5MGBA

Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nad
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural enzymology comparisons of multifunctional enzyme, type-1 (MFE1): the flexibility of its dehydrogenase part.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peroxisomal bifunctional enzyme
total genus 265
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5mgbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mgbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5mgbA01
1GEGA 2GGSA 4PCVA 4UUPA 4Z0HO 3P2YA 2WJPA 2AW5A 3ZW8A 4I5FA 1DJQA 4XDZA 1DUBA 1DHTA 1R16A 5GMOA 1WDMA 1O94A 3L0DA 3PYLA 2O4CA 4BS9A 2VT3A 4J1NA 2RH4A 5KVQA 3TL2A 2HRBA 4FFMA 3U0BA 1YKFA 3UH1A 3OBBA 1C14A 1PZHA 3WG9A 1Y7TA 4MKRA 1M67A 1Y5RA 3ZH2A 4MIEA 2HAEA 4NDNE 3N58A 4IDEA 1FK8A 4FOOA 2VT2A 5FIFA 3JQAA 4ALKA 2YZ7A 3OC7A 4XCVA 5IDYA 4NFSA 2O48X 3JQ7A 1Y8RB 3F46A 2DT5A 3FTNA 4PGFA 4WPGA 1SOWA 3PHJA 1QLHA 1HE2A 1Y9AA 2CVZA 5TJ9A 5A05A 2GSDA 1W0CA 1JKFA 3NDIA 4RF4A 3CKYA 3DHYA 4R4JA 1OFGA 3BZUA 4QFDA 1E3WA 3VH1A 2GRAA 4K29A 3GVHA 2NU6A 4TRNA 3E9NA 1HDCA 1PX0A 1VKNA 1U5AA 4ZICA 1XWFA 2GN8A 5HS6A 3DZHA 2AE2A 4I9HA 3H3JA 2O3UA 3OEYA 1NM5A 4IMRA 4YJFB 2V7PA 4A0SA 4WCDA 5L9AA 2J5RA 5IDWA 1TB4A 5JAZA 3Q2KA 3V1TC 3OIDA 4YJHA 3ZV4A 1GTMA 1T2CA 1A5ZA 3DBRA 2B36A 3DOCA 3AW9A 2FN7A 1UP4A 1KEWA 1XR3A 2Z1MA 1VLLA 4O6VA 4BNIA 3GF7A 1M6WA 1T2DA 2ZATA 3CTMA 4J16A 4CLEA 3DHNA 3OHSX 3V2HA 1KEUA 3GLQA 2Q35A 3C7DB 2EGGA 3DB2A 4GGOA 1EE9A 1LQUA 1WW8A 4FJ0A 2Y67A 4OXNA 2F6QA 1KVUA 2JCVA 3ANLA 3PRJA 3VPGA 3ZGYA 3E18A 2FSSA 3MJ4A 5DT9A 3IP3A 4Z3DA 3TOZA 3CIFA 4FN8A 4QFEA 5A5FA 5ICSA 3VIVA 2PD6A 3K73O 1QXSA 2NVUB 4CM5A 4ALIA 2TMGA 1PL6A 4DC0A 3KYCA 4URFA 1KS9A 4OL9A 4ZQGA 2VUTA 4JCTA 1IHXA 4K1LA 4P4GA 3WBBA 4K3WA 1R4MB 4W9NC 1ZEJA 1A7AA 1Q0LA 4M89A 1CETA 2O3QA 4WGGA 2QQ3A 3K8XA 4UEJA 3O38A 4DQXA 1JA9A 1WP4A 3MTGA 2RH8A 4DGSA 1YONA 4XYGA 1K89A 4XA8A 3L4SO 5C7OO 1ZSVA 2C5EA 3H8VA 3VKVA 4ZHSA 5K0ZA 2PD4A 4NIMA 2QRLA 2E37A 2E82A 3NT5A 1K39A 1ISMA 3PJEA 4KUEA 3UFXA 2GYYA 2X5JO 1ZW1A 1K0UA 4F3YA 2NVWA 5JBWA 1P1KA 4CM4B 3DC2A 2Q2WA 4R01A 4I42A 4LW8A 5ILGA 1VJTA 3ZWPA 3TDCA 4PG6A 2ILTA 3OA2A 1IYZA 2EV9A 3ZWNA 2ZCVA 3RASA 2IZ1A 2WE8A 3GEMA 4UVGA 4FB5A 3HRXA 1NVMB 3JQ8A 4R41A 5T5QA 1ZUD1 4OQZA 3LC2O 3A4VA 4PLYA 3OF2A 5F21A 4DLLA 4EI2A 3RSHA 1Z45A 3TZ6A 1YBVA 2VQ3A 3GPIA 2DLDA 1PGJA 1WMBA 2YV1A 4FOSA 4OJNA 2VHXA 3S8MA 3U4HA 2VSSA 3SWXA 3SJUA 2HJSA 4J1QA 1E77A 2OBYA 3QXIA 3MWDB 1LBEA 1KC3A 5DBFA 2EIHA 4CUJA 4JSBA 1BHSA 4MVJE 4WLUA 2CD9A 3IMFA 3UVEA 2D4AA 2Y1DA 2ZYGA 3KB6A 2J5II 4O59O 1D4FA 4B4UA 3BMQB 2Y1GA 1E0DA 4R1SA 3WICA 2QIOA 3C24A 4MP8A 1ONOA 3HHPA 1O95A 4B4WA 1LX6A 1UYVA 3KUXA 5L7TA 2J5IB 4FFLA 4MOUA 3ZWBA 4ZA2A 3TOXA 3OT6A 3NYWA 3QV1A 2GZ3A 2PY6A 5G1QA 4CQMA 5CG2A 1WWKA 4I5EA 3E5MA 5IXSA 4DMMA 1FJHA 2X5OA 3OJOA 1PS9A 3DONA 3BTSA 4RPGA 4BO7A 2NU8A 1UAYA 1JWBB 3BMCB 5CDUA 3QWFA 4NK5A 1HRDA 2NTVA 3BIOA 2RHCA 3RCBA 2H1SA 2DAPA 1DAOA 1JAYA 1QV7A 1ZK3A 3KRTA 1O9BA 3UCEA 4CR7A 3NJ4A 3KM0A 4HXYA 3ZZNA 4BNUA 4FJWD 3U9SB 1NWHA 5DBGA 4BO3A 5ADHA 1GYPA 1L7DA 2OXIA 4ZU3A 2V6MA 5TLSA 5ENDA 2P9GA 4R3NA 3RVDA 4D42A 1I30A 2C7GA 4KUGA 3CZRA 2DEOA 4FN7A 5KKCA 4AJ4A 4J49A 1IULA 5EESA 4PFJA 1PR9A 4WLVA 5F5LA 2JAHA 4ZJUA 4IZHA 3F4LA 2X5KO 2GZ1A 4D44A 4NNQA 3ZW9A 2Q50A 4PVCA 4Z0PA 3X2FA 3RSTA 2GLXA 5THKA 2IEBA 3RBVA 2DPHA 1HNUA 3WSWA 4RPLA 4DYVA 4U0GH 3CINA 4ONEA 5KJPA 5I9LA 2FZEA 1UDBA 2CVOA 1BMDA 4XB1A 4E2ZA 4Q1IA 3R9QA 2Y0EA 4ID9A 3GGGA 4ZVVA 1OZAA 3Q9NA 2H63A 4QT0A 3MOIA 4KMSA 1EE2A 3E82A 2B4QA 4CL3A 4TZTA 2C0CA 3IL2A 1IHYA 4OH1A 5G0UA 3RI3A 4KD6A 3H7AA 2LDXA 3M6IA 1IUKA 3IIEA 4RVFA 1F0YA 5BSGA 2BHLA 3WSVA 3JQ9A 1QSGA 1C1DA 1E7SA 3U9TB 3GT0A 3PQFA 6ADHA 3OH8A 5G0WA 1V9LA 4RVUA 4RF3A 5IAAA 4UUMA 1EVIA 1GV0A 5GY7A 5KDRB 5AXDA 3SJ7A 5KJEA 2WYUA 1Y8RA 3I9LA 1CRWG 3IS3A 4DQUA 3TLFA 3MJSA 3TSCA 3VC7A 4J43A 1V0JA 3PJFA 3WB9A 3W6UA 1HYEA 1M76A 4DQVA 2NTJA 3ENKA 1EK5A 4TVOA 2O50A 1LUAA 3WTCA 1YG6A 1XU9A 4CM9D 2F6IA 1PJQA 5C7LO 3D3WB 4B4VA 3GUYA 1UP6A 1PR3A 3TPCA 3OFSA 3QWBA 2PLAA 2YY7A 1FC9A 4S3MA 5LDHA 1X1TA 1J6UA 1HE3A 3DBVO 4FR5A 3NJDA 3E48A 1DCIA 4JP3A 1PS8A 3CPSA 4DLAA 3F3SA 3I47A 4ZDEA 1MXHA 3WNVA 1M66A 2J3IA 3QJ5A 1OC4A 3KHUA 4YB8A 3WGIA 3PIIA 1A9ZA 5JNLA 3G49A 4UVDA 1Q0HA 1RYDA 4WNCA 5AQ1A 3IKVA 1JTVA 2XOXA 3I9OA 4YJHB 4BGUA 5C5IA 1DRVA 3JD3A 5DUCA 1TLTA 2EEZA 4INAA 1HZZA 4H15A 4BB6A 3RC7A 5ER9A 3ZU4A 3WGOA 4B3IA 4AFNA 2VWHA 3HFGA 2J5QA 2CDAA 1T2FA 3PQDA 4XYBA 5DU4A 3MYBA 2PR2A 1JVBA 2VYVA 2W2KB 3JYQA 4JWVA 1UXGA 4NJMA 3HADA 3TZQA 1XDWA 3H2SA 3WQSB 3W4IA 4PIVA 1LC3A 4LVUA 4TSKA 3RUCA 4R3WA 3AOEC 1YDEA 3O8QB 4D7AA 4JNKA 3LC7O 1BXKA 2F00A 4CMEC 1CJCA 5TT1A 1GCUA 1JXZA 1B16A 2JL1A 3WX0A 4IS3A 2J3HA 4TWRA 4XD2A 4NNJA 3FWNA 2CFCA 2WD8A 4YXFA 1DHRA 5JYEA 3MJCA 3GAZA 1KY4A 4B8WA 2PZMA 1BRMA 5JDCC 4IJVA 1Q7CA 3RWBA 3FRJA 3ZHBA 2H9IA 1Y7OA 3HSKA 4C4OA 2F9IA 1UIYA 1ZVMA 2QW8A 4ALJA 1QYXA 5IG2A 5C90A 1XQ1A 2GO1A 4YQYA 3TT7A 3WWYA 1TT5A 4L9RA 3D5QA 1XGKA 3WJAA 3GRKA 3PP8A 4IXWA 1PGQA 1WZ8A 