA 3F5QA 4S3MA 1CF2O 1P74A 2VHWA 1LU9A 3IDSA 1ZZEA 2C20A 4NFYA 3SLKA 3GZ4A 2NADA 3OC7A 4M55A 5C7OO 1KVQA 2O23A 3D4OA 4RLHA 2D0IA 1TG6A 1NQAO 1Q2XA 3W8FA 2DBQA 2QW8A 1NVMB 3I5MA 4N5LA 4Y67A 4J1NA 4NBWA 1FDSA 4MKRA 1IY8A 1U3TA 3MT6A 4CLDA 1KEVA 2XAAA 4KQXA 4XCVA 4XEHA 1Z82A 3LZ6A 1ADCA 4HBGA 4IDFA 4YJFA 5T67A 4MVJH 3HRXA 1DFGA 2JD1A 3U9TB 1D3AA 1KVSA 2GN6A 1T1RA 1YOVB 4IUYA 2PWZA 4WNCA 4BNHA 5CEEA 2O48X 1GEGA 5ITVA 4FN8A 2AQ8A 1V3TA 1VM6A 3PZRA 2NTNA 4U18A 5IDYA 1Q51A 2CVQA 1GQYA 1SPXA 2BRUA 4UVIA 4XQEA 4BO2A 4CUKA 3N6RB 5E0SH 1C1XB 2J5II 4AJ4A 2F9IB 1BRMA 4QFEA 1M6WA 5DBGA 2P5UA 4JNKA 1FC9A 4RYFA 1M2WA 4R5MA 4BO9A 1E1MA 1V35A 3L6DA 2FZWA 4MIYA 4EUFA 3FR8A 3GRPA 3AW9A 1ENPA 1ZEMA 3VH4A 4AJIA 1JKJA 5GY7A 1YQGA 3C7AA 1PIXA 3O4RA 3VIVA 1K3TA 3QY9A 3TN7A 1OD2A 1D1SA 5DUFA 5L9AA 2OUIA 4OL9A 4Z6KA 5GZ1A 3JQBA 3AM3A 2Y05A 3G0OA 3BMCA 4ITUA 4YBZA 1RM4A 5A5EA 4ND5A 4I5EA 3GGGA 1CDOA 3GVIA 5JNLA 2J5IA 2Q1UA 4OXYA 4PG5A 2C7VA 4Q3CA 1Q0LA 3HB4X 1ZIDA 3QWIA 3ZGYA 3OF2A 1O0SA 4EJ0A 3NRCA 3WBBA 3R9SA 2I76A 2O3QA 4K2NA 4IDCA 1IPEA 1VL0A 4JK3A 2NVUA 4IINA 6ADHA 2YQ5A 4K6FA 5G0UA 4BNMA 2HMSA 3EZYA 4CM1A 1HNOA 2GD1O 3MJTA 3PGQA 3K31A 4ZQFA 3ST9A 2HQ1A 4JROA 2VHYA 3DO5A 4MPDA 3PZBA 4ASIA 2YFQA 4J49A 3I4CA 1UYRA 4ND1A 4LN1A 1MLDA 3H2ZA 4MJLA 4YAJA 2W2LD 3RASA 1M6HA 1SZOA 1BVUA 3KHUA 4DQUA 3JQGA 1A27A 1PL8A 3ANNA 4HX5A 4NJOA 5BNFA 1U3VA 1B3BA 2GN4A 4L74A 2O50A 2VQ3A 5IAAA 1LSJA 5BSFA 3I52A 4FQ8A 4C4OA 5JO0A 4RCVA 2PA3A 1ADFA 1F17A 3M2TA 3KM0A 3O38A 5H83A 1NWCA 1G0NA 4ZQEA 1IUKA 3FR7A 5TF4A 2HSDA 2GLXA 4CODB 1Y8QA 4FFNA 3S2FA 3IS3A 3JYQA 1HZJA 3GKBA 2PNFA 3V1TC 3AU9A 1BW9A 2DTEA 3GEMA 3S1LA 3DBHA 3V5NA 3FNEA 4B4OA 4DBVO 4CLXA 2X5KO 1RJWA 1BXZA 4IIVA 4QFCA 5CDSA 4L75A 5KKAA 3OP4A 4RF4A 5I9NA 3PYMA 4B7XA 5JMPA 2E82A 1E3WB 4LK5A 4M8SA 3GF4A 5BSGA 4RPLA 3ZV6A 2W98A 4MP3A 3RUFA 1HSOA 1YL5A 2NQ8A 4BKQA 2WWRA 3PDJA 4NBTA 4NBUA 3HFSA 1N92A 2H9IA 4MVJD 1ZUD1 2JFHA 1LI4A 3R0OA 5B4TA 2W2LA 1EE2A 4LGVA 3DQPA 4YT8A 4EJ6A 4K6CA 1E0DA 6LDHA 5JAIA 3GF7A 4CR8A 4B4WA 4FJ1A 3NTQA 2ZTMA 1DIGA 1XNWA 4RQUA 1N6FA 3WGZA 2BFMA 2WYVA 1N6EA 4YA6A 3LLSA 2A81A 3ST7A 1QG6A 3DB2A 3AUSA 2BFAA 3HUDA 2OFPA 4WEOA 4PLPA 2OGUA 8ADHA 2J3HA 3HJAA 3JQ7B 4R41A 1DCIA 1NYTA 1U1IA 1AUPA 2Q2VA 3BA1A 4WASA 1K6JA 4PG8A 3TDCA 2GPTA 1E3LA 1I3MA 3JQAD 3HDQA 4TRNA 4HC8A 3HDJA 3O03A 3JD4A 2CY0A 2ZB8A 3DAPA 4F6LA 1R66A 1HDGO 1HL3A 4GH5A 2PZKA 3ZU2A 3IQDB 3ROPA 1IZ0A 5JC8A 3BMQB 2WYWA 2VNAA 1JW9B 3BXXA 2PK3A 3BMNA 4FOOA 2JKVA 3ZHZA 4CM8B 4CL8A 4L4SA 3PLRA 4J4BA 5KVCA 4BNKA 2G76A 3GMSA 3ADOA 3WQQA 2DPGA 3AOEC 4Q1IA 3GEGA 4BGVA 4BO0A 3DZGA 3JSAA 4BNXA 4CM7A 1MV8A 8LDHA 3VPSA 2A35A 2RAFA 4YACA 1U5AA 3UGKA 4FDAA 4CM9D 4U19A 3I4FA 5JYEA 2FBMA 2WE8A 5INIA 2VUTA 4KTVE 1Y5RA 3QWDA 1WW8A 4YVFA 5KJ1A 3F3SA 2WEKA 5T8KC 5B4VA 2AEMA 1HE3A 1KC3A 1U3UA 1E5LA 5A1TA 5ER6A 1CERA 4BQPA 1BG6A 4WK6A 1VL8A 5CG1A 2OHXA 1J7XA 1TYFA 1QV7A 3RKRA 3L3SA 1SAYA 1MX3A 2X23A 4ELWA 3STHA 3OA2A 3KXDA 3WTCA 2GF2A 3LU1A 4HFJA 3ZWYA 2Z1NA 3VDRA 1GPDG 4I52A 4PZCA 4YJGB 3A14A 3WXBA 3JQEA 4QTZA 3ZWOA 4FOSA 4IJWA 5EN4A 4UVEA 1YS4A 5DTPA 3F1KA 4PLYA 3GZNA 1VC2A 5COAA 3QK8A 4ILKA 4PFJA 3RUEA 1E3JA 2OBYA 4L0QA 1DIBA 4YTEA 1U4SA 3K92A 4YT2A 4AJEA 1U3WA 4URFA 1B16A 1PEDA 1DPGA 2CF6A 2YV1A 4CMJA 1LSOA 3DBRB 3PXXA 2FY8A 1GCUA 2VWHA 1GZ6A 2PKQP 3SXPA 4XYLA 4MIEA 4B3HA 1DJNA 5DOVA 3KSZO 1SOVA 4CM9A 4R1NA 3Q9UA 1DO8A 3T4EA 3TZKA 5KVVA 3MEQA 5L4NA 4RZIA 3EY4A 4RQTA 3SJ7A 3CE6A 4YWJA 4YRAA 3D1LA 2GZ1A 4XZ3A 2VYND 1WP4A 3AOEA 1V6AA 3DFUA 