3UGKA 3EVNA 1D7OA 2EHDA 4H16A 4JLWA 4B4OA 4E33A 3PTZA 2GCGA 3AK4A 3QW2A 4BO9A 1V35A 1MG0A 2JKVA 4CM4A 4CPDA 4PZDA 1A9YA 5FF9A 5JMWA 5L53A 1D1SA 4I4ZA 3RBZA 2CDCA 1LQTA 2O3RA 3T4EA 3VZRA 1X7GA 4IIUA 1KETA 3F5SA 3NDJA 1EQ2A 4B7UA 1LRKA 3H9GA 3OECA 2QX7A 4N5MA 2O7SA 4RCNA 4DC1A 2NWQA 3ICPA 1BXGB 2AG8A 4R5HA 3SX2A 4E5YA 4JBHA 5KIAA 1MX3A 3PPIA 2O2YA 3LU1A 4PLFA 4PZCA 4JBIA 1NX6A 2CSUA 1ZH8A 3WIEA 3KTKA 2FW2A 3G17A 1Y8QA 2Q1UA 3U3XA 4ROSA 4IJUA 4E21A 1I2CA 3GNTA 3LSYA 2X0NA 1E7MA 4WCZA 4EBFA 1R12A 3ON5A 3OP4A 7ADHA 3FDUA 1B7GO 3FPCA 2HJRA 4K9DA 2OP0A 3JCZA 5AXAA 1J7XA 1PJHA 5G1SA 3AOGA 3HP0A 4KOAA 3UOGA 4D3DA 1GD1O 4HNGA 4Y98A 3GOHA 1SCUA 4BNKA 5KNLA 5CDYA 1PWZA 3GDFA 2D59A 3OM9A 4LRTB 1JKIA 2VREA 3TRIA 3NV9A 3PLRA 3AUTA 1GZ3A 1FDTA 3PXXA 4XQ9A 3R1IA 1UAGA 1DBVO 2HDHA 3DL2A 4EZBA 4FCCA 4JXKA 2CNBA 5DNAA 4IINA 1L1FA 3E1KA 4KTVE 3HDJA 4RPHA 3D4OA 1NYTA 1JAXA 5KJ6A 5A04A 2W4QA 1Z75A 2NNLD 3G79A 3WYBA 3W8EA 4MKXA 3GFBA 2C82A 3H0JA 3EVTA 4P8RA 3GRPA 1U5CA 3IP1A 2G0TA 5JY6A 1J0XO 4L4SA 2DC1A 3ZV3A 1BTOA 4L6WA 1W6UA 3EC7A 3R3SA 1HYGA 1AHHA 3LLSA 2P2SA 3EZLA 3ZHXA 2JAPA 4R5MA 2GN9A 3EW7A 3AUUA 4ALMA 3PHLA 4GX2A 1U4SA 2YV3A 2DPGA 3WLFA 2O3JA 3GVXA 3TNLA 1K6XA 1ZSNA 4ILKA 1U8FO 4YA6A 5C37A 3BMNA 3HN2A 2A7SA 4PLVA 5B1YA 1PU2A 2BI7A 4PLCA 1LDMA 5INIA 1CWUA 1B2LA 3JQ6A 4TKLA 3I5MA 1I36A 1G1AA 2OHXA 2Q3EA 1P77A 4MVJA 2EKPA 2J3KA 1YOVA 4NFYA 5CAEA 2ZK7A 4IQ0A 1UXIA 1NVTA 2NTNA 5DOZA 4XRRA 1UZNA 4U5QA 1VRWA 1GYQA 1DAPA 1TEHA 3GZ4A 4I08A 1H94A 4O5OA 1T2EA 3JQFC 5ENVA 4W7IA 3WR5A 2P68A 4IJKA 4IXTA 5JC8A 1V3TA 2EW2A 4A73A 5BSHA 4NBRA 1Q7GA 2NADA 1P31A 4CMEA 2Y1EA 2VSSF 1C1DB 4ZRNA 4QO7A 1IB6A 3WIDA 4CUZA 3W4KA 4BMVA 2JHFA 2D5AA 4CM9A 3E03A 1SC6A 4D46A 1WNTA 1DIGA 1ZK1A 2EGHA 1RM4A 1E3EA 2X23A 3GN1A 1HDOA 5GZ6A 5HA5A 1DO8A 3QWHA 3MJTA 3IQDB 4GKVA 4GX1A 4IQGA 3U09A 1SZOA 1IPFA 1DIAA 1GPJA 5EQFA 2RIRA 4JJGA 3OICA 4J4TA 1PSDA 4Y67A 1ISHA 1Y9EA 4GVLA 3SLKA 3ST9A 3VDRA 4KPKA 1DFGA 2PH3A 1UXHA 4CJXA 2YHUA 3GDOA 1ENPA 2E6UX 2G76A 4BKOA 1Q51A 3DXFA 5G0SA 3H9QA 1GQQA 3NRCA 4DTIA 1DLIA 3O26A 4M86A 4JJFA 1QYVA 4H7PA 2AQIA 4OIMA 4IS2A 5JCXA 3PYMA 2YDYA 4RZHA 1UR5A 4FGWA 2ZTUA 2VOEA 4GHNA 1WDKA 2VYND 4RLHA 4XYLA 4RF2A 2FRDA 2OBNA 2B5VA 4NH4A 3GGOA 2PZJA 4WEOA 3D4PA 1P1JA 2G82A 3WFIA 1JN0A 4BNWA 2OGUA 1UDCA 2O7QA 2ZTLA 3WYCA 4FGSA 3PE8A 3A1NA 5HWSA 2F9YA 2X86A 2X58A 5HBRA 4EYEA 4PRLA 3BTUA 4R1UA 3KTHA 3MWEB 1VL0A 3QLJA 5KJFA 3M6MA 3RC9A 5G0VA 2UDPA 3TWOA 3BEZA 2Y1OA 2OL4A 4DI1A 3M2TA 3VKUA 1UXKA 4HKTA 4HNHA 1T1RA 1MP0A 2C07A 3BTVA 4AJJA 1CERA 3JD2A 2Z1NA 1U28A 4ND2A 3QWDA 3S1LA 3I23A 1NPTO 2I76A 3C1OA 1NR1A 3DFUA 1HNOA 3UF0A 2OUIA 4GWGA 3QVSA 2QZZA 3SVTA 3MZ0A 3O8QA 3OETA 2R2GA 4B3JA 2ZCUA 3K96A 4KZPA 1ZO8A 4GMFA 4CUKA 3AI3A 1YDWA 2ZB4A 3OQ6A 4D41A 3TZ3A 5B4TA 4OQYA 3HUDA 1LDEA 2Z5LA 3TQHA 3DZIA 3GPDG 2VNAA 4WLOA 3OIGA 1LNQA 4EGFA 4R1TA 2Q2QA 2EJWA 3ONDA 4HC8A 2HRZA 1YRLA 1XO6A 4GMGA 3WGYA 1YH3A 4WE3A 1GQ2A 2B0JA 5JAMA 4JYJA 1UZLA 4DLBA 1SOVA 4GQAA 4LSMA 3PEAA 3SEFA 1HWYA 4DBVO 1B0AA 3G64A 4ZQBA 3M2PA 2EKQA 4LSWA 1GY8A 1VSUA 4OMRA 3NGLA 1KY5A 1OAAA 3RIHA 3UUWA 2HK7A 2WD7A 3K9QO 1J4AA 1ORRA 2VTEA 4RZIA 4RLSA 3H9EO 3G1TA 1PS0A 4II3A 3D7LA 3JQAB 4K6FA 4IBOA 1A7KA 2V6BA 2YUTA 3JQ7B 3DORA 4MPDA 1TVEA 1I33A 4WECA 4YEDA 1BXGA 3GNSA 4ZDDA 3I9MA 1VI2A 5LDGA 4NBVA 2AMFA 3D5TA 1BXZA 4I5DA 1F17A 3ISAA 2BFAA 2P4QA 5B4UA 3JQFA 1ZKMA 4YAJA 1N7GA 5COBA 1E7WA 3TN7A 2CE3A 4YAEA 4IUYA 1NZYA 5IN4A 2VSUE 1ZEMA 2IODA 5A1TA 1EUZA 3AFNA 4TROA 1SBYA 4CV2A 4LN1A 3QY9A 5A9SA 1EVJA 4A7PA 1JW9B 1K5HA 2EW8A 3LK7A 1QR6A 1ZZEA 2UYYA 3FBGA 2DUWA 2PKQP 3UXYA 4NJMB 4ND4A 3KTGA 1ZXLA 1GZ4A 3ROPA 3ZWXA 1DFHA 1SB9A 3G0OA 4FW8A 4K2NA 2X9VA 2J5GD 3CZMA 1SO8A 4LGVA 3ZV6A 1UZMA 1OMOA 2C54A 1F8FA 2UUOA 1D8AA 2VYVD 3C85A 4KWIA 1XU7A 4RF5A 3ZV5A 4BNHA 3TL3A 4J1SA 3IDSA 2QHXA 1HE5A 3WYEA 3E9QA 3PJDA 2PZKA 4FNBA 4NBWA 1H2HA 5A9TA 2Y66A 4ND1A 2NM0A 2DFDA 2ZTVA 3ZWVA 4U0HA 3Q0GA 1LSUA 1AHIA 2YQ4A 3LT4A 1N8KA 1YE3A 1Z7BA 2YYYA 3EK2A 3FNEA 1ZMTA 3PDJA 1R37A 4CMJA 5K6AA 4Q3DA 1UDAA 1PL8A 1DRUA 2NLOA 3PDUA 3HDHA 5H81A 1GFSA 4E13A 4N18A 1ENZA 1HSOA 2PWZA 3UHAA 4F46A 4CMAA 1KOLA 5IN5A 4Z9FA 3JQCA 1X7HA 4ND5A 4AJLA 4J7UA 3DTYA 3C1TA 3H6KA 3LT2A 3V5IA 3FBTA 4FDAA 3JYOA 4IDCA 4TRRA 5KVVA 4CLRB 5AXBA 1U3UA 4BO2A 3Q1LA 5FEUA 1DXYA 3I4CA 3EUWA 4NEKA 4W82A 5AVOA 3OJEA 3CUKA 3BMNB 3O03A 5BQFA 1LLCA 2H6EA 2Q1TA 5F1PA 1MFPA 4DPKA 4XX0A 4D45A 5A03A 3WOHA 4N5LA 2FR8A 2HMVA 4E12A 1ENYA 1W4ZA 4BNNA 4YT4A 1TYFA 4D43A 4R69A 4BNGA 4BO0A 4JROA 4YT8A 1UJMA 2EKLA 2W3PA 1K3TA 2P9EA 4M54A 4WLEA 1CQIA 1LDGA 1DC5A 2X0RA 3CSDA 3C1AA 3VH4A 4BO5A 4XEHA 4E30A 1X1EA 2PH5A 1GYRA 1E6UA 1TI7A 2HMTA 2VUSA 3ZHZA 2AEFA 5IZCA 1DC6A 3JYPA 5L7WA 1EF9A 4OXKA 4S1VA 5ER6A 4JCRA 4JBGA 2PG8A 1D3AA 5CP8A 1UH5A 3WGQA 1HETA 2O2SA 3I52A 1U4OA 4CQMD 5G4LA 2GN4A 1GEEA 1EUDA 1ZXBA 4GPD1 4CMIB 5I8ZA 5DTWA 5CG1A 5JLAA 2E49A 3UKOA 2P9CA 4UUOA 4GAEA 3PK0A 5BR7A 1ULSA 3ZHYA 4CV0A 3P19A 1GDHA 1PIXA 4NZ9A 2GZ2A 2JHGA 1I0ZA 1VL8A 3HE3A 1MA0A 4AL4A 3F4BA 2Q45A 1NBOA 5DL1A 