1EQ2A 3FCOA 3JD3A 5A9SB 4DL9A 1PWZA 1PJLA 1PJ4A 2W2KB 3W4KA 4OO3A 1ADBA 1YQXA 4C7JA 1TA4A 2G5CA 1H93A 1I32A 2Y1FA 3SX2A 5T8KA 1K32A 5A9RA 1LRKA 4DVJA 1TB4A 5KJEA 3Q11A 3QYRA 5F1PA 1JN0A 2DUUA 1LDBA 3ANMA 4R9SA 4DXHA 2B4RO 2DLDA 5CG2A 5INGA 1O9BA 4R4JA 3KB6A 3PDUA 4AVYA 2EXXA 1HSZA 1WDKA 1PGNA 4HNKA 4U7WA 1B15A 4K1LA 1FDUA 4Z3DA 5LDHA 1BDMA 4HFNA 4W82A 3UVEA 3AY7A 4L73A 3KYDA 3R9TA 3N74A 4ROSA 2YY7A 4U6SA 2PKRA 1T26A 1HNUA 7ADHA 5JDCC 4U5QA 4DA9A 1HLDA 3ZH2A 3ZWCA 1HDOA 3HLN1 3P2YA 1XELA 4PG7A 3JV7A 1SOWA 3WIEA 1D1TA 3FBGA 4I1IA 4RVHA 1P1FA 2AA3A 2C82A 1KVRA 3HDHA 1RWBA 2X8LA 3GQVA 4XQCA 4BMVA 4RVFA 3H3FA 5CTCA 1NVGA 3WQSB 4ZRNA 3ZV4A 3KLMX 4IQ8A 1WDLA 1YB5A 1YONA 3H6KA 1IE3A 4MP8A 1KOLA 4ZDEA 2YQ4A 3DOCA 1EVZA 3NUGA 2WJPA 5TQVA 4ALKA 3GAZA 3DDNA 1T4BA 2AE1A 3GRKA 4CLOB 1OD4A 2BHLA 2DBRA 1XX4A 4IM7A 1XO6A 4YJDA 3OEYA 4CLHA 1DB3A 1QMGA 1I36A 2C5EA 4J2HA 1YE3A 4JCTA 3WGTA 4D0SA 1P0CA 5G1RA 1BXGA 1UAYA 5EERA 4M1QA 1U9JA 5L4LA 4U0KA 1ISFA 1OZAA 3JQFC 4J1SA 2ZCVA 1E7SA 4KDEA 4WLVA 1O8UA 2H63A 4XR4A 3D4PA 2WYUA 3SEFA 3U9SB 1JVSA 3IJPA 2RBEA 3PEFA 4RV9A 1NAHA 5FF9A 3DEYX 3K5PA 4RJTA 4CM3A 1A4UA 4D41A 3OFSA 4BNJA 1TI7A 4RVGA 3QREA 2V7PA 5DU6A 4QSMA 5JO9A 1Z45A 3CZMA 4O1MA 1QLJA 4U0GH 3BMOA 3PJGA 4WPGA 3MYBA 3PYLA 5ADHA 4D43A 2YW9A 1U7HA 3OJLA 4B4UA 5U1PA 1CWUA 1H0KA 5JDCA 2CSUA 4PLWA 2VSSA 4PZDA 2QYSA 1ZKMA 4Q0GA 4ESOA 2HRZA 2RHCA 4AJ2A 3WB9A 5CDUA 4QECA 3W8EA 2AXQA 1IB6A 3H9JA 3ONEA 5FI5A 5JAMA 1ZSNA 1DXYA 4EJMA 1J4AA 1PGPA 1BSVA 1Q1NA 3CKYA 3KOUA 4DLAA 3H5NA 2IE0A 4JLWA 4LVUA 1OC2A 2FPPA 2ZL2A 1T2CA 3Q0EA 1W2XA 1DFHA 1M66A 3ENNA 4XJSA 3UW3A 2B4QA 1UXGA 1GY8A 4JWVA 1KBZA 3JQ8B 1U5CA 3AU8A 3PEAA 3CINA 3CH6A 5JY1A 5A3JA 3DZJA 4B4VA 4EZBA 1DEHA 1DRUA 3GDGA 2HU2A 4CUJA 1QSGA 3RCBA 4CR6A 3OIGA 1EMDA 3HADA 3W6UA 3P2LA 4MVJP 1KYQA 3RUAA 1R4MB 4XGKA 1C14A 5CTBA 1XGKA 4NU5A 3JQFA 1L1FA 2I6TA 3I83A 1VRGA 5TJ9A 3E82A 5J23A 4GPD1 2PZMA 3HZZA 2BELA 2NVWA 4PZEA 4YJHA 4UUOA 2NM0A 5HS6A 2X0IA 3OECA 4YRDA 1M75A 3G79A 3LAOA 2PH5A 2C7GA 4DIOA 2B83A 4UVHA 2EJ5A 1A71A 3U0BA 1P1IA 1OMOA 3PHLA 2C07A 1E7WA 1I3NA 3QVTA 2OZPA 3BIOA 3RU7A 3GPDG 4X54A 4XDYA 3HB5X 2ZQYA 1N1GA 3LC7O 4U1AA 4GQAA 1W0CA 4JGBA 4E5KA 3KTHA 3I9LA 3TV5A 3TRIA 3LT4A 1WZIA 1MG5A 3QE3A 4WJZA 1UIYA 3PWZA 3I3OA 1D4FA 1FMCA 3KZVA 3COSA 4BO6A 1N7HA 1DOHA 2DKNA 4QT0A 2VSUE 1BWSA 3OQ1A 4RYFH 2DTXA 1TXGA 1PS0A 1XDWA 4K26A 4JCRA 3MTGA 4LISA 3VPXA 4AJJA 1LLQA 2PTGA 1JLLA 4GX2A 1LDYA 4IDBA 3DORA 3KRTA 1UXJA 4E21A 1GADO 3OIDA 2AEFA 3FRJA 2ZKLA 1K5HA 4ZRMA 5AXBA 4ZVVA 5THQA 3TZ6A 2X86A 1UAGA 3AFNA 1CQIA 2J3KA 3D5QA 1VSVA 2PBPA 3R1IA 2XXJA 2P2SA 1IYZA 1P1HA 1SCUA 3WFIA 1NZYA 4GM2A 1YGYA 1EF9A 1GYQA 5K0ZA 4NHEA 3PWSA 3JYPA 3SWXA 1M67A 3GUCA 1BMDA 2OXIA 4KTTE 4ELSA 1ZNQO 3VVCA 3QVSA 4EGFA 4DYVA 1FCFA 2AEJA 1XR3A 1LX6A 3X2EA 5G0VA 1U8FO 1EVIA 4I9NA 4DYDA 2D2IA 4BUCA 2VOJA 2GN8A 2HK8A 3SBOA 1PJCA 1ZW1A 3EVNA 4Z9XA 4GWGA 3U9LA 1HKUA 4AJ1A 2ZTUA 3RUHA 4BO8A 1ZK4A 5ES3A 3Q1TA 1T4DA 2EKPA 5A03A 2WD8A 2Q2QA 3ITDA 4RVSA 2VHZA 4HY3A 3RD5A 1U2DA 1JKFA 4FJ2A 3LVFO 2QQ5A 3ABIA 1A5ZA 5TGDA 3PP8A 1I2ZA 4IXWA 3FWNA 3JYOA 1SC6A 5H82A 4RVDA 3DMTC 4PRKA 2F9YA 2I67A 3KYCA 3QKAA 2NU6A 2NQTA 2ZYAA 3OA0A 4A0SA 2V6BA 3C1OA 4WCFB 4CM4B 5F1OA 4UVDA 4Z3KA 5A9TA 3TL2A 2J3JA 3UCEA 3RROA 3O8QA 4L9RA 1KIFA 1XQ1A 1D7OA 1P33A 2ZL4A 2NACA 1ORRA 1GYRA 2O3JA 2VYVA 1W73A 1V0JA 1O8CA 1O5IA 4JBHA 2EHDA 2OL4A 2D5AA 4B79A 5JPIA 3WWZA 2DVMA 2WTBA 1J6UA 5EINA 1OFGA 4CUZA 2ZQRA 3HE2A 1E77A 1UXHA 3Q9NA 1DJQA 1ZCJA 2X5JO 3M6IA 4U6QA 2XXBA 3NGXA 3ZWVA 4BNFA 4FJWD 3RI3A 5KTKA 4NI5A 3IAHA 2IEBA 3GT0A 1Y8RA 1XLTA 2GTRA 5BT9A 3VH3A 4BNIA 5U4QA 4P4NA 5ICSA 4KWHA 2F1KA 4Y98A 1H6DA 4FSHA 4E31A 1SEPA 4P38A 5ILGA 1LSUA 1OAAA 3PIIA 5G4LA 4ZN6A 3KEOA 1QYVA 2FR8A 3AOGA 5JY6A 2WD7B 3DC2A 4RF3A 3Q0JA 3DXFA 4PVCA 2JJYA 1H6CA 4WUVA 3L4BC 3ZU3A 4CQLA 3IIEA 3HWRA 3MJEA 4M49A 3ZNPA 5HS4A 1R15A 1I0ZA 3DBLA 3IBBA 1WZEA 3DAGA 1K6IA 1MA0A 2IYPA 3M6MA 4RPGA 4RVUA 4ND3A 4OXNA 1EK6A 3QWFA 4IDEA 3UKOA 1C1DA 1UXKA 4XD2A 3DBVO 1YL6A 4TRMA 3RSHA 2UAGA 3TT7A 2BI7A 3DMTA 5L45A 4ZA2A 2PD6A 4GLLA 3WSWA 3S8MA 1UYVA 3H81A 2ZQZA 1DLIA 1RPNA 1VKNA 3MWEB 2J5QA 3WGOA 1PJ3A 4WCDA 2FR1A 1KEWA 3OJ0A 2IRWA 3PPIA 2QG4A 1JAYA 1PJBA 3FSRA 3JQAB 1RYDA 5G4KB 2RH4A 4CM5A 4FNBA 1UZNA 3VKUA 4R3NA 4ZDFA 4TWRA 4IPTA 1DSSG 3ZV3A 5L53A 4ALNA 5CEFA 1T2AA 1PJTA 3QWBA 2QIOA 2Z5LA 4GL4A 3WG5A 4P22A 1IOLA 5A3VA 2JHGA 9LDBA 4B3IA 3DHEA 3I23A 3EYWA 1HF3A 3A9WA 3LLVA 4QX6A 3RBXA 1R0LA 4ALIA 5JDIC 3LC2O 4E3ZA 3JU1A 3ISAA 2G82A 4KUEA 2FSVA 3MTJA 3UF0A 4TMFA 4ZU3A 3WLFA 3PE8A 1VLLA 1A9YA 3CIFA 1QXSA 4FC7A 3ZWWA 5DUCA 1W4ZA 3U9RB 3I6IA 1AXEA 2V6FA 2O2YA 1W6UA 3GMDA 3ADPA 3L4BA 2Q35A 1BTOA 1C0LA 3GAFA 4ZU2A 2NU9A 3TVWA 3H0UA 2IZZA 3Q1LA 1PGJA 4WOJA 1ZBQA 3OM9A 3QIVA 5JS6A 4DLBA 4RGBA 2OBNA 2D3TA 2VOEA 2F6IA 4AFNA 1QYXA 4QO7A 1DAPA 2UZFA 2YDYA 3R6DA 4YB8A 5IG2A 2HRBA 4JCSA 3PHGA 2J5RA 4EI2A 2QHXA 4OSPA 3UICA 4XX0A 3R9QA 3W8DA 1X1EA 2X5OA 4WECA 2NU8A 1NXQA 3IB9A 3IKVA 4GKVA 5F21A 1XSEA 2FZSA 1ZK0A 3TSCA 4WCZA 5COBA 2C54A 2Y1GA 1ZK3A 2JAPA 1ENOA 1V3VA 1KC1A 3FN4A 4Q3EA 3OMEA 2BMAA 1H2BA 2YDXA 4IDAA 3TDKA 1CEQA 4Z0HO 4Q3AA 2ET6A 2YV2A 3WGIA 1ISJA 4GVLA 1PGQA 2AW5A 3BHIA 3QXIA 2P9CA 1SNYA 3QVXA 1RM0A 1NX6A 3PFWO 3RSTA 4R5HA 2AMFA 3LF2A 2P4QA 1LJ8A 1QYCA 3KLPX 1P9LA 3LT2A 4FGWA 1I01A 2RH8A 2C2XA 3KTIA 2C59A 4IMRA 5JC1A 1QYWA 3Q6IA 2Q2WA 3PYXA 1R0SA 1DRVA 3BHJA 5JDIA 2JCYA 1KEPA 3GVHA 1MGOA 2PPYA 3GMAA 3HP0A 4IDDA 2Y99A 4PLGA 4E2WA 3FPCA 4I5GA 3A28A 3RIHA 3E9QA 4EUHA 5MGBA 1EVYA 1AHIA 3CMCO 2BKAA 1A7AA 5L7YA 3KVOA 5G0SA 3JQ6A 4ZJUA 4EMPA 4MVJE 1BXGB 1DIAA 4KDFA 3QV1A 2Z1MA 2Y0CA 1R0KA 1NM5A 3ZN2A 2Q1TA 5EQDA 3ROMA 3H0QA 4OMRA 1R6DA 3JD2A 1GZ3A 4HWKA 1Q0QA 1TT5A 4EITA 4CLRB 3T8BA 4DI1A 1AE1A 3WWYA 3NGLA 1MUUA 1GZ4A 1I8TA 3MJCA 3V5EA 3IL2A 1EDZA 5JW6A 3E6AA 3JQDA 1VJ0A 3GDOA 3D5TA 1UXIA 4ALJA 4R3WA 3R3JA 5FEUA 3RFVA 1C3VA 2ZJ1A 4FZWC 1L7DA 3OJFA 1DC3A 4OOEA 2O4CA 2JD0A 2BGKA 2GUGA 3VKVA 4B8ZA 4JXKA 5EESA 3H7AA 1DUBA 3U4CA 2QRJA 1X0VA 1YQDA 3IMFA 4WEQA 5I7FA 2Y0DA 1ULSA 4OXKA 5GZ6A 4XRGA 4Z0PA 4KQWA 3TQHA 2VSUF 1GU7A 2A94A 3T88A 5JCJA 5G2OA 4II3A 2X1HA 4BGEA 4TZTA 2O3TA 3GFBA 5L7WA 4CQMA 3EVTA 2HMVA 3P5SA 4CJXA 3JD1A 4CLEA 2EJWA 1UDBA 2GO1A 4ONEA 5GMOA 1UH5A 3BAZA 1ZK2A 1YH3A 5BNIA 1MC5A 2C2YA 2EGGA 1E3IA 5FUSA 4BIIA 3F1LA 2ZK7A 4PG6A 2OMEA 1B26A 4BO1A 4HADA 1RJMA 2BI8A 4PN3A 3GVCA 5DTWA 2DT5A 5HWSA 3HG7A 1YVEI 1NQ5A 4FW8A 3OHSX 5TT0A 1GTMA 3BZUA 4GX1A 3ZWPA 3QQPA 3JCZA 4IZCA 4E0BA 3INRA 1YO6A 3RC7A 5JSFA 3JQCA 4J1QA 5FFFA 2FHSA 2O7SA 4EUEA 5K9ZA 1SMKA 3C24A 2DBVO 4NJMA 3PWKA 4OH1A 1AXGA 3OQ6A 3GHYA 1KERA 3P2OA 1PJHA 2J8ZA 4Q3BA 5BSHA 5JBIA 1NFFA 4RPKA 1HWYA 1NPTO 2GRAA 3QP9A 1GQ2A 2HO5A 1RYEA 1P31A 3VHRA 1F0YA 2WSBA 3LK7A 3NKLA 5TC4A 3INTA 3MCVA 3RAJA 3V2GA 4FZWA 2JD2A 4MP6A 1PJQA 3KSDO 3NEPX 3GHHA 4LRTB 3NTRA 4M89A 2EKQA 1Y81A 3M2PA 1IHYA 1DC5A 4NG5A 4B3JA 1LQTA 4NNJA 1HZDA 3B1JA 3AJRA 5IN4A 3Q2IA 5A02A 3E03A 3ZWXA 2ZATA 2PD3A 2V6GA 2GNAA 1ZXBA 2O3RA 4M87A 2Q2XA 4NK4A 3H65A 3FHLA 4MINA 5G1SA 3RC1A 4K28A 4OMUA 4PLVA 