1X0VA 1X7DA 5L45A 4Y6RA 2HUNA 1XELA 2W98A 1LRJA 5IDQA 1N5DA 4AJIA 4ELSA 3ETEA 2J5IA 2J3JA 3WNQA 5GZ3A 1U7TA 3B20A 4EMPA 3RKUA 4L8KA 1SNYA 3H0SA 3VPSA 3ZWOA 5ITWA 2B69A 3CMCO 1H6DA 3PGJA 3MOGA 2OZPA 4FNDA 4WZ8B 1ADFA 1I2BA 5CTCA 3U49A 4XWYA 2F9YB 4WCFB 1WVGA 1ON9A 2Z95A 3BHJA 1EEHA 4AJPA 3AM4A 4CMCA 1EQUA 5B37A 3T3WA 2X9GA 4JFCA 4DIBA 5A3VA 3LT0A 1KEVA 4FJ2A 4XJSA 1IY8A 1LC0A 3JQBC 1W8DA 2VHYA 1EK6A 3AU9A 3OEWA 4MVJM 4X54A 4NU6A 3L07A 5BSEA 5DU8A 4JOTA 4JQCA 1V8BA 2P4HX 5DULA 5IJZA 1U7HA 2FSVA 3HN7A 3IUPA 2BLLA 2EF1A 4MVJD 1DDOA 3V2UA 4CLDA 4EUEA 2Y1CA 2YQ5A 4WOJA 1LDYA 1O8CA 3DBLA 4JK3A 3T88A 3I1JA 3H0UA 2GF2A 2Q34A 1QLJA 2ZJ0A 3STHA 4J7CA 3ZNOA 5T57A 1LEHA 3JQBA 3OMEA 5T8KC 2Q1WA 4P38A 2FZSA 1M6HA 5T67A 5TNXA 5TS3A 1N9GA 5CEEA 2DM6A 4U6QA 3HNPA 4OHUA 1CF2O 5AYVA 2W8ZA 1LJ8A 2HKIA 3VPHA 2G1UA 3NX4A 2NSDA 4UREA 5BNIA 4Q9NA 3VH3A 3AUSA 4ZU2A 1RJNA 1IPEA 1W73A 4I9NA 2JD2A 1SEVA 1VM6A 1Y1PA 3ANNA 3VZPA 3BTOA 4XR9A 2BFOA 3UAGA 5JYDA 3RD5A 1CQJA 1TT7A 1HF3A 3FNFA 3U4DA 3K6JA 1ARZA 3BMOA 3BHIA 4W4TA 4WKGA 1H9AA 5EJ2A 4R16A 4A10A 4AJNA 4AJKA 3A14A 2C20A 5TT0A 1U1IA 3IKTA 4IGEA 4ITUA 4FIZA 1YS4A 4OMUA 3DMTC 3H4VA 4CQMB 4JP2A 5TC4A 1EFKA 4U18A 1XIVA 5ICMA 1GCOA 3MJVA 3Q6IA 3LVFO 5JDIA 1MLDA 4RYFH 1UXJA 2ZKLA 3DAGA 3LDHA 2DTEA 2VWGA 3JV7A 2JJYA 4DMLA 3AOEA 3QVOA 5BNFA 3ETDA 5DP1A 5LCXA 4YYZA 4Q0GA 2WEKA 1VSVA 1U8XX 2Y05A 3EZYA 3HE2A 2AG5A 5CPFA 3RC2A 2YDXA 1PQWA 4MVJF 4YT5A 1SPXA 1OI7A 2BFMA 1GU7A 3AY3A 4RJTA 1MV8A 1FC7A 4KDFA 4R9RA 3DMTA 2XAAA 3NTRA 2YV2A 4YQZA 4L8VA 4M55A 2X22A 1ISGA 2AHRA 2HK9A 1HZJA 4PZEA 4IGFA 3AM5A 3RFXA 3H2ZA 5K9ZA 3C8MA 5JBIA 4KP7A 1XNYA 1XHLA 4A26A 4M87A 4CLOB 3MOYA 2D0IA 3S2GA 3RUIA 4CM8B 4HNKA 3JQGA 4NFHA 2DQ4A 2TMDA 3JSAA 3PGXA 1JQBA 5EL0A 2HO5A 1G0NA 1YL6A 5A02A 2J5SA 1PJ2A 3PJGA 4RPJA 2W2LD 3CXRA 1KVTA 2W2KA 3E9MA 2I3AA 4ALNA 4JCOA 3GQVA 1PQPA 1E5LA 3PHGA 3GHYA 3AY7A 3WGTA 4GSLA 4DXHA 2CUKA 5JAQA 3WGGA 4Q3NA 4Z6KA 3PEFA 1EBUA 4XGKA 3AFMA 2GDZA 3BYZA 2BKAA 1O5IA 3PWSA 2ZYAA 5K6AC 1ISJA 4CLRA 5JC1A 1B26A 2WD7B 4M49A 2AQ8A 4YWJA 4YJDA 1GV1A 2JCXA 3H5AA 3KSDO 4WEQA 4UEOA 4U6SA 1JDJA 3FHLA 4IM7A 5KDRA 5DZSA 1UYRA 3RQSA 1BDBA 1GADO 3KZVA 4HADA 1TG6A 3QREA 3TF5A 1HDZA 1V3VA 3NTOA 3UCFA 1EVYA 2GR9A 2Y68A 2XXJA 4B3HA 1NFQA 2WDZA 4XIJA 1HXHA 4M8SA 3PHHA 1Q2XA 4YTEA 1FC6A 1EBFA 2DBQA 5ITVA 2BH9A 2V6FA 2ZTMA 9LDTA 1GPDG 2HCTA 2YHIB 2CVQA 3G3EA 3E8XA 4I5GA 4QXMA 2Q4BA 2X9NA 3NJBA 5IF3A 3JU1A 4EUHA 4KQXA 3LLVA 5E0NX 3IJRA 1LSOA 4QX6A 4H3VA 5JFOA 3W8FA 1P1HA 2ZQRA 4HBGA 2IYOA 3QVWA 2QG4A 1BWSA 1CIVA 4IZBA 8LDHA 1T26A 4W7HA 3O9ZA 1N1GA 3VZSA 4U7WA 3AI1A 4HFJA 3QYRA 1RPNA 2FOIA 4EJ6A 2FMUA 5EINA 4NMHA 4ZQFA 5I7EA 1PJSA 1H5QA 2NU7A 3ZU3A 1WAMA 4FPXA 4CMIA 3GZNB 4HX5A 3P5MA 3KO8A 1YQGA 4BKQA 4I1IA 3MT6A 4CV1A 1VC2A 1M2WA 1R0KA 3UICA 3OQBA 2VN8A 1R15A 4RO0A 3PVZA 5L40A 5F1KA 4GLOA 3ENNA 3ZN2A 2ZQYA 4IDAA 3EYWA 3ROKA 4GWKA 1K6IA 1QMGA 1R6DA 5TSDA 4CMGA 2IZZA 3RFVA 1ZSYA 3MCVA 5B12A 4OG1A 2GNAA 1B3RA 4Z0MA 4FSHA 1XG5A 1MFZA 1IE3A 4F6CA 4BO6A 2QQ5A 1U3VA 3ASUA 1PJ3A 4NHEA 3RUHA 2A92A 2YFHA 5JMPA 1YL7A 1C0KA 1I3LA 1GL3A 3MJEA 1E7RA 4ESOA 1PEDA 2NQTA 1CEQA 3OIFA 1E6WA 4ELWA 4Z3KA 1VPDA 2PD3A 4KDEA 3VH2A 3CMMA 3GG2A 4OYRA 3ZNNA 3WGHA 4RQUA 1XNWA 4FC6A 1E1NA 2BELA 3DR3A 4UAGA 3JQEA 4FD3A 2G5CA 4BNLA 4BKRA 1AXEA 4IY1A 3HLN1 2FHSA 3PI7A 4U8GA 3EHEA 4I8XA 4E31A 5L4LA 3TFOA 4CR8A 3IAHA 1E1KA 2NV6A 3PLNA 3PHIA 1X14A 3OJLA 3RU7A 4E5PA 3ZU5A 3DBLB 5KJ1A 3ZI0A 1SB8A 3L9WA 3RUFA 4CV3A 1WPQA 1NAIA 4D79A 1S6YA 1VRGA 4N5NA 2QRKA 4BVAA 1FDSA 1ZBQA 4E4YA 2NACA 3C7CB 4TKMA 4MINA 2HQ1A 3RROA 4UVIA 3H02A 2CY0A 4IDGA 5JDCA 3DAFA 1PIWA 3D4NA 4EEZA 2DBZA 3QIVA 4Z9XA 3QQPA 4QTZA 3LKEA 2VRBA 2BF7A 5KKAA 1LRLA 1ON3A 3KTJA 2P5UA 3OMLA 4OGWA 4YJGB 3NTQA 1GQYA 5JSFA 1H93A 2DU8A 5F1OA 3K92A 4YBZA 4A27A 2Y0DA 2Q49A 3KEOA 2BZRA 2YJZA 3SBOA 3L6EA 3MFMA 5JXWA 1I8TA 4WCFC 1E1MA 4EDFA 2WTBA 2BFPA 2CF5A 2WYVA 4J4HA 5FI3A 5L4SA 1VL6A 5U4QA 4RL6A 3V8BA 2OFPA 4F45A 3RRVA 4BNTA 1LTHR 3F9IA 3AUAA 3ORFA 3ITKA 1XCBA 2P91A 1E3JA 2VHVA 2IEDA 3L6DA 3BF0A 2VYNA 1QKIA 4J1TA 3PGQA 3KTIA 1HE4A 4FFOA 4XB2A 1YG8A 1EDOA 1V3UA 3Q9UA 4A5OA 3A06A 3L6OO 3KV3O 5H82A 1HZDA 3N74A 4BL5A 2VRCA 2XPCA 2CF6A 4XIYA 2H5LA 3QA9A 4NBUA 4WCFA 3OJ0A 1KBZA 4QSMA 3GY0A 5G4KB 4CM3A 5CEFA 4LK5A 3WG5A 3UCXA 1YQDA 1MJ3A 1YWGO 4ASIA 1PJCA 2VZ9A 1YB5A 4Q39A 4BNMA 1N7HA 3CH6A 4HUJA 1P1RA 1QG6A 4O63O 3PFFA 5IFLA 1Z6ZA 3AI2A 1U3WA 4BOYA 5LC1A 4PG7A 1NVGA 2EJVA 2VNSA 5L95A 4IIVA 3HB4X 2DVMA 4ZDBA 3GF3A 4BNYA 1KVQA 3QWAA 5TJHA 3TRRA 1BW9B 4GSKA 3EGOA 4KTTE 7MDHA 4N54A 4DWVA 4BKUA 4YDRA 3WGZA 1HL3A 1JVSA 5JCJD 4GH5A 1PTJA 1P74A 3GVPA 5BT9A 5FWNA 1UP7A 2AXQA 1W2XA 2EG9A 3HZZA 3TZHA 3HINA 1N9GB 1PZGA 1C0LA 3JYLA 3PZBA 1YOVB 3R0IA 4HWKA 5CFZA 1P3DA 3NT4A 5FYDA 3MEQA 1UYSA 4JVTA 1V6AA 4UVHA 2GD1O 1F06A 1QYDA 3SLGA 4ZQEA 4YACA 1PGOA 4DYDA 2HK8A 2UAGA 2VHWA 5U9CA 3FTPA 4K26A 5IZCC 2D5CA 2HMSA 4LRSB 2A35A 5DCWA 4L75A 3UW3A 2I66A 1YL5A 1ADCA 1MC5A 1NR7A 4GGPA 4AICA 1PJBA 2D1YA 2VSUC 4DIOA 2X1HA 1RM3A 1DPGA 3H5NA 