4YT5A 4E6PA 3TZ3A 4YAEA 1X0UA 4OSOA 2GR9A 1ZEJA 3U4HA 3GDFA 4O5OA 5EL0A 4CM6A 1JA9A 2X22A 3HINA 3FTPA 3KTKA 3OH8A 1YOVA 3INGA 3NT2A 4NDNE 4PGFA 1MXHA 1UDCA 5K6AC 4D3FA 1E7QA 1ID1A 3DOOA 1RKXA 4N5NA 3NT4A 4ZQGA 1OI7A 1WZ8A 5FIFA 1R4NB 2HCTA 3FDUA 4WNIA 4F47A 1JAXA 3WFJA 3UHAA 2DAPA 1C1XA 2XOXA 3AM5A 5C7IO 2PY6A 4E2ZA 2F9IA 3F6YA 4BO3A 3ENKA 2C29D 4JJFA 3UOGA 2H1SA 2D8AA 1DC4A 3RC9A 1X14A 2CBYA 1XU9A 3QMJA 4GHNA 1P3DA 2EEZA 4F46A 4I8XA 1V3UA 5KDRB 4UEKA 3KV3O 4G65A 4OIMA 4G2RA 5DP1A 4YQZA 1LDNA 3DTYA 2CDBA 3KEQA 4YLHA 3TOZA 4YAKA 2AHRA
chains in the Genus database with same CATH superfamily
4FS3A 2YQZA 2C4TA 4OK6A 1M7GA 1KFJB 3W5VA 1NPYA 3WJAA 3GGSA 2CD7A 3S6JA 1QCZA 4B2IA 3TLEA 4KIJA 2G5TA 2RAPA 3DVQX 4XJVA 2BEUA 2NLOA 2UZ1A 2POCA 3LKEA 4NMMA 4DCPA 3ZHXA 3IOEA 1RPJA 1A97A 1AHNA 3NDIA 3STWA 3G2OA 3VC7A 1W30A 1CUCA 3R0ZA 4KQEA 5LWQA 1EUCA 1TZKA 5DCUA 2I1WA 1FA9A 2XSZA 3A1NA 3EZLA 4RS4A 1AURA 5DZSA 1L4NA 1QWOA 3JWEA 5TRTA 4NNQA 4H31A 5DKFA 4KMMA 2JEOA 1SA0B 3SM3A 2VJOA 4LBVA 1KO8A 4ZT5A 3CRVA 1E1CA 4CW7A 1A9XB 3I73A 1C3EA 3VO1A 2B69A 1OH8A 1F12A 2NTJA 1UANA 3O2NA 3QXSA 4LY3A 1EJ2A 4BN4A 1YS1X 2D0OB 3JXEA 3N59A 4WY5A 2CE2X 3O9VA 4XDGA 4EKIA 3T06B 3M9WA 5J2TF 1M8PA 1Y9JA 5AW1A 4UHCA 3ZHBA 2PS1A 1ETUA 1RTKA 2Q0QA 1XRSB 3EOZA 3Q15C 4QYWA 1YK0A 1VGVA 5AHXA 1K0UA 1U11A 2FX5A 3U3XA 5LQJA 2A5DA 2D0PB 1ISIA 4DXDA 2YZMA 5K45A 4PTYA 4JJ7A 1SCAA 2Q3EA 1IPFA 4O4LA 3MB8A 5FPTA 3E7XA 1XQXA 4JU8A 4MOUA 1TKAA 4WBNA 1V2GA 3OCVA 4UREA 2C7PA 1F0KA 4YV2A 3R9WA 1VDZA 5KTRA 2AZTA 3TXXA 2X6QA 3MAAC 1YL7A 3TVDA 2SKCA 2C00A 1D09A 1JUDA 3CW2A 4MR8B 4MS1A 1AOXA 3FCXA 4X62B 1EF8A 2PM8A 5EVJA 3Q7SA 1LK5A 1CDDA 1H8HD 1JHQA 5E2BA 4I8IA 3EPJA 4E07A 3LFTA 3PLAE 1ULUA 3ZLTA 2XEXA 3MT0A 1XPOA 3CXRA 2IEYA 2QUZA 3R5XA 2V0CA 3NIFB 1DEXA 3UOAB 3QJYA 3KUXA 1DCFA 5AVRA 4FYHA 2I7VA 2X0DA 2HCRA 5DXFA 5A4DA 3V97A 1Q7EA 2QR2A 2ZDGA 4P3OA 5J2UB 5BQ5A 4JKOA 5DNVA 1Z7EA 1MBZA 3RIEA 4DNQA 5HQ3B 3P2EA 4UBMA 4XIGS 3U4IA 3I53A 2IKSA 1GA1A 3H1EA 4P08A 5CTJA 4YO7A 4TPKA 4WESB 1MN6A 5EMJA 1WQ3A 2G70A 4EMMA 1CJSA 4JSTA 3DC7A 4QODA 5LKAA 2E85A 5FO1A 1CYDA 1CPYA 3C70A 4Q12A 5BR7A 5FUMA 2W6NA 5E7QA 5HYVA 3OU2A 3I45A 1FP4A 5IT5A 2Q4BA 4QUKA 3IP1A 4OVKA 3H8WA 3O91A 4R69A 5I7UA 2H4YA 1K9VF 4JLUA 2WTUA 3D3WB 2QEQA 1AKWA 2QQEA 1WMDA 1AKNA 3ETEA 4UHEA 1SK8A 3AR6A 4ZOLB 1UWVA 5HQTA 1P8JA 4XVRA 5BVGB 2G0TA 3H8SA 4MYTA 4PXYA 1Z7BA 1LLCA 4XB1A 4BNTA 3KOXA 1CNFA 1I2CA 2ZJ2A 4TSRA 2P9EA 3QFTA 4RF2A 3WJ7A 5D5HA 3W6ZA 2X58A 1VP3A 3H5AA 4EAQA 2CSXA 5I9LA 4JR0A 1UT6A 2JIQA 3JR3A 3SYRA 4TVBA 5C46F 1BHSA 4YRQA 3B85A 3KT0A 4EI7A 1RJMA 3F4LA 2PYDA 4C4YA 5EZYB 4YJFB 5IT9A 1VIYA 2V7WA 4OCZA 4QNMA 4C08A 5JE8A 3GLRA 2ZBQA 3H4TA 3T5AA 2LCQA 4RLFA 1RD4A 2FEWB 1DG3A 5DTWA 3L9XA 1UK7A 3BMQA 1LVGA 2A5LA 1FXSA 3GR6A 3SOZA 1AKYA 4P4GA 1WMAA 3K6JA 3L6OO 3LVRE 4QDTA 5EZ6B 4LCJA 3U56A 4RORA 4TL7A 4INAA 1MFPA 1S8AA 1XP8A 3ZV5A 3LRXA 2P65A 3I9V6 3MYRA 5KX5F 1SZJG 2C4HA 3QTBA 3LP8A 1DNPA 3SZRA 5K0EA 4U7TB 1AGRA 1QCDA 1MB9A 2PZJA 3CEAA 3RYHB 3T7SA 1BCSA 3V8EA 1L8XA 2DPLA 3MWDB 2GTPA 1WLYA 1HDYA 2C03A 2COUA 2Y66A 3OO1A 4RHYA 5F5NA 1HEUA 2ODNA 1QOZA 4KPYA 3BL5A 1ISGA 4GPTA 1OX5A 5KNDH 2MR5A 2VH1A 2ZM6B 2WLSA 2NXCA 4ZDDA 3DM5A 1HBJA 3IMKA 3NJ4A 5EXXA 4RM2A 1Z37A 4AP6A 2BEVB 4JQSA 3H2GA 2B1IA 2YZ7A 4FN4A 2JAOA 4G63A 4KN5A 1FRFS 4GRAA 2VBGA 2HPAA 2EARA 2FPMA 1TLFA 3H9BA 4LMPA 4DWVA 3PK0A 3GLGE 1YSCA 3R3VA 5LC1A 4B8WA 5TPWA 4AP9A 1Y5MA 3KTGA 3B6KA 1PQ4A 2VJKA 5L95A 1S3SA 3BTVA 2O5VA 3PIRA 3FNBA 5EUBA 5HMMA 4R0NA 3STAA 2ATEA 1XZIA 2PSSA 3UQYS 1UYSA 1GAWA 5JQWA 4J29A 4ES6A 3NHKA 4IQGA 1RM5A 3U3ZA 5K0JA 5IYZB 5K0FA 1WMBA 5IVDA 1JPNA 1H3EA 2R1ZA 2NP6A 2HMTA 2ZB2A 3W5SA 2K6GA 3W5BA 1Z3CA 2QMUA 4OJYA 1NA5A 3ENWA 1RMQA 1HNXB 4MR9B 4MRMB 2HXGA 2EKLA 2YMMA 1C80A 1ZM4A 1VECA 3OD1A 3Q8XB 8GPBA 1FIUA 1NTRA 3HXMA 2GPYA 4DQVA 4N3AA 5ALVA 3ZI4A 2COEA 4GPAA 5ALYA 1XEWY 4PX2A 1PSDA 1WX1A 2C2KA 1J25A 3HBMA 4B3XA 4ZI3A 3TNDA 3OZTA 1ZGZA 1LW7A 3TM5A 1R0ZA 1E6CA 1SHLA 3I1FA 2JLUA 3JQGB 5K0CA 3A6HA 3D3EA 5K1ZA 1W5TA 2H7XA 2NVBA 2JFGA 4F3NA 4MA0A 1GZ7A 4RNDB 5GVRA 4F5WA 5IULC 2VPPA 3AESB 3H9QA 2YWFA 3UATA 3WS7A 1GPH1 5AKKA 4ML3A 4AQDA 5MFZA 2AXPA 3OMLA 5DBFA 1J9ZA 2A9QA 2W0SA 3FUXA 2ZB7A 4X61A 3TGPA 4RULA 4P36A 3FPEA 2KBEA 2MJLA 2ZRDA 4C7KA 3CJQA 3K8XA 3IRUA 3C7CB 3CVVA 4E88A 4QREA 2TMDA 3DCYA 4HGQA 4M1WA 3D6MA 4ZEMA 3DDSA 1GZUA 1XO1A 3OSZA 4U2KA 4CFZA 3C8ZA 4JVOA 1YWGO 3SR0A 1B8OA 2GB4A 2AB0A 3D2CA 4ZVNA 3FNGA 3VZSA 4ZIRA 4FYWA 5CJ2A 4C3UA 3MCTA 3A05A 3GIDA 4GNKA 4MWTA 2QQ3A 1ZGBA 2EC5A 4EO7A 2OV3A 1HG0A 3ZDQA 1KQ3A 2PMBA 5K2OA 3VKHA 1CZRA 1QH8B 3K6KA 2FAXA 3EA5A 2P1DA 1PBTA 5HIJA 3QEOA 2MSEB 1GGMA 3MM4A 4IV8A 4BV9A 2FV8A 5DI9A 1IM2A 3T9DA 1V16B 4WMLA 1USKA 2J7KA 2Y1KA 5C32A 1HT0A 5BW6B 3NVDA 2NSLA 5DSTA 4DIMA 1JEAA 3UEOA 1FVOA 2XW6A 1MENA 2BSAA 4EIWA 4B32A 2JIZD 4R51A 1G21B 1LBTA 2BEJA 3D8HA 3W1EA 3BD6A 4HAIA 1X7ZB 3DM9B 4D46A 3TW4A 3K8YA 2WM9B 1JJBA 1IZYA 3KKMA 4DLPA 3GDHA 2VSUA 2RGNA 4GMGA 1X8LA 2H9AA 4PSKA 4Y2HA 2X4GA 2QVBA 2ZI7A 1NWHA 2V4MA 2WHPB 3KTAA 1RWWA 4PYOA 4A26A 2DEOA 1F4VA 1KJNA 4G5HA 5FWNA 5CFZA 2R60A 4BJHB 1QLHA 1L7EA 2JZOA 4P34A 1G3QA 4NFHA 2ODWA 1NBOA 2AF3C 5AJTA 1NUPA 1QNFA 4H3SA 4XKJA 3TINA 2A3NA 1LPAB 5KNDD 4I4ZA 1MW8X 2PJZA 4MO2A 5FA6A 2O3SA 4D82A 5LYJA 3PQ4A 3EMDA 1TMKA 4MXIA 3MPOA 3DWFA 2Q45A 2DQZA 5LMZA 4O0LA 4KFSA 4LJSA 4WV3A 1NQTA 1AF7A 4B74A 1F6WA 1D5WA 2FRXA 2C5BA 1P0FA 2QVYX 5ES4B 2FPIA 3TQSA 5KOHB 3SLLA 2ZE8A 2DUJA 3IHKA 1FFHA 4D45A 1W52X 2D3WA 4F1KA 4NCKA 4YPOA 3KJQA 1MXFA 3GFVA 1BNCA 1QKIA 3AI1A 3LHFA 4DLKA 4E1VA 3WMXA 4DLLA 2ZTSA 2WWGA 5CA0A 4E5UA 5EIXA 3OFNA 4A2CA 5JBQA 2P5TB 1QRTA 3KUKA 4MOWA 5I9NA 1YBAA 2G9ZA 4LJLA 4ZMRA 3OAAA 3C8HA 4P53A 5TE9A 5I9MA 1DINA 5EJ8A 2IF0A 3NEJA 4N03A 4IGKA 5AM4A 3K2EA 2H85A 3C14C 5AUOB 3RT7A 3ER8A 2YOGA 1ZR2A 5HGJA 2I91A 3LT5A 3JQ9C 2OORC 1DLJA 1PK9A 1AK2A 2H48A 1RM3A 3CSDA 1C1YA 2VLIA 3DMGA 3N87A 3MJSA 2UYCA 1UMBB 4CV3A 1VL6A 3HYCA 4M7WA 4YP0A 1E2LA 2HLPA 1NVBA 4Z7JA 3FNHA 2IWRA 3SS8A 2IZOA 4JSYA 2CF5A 4Z86A 1LPBB 1QP8A 1RE0A 1VIMA 3TOCA 4EVIA 1UZMA 4XX1A 1W87A 5EOVA 1ZJ5A 3IJEB 5JATA 1TFUA 3HEMA 4PAGA 4QOSA 2OFFA 1ZVMA 2HN9A 4U2BA 3VSBA 3TAXA 1CX9B 1M1YB 3AM1A 1XRQA 4JL5A 2RK6A 3AG6A 1CJCA 2BFBB 3TZLA 2R1TA 1J21A 4I5FA 4QQNA 4A6XA 1HGXA 4MI6A 4DUGA 1WNTA 3UWKA 1WXWA 3FKJA 4D4IA 4X44A 4G85A 1KP9A 4QGHA 5SV2A 5A5GA 3PHHA 4CCWA 2KX7A 3B3JA 4ETMA 1I9CA 4AZ0B 4LTNA 5ARCA 2XYPA 3N58A 4YRTA 4BJ6A 2V6JA 1EVLA 4XA8A 3HDYA 5AOCA 1WD7A 3S4YA 5KTNA 1X8JA 1ESDA 1RXUA 1Z0JA 1LA2A 1TVKA 2C2HA 4IDNA 5JXGA 1J06A 4LGMA 3R40A 3RRXA 4UE3S 1T1JA 1TYEB 1WCXA 4IQFA 4BDSA 3CH7A 4UD6A 3MOYA 2ZL3A 2ONJA 3N3BC 4M9SA 5KQGA 2G09A 1EWYA 3MUFA 2RARA 4Y2UA 1IJKA 4Y2PA 3ZW9A 3UJCA 3M9XA 4BNZA 3I9MA 3OLCX 2XIJA 5AKGA 4ZI7F 2D2FA 2ZRFA 2PT7A 3NPMA 3K8ZA 5KJPA 1Y3HA 3OBIA 3TLMA 2WQ7A 2ASVA 2CXPA 1YF3A 4OG2A 4Z4QA 2DWQA 2JHCA 2ZTHA 5LP6C 4K6MA 2A59A 4UEOA 4OYRA 4N7MA 1V5EA 1MJ5A 2GZ3A 2FUEA 1L3CA 3TCKA 3TTYA 4G1BA 4L5AA 4BTVA 2EX1A 1G4HA 4WY8A 2REOA 1B1AA 3P1JA 4OSEA 4PLFA 1SVIA 2WUVA 4TGLA 3W5IA 2RI1A 2N42A 