2HU2A 1ISIA 3VAZA 1CDOA 3WQRA 4GX0A 5JDIC 1F14A 3HDYA 1E92A 3QSGA 2A4KA 5INFA 4ELXA 1UYTA 3WS7A 3U9RB 3K30A 1U3TA 3KLMX 3N7UA 3T89A 4DL9A 5I8WA 5DBIA 1J5PA 4BMNA 3R6HA 3S55A 2B35A 2QRJA 3FWZA 3OQ1A 3NUGA 1X15A 4IQ8A 4BB5A 2GPTA 3FN4A 3R9TA 3FPLA 2QZ9A 1BSVA 5DDIP 2A81A 1PZFA 5JE8A 3DZFA 1XX4A 3DBHA 2B4TO 3QP9A 4MKZA 1NP3A 4HP8A 2VUUA 2VSUA 1NHWA 3F5QA 4IZIA 4E5MA 3FF4A 3V5EA 2AE1A 1EF8A 5T6BA 3KETA 4PLTA 5L3ZA 2I3GA 3NAQA 1ID1A 4WYOB 4GLLA 1Z74A 3P2OA 3JQAD 2ZB3A 3ZWWA 4MXIA 4Y8VA 2JFHA 2A7KA 3PZKA 3I3OA 2IXAA 3K5PA 5COAA 3LT1A 1MB4A 3V1YA 1ULUA 1UUFA 2BD0A 4YJFA 3H81A 4G2NA 3KXDA 5EPOA 4LMPA 1JU9A 3HQ4O 2FPIA 4Q3EA 4CLOA 1O8UA 2Q1SA 3G1UA 5KVCA 2OMEA 3DBRB 3KOUA 4GVXA 4PG5A 1GUFA 4BNXA 1NZYB 1P0FA 4DIFA 3F1LA 4E2WA 4I52A 2J8ZA 1LLDA 4BV8A 4W6ZA 4G5HA 3WJ7A 1KYQA 4TVBA 4BUCA 5A9SB 1H6AA 4EEXA 5ES3A 4MIOA 3Q1TA 2EP7A 1C0IA 2XXBA 2VSUF 1ZJZA 3WDSA 3K2EA 3VPFA 3WMXA 2Q2VA 1AGNA 1YVEI 3ZWYA 5C7IO 4U19A 1U2GA 5T8KA 5COQA 4J7XA 1HDGO 1GUYA 4FBGA 1EFLA 4XKJA 4WASA 1Z7EA 3GA0A 3ZWAA 2VSSE 4PLGA 4W99A 1P1FA 3GMAA 3F47A 4NK4A 1R4MA 1LSSA 2A94A 4UEKA 3DDNA 3GF4A 1VE9A 1ADGA 3ROQA 4BHTA 1Q1NA 1DIRA 1JLLA 1Y5MA 4ND3A 2EWMA 3Q0EA 1K2WA 1ZNQO 5EN4A 3UN1A 1A27A 4TRMA 2C2XA 4XGNA 1EUCA 3KSUA 2W2LA 1PZEA 4DBZA 3D1LA 3S2FA 1Q0QA 4FB8A 2C8TA 4J90A 9LDBA 3RFTA 2YFQA 1ZK0A 3KEQA 3ADPA 4XJTA 4NJOA 4CM7A 1OD2A 4E2YA 2YHIA 4CL8A 3QWIA 4BMSA 4RV9A 3PIDA 3ICCA 1R4NA 5HRUA 5EQDA 2X7HA 4KWHA 4BGVA 1B3BA 3ONFA 5G2OA 3JQ8B 5KVSA 1HEUA 1MC4A 5EMHA 2BI8A 2PGDA 2ZQZA 1DSSG 4RCVA 2X6TA 2PFGA 1LSJA 4G65A 4P4LA 4GKBA 2EP5A 5HS4A 3ZWCA 1PGPA 5U1PA 4CODB 1ONPA 1IZ0A 5C3MA 2J5GA 1ZJYA 1DJNA 3P2LA 4EUFA 1F12A 1KEPA 2WM3A 1AE1A 4TZKA 2VZ0A 4BO8A 3KBOA 4FQ8A 1JWAB 2PPYA 3DO5A 1RKXA 1N1EA 3HDQA 3DTTA 2WYWA 4DA9A 3INTA 1LDNA 2RBEA 4RDHA 5J23A 2I5PO 2X0IA 4R51A 1DIBA 1LA2A 3WTBA 4MO2A 3WQQA 3FSRA 4LK3A 1YJ8A 1H6BA 5DCYA 4QEDA 1Q52A 1T4DA 1NFFA 1QYCA 3DQPA 1YXMA 5TF4A 1B15A 3SC4A 3OJFA 5DF1A 3QVTA 1WZEA 4R1NA 3VPXA 5DZKA 3KLPX 4JJIA 4CM6A 4MJLA 1C3VA 4MVJP 2IDZA 2WWRA 4BIIA 2BGMA 4OSOA 2DBVO 1K32A 5G4KA 3ABIA 3MTJA 3IAVA 5KOIA 1I10A 1BDMA 2B5WA 2DTDA 3VOSA 1H6CA 1MXFA 3VZQA 3ZNQA 1EVZA 4B8ZA 3D64A 4PVDA 3GR6A 5G1RA 1N2SA 1R0LA 1YO6A 4TQGA 3DZGA 4K28A 2FPPA 4QECA 1FMCA 1QP8A 3BAZA 1ZMOA 4WNIA 2OP1A 8ADHA 1Z73A 4MDHA 1PL7A 2DFVA 4MP3A 4LCJA 5A3JA 1SG4A 4CLHA 3SC6A 4D0RA 5G0TA 2AEMA 5F5NA 1P45A 1RWBA 1HSZA 2GUGA 5T64A 1NFRA 4NU5A 4E6PA 2BRUA 3V2GA 4Q3AA 4CQLB 2X24A 4R68A 5FUSA 1I5RA 4M1QA 1SEPA 5THQA 4KUHA 4BGEA 2WE7A 1U9JA 3LF2A 3LF1A 3GK3A 2OOSA 5JAIA 5HM8A 2DKNA 2VTDA 1E1LA 4NR0A 3WWZA 2NUAA 3OA0A 3RC1A 1RM0A 1O89A 3ULKA 1ADBA 2JFGA 2QYSA 4ZN6A 1NWCA 5INGA 5EIOA 4O0LA 4YJGA 1G0OA 4XDYA 4YCAA 2PGLA 1LLUA 3QE3A 3VDQA 3GKBA 4AJHA 3DAPA 3R0OA 4NQZA 4YR9A 1NTOA 3I9JA 1LU9A 2I67A 1X0XA 3SXPA 1PJLA 4RPKA 5DP2A 3U4IA 3V5NA 5JY1A 4P4NA 3QMJA 1QYWA 1KC1A 2IYPA 4R54A 3S2EA 1E3SA 2O4UX 1MG5A 1E5QA 2IE0A 1B14A 3LQFA 1E3LA 4BO1A 2O23A 1X13A 2WSBA 1L7EA 2ZJ1A 2V6GA 3PYXA 2ZB8A 1HDXA 1Q7BA 5CPBA 4FZWC 4OOFA 4JCQA 4FS3A 4DREA 1PGNA 4BKPA 2BGKA 1B8PA 3WLEA 2PZLA 1Y6JA 3KYDB 1VJ0A 4A2CA 4I9UA 4PLWA 4JGBA 5H83A 4HY3A 1YJQA 2DTXA 4AG3A 1OBFO 4R9SA 4BNJA 3BMCA 1U2DA 3DOOA 1DOHA 2I9PA 3ST7A 1H2BA 2XF8A 3GMSA 4EJMA 4RGBA 1AUPA 2HSDA 3P85A 2VWQA 2VCYA 3BMOB 3L77A 3I9NA 3HJAA 1H9BA 1HT0A 5E0SA 2PV7A 3GH3A 3RJ9A 3D0OA 1YBMA 4TRJA 3B6ZA 1E7YA 3FCOA 1YGYA 3COSA 5L4NA 5BNTA 3T7CA 1GAEO 1I3MA 4OOEA 2FBMA 3Q11A 3INGA 4J3FA 4BNZA 3DWFA 3F6YA 3A9WA 4FFRA 3RBXA 1BW9A 1YB1A 3V1UA 1QRRA 1MUUA 3BA1A 1NQTA 1OC2A 3HG7A 4J0EA 4MVJI 4WJZA 1N6FA 3NKLA 3C7AA 4J91A 3F1KA 3T8AA 4CMKA 4D3FA 1EZ4A 2PGJA 2AEJA 5HTOA 1C1XB 4PLHA 2LDBA 4GBJA 4OO3A 3EDMA 1E7QA 4RVSA 4UVEA 1KVSA 1ZFNA 3RU9A 4CM1A 3JD1A 2ZL0A 2OORA 1HLDA 4ZQHA 1SZJG 3LYLA 1P33A 5I7VA 1FCFA 4EW6A 2CZCA 3B1KA 3ROMA 2Y99A 4YRBA 2UV8A 4ZGWA 3I6QA 3FR8A 3K31A 1ISFA 4WUVA 1BVRA 1DEHA 2Q46A 3KSZO 4N7RA 4XGIA 4YT2A 3KTDA 4II2A 3DZJA 3FNHA 3VVBA 4MVJH 2PBPA 1CYDA 4D3SA 1F8GA 4B7CA 1BG6A 1MGOA 2R6JA 4FFNA 4L0QA 4AJEA 2F9IB 5DUFA 1DLJA 1XYGA 5CHEA 5IZ4A 3QXZA 5EERA 4J2OA 2X8LA 2RAFA 4HFNA 4ALLA 5DTPA 4IJWA 4W9NA 1ZK2A 2FR0A 3INRA 2PKQO 1JKJA 3AWDA 4RVHA 5A5EA 3DOJA 3R9SA 1TT5B 3NGXA 2FPGA 3GG9A 3JD0A 3I6IA 3DBHB 2UZFA 1B8UA 3BHMA 4BO4A 1BGVA 4IZCA 4QIIA 4Q3CA 1XA0A 5TX7A 3VVCA 4PLPA 2C59A 2CBYA 3EMKA 4J2HA 3KVOA 1IOLA 1SMKA 3D3WA 2IEXA 5DKPA 4EITA 3ITDA 4FFPA 4EJ0A 3QKAA 4PN3A 1P0CA 4MVJG 1R4NB 4AVYA 3GC6A 3DFZA 5B4VA 3RUEA 3O4RA 4AJOA 3GFGA 3W4JA 1LXCA 5I9MA 3GVIA 4FN4A 4DRYA 4DUPA 1EY3A 2C2YA 2IRWA 2HW5A 4UULA 1HYHA 1ZIDA 2PA3A 2HLPA 3DEYX 3GHHA 3H5RA 3TZKA 2ZQQA 3L3SA 1J49A 3TZCA 1PJ4A 1WDLA 2VX2A 4U0KA 4WK6A 4E0BA 2IXBA 3RSIA 3IC5A 2ET6A 1RJMA 2VRCD 5KCZA 2R00C 4XYMA 4E5NA 3JQ9C 3LAOA 2JCYA 1DRWA 5KWEA 1NAHA 1ENOA 1XLTA 2GN6A 3I9KA 1EMDA 1Y8QB 4BNFA 4MP6A 4PG4A 1IZ9A 3R6DA 1DC4A 4J9UE 4OKNA 5JO9A 3VTZA 4GM2A 3PQEA 4DPMA 4A03A 1T24A 3JYNA 3GLMA 2ZYDA 5TQVA 2QYTA 2O3SA 3M1AA 1NPDA 2NP9A 1T25A 2A9FA 2BGLA 3AY6A 1NPYA 3PZRA 4L73A 3RUAA 2EXXA 3H3FA 4XYEA 4XZ3A 5CDTA 