4J7UA 3EDOA 2P6RA 3RS8A 1O1YA 3PQEA 3LXMA 4R31A 2RHJA 3UO8B 3VX3A 16PKA 5J9FA 1I2MA 1SEVA 4L2IB 4B0OA 2PO5A 1SQGA 5TGTA 2MTBA 3JTMA 3JYNA 2ARKA 2BH9A 2LBPA 3PDIB 1KQPA 1LRLA 1FSFA 2V5UA 2Y9MB 3O95A 1N4AA 3USZA 5EJ6A 2HJRA 4WCFC 4DGSA 4NBVA 4FMPA 5CIYA 2VJAA 1SG6A 1NSYA 2VHJA 3FIJA 4Q3OA 3GRRA 3ER6A 1WV0A 1LQ2A 3NHYA 1Z5UA 4X85A 2NUPA 4MW4A 3U7QB 4CMEA 1D7AA 2OHJA 2QGNA 4RANA 1JQBA 3PG5A 1ZM3A 1A8PA 4K9NA 1KDRA 1JEYB 3O2QB 1DOAA 3E5RA 2JI6A 1YMUA 1VHQA 4YDHB 1CY6A 1W4LA 4BZWA 5ERXA 2XDQA 5FWYA 3EQZA 3DEHA 2B6NA 3K4PA 3CUWA 1G8HA 3QLJA 1ODJA 1IMJA 3FTQA 1AG9A 4MQMA 5TMEA 3PQ8A 4ZCSA 3T4UA 4TVOA 1JSCA 1R3DA 1RXCA 3NWBA 5DLYA 3MBOA 4WK0B 2PH3A 1AF4A 3BDVA 3FFTA 4JDPA 5GWXA 1OX4B 5TT1A 4JC5A 4PY2A 3E5MA 4GT1A 3KU4A 2BI4A 5TSDA 1JQEA 1PO7A 1RR6A 3U7HB 1ODSA 2CXSA 3HZRA 2M6SA 4AS2A 1MRZA 1N8KA 1LDEA 2F1JA 2B34A 2UVPA 4JN6B 5C8DA 2GJ9A 3UBMA 1NQXA 3I12A 3NDBB 3LE8A 3D0OA 2WIKA 3D0QA 4D9NA 3EXIA 5KPJA 4EW6A 3ECCA 1JR3E 4J1TA 4TTSA 3E3OA 1XZJA 1SU7A 1Z8HA 5ECDA 5HBGA 1OBHA 3HUEA 2A1TS 4OHUA 3V8BA 3UK7A 2G17A 2NV0A 4R01A 4Y6RA 3TL3A 3A3OA 1REQA 3KCNA 2CYCA 2QZJA 3HSKA 4B43A 4DPKA 2CLMB 3IP9A 2D1RA 3BMOB 1QE5A 2GAOA 3AP3A 2JA2A 4Q3DA 1JEDA 2Y1EA 1KHTA 4HDKB 3LTNC 5AKJA 4DRYA 4PQYA 1JQAA 2FPUA 1Q11A 2VP0A 1QG4A 4L5CA 3OWHA 4RL6A 3UAGA 3HCDA 3TLCA 4CM4A 5DRTA 1XTIA 4L07A 1IU9A 4B33A 3HXKA 5IZCA 3A26A 4B3SB 1SXJB 5KAPA 3DBOB 3O9ZA 3TJMA 1TM1E 3GBPA 1CZNA 3PHBE 5DHQA 1VFNA 2WZDA 1BGVA 1FSZA 2R7MA 4XGRA 1Z0UA 3IPYA 3C97A 5M29A 2C5AA 1HPLA 4G56A 4EW3A 2YN2A 4NATA 3PFFA 2IIVA 4CL2A 1QRSA 5ERYA 3R20A 3L8HA 1BDJA 4ME6A 3IO5A 1E3EA 1VG9B 1BXKA 3FVQA 3GMTA 3GPLA 2X9LA 2PZEA 3M5PA 3HHEA 4AG3A 4CMCA 2D5LA 2ZAMA 1JE0A 2YZKA 4WZBA 3WNVA 1SCKA 3DHVA 4ZTUB 3L7IA 1JPJA 2PH1A 1ZSVA 3NYRA 5AJVB 3I5YA 4MDYA 3AF5A 4HC4A 3QWHA 2QTBA 2Z8YM 4MX8A 4H7EA 1IM5A 2HO4A 1KJJA 1BVRA 1U0LA 2W2XA 4FLFA 4P8RA 5LR6A 1RFGE 2HMUA 2AFIE 2E0IA 3G6KA 1WNFA 2P4SA 2WMYA 5ALEA 4C04A 2H1VA 3FF4A 2E6UX 4C6RA 4EGCB 5C8VA 5KVSA 5AW5A 4UFNA 2O4UX 2F3RA 1NX9A 1B14A 5EEGA 1T9DA 1QZUA 2BTQA 3R7AA 1PSWA 3F97A 4GRIA 4KOAA 3VU0A 1U2GC 2O0HA 3SC6A 4FYKA 3WDKA 1MO2A 4BLOA 1J0CA 3QKUA 2F3UA 1Z73A 1P29A 1JXAA 5EMNA 3QX8A 2F17A 1DZIA 3RC2A 1V11A 2MWMA 3IAM1 1S2DA 3VVLA 4ZICA 2ZIGA 4JJTA 2V7GA 1XCMA 2EIHA 1S2LA 4DT1B 5FA8A 4ZKDA 4QUHA 3WIOA 4PNEA 3U7GA 2HA4A 3H4MA 2G4VA 2AG6A 4EBBA 1RI1A 4DLUA 4CMHA 1QP7A 4R16A 3VTAA 3L82B 3P0RA 3DFMA 1U0SY 4XYMA 3GRCA 4ZOLF 3CCCA 4L5YA 3G2HA 2I99A 2R68A 5CVDA 5EIOA 4ZEVA 1JIQA 1Y9AA 3FYUC 5MF6A 2H5IA 4QIHA 4CMKA 3JVDA 1HMYA 2VH2A 5J5AA 2HWYA 2NP9A 3CKKA 3VTZA 5K0GA 3AI3A 3OZ7A 3PI6A 3FPGA 4RCZA 5KOIA 1ZL2A 1EBFA 4BMSA 3JQAA 1BDBA 2H4XA 1P45A 3B7WA 3KL4A 2HHAA 3KZXA 1YS2X 4WLUA 5G4KA 4EA6A 4F97A 5EZYF 4XYGA 5HF6A 2Y2UA 1C8BA 5B37A 1PTKA 1FNNA 1Z5GA 4AN1A 3BTOA 1TEHA 4QRDA 3PGJA 3BGSA 4TLDA 3A8TA 4QC2A 5IF3A 2VSNA 3KYIB 1JJFA 1N3IA 3I01M 4UU7A 1W0JA 3QJGA 2N75A 4GWKA 2EKDA 4ID9A 1N6RA 3H9CA 3DMYA 1U1EA 4O4HF 5LQMA 3B6IA 1NKVA 2AVDA 4TS3A 5DW0A 2WAYA 1I9GA 3WLPA 2WPDD 5SY4A 3SP1A 1H05A 5BMVA 3VA7A 3AWDA 4P5EA 1UT8A 4ZOEA 5A05A 1AZSC 3LCMA 1E2JA 3I92A 1IY1A 2IDZA 3Q6MA 4QBGB 5KYKA 3Q6NA 4FFBA 1SG9A 3VYVA 1GNRA 2CHQA 2IL1A 2QZSA 2WWWA 2I2AA 3GY0A 3K09A 4P0TA 4J16C 2Z6AA 4W7IA 4C0XA 4NZ9A 4LJYA 4BMNA 1PQWA 1NV9A 3L0CA 4ZVSA 3IVGA 4DUZB 3TVUA 4PHHA 3BJMA 4C7MA 1D2CA 2LR0A 3ESZA 1XTQA 2WU4A 3RAPR 1OREA 2C8JA 2HU5A 4R68A 1HQYE 3IUSA 2IW1A 3WLOA 2LGJA 2QTFA 3LKVA 3VZCA 2Z8XA 3V2HA 5FO0A 1G2OA 3C7TA 3P0HA 1K92A 3MLAA 5BOVA 5E3HA 3VH2A 3I6MA 4K6GA 2ZUTA 