4YAGA 4CMBA 2Q99A 4OM8A 2FWMX 3H9JA 3EAGA 1HDYA 1O6ZA 2ZL2A 1O0SA 2HMWA 4MIYA 3H9UA 4L4RA 3P7MA 3R3JA 1I2ZA 4YLHA 1PWXA 3U4CA 4CM8A 5TIIA 4MI2A 4QIJA 3HFSA 3U62A 3I83A 2FP4A 4LVCA 3NT2A 3ZDFA 1NASA 4E32A 3JQGB 3TVUA 1WXDA 1EDZA 2V65A 2VWPA 3U9LA 1NNUA 4E5KA 1Y81A 1ZK4A 4EMLA 2C7VA 5DCUA 3ETGA 4XRGA 5IKLB 4U0JA 4YRDA 1R0SA 1G6KA 2Y93A 1YQXA 5DOVA 5DZKH 4BQPA 3JD4A 2JD0A 5I9NA 4LMRA 4QFCA 4KNPA 3H0QA 3GEDA 4GI2A 3KQFA 2HMUA 3IB9A 3B1FA 2W90A 3W8DA 4YAKA 4WLFA 3T4XA 4YAIA 1XEAA 2PTGA 4L74A 2C5AA 1A4UA 2ZB7A 4LCEA 3LZ6A 5JBXA 5JO0A 3GDGA 1YBAA 4J4BA 2EERA 4Y6PA 4PLZA 2D2IA 1LDBA 1YB4A 3I4FA 5JS6A 1WZIA 3GNQA 2RCYA 4XQEA 4ZRMA 2AQKA 4OAQA 2VZ8A 4L76A 2PKRA 2E4AA 5C9GA 5AXCA 5IDXA 5BSFA 1XNVA 2PNFA 2X4GA 5TRTA 2POQX 1B8VA 4RDIA 1HKUA 3LC1O 2VOJA 4F47A 5I7FA 4Q3BA 3QK8A 2UUPA 4C7KA 5IXYA 5ILOA 2BMAA 4G81A 3STAA 1E3WB 1FDVA 2AA3A 4E2XA 2IZ0A 4PRKA 1QV6A 1T2AA 4B79A 4QQRA 4YRAA 2G17A 4JIGA 3L4BC 4L4XA 1OD4A 1I01A 4ZD6A 2JD1A 3NDRA 3E6AA 3KYBA 1N6DA 1XSEA 1VJ1A 5FI5A 3ANMA 2VHZA 2DUUA 3ASVA 3BXXA 2GERA 1RYEA 1I3NA 4J0FA 2OO5A 5AOVA 3WMWA 2I6TA 1A72A 1PJTA 3GZNA 4O1MA 4IDDA 4C7JA 5A4DA 4NBTA 3TDKA 1WMAA 3GN2A 3NJ8A 2NVBA 4NPCA 4G2RA 4U1AA 1I3KA 3SLLA 4RYFA 3AJRA 2GASA 1XQ6A 2DUBA 3DZBA 2E48A 1FF9A 3WFJA 2UVDA 1GZ6A 1NQAO 4FZWA 3FF6A 5L51A 4HV4A 3K8ZA 3OSUA 3S2IA 3Q0JA 1ONNA 3T7EA 2NU9A 2GTRA 4Y9DA 4OLQA 2J5KA 4KQWA 1H0KA 4NI5A 5KJCA 3Q7HA 4DPLA 3T8BA 2D8AA 1DFIA 1KIFA 1FXSA 4DVJA 1N6EA 5CDSA 3M6NA 1R66A 5A06A 3A28A 1P1IA 1LLQA 2NVUA 3AM3A 4JX8A 3U5TA 3NEPX 4CQLA 3ZNPA 2R00A 1Z82A 3KYCB 3AU8A 2EJ5A 3GUCA 3FNGA 1PQUA 1DIHA 2J6IA 3JQDA 3TJRA 4GL4A 4QUKA 6LDHA 3WBFA 1DB3A 5DU6A 3VTFA 4RQTA 5E0SH 3WXBA 1RJWA 3RJ5A 1NQOA 1HDRA 4P22A 1HLPA 3CE6A 5GZ1A 1TXGA 2P5YA 1XKQA 4XR4A 3H65A 3CEAA 4LISA 4PG8A 4BQRA 5JW6A 5I7SA 1K6JA 4WOKA 3BPPA 3GMDA 4Z0TA 3RKRA 2I99A 1I32A 1VKOA 5KTKA 3L9XA 5F3RA 5CTBA 1NHGA 4UUNA 3HWRA 3B1JA 4D0SA 3P5SA 1AN9A 4IZDA 2ZIZA 2F1KA 1E3IA 2C29D 4RVDA 3PFWO 4IMPA 3ZU2A 2B4RO 1WLYA 2Y0CA 4XQGA 5CEJA 3DZKA 4E3ZA 4GX5A 4CMHA 1A71A 2Q4EA 3TVWA 4XQCA 1KERA 1RM5A 3DHEA 3GGPA 3N6RB 3DMYA 4YPOA 3C3XA 3IBBA 3DJAA 2D3TA 3W6ZA 4JN6B 2WMDA 2O3TA 4RORA 3KYDA 3Q2IA 3W1VA 3D3EA 2B37A 4TMFA 4WLNA 3ZCXA 4RVGA 4CR6A 4FJ1A 1NXQA 4BV9A 1SAYA 3EY4A 3E5RA 1X0UA 4IDFA 3BMQA 1T4BA 3FR7A 4OKIA 3ADOA 3X2EA 4J6FA 1D1TA 4JJTA 1GUZA 3QRWA 3Q3CA 4Y6SA 4IDBA 2ZL3A 1P44A 1FDUA 3QHAA 4AJ1A 1I24A 1TA4A 2AQHA 2CDBA 5JPIA 2RHRA 2NQ8A 4K6CA 3RUDA 2FR1A 1S7CA 4KWBA 1BVUA 3VHRA 1IL0A 1ZCJA 4ZDFA 3ONEA 1FDWA 4OSPA 5MGBA 2I65A 3B70A 3M1LA 3QVXA 4JCSA 4BGIA 3JTMA 4IPTA 4FC7A 3TT6A 4QO8A 2Q2XA 3IUSA 1M75A 3ZWMA 1AXGA 5L7YA 4AJ2A 3IOYA 4BNVA 5JCJA 4YVFA 3HB5X 2YW9A 3FI9A 3K50A 2Y1FA 3RAJA 5MDHA 4NG5A 1GR0A 1C1XA 5TGDA 1A4IA 1P9LA 4OXYA 3L4BA 3GEGA 1ML3A 4F6LA 4U0GA 1NQ5A 3K2BA 1C0PA 2FZWA 4HFRA 4ZDCA 3TFQA 2ZL4A 2PK3A 2X0JA 4EMMA 4MOWA 1HTBA 5FFFA 1E6EA 1LI4A 3GAFA 2SCUA 3IJPA 3PWZA 4J9VA 1QORA 5DN9A 4B7XA 4CLXA 1N92A 4Z9YA 4JYLA 5A9RA 1DC3A 3TV5A 1OOEA 3FD8A 2B83A 1KVRA 5CDGA 4HFMA 2JFFA 3PWKA 2DBRA 2FY8A 3GVCA 1T1SA 2CMDA
chains in the Genus database with same CATH superfamily
3UXHA 2BUBA 3HVKA 4PCVA 4J76A 3B1WA 1TD1A 3SYRA 3ZY3A 1E60A 2ODPA 1E69A 1KS2A 1W48A 1W581 1ZA1A 2AW5A 2FGJA 3E9DA 1DUBA 1DHTA 3EQ9A 4Y2TA 3DNFA 2ADMA 4YRGA 1DAFA 2CJYA 1WDMA 3O95A 2I2FA 3PYLA 2O4CA 3UJHA 3SK0A 4F04A 4ETNA 4BQSA 2D5BA 3T94A 1N8TA 3FSGA 1CR0A 5LP6B 3OBBA 1LKZA 4DCUA 1C14A 5HQTA 4F84A 1DKQA 2OK7A 3WG9A 3B1XA 3U4QB 5IARA 1M67A 2OA0A 1PV4A 3MS7A 3REQB 1J7KA 1TFUA 4MIEA 4BCBA 3LUFA 3MT8A 4HNQA 3A31A 1Z62A 4L16A 2CGEA 4AMUA 3DEKA 5FIFA 4MQLA 4Y1RB 2R79A 1FFDA 1L0BA 1C2YA 1FVOA 3PR1A 4CHTA 2Q27A 1Y8RB 1HFWA 3DTVD 1I6LA 3L93A 4GG1A 3OF5A 5LP6C 1E3QA 1A95A 3ESQA 3I5UA 4NHOA 3WLNA 4DG5A 4EYGA 5BW4A 2ST1A 3IELA 3ONNA 2V59A 3ADKA 3A6LA 2JH3A 1PR0A 2YHAA 1Q3HA 2KMLA 4JI8B 2RGYA 2GKOA 1HYBA 1UPTA 4HDRB 2QNIA 5ALGA 1W0CA 1G8FA 3KJEA 3NDIA 1JXAA 1XI2A 4D1YA 3DHYA 4HN9A 2LD4A 2VK1A 1TF2A 2FE1A 3W5IA 2IH2A 2ESRA 4PRZA 4TV8A 1B76A 3S44A 1NXPA 1Y1SA 1SXJD 1E3WA 3GBVA 2AFRA 4YCBA 5CLHA 3IODA 1DCMA 4K29A 4DKXA 2ECPA 4GLBA 4KXXA 2UUCB 2ZVQX 4CEHA 1HDCA 2DZDA 2HFJA 4ZICA 3ZK8A 2Q5QA 2FZVA 3IMEA 3LK6A 5HS6A 4JUCA 2B5OA 1NW5A 3DZHA 2AE2A 3D6JA 4DV6B 4N0PA 4B4KA 2QPOA 4IMRA 2V7PA 5HILA 1V8DA 4EGJA 1V8OA 1OKKD 4WCDA 4MCIA 2QGFA 5DI3B 3LTNC 4HZIA 1BE8A 1P2BA 1EFAA 3OIDA 4BC1A 4X6LA 5FA5A 3U44A 4ZZ3A 1YVPA 3P0FA 4MX8A 1QRDA 3SC3A 1H2ZA 3PRHA 4KLAA 5DHAA 1AKWA 2Z1MA 4BNIA 1VLLA 3KG2A 3GF7A 5LB4A 1T2DA 4AIIA 4AUEA 4CLEA 4RSHA 1GU1A 3DHNA 4MK4A 3J80A 3HXQA 1V8FA 3GLQA 4R2XA 5B1DA 1ZGJA 1YS9A 4GGOA 5H68A 3L7OA 4OXNA 3VSCA 1P4SA 2ID4A 4RM2A 1M7BA 2JCVA 2WMNB 3PRJA 2VFAA 3GP5A 2B7LA 4C30A 3E18A 2FSSA 4CTNA 5KU1A 1UJNA 5DT9A 3IP3A 3EFEA 3AB8A 5ALUA 3H5OA 1BHQ1 5FLEX 4LOAA 4YJ2A 4FN8A 1TUBA 2CMKA 5EIEA 3OZBA 4I8IA 2HCRA 5I4BA 3DEJA 2XNDA 3P2MA 3HZHA 4ALIA 1PL6A 3SQNA 5CVEA 1E9VA 4K9KA 4HUTA 2DP4E 3E0XA 1OFCX 3KYCA 4URFA 2IH5A 2H1OA 4JCTA 5NULA 3L01A 3WBBA 3EXG1 4M0UA 4P4GA 4K3WA 1Q0ZA 1IONA 5CDFA 4AF7A 1AKVA 1ZEJA 4ZCMA 4GW3A 4M89A 1VE6A 4WGGA 3REFA 2AN4A 5HW0A 4UEJA 2QQ3A 5K4HA 2PBRA 1U7WA 1L5RA 1GT6A 1B42A 3UAOA 1PUIA 2B7BA 2WU8A 3T3GA 3NBFA 1JYFA 3UMYA 2ZWOA 2PD4A 2E37A 2E82A 2WJVA 3NT5A 3W3ZB 3FKSD 2RK3A 3HUFA 3IQEA 1TLFA 3OOWA 3PJEA 1EX1A 4IEIA 4NMWA 5IEBA 3WNDA 1U1GA 5LU8A 1G2PA 2RGDA 4Y2RA 4NOLA 2PMKA 2FRXA 1MOQA 1M2OB 4I6GA 4HDMA 4J0JA 2P6MA 1PQYA 1Y1RA 2WDPA 3F71A 2NZXA 5ILGA 3TDCA 1AMNA 3L46A 1NF3A 3OA2A 2OVBA 4YAOA 4N39A 3UUGA 5ECDA 1K27A 3KVVA 3GEMA 3K32A 3HRXA 2RK6A 1DS6A 2Q3BA 2VUHB 1NVMB 4JT9A 4R3WA 5D87A 5A7GA 2CHUA 5M3BA 3GDWA 3LC2O 3LUPA 3N75A 5T3UA 3OF2A 1MR3F 1C1HA 2BY4A 2CB9A 2VSOA 3OT4A 4G1EB 4PO1A 4PR0A 3H86A 4K88A 2PUAA 3AF0A 1SIWA 4XH9B 3V80A 3HCNA 4OSEA 3GPIA 3NIWA 1WMBA 2OHGA 2OBBA 1NXOA 2ZR8A 1TE2A 4P3OA 2HJSA 3G8AA 1EWVA 2IOFK 3EGWA 4F9EA 1SXPA 1REQB 1T9HA 4HRYA 5H80A 3DOEA 4V0NA 5DBFA 5PNTA 2J6BA 2IA5A 1RNLA 2X3YA 2YMMA 3UVEA 3G68A 4F3NA 3KB6A 2J5II 1M9NA 1UFOA 3IE0A 4FDMA 4I99A 4O59O 5A7HA 3AFOA 4Q9IA 5JNVA 1GCIA 1RRPA 1XDGA 2Q1XA 5LN1A 2B8EA 3WICA 4WKBA 2QIOA 4MP8A 1ONOA 1NV8A 3D6NB 1LPNA 2PXCA 1UYVA 3KUXA 3O4HA 3QMMA 2I8LA 2PBLA 3DF7A 3N2IA 4UU0A 1QPBA 4Z1MA 1YZTA 3FDZB 1L3IA 2P1DA 3TVTA 3KPYA 4QARA 2GZ3A 2UZ4A 3JW8A 2FF7A 2V74B 1R3UA 1WWKA 2HRQA 2O0MA 2WAMA 3E5MA 4IJQA 3ZGXA 3IKLA 2C1EA 4DR6B 3DOUA 3LW7A 3KQNA 1U8AA 3NFRA 3PPYA 5LD2C 2C03A 2XCUA 1P19A 3BMCB 3HBAA 2OCGA 3H5LA 4ZEMA 1FUYB 2JGIA 4FDTA 5CDUA 3QWFA 1HRDA 1TJ5A 2NTVA 4MRMA 2RHCA 1SG9A 4YPFA 3JALA 4LF9B 3FPBA 1JAYA 1QV7A 2HPAA 2WOJA 3BQMB 3UCEA 4KE8A 4HXYA 3QBDA 1TKRA 2W8BA 2HRCA 4LXTA 4OA5A 5EWMA 3DDOA 2HDOA 5ADHA 1GYPA 3GV0A 4ZU3A 4JVNA 3QHQA 1UZUA 5CA1A 2BDEA 2GHIA 5C1PA 2ANBA 2IPXA 5K2OA 3OTOB 3R7LA 2C7GA 1OXTA 2BAGA 3HJCA 3KZNA 3L3BA 4FN7A 1QG4A 2PDAA 4RYDA 1SUWA 4J49A 2ZKIA 1HEYA 4RVNA 5JADA 3SYLA 1BCRA 1CDEA 2HCBA 1XQ9A 2JAHA 4UNSA 5F5LA 3A6PC 2XRFA 1TQHA 2G25A 2GZ1A 2Q07A 2C4WA 5EYPA 4AMGA 4D44A 4NNQA 3GFFA 1BJTA 5CA0B 2Q4RA 3FB1A 1UQUA 3RADC 4RPLA 5AMXA 4DYVA 3CINA 4TYNA 2LPMA 2Q5FA 3N6RA 4MUXA 5I9LA 5KJPA 4BQIA 4RSGA 1X7YB 2PS1A 2CVOA 1T91A 2CXHA 1W87A 1E96A 3R7BA 1M6YA 3T5BA 4ID9A 1RQXA 2FZCA 4RD3A 2ZDGA 1S2MA 2CK3A 2DECA 2PO7A 4TZTA 2OXCA 1O77A 2XB9A 3I73A 4OH1A 5C8DA 1FS4A 3H7AA 4KD6A 1B6TA 4D4KA 1IUKA 5GJVC 4DG8A 1V8ZA 4YRFA 4Q5IA 1JQEA 4F1JA 3QENA 1M8KA 3LJKA 2P79A 3EBPA 1CIJA 1QSGA 3BZWA 3SSMA 4FDLA 4L28A 2Q9BA 1E7SA 3EDQA 2R87A 2IELA 2A9OA 2O2DA 5D7BA 6ADHA 2EKBA 2WUFA 4W8GA 4CNBA 1TRHA 5UKDA 2L19A 4FOPA 3EY9A 1L4MA 2Z2KA 1V9LA 4K03A 5F7ZA 3ZKWA 5J47A 5KSWB 1ZD8A 2A57A 1UC8A 4UUMA 1RHKA 4WZBB 3RIYA 4V0OA 2EBHX 1W44A 3T7JA 4EIWA 5KDRB 1V47A 2X42A 2Z5VA 4AZWA 2QMZA 1YOBA 2BONA 1Q7RA 2A0KA 1W88A 1FPQA 2WIBA 2WYUA 1WABA 2QAGB 2XE8A 3PQ5A 4WZAB 5I4IA 3UO8B 3WAKA 1D6SA 3PSAA 3VC7A 1VL1A 4HDSB 4RBNA 2QD5A 4NOJA 1HYEA 3A36A 4I4CA 4TVOA 5KREA 1F2VA 2PWYA 3I8SA 4ZQCB 1Q1AA 2I4OA 5DLEA 3U3RA 1MRNA 3K1AB 2WWHA 5C7LO 3GCGA 3GUYA 4X1IB 3TPCA 3ZHRA 4LXXA 2ZBDA 2PQ0A 4H7DA 4FLEA 5HF9A 2R3SA 4S3MA 2AX3A 2XD9A 3EAFA 4NBKA 1FC9A 1J6UA 3BWDD 4KO3S 2NU6B 4EHKA 4JP3A 1PS8A 3CPSA 4DLAA 1YR1A 4K3UA 5L6LB 1SOMA 1M66A 1JQDA 3MA0A 3QJ5A 5AM2A 3AW8A 5ALQA 3STXA 1XL0A 4OG2A 4V0SA 2VJLA 2V7GA 3UHOA 1TAQA 3IKVA 1JTVA 1WQ3A 3EVGA 1R0WA 1QS0A 1VRVA 1XLUA 3MINB 4YJHB 3CVWA 2OZLB 1LJLA 3J81k 4FTWA 4INAA 5DW3A 1O96A 1TMKA 4UM5A 4H15A 1ZJ4A 5JT1A 1QAQA 2XMDA 5ER9A 1AHNA 3DEIA 4AMYA 1XD8A 4WERA 3IUMA 2VDQB 1UBHS 2ZSHA 4YAWA 2BEVB 5B2EA 1EGAA 2NZWA 2VWHA 2WTUA 4AQ7A 1O95C 1I2DA 5CLFA 4KO4S 1ADYA 1G5FA 2DX7A 1T2FA 4XYBA 1ZM9A 2BE7A 1UBJS 2VYVA 1JVBA 1KI4A 2W2KB 1JFFA 1MH1A 3JYQA 1A04A 3LECA 3IVMA 4Y9RA 3HADA 4EEKA 2Q3LA 2PRIA 2RGBA 3H2SA 3W4IA 1MTZA 3RUCA 5F9FA 3AOEC 1T1JA 1YDEA 3O8QB 4JNKA 4AZTA 5AW9A 2F00A 3H05A 4QQKA 1CJCA 2AKAB 5LMZA 2J3HA 2V55B 4TWRA 4NNJA 3FWNA 1P2VA 3V7UA 2P7IA 1KSGA 3FNIA 3H5VA 3PNLA 1DHRA 3N0RA 1NSFA 3BIJA 4JI5B 2PX6A 5JYEA 4NDZA 4KDRA 4IJVA 1H2RS 2P9BA 4ZAFA 3N0TA 1Y7OA 4C4OA 2F9IA 2HQRA 5AJVB 5JARA 1OB2A 2QW8A 3AX6A 1TUIA 2PAFA 3CKMA 5AR1A 3GUHA 1JX6A 3KQYA 5C90A 1YZKA 1GKUB 2HSGA 3WWYA 3LL7A 3PEUA 2HREA 1OPRA 4RXTA 3MUFA 1B1AA 2Q4OA 1Z4OA 1QB8A 1WBJB 3A4YA 1D7OA 4KQ2A 3UGKA 3T12A 2RD2A 4JENA 3PTZA 2GCGA 4ZOLB 5EKXA 4ZYLA 2CLDX 1I6WA 1TAGA 3D3KA 1A9YA 5AHKA 3IYLW 4BP9A 3BD7A 5A4KA 4J8PA 4RADA 1L5SA 1JLKA 3RBZA 4LNAA 3S5UA 2DPLA 3M6AA 1DKPA 4V1CA 2BRUC 2CUZA 2BFEB 1QF9A 3NDJA 1ACMA 1CS0B 3DH0A 4ZEVA 2PUVA 4B7UA 1VI6A 2FG7C 3K0CA 3NOQA 2R1VB 3H9GA 4LE0A 2QX7A 5J2TF 5KOHB 4BNDB 3T1TA 2O7SA 1N75A 3KJHA 3KJQA 5K3FA 1ZVQA 2ZSIA 1QDLB 3S2YA 3IESA 5LQMA 2JHAA 2IXDA 1D6NA 3N0XA 1T8RA 4R5HA 3JPWA 3KLNA 5M7EA 2XUGA 2BZ0A 3AHIA 4J29A 4Z86A 5JRDS 1T5BA 4KLCA 5KIAA 4P98A 5FX2A 4YNBA 3LU1A 4DSZA 1JEQA 4FILA 1WLSA 1YR6A 2CSUA 5BNZA 4ZCTA 3A6HA 1NJ2A 3HNOA 3LO8A 1K7YA 2JH8A 2Q1UA 3U3XA 3DE6X 2EOAA 4CEJA 3W0LB 3GNTA 1IMOA 1FZQA 1YCGA 4J2UA 2JFPA 1U31A 2FU5C 3OP4A 4EBFA 3FDUA 1B7GO 1QHHB 3CF6R 2OP0A 3JCZA 4UD6A 3O3NB 4WBSA 5AXAA 1J7XA 1TMOA 1UXOA 5ALNA 1ESEA 1U6JA 3L1UA 4HDKB 2AZDA 4A0QA 1TJ3A 3LQQA 4HWOA 2JA2A 3N59A 3TRHA 5KQGA 1F9AA 4OGKA 5DYNA 