2PRKA 3OZCA 1K98A 1N3LA 4J76A 1DP4A 1J49A 4QQRA 5IN5A 3C1UA 3EW9A 5JISA 4P84A 3RWMB 1I33A 4FHEA 4MQBA 3SD7A 3UJ7A 4WLFA 4KR9A 4BAZA 2O7RA 5AK6A 3RFTA 3SC2A 1CR6A 3OURA 4EPWA 3ZCVA 2VHQA 3BBLA 4ER5A 3H0JA 1RRMA 2GZDA 3UC9A 2CV0A 3T7DA 1YZVA 4GE0A 1IUNA 3OLWA 1PK8A 1KTIA 1QHHB 2NU6B 1V1JA 5AJYA 4ADSG 3FGZA 1ZGGA 3CVOA 3GVXA 4LOHA 2VDUE 4J4TA 4W4TA 4Z1MA 5A06A 3J80A 1YJ5A 4TV9F 5BORA 5CDYA 3ZEIA 4MGZR 3NXSA 1E6UA 1SC4A 4H2DA 1RTTA 3MCWA 4OJTA 3GLHA 3LGXA 1N0IA 5CA1F 1TT7A 2A4KA 4DA7A 3G17A 4JLNA 1IXZA 1ZD5A 2GXUA 3W77A 4P98A 3KHKA 2XVMA 1K0FA 1O4VA 2ZBEA 3ANLA 4KO8A 3ZDYB 2N47A 4R8MA 4V24A 4EHHA 3OBBA 2VYNA 5JFGA 1CW2B 1N2CE 2G06A 4ZQIA 4CU5A 3UUFA 1XMOB 3WICA 2HHJA 1FVFA 1OKKA 3IA7A 1KY5A 2Y27A 4HLCA 2NSDA 1PR9A 4H77A 4NE2A 2BPOA 2BGIA 4QOJA 5H81A 5C37A 2IYXA 2WUEA 4UCQA 5HUQA 2W6PA 4IZIA 4KL8S 3ILSA 1OFUX 2OT3B 4FONA 4H7PA 4MR7B 5IH3A 1D0IA 1UADA 1V7PC 2IC5A 2TS1A 2XYRA 1ECPA 2P9BA 3SFVA 4NZMA 4TKMA 2WJYA 1TECE 2HAEA 4TXNA 4PX3A 1ID8A 2Z98A 5SYNA 4JI6B 3WLIA 1WCV1 1K7XB 1J0BA 1VLHA 1H9BA 1VMEA 3P0JA 4RIHA 4O3FA 1PW5A 5ENDA 1MG0A 3TGWA 1S2GA 1X7GA 4YQYA 3WBKA 2GILA 2G7MC 1B6TA 3VPHA 5AVVA 1JDSA 1IFXA 1F14A 2GCNA 3S2ZA 1BD4A 4CQLB 2WR8A 3LXRA 3WWOA 1ZITA 2G5PA 1PWYE 3B8EA 4Q3LA 2QRLA 3BD9A 2AWNA 3GA7A 4IIBA 4KAFA 3DBLB 4FCWA 4GW3A 3SZGA 4AKSA 2PJRA 3DDUA 3JARB 3FM9A 1JI0A 3LECA 5DW3A 3THSA 4IH1A 2P40A 1WVIA 4HB3A 1VI5A 3HSYA 1GP2A 1YIAA 2V9CA 4JT9A 2UYQA 5K99A 2P0YA 2W8ZA 4ZD6A 1I5RA 4XH9B 5F76A 3TW8B 4JJIA 1K8XB 1E8NA 1NRXA 3WLEA 1EEHA 5ELLA 4B7CA 4EO4A 1NE7A 2FRDC 1AQNA 5BSTA 3PGKA 1WB4A 1EP9A 4K1XA 2C8TA 4GOMD 4WLNA 3IDQA 1A9QA 1JFLA 1SUWA 4RACA 4DM3A 3MGBA 3C3AA 2HJHA 5T3YA 3W9SA 4N9QA 1QQ7A 2WHXA 2EW2A 1HE2A 4J91A 1INLA 4JVTA 1Z8NA 1OAOC 3KXPA 3O3MB 4O8CA 3CPJB 4JA0A 2AZDA 3WYFA 3RS5A 2NXJA 1N0HA 4YHHB 3V9PA 3FXAA 3N5CA 3ZQ6A 1B6SA 2VPTA 2FPOA 5K3SA 2ZRQA 3VO8A 1LPPA 5KKCA 1I2DA 4M2LA 4MTLA 3LUAA 4X1IA 3QFFA 1FBNA 1U63A 3H8VA 3QU9A 3M6XA 4XWGA 5DF1A 4D2IA 4KIUA 3P5BA 1GGNA 4G8CA 4EQ6A 2GOYA 3EFBA 2VUSA 3LRTA 4IZBA 5JTUA 5M34A 3UT6A 1ZJYA 1NUSA 2PG8A 1HZZC 2GLUA 4GBJA 1E3TA 3M6AA 3TKLA 3WGJA 2PZLA 3R9XA 3B1FA 5LP1A 4IZCA 4RBNA 2BHSA 4HTFB 1NVVQ 1Y4SA 1KKMA 1NVUQ 3HMQA 4LDZA 4ZAYA 3VUEA 1SZCA 3PXAA 4H0NA 2AW3A 2IU0A 1X70A 1DJPA 3QKRA 1AK1A 1DQZA 5EFOA 2FWBA 4P4SA 3S5UA 3OT1A 3VPFA 3H2SA 4DDWA 4LSZA 4ZYLA 3JVVA 4X8HA 1V8ZA 1Y37A 3H8JA 1W76A 4X6YA 4MJXA 4WTOA 2ZBGA 4XI9A 5C5IA 4C0BA 5IX8A 3ENZA 1E9EA 3BS4A 1YDHA 3T38A 5TDHA 4JFCA 4WYOB 2BD0A 1MJGM 1IOWA 3IALA 5HFAA 3ACBA 2YWXA 4Y0VA 4Y2SA 5HZGA 3M6NA 3U3RA 3HWWA 2QP4A 2NWQA 3B1XA 2H08A 1E5QA 1Y1PA 3WX0A 3UH0A 2FCAA 2QLTA 2Q5CA 2ZJ6A 4Q4DA 4B76A 3DOUA 2B8JA 2HDNB 4M60A 1AU9A 5JQGA 2XPCA 3GLMA 3DPUA 4PRYA 2I2FA 1OHHA 3JZIA 1RRKA 3UC5A 3GNTA 4C22A 4G25A 1GR1A 4IX9A 2R86A 4KN8A 4FMDB 1JVBA 4C88A 1ZA2A 3CLKA 3SQMA 3DNMA 4HB4A 5C7LO 1ZN9A 2ATXA 1PL7A 2Q1WA 3QOWA 1UINA 4UAGA 5DWDA 1ENYA 3LW7A 1NBWB 1XEAA 1DTWA 1ZUNA 4JBIA 4K2HA 4JUDX 4L76A 5EP1A 2ST1A 5KQLA 3V5IA 1ORWA 2VXBA 4G5YA 1U7DA 2H1LA 2PU5A 1ZU5A 1JJIA 1SKBA 1Z6PA 5DHFA 3THYA 1RBZA 4RKEA 5E1OA 5F2KA 3WK4A 4M36A 1O3YA 1OROA 5GONB 4W5NA 3OZBA 5DGXA 1HRDA 2WFMA 3EIUA 2H57A 2YR0A 4QDXA 4TRJA 3EDCA 4G0PA 1Y3BE 3E22A 3G23A 2JFBA 3WL4A 5KNLA 1XYGA 2EF0A 1AN9A 2VX2A 1R4NA 4O4IA 3K9BA 5CB4F 4OXXA 1E4VA 2WAMA 4WFIA 5AXAA 5IZ4A 3TNLA 2HMYB 1JILA 4P0QB 3C41J 1DKUA 1TLTA 1G42A 1JU4A 1TJ3A 1O5OA 4MVXA 4OAPA 5GOTA 3PCXA 3VC3A 4R1LA 4BN0A 1Z68A 2C7RA 2NIPA 2W3PA 2NZXA 3QU4A 5F3DA 4HI0E 5HFJA 3IE2A 4IJ6A 5KDRA 2CUKA 3KZOA 3DHNA 