1OX4B 5C8YB 3OM9A 2D59A 3SJAA 2EHJA 1JKIA 4FKMA 4QA9A 1V11A 3TRIA 4YMWA 3NV9A 1V5FA 2VREA 3AUTA 1ST2A 1VDMA 3AETB 3RFCA 3BERA 1ZOIA 4CL0A 1K7CA 2IZ5A 4U6NA 2BM8A 4C0BA 4DUYB 2IK8A 1UAGA 3PIRA 3R1IA 4OQQA 1ZNWA 4IRUB 3LFHA 5JWHA 4EZBA 4DIDA 4FCCA 3DDSA 4JXKA 4MRPA 2P9QA 4X1YA 3KNZA 2FP3A 5JFGA 1KF0A 2AOVA 3A05A 3QVGA 5BN1A 1QH1A 1L4KA 4F6RB 1NYTA 4WDQA 2H92A 1E79A 4H7IA 3K05A 2JLAA 3PX7A 1U63A 2CMGA 3MYRA 4IILA 3SEAA 2OUKA 2Q29A 1Z26A 4DABA 4ZCRA 1IJEA 5TVGA 5ALXA 2Q8PA 3DD1A 3H0JA 1L1QA 3GL9A 3EVTA 1NT2A 3A1FA 3LVRE 4NTZA 4F5EA 2ZJFA 1M10A 5C80A 5JY6A 1J0XO 4O2RA 3ELYA 1DTEA 2OFXA 2XNCA 4KJZA 1Q19A 3QEMA 4L6WA 4WXEA 1AV6A 1HYGA 1LPPA 2E3JA 2YXNA 1INLA 4TS9A 4P82A 1HPLA 5JZBA 1HLFA 3L40A 1BGWA 3R41A 5CNKA 1QE5A 4X7PA 4ALMA 1AZTA 3VGJA 3RK4A 5BWLA 1U4SA 2YV3A 4Y9SA 1JHXA 3CLSD 3ET4A 4MUGA 4ZWNA 3GVXA 4LTMA 3EGXB 1NP7A 3WLFA 5C37A 2SBTA 1U8FO 3RSGA 3WY9A 3NJRA 1L2TA 4LZWA 4C2AA 3PENA 4JLDA 1CWUA 3N6VA 3E9CA 4M0EA 1G1AA 2F3PA 2OHXA 4MVJA 2EKPA 3UT5B 5CAEA 1FNNA 3AJ9A 3DXYA 1AQYA 2ZSAA 4IDOA 4WESA 1BDJA 4D57A 1UBLS 4M0DA 4XRRA 1UZNA 5G41A 1GNRA 3IKJA 1VRWA 1QIFA 1GYQA 3CX7A 1DAPA 1TEHA 1V71A 3HL4A 4X3CA 2VDOB 2GM5A 1Y8CA 1T2EA 2W58A 2YWDA 3JQFC 4NX2A 5ENVA 4B0OA 4IJKA 1O94D 4GYKA 3IQIX 1SC1A 4A73A 2YFYA 4CF4A 1BS1A 1EYZA 4JJ8A 5BSHA 2RGRA 4ND8A 1XTZA 2JLBA 4TLCA 1ZW6A 2PS0A 3L7LA 4CMEA 2VSSF 3AI7A 4QO7A 2IOFA 3ZBQA 4D0NA 2EF0A 3W4KA 4BMVA 1QGAA 3I53A 4U4AA 5DIFA 1EA7A 2EGHA 1RM4A 3LLCA 4XARA 2Q8QA 1WIWA 3PU6A 2FZGA 3DCNA 4IOKA 4KJXA 5GZ6A 2P78A 4GMKA 1DO8A 1EG2A 1EVLA 2HV9A 3AUJB 3MJTA 4IQGA 4POAA 4ZVQA 5H3HA 4ZO7A 4BDSA 5KYYB 3TRKA 1GPJA 2HWXA 3N2LA 1QIDA 4UXJA 2CNWA 5EEGA 1T6XA 4BDTA 1BX1A 1R0YA 2XMSA 1UC5B 4YV7A 4ZQIA 1M6VA 2ZBGA 3ST9A 4Z8YA 4RY9A 1F8UA 1XZAA 2GZHA 1LK0A 2HLNA 2PH3A 5HSGA 3CLVA 3GDOA 2WABA 1ENPA 1V1RB 4M7OA 4R2LA 3Q8LA 2ALJA 3DXFA 3O1HB 1PG5A 1GQQA 2XNSA 3NRCA 4YIKA 3ZOKA 5DGCA 1DLIA 3O26A 3TNDA 5DM1A 2XEXA 2AQIA 3OT5A 5DGXA 2Z0MA 1FDRA 3PYMA 2QK4A 3RW9A 4D8WA 4WZAE 1Q83A 3HUTA 1SPBS 1UR5A 4MTCA 2VOEA 4DSTA 4GHNA 4PONA 3NHYA 3WKEA 5E8JA 2DHDA 3BGDA 2OBNA 3SNHA 2B5VA 5IJ0B 1NBEA 4Q9JA 5EZ5A 3EGEA 2PZJA 2X4IA 1KYIA 4PHHA 1CDDA 5KB3A 3D4PA 1R8XA 3GJ5A 4BFYA 1ZD3A 3QEOA 1JN0A 4ZK6A 3WYCA 4FGSA 5LQDA 1YK0A 4NYJQ 2JGJA 3K0BA 1QHYA 4M3NA 1JB1A 2IQIA 2QJRA 2FQYA 3BTUA 4PRLA 1BJRE 1VL0A 3MWEB 5BN3B 3HXOA 5AH0A 3QLJA 4H6XA 5C5EA 4DCCA 3WGUA 2GCNA 5G0VA 2R7MA 1YGPA 2Z6AA 5GJWC 1CS4C 1GRQA 3A10A 4JEHA 1XFDA 4X20A 1QNLA 2GA8A 1AU9A 2ZJ2A 3CCBA 3H4IA 3VKUA 5JSHA 1KO7A 4BTLA 4HNHA 1QK3A 2X9LA 2M6SA 3ROGA 3EWSA 3OZTA 1H9CA 1CERA 4FGUA 1BMTA 1A1SA 4ND2A 4BLWA 2OHIA 4RHCA 3QWDA 3B7PA 3VR0A 2H18A 4LHYA 5G40A 3VNQA 3ZXIA 3ITNA 3C1OA 1G7TA 1IEWA 2QLLA 4G5GA 4NL4H 4GWGA 2QZZA 3E3OA 1KR5A 2WAAA 2WM9B 2XE6A 3OETA 3AERA 4BUJA 3IR5A 2XMRA 4B2IA 5HJEA 3PITA 4BFUA 2BJWA 2NOGA 3HS3A 2PCLA 1GZSA 4BU1A 4BVJA 3O2NA 4H1TA 3T5PA 3HUDA 1LDEA 1UPCA 2Z5LA 1P5ZB 4LBWA 1ID8A 3OIGA 1LNQA 2Q2QA 2EJWA 3DV2A 5JQGB 1XO6A 4GMGA 5BMOA 1GQ2A 3I6ZA 1PFGA 1UZLA 3W3AA 4PZPA 3NRBA 1SOVA 4U2BA 5BXQC 1BDHA 1KJIA 4GQAA 5EP3A 1QQBA 1VSBA 2C83A 3OTWA 4PX5A 3VMFA 3PEAA 3UC5A 1CR4A 3Q7QA 4IMIB 3OCUA 1SOAA 3BG5A 4QU8A 1HWYA 1T6YA 3UFBA 4DBVO 1JHYA 2DFTA 4I6JA 4N8SA 2EKQA 4XWTA 3ZGOA 1EM8B 3GCZA 2AFIB 2ZRQA 3EF3A 3FG9A 3CFYA 5EEHA 3W7BA 1NMQA 4KQJA 5HMLA 1L5GB 3L2OB 3N2GB 2WD7A 1Z56C 1J4AA 2RB5A 1ORRA 2VTEA 3DTVA 4MKIA 1S2NA 4MUYA 5GONB 4ZMBA 4RLSA 3S4YA 5L4NA 3JRXA 421PA 3G1TA 4S1NA 4TMXA 2O7VA 1PS0A 1P6QA 4J3JA 1BFDA 1R0CA 2IXTA 2X5XA 2DPYA 4BMPB 2Y1LA 2BM9A 4YP6A 3JQ7B 3DORA 1K8RA 4MPDA 1OH7A 5BPFA 1NUPA 4WECA 4YEDA 3ZDQA 2ODNA 1YZLA 2BZGA 2H06A 4BXOB 2Y9PB 1VI2A 1YKSA 3H11B 4XDGA 4XJVA 3B38A 2RHDA 4U7FA 3D1JA 1BXZA 2VBFA 4F2DA 3VSAA 5BN5A 2P4QA 5B4UA 1ZKMA 3VPCA 4CIXA 3K6RA 1N7GA 1E7WA 1KJ8A 4TVKA 4YAEA 2UU9B 4YMUA 3OZDA 2XXAA 4UATA 4NCBA 1OW3B 4ECAA 3HDGA 1I14A 1SBYA 2DE0X 4HGPA 4Q7QA 5BSUA 3R9XA 3FLBA 5GV8A 4P7BA 1JW9B 2WJGA 2GS9A 4O8CA 2MINA 2EYUA 4TQAA 1XROA 1PKXA 3L0BA 2Q28A 2DUWA 2R7AA 5AKIA 4ND4A 2XWPA 3VYRB 5KYUB 1SB9A 4M9CA 1QHXA 4GP9A 1Z3IX 2BT4A 3D7KA 4FW8A 4AKEA 4BPBA 3BXOA 4UQOA 2UUOA 2C54A 1F8FA 2Z2ZA 3C85A 3CLHA 4HZGA 3AUKA 1XU7A 1GIAA 3IBYA 3PD1A 2QHXA 3WYEA 2BBOA 1EIWA 1JP7A 3EMDA 2EATA 1Y4AE 2QX4A 2VAWA 1SA0B 4GOJA 4MQ5A 1K63A 2DFDA 2H5EA 1VFNA 3ZGVA 4A2WA 3M6VA 2CXUA 4EG8A 1AHIA 2YQ4A 2ZIEA 4YX9A 2PBFA 1N8KA 3EK2A 3FNEA 5IW8A 3VQTA 2FPWA 4URWR 3A37A 4RTMA 1QGYA 2A59A 3IEIA 4QQNA 4DLYA 5CFNA 2I4TA 4JHLA 5H81A 1ZCZA 2AC7A 3HDHA 3FFAA 3LKZA 4HZUB 5CK5A 5EIXA 1GFSA 4E13A 1D2CA 1MEJA 1P5HA 3N9IA 4MRNA 4N18A 3TO5A 1KOLA 4YRTA 3ZCTA 4Z9FA 5KNDH 2FGKA 4P81A 4HNAB 4ND5A 3ESRA 2A5FA 4AJLA 2JAXA 4RHFA 4M7WA 1UKBA 1CY7A 1DJPA 2Z09A 5HVNA 3K0SA 4CLRB 4DRXB 2X0FA 4UOQA 5AXBA 4ZEOA 5IANA 4BO2A 3KJXA 4JLJA 3QNMA 3W5VA 5FUQA 4C5CA 1FP6A 3EIWA 4NEKA 4W82A 5AVOA 3OJEA 4Q1FA 3BMNB 3CA8A 5BQFA 2P4EA 1Q50A 4B2LA 4BLRA 2OM6A 5F1PA 3GT7A 1QFXA 3WKBA 2OAEA 2QX9A 2JK1A 3K0FA 3SLRA 2FR8A 5SZIA 2XUPA 4K81B 4E12A 1G291 1WULS 2JEYA 4KGDA 1THGA 4YT4A 3AP1A 4KKXB 1TK2A 1OE0A 