2ETVA 5T7BA 2NUTA 5IDVA 3AF6A 3OT6A 3S2GA 1MX1A 4DSZA 1OWNA 4FFPA 2QM3A 3JPYA 3HN2A 4FDTA 4KMSA 1L5LA 4H4DA 1ZMOA 3TQIA 2CV2A 3ETGA 2O8BA 1FMTA 5JI3E 3EEQA 3WWPA 3K2IA 3K16A 3JAKB 2XMSA 3EEBA 4QHTA 4QU8A 4I1PA 1AA6A 2Q49A 2Y9PB 2M2IA 3UJDA 3ZGOA 3OMXA 2J9YB 3LVQE 2UZ3A 4A6DA 3BDAA 4DMGA 4AWBA 3EZXA 2ASEA 3G1UA 1U2PA 3I8XA 1FDVA 2Y68A 4XRGA 3FY4A 3BICA 1O03A 1NFQA 4DIFA 3N28A 4PXSA 1P5RA 4TV8B 2PKQO 4Q39A 1FVHA 2PGAA 2ECQA 3G8AA 4Y6SA 1OV6A 5IVKA 1DC6A 1GDHA 1XXLA 4KAXA 4RMIA 2RIRA 3X3HA 4C06A 5I7EA 1P2BA 3GLGA 2X3UA 4CF4A 3A1WA 4ZYXA 1ZH2A 1MO5A 1E2UA 1JFFB 4O63O 1A5BB 3EPKA 4Y0AA 4XIYA 2GPBA 2M6KA 1NFRA 5LLTA 3KTOA 5DBIA 2I6UA 5C1PA 2VA9A 3SY8A 3DG9A 2NO0A 2HB6A 2VF7A 4ZOCA 3ZYCA 1T0UA 3WLMA 1XL1A 3UAWA 2A9JA 2JFPA 4CQJA 5JWOA 2AMVA 2EBHX 3IIJA 2JH3A 4HLUA 2WUWE 4RPCA 1DZ3A 3VPDA 1KDTA 2BE7A 5KMGB 4XGQA 1TZCA 4C4RA 3MOIA 4K46A 2ECFA 2GKGA 3QY0A 1ND6A 1M2GA 1D2NA 3E8SA 2XADA 4WKCA 5HCIA 3RANA 2IITA 1LLUA 5ILOA 2LPMA 5JD4A 4S1NA 3IMEA 2AOWA 3LOUA 4U0GA 1WF6A 2UV8A 4RQAA 2B94A 1JHZA 2GASA 3QLTA 1HDZA 1W1WA 1FNBA 1G5QA 2ZW9A 4MS4A 5JNVA 4B7UA 5DX8A 2OV1A 3ISJA 1OD6A 1RWMA 1X39A 4RVNA 1C81A 3PRJA 2VATA 3OZIA 2FE4A 4XFDA 4XD7D 3UT5A 3N8NA 2IY8A 4FPXA 4QELA 4U2FA 4KPKA 1N5OX 2BRUC 1HDXA 1P9RA 2PLWA 4MRPA 3JZAA 1P4AA 1WZNA 1FP6A 2AYXA 4LHWA 5GPBA 5B36A 1WULS 3GT4A 3BK2A 4OQMA 3RG8A 1W5EA 3BG5A 3RTEA 5FA5A 2R1UA 3U0VA 3DEIA 1C9YA 4HAXA 3M6WA 1JR6A 1Q6ZA 3ED5A 4DG5A 3CGGA 2Z4SA 1XWFA 4TQGA 3HGTA 4I3HA 1DIHA 5C52B 3RSIA 2PBLA 3D59A 1C7IA 1GCIA 1IG0A 1XRMA 3W2HA 1W4AA 2C9ZA 3G0BA 1G20B 2QE6A 2VZ9A 3NTVA 4K8RB 5E7MA 2CDCA 2PYZA 3NIBA 3A6JA 5L4SA 3PX3A 4EKYA 2OWEA 2PNJA 4KKXB 1K8ZB 2F90A 4GC5A 1ONNA 2WSSA 4GOOD 4TUYB 4RDHA 5TQ0A 3PLNA 3R75A 1NG9A 1KGSA 4LW8A 1ZYUA 3ED1A 4TTTS 1KPGA 4LHYA 1LU9A 2Z3WA 1ZZEA 4NARA 5HJ5A 3G0GA 2J7PD 3GZ4A 2WRZA 5ELMA 2DG2A 4M8KA 2IYSA 4HMPA 4KQ6A 3J7AC 2O23A 4RLHA 1M2NA 1Q2XA 3W8FA 4LZAA 2ENWA 4IHJA 4NBWA 1FDSA 3HUUA 4MKRA 2WMOB 2DLNA 2B8NA 1AO3A 3F6EX 3B3AA 2XAAA 4ESHA 2AC4A 1E1RD 5J5VA 1Z82A 3LZ6A 4QXOA 1L7OA 4PZPA 3MAGA 4C2TA 3HRXA 5AVQA 2JD1A 3MG9A 1QO7A 1MQ9A 5CFOA 2Z56A 3ND8A 4ENTA 2VK1A 4IUYA 3AHJA 3RRFA 2PWZA 4WNCA 1L4UA 1S2MA 4PE5B 3D1VA 1GEGA 5JMTA 3GLKA 1X7XB 1WCIA 2AQ8A 1VPLA 3JQQA 4TKUA 2NTNA 4U18A 1VLQA 4F4DA 3W5DA 4CCYB 4OREX 2QNBA 4XQEA 4UVIA 4CT5A 1SGWA 3FLEA 5DFAA 5JJ5A 2J5II 4MWBA 3LBYA 1JMKC 1VZ2A 1CJVC 3CZQA 2QIPA 4LDPA 4MVWA 1DQSA 1X19A 4PWZA 3C5WP 1JB1A 3IHWA 2DMRA 4RHXA 3R8XA 4BO9A 4RYFA 2B1QA 2XQVA 5CLLA 1LLFA 1Q17A 3E9YA 2R7AA 5F64A 4DADA 5A4FS 2WU8A 4ESVA 3VH4A 2HLDA 1NN1A 1HTTA 1I0LA 3C7AA 4GQBA 1P7WA 1I4WA 3O4RA 3IHTA 4Q03A 2WJ3A 5BSWA 1SVWA 3C3MA 4KSBA 3DQZA 1D1SA 3ZBUA 2OUIA 1UBLS 4Z6KA 5F12A 3H99A 1U9ZA 3K72B 1BVHA 1QIEA 1X87A 5K5EA 4UPEA 2Z6QA 5CVEA 2BEUB 3BMCA 2UZ1B 3MTAA 4XOIA 4WT7A 5KOYA 1SIWA 3ABSB 1R5OA 2JKZA 2VC2B 2CKDA 4ND5A 5BUCA 3GVIA 5BR8B 5K7SA 4OXYA 4Q3CA 2YMQA 4LI3X 1EUCB 1ZIDA 2WNIA 2X8BA 3EGWA 3GJXC 3OF2A 3CONA 3O2JA 1QLWA 2D4HA 1PG5A 1BE8A 2NYVA 2PGIA 2I76A 4GD3Q 3OPXA 4JK3A 4EI9A 1FFCA 3CG0A 2YCLA 1E1CB 4TT3D 4GUAA 2C1ZA 2WWHA 4OMDA 2QAIA 3U16A 2ZIFA 3ESQA 3UMSA 2MU1A 3WRYA 1Z2EA 4JI5B 3K31A 3EQ8A 3R6GA 4ESEA 4MPDA 3LKZA 4YCBA 4ZTBA 3VISA 3G2PA 1ISPA 1E6MA 4CF5A 2QSZA 1MLDA 3UNXA 3H2ZA 1TF2A 4YP9A 5AW9A 2VH5R 3IBSA 3HBAA 3CLSC 2MSKA 3FHJA 2QRVA 4N40A 4L8WB 1G5IA 3LSTA 4O4LB 10MHA 3ZGNA 3A1TA 3LTEA 3BAFA 4NJOA 5BNFA 1OH7A 2PCJA 2Z1DA 4WBNB 1ZMBA 2IZ6A 3AHEA 1R64A 1VYHA 2OQVA 2VQ3A 3H81A 3IT0A 3G7SA 1LSJA 4I6GA 4UVGA 4BQOA 1XPJA 5BSFA 2COKA 3I52A