5EJFA 4AS2A 4BNGA 4YT8A 2W3PA 2RJ3A 2HXYA 4P80A 4TLMB 5G1NA 4BGIA 2J0UA 1GG8A 3W5HA 4DV4B 2G63A 3AJEA 3VU8A 5AO9A 4XEHA 1TZMA 2UVPB 4Z2AA 3CKLA 3TQRA 4K0KB 1E6UA 1WXHA 1MAWA 3MUEA 4D4MA 2J31A 5LZ9A 1R4AA 5AK5A 4XLLA 3RIMA 3V3KA 1Z0KA 1C7FA 3H9BA 3HWX1 1TCCA 3R5XA 4KOEC 1RCUA 3FZYA 4IIYA 3VYVA 4X1KA 5ER6A 1HH4A 4JCRA 4BJHB 1D3AA 1Z5VA 2ZI6A 1Y5LA 3OIYA 3DT8A 1MU0A 1SZDA 1EHCA 3WGQA 1VMAA 4OI4A 2Q9CA 2A30A 4CQMD 2RAVA 13PKA 1X92A 2JJ1D 4G4SO 3KWFA 1EUDA 4J07A 5B7GA 4RE6A 1R8QA 1ABEA 4PC6A 4MUJA 1L4UA 4KFRA 5I8ZA 4CMIB 4BAUA 2LCFA 1Q5PA 2E49A 4UUOA 2XRYA 1J97A 3VSDA 5C2JB 3LXMA 2G8NA 4YS6A 1CUSA 4TS1A 2FUG1 3V6LA 1QDEA 2FWIA 3NBXX 2BKEA 1X0VA 1N6HA 1VJRA 2HUNA 4V0KA 5FTLA 4MWTA 3GDHA 3E2MA 5K0NA 2WWYA 1L4EA 3NOXA 3RYCA 3W5BA 2B82A 3VSBA 2FRVA 3REGA 1JMKC 3WI7A 4MYDA 4UBOA 2QL7A 3HR4A 3ILXA 3WL8A 5ITWA 1TUBB 4OA8A 2INGX 5DGHA 5GOTA 3WLOA 5B7QA 5IPFA 4L27A 1QR2A 4JVLA 1ONSA 5KNCD 5AVJA 3V3TA 4ZREA 3U49A 4XWYA 4Y1GA 2BTQA 3ZQUA 5ELXA 2RGAA 4DANA 1POXA 4MUNA 3UWDA 3A2KA 4G0OA 1T2UA 5LUBA 4GBMA 1EEHA 3AGQA 4HB2A 1MW9X 4OLFA 3OG9A 4JIMA 4Q4LA 4DHEA 2G9NA 4CMCA 2WG1A 5B37A 1S3FA 1IQUA 3GX1A 3Q3HA 3NORA 1KEVA 4M6WA 3IBFA 4Q3OA 5G02A 1OWMA 3DT9A 5BSEA 5DU8A 5M5BA 3H4TA 1F2UB 2YZ2A 4JQCA 4LJRA 4NYJR 3EISA 3HN7A 2DFPA 2EZ9A 2EF1A 4PFKA 1DDOA 3RSSA 3V2UA 2EKDA 1DADA 3BC1A 5DMXA 3WO0A 5HQ3B 1ESCA 4EQZA 1AH2A 2YQ5A 4WOJA 3G2PA 3GLHE 4KMRA 1M2OA 3DDZX 5A3QA 3DBLA 2CEAA 3BRQA 4I1YA 1XD9A 3LCRA 2OECA 2GF2A 1UJ6A 4LJ7A 5EXPA 1EVEA 3WNBA 3WYNA 5FPPA 2FKAA 4J7CA 1JG1A 2J46A 3D0QA 5JJLA 5TQ0A 1LEHA 2IW1A 5AVXA 5T8KC 1NI5A 2Q1WA 4MUFA 4RKEA 3HM9A 4P38A 2NO1A 1YVUA 3FKQA 3CEPB 2FZSA 3COJA 5LZ8A 4EA8A 1FNSA 2O5RA 1NUUA 3PQ6A 5IKOA 2GETA 1XTSA 3MF4A 4OHUA 1KH3A 1RLIA 2VAVA 3B6KA 3WYAA 1PHRA 3L84A 3QE4A 2XDWA 2WSSA 1JTEA 3NIBA 5JCOC 1XRLA 2C4NA 3D31A 3HCWA 1L9KA 3PC2A 4U5XA 4MWDA 5D00A 3B9PA 4I9NA 4W1SA 1SEVA 1VM6A 3FHCB 4IIBA 4QICA 5C8ZA 1IH8A 1Y7LA 3GLFB 1K7FB 3EXG2 2C7QA 4JYBA 4HK4A 4JEIA 2BFOA 1G20B 4LZNA 3TZBA 4RJJA 1OHHD 3L18A 2HHHB 4RDXA 4AY4A 2ECKA 1ZDMA 4GPZA 3H2IA 1QBKC 3HYSA 5EFZA 4HMPA 2EDCA 3O6VA 2XTNA 1L6IA 3NU1A 4FFWA 4DCGA 4MULA 4GT1A 4GYJA 1H9AA 4HWGA 4R16A 3HO1A 4RHEA 3HO6A 1PK9A 1UDWA 1V45E 4IQFA 4LVNA 4AJNA 3FDZA 4AJKA 2C20A 3B51X 1A8IA 4ITUA 3W78A 1PJ8A 3DMTC 1KDRA 3H4VA 4F2PA 4JP2A 2YZGA 3AEXA 1XIVA 3JAWA 1NU6A 5ICMA 4I3GA 4DEXA 4KL8S 1KAGA 4RYFH 1UXJA 2DKFA 2ZKLA 4LPKA 2JATA 3DAGA 2R84A 2DTEA 3O7MA 4EG5A 3AEKA 3S68A 3AR7A 3H2GA 3QVOA 4JX9A 3ETDA 5LCXA 3ZUGA 1EB9A 4B2YA 4EA7A 1VSVA 1U8XX 3EZYA 4DM4A 3HE2A 2AG5A 5BMVB 4JYZA 4JKIA 4M83A 4MVJF 3O75A 2PYIA 3T5MA 4CKZA 4TLDA 1TF5A 1FC7A 1ND5A 1GA4A 2RARA 2FPUA 3H1BA 4FYJA 4UOZA 3UJCA 1P9NA 4EO7A 2K7FA 1E32A 3DMTA 5AUPB 2XAAA 5EWLB 3NTRA 2AOWA 3ZVLA 2FW7A 5EC8A 2YV2A 3WMGA 4EHNA 1BN6A 2RGGA 3NBUA 1V7ZA 1S2DA 3G8CA 1W85B 4JJ4A 3T54A 3RIEA 4WFQA 3AM5A 4WUTA 4ZANA 3W2FA 5LFAA 1XZEA 5IBCA 4CTJA 5JBIA 4LFCB 3KHSA 4ZO8A 5LLTA 1FNCA 2B2NA 1EWKA 4CLOB 3I45A 1U6KA 2I4NA 4N6GA 2D0IA 1J0CA 3UG7A 2QA5A 4C21A 4CM8B 5JISA 3TRJA 1IDN1 3EXFA 4I50A 1VMKA 3WA6A 1G5TA 4HNKA 5J4VA 1NVUQ 1Z83A 2PFKA 3FJYA 3JWGA 4NZOA 2AJTA 2PLFA 2TMDA 3DL4A 2GBLC 3IIKA 5KOYA 2DHEA 3AJDA 1GRNA 3I61A 1C4KA 2HO5A 1G0NA 1IFXA 2AKYA 3LDFA 3QLVC 5A02A 3GJQA 3LUKA 3ZHVA 2NXCA 1J0DA 1MCZA 4RPJA 3EIHA 5B6JA 4FZ5A 3T7TA 4DR1B 4F56A 3HACA 5KNDD 2UZ1A 3E9MA 3WLSA 1IC6A 4ALNA 4JCOA 3ZJVA 2YBEA 3CR8A 4HNSA 1IHPA 5IDWA 3AY7A 1SM4A 3WGTA 4J0GA 1TUGA 5HIAA 2J45A 2D5LA 1EBUA 3PFBA 4LJ4A 4US0R 1JYEA 3BIXA 3DV9A 5HF6A 2GDZA 3TTYA 2JANA 2A0UA 3B5EA 3PWSA 1KL7A 4RZUA 2OGSA 3HYLA 3UJ8A 1B26A 1FU7A 3L1VA 2B99A 2JIQA 4YWJA 5TB5A 2C5LA 4RESA 4YMLA 2GFQA 3KVNA 4WEQA 3PNKA 2IFTA 4WZBA 5IVHA 4UEOA 4U6SA 3MXTA 1P4JA 3IVRA 2O14A 2H48A 4QDJA 2HCJB 4DEVA 1NI4B 5KDRA 4CI0B 1GADO 4G2RA 1I4WA 4WZAA 4Z4HA 1DQSA 1TIKA 4FMDF 3TF5A 3HLKA 2AXEA 3NTOA 2Y68A 2XXJA 2WOOA 1NFQA 1XHFA 2JVKA 2WDZA 3K7EA 4TTJA 4XIJA 1A2KC 4LQCA 1TADA 3B3GA 3K9CA 2WNIA 4MCHA 5AOAA 1FC6A 1V4VA 2PUJA 3R3YA 7AT1A 2Y6VA 4F86A 3O1LA 2HCTA 9LDTA 1FZTA 4F9GA 5EMJA 2GX6A 4QXMA 4WNAB 3X43A 2H11A 2REOA 2X9NA 5NLLA 1D9XA 3E8MA 3LLVA 4KQXA 1YQUA 3IJRA 3HPQA 4H3VA 1Y9DA 5JIBA 1LNZA 2ZQRA 4CKYA 3MN1A 2GOYA 4H27A 4DSNA 1X38A 4I55A 2OV2A 3AEUA 3O9ZA 2OGZA 4CN8A 3PD7A 4U7WA 2I3ZA 3IV7A 2XWJI 1CE8B 2FMUA 4EJ6A 5EINA 4Y2HA 2XKKA 4DY4A 1K88A 1PJSA 1H5QA 4GECA 4A6EA 3AVVA 4GKKB 1XCGB 1WAMA 2FEPA 2FPIB 4FPXA 1FE8A 3QBTA 4UBLA 4HX5A 3VR1A 1WS6A 4DR2B 1NG9A 2UZ0A 1MNQA 3P5MA 2ADOA 4BTVA 3OAAA 3RFFA 3WGKA 4BKQA 1ZN8A 3EIQA 1H22A 1Z47A 3MT6A 1VC2A 3HJNA 4MB0A 1M2WA 2E4ZA 4NSNA 3OQBA 2VN8A 4RO0A 3P4YA 2DFLA 2VKQA 4JUBA 4GLOA 3ENNA 4HVAA 5T7BA 1VMDA 2ZQYA 1YR9A 2ZJ6A 1GQSA 4GWKA 4J0IA 1GKLA 2Y0PA 2KJQA 3U0VA 4BX3A 3T4PA 3ZQJA 1R6DA 4QU0A 3WLHA 4ZTZB 2GBIA 3BN3A 3DE7X 4LC0A 2V7TA 4ZAZA 1NZJA 1G18A 1NOJA 1W76A 5GM2A 5GVRA 3TZEA 2OM2A 3LFUA 2RDMA 1Z88A 2H1FA 1B3RA 2B7CA 4H4CA 5ALSA 4MRSA 1MDBA 2HJVA 2J9XB 1BIFA 4LOHA 4XOIA 4GDFA 1Y6QA 2RHWA 1MFZA 2QVZX 2H4FA 1U3VA 3C5VA 3OPYB 1T8SA 1YUMA 3ASUA 4QWMA 1NDHA 1PJ3A 1ZX1A