5MGBA

Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nad
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural enzymology comparisons of multifunctional enzyme, type-1 (MFE1): the flexibility of its dehydrogenase part.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peroxisomal bifunctional enzyme
total genus 265
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5mgbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mgbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5mgbA01
1ZEMA 2PG8A 1FXSA 1P44A 1LQUA 4MO2A 4QUKA 4KUGA 4W9NA 1C1DB 3TL2A 1BVRA 5MGBA 2I3AA 4BKUA 1YXMA 1R4NA 4RPJA 1Y7TA 3ITKA 4O0LA 3ZWAA 1QMGA 3LF2A 1QP8A 1BG6A 4ALKA 2YV3A 2VNSA 3FBGA 3VKUA 3ZNNA 3GMDA 2FRDA 1NTOA 1MA0A 3JYLA 1PTJA 4J2HA 3EHEA 1AXEA 5I7SA 2BMAA 1T1RA 1J4AA 5IZCA 3F46A 4L76A 2X0RA 3DWFA 4D3SA 3CE6A 3TDKA 4RORA 1GEGA 1T4DA 4AJHA 4NU6A 1R0SA 4LVUA 3UF0A 3QKAA 1YJQA 1CRWG 1OI7A 1PWZA 3FR7A 2ZKLA 2I76A 5L4NA 2AEJA 1I30A 2O48X 1QG6A 4Y6RA 4BNMA 4E21A 3GKBA 4NNQA 2QZ9A 1N6DA 3MFMA 3GVXA 1ZMTA 2CZCA 1U5AA 3NJDA 1GAEO 2Q2QA 1V9LA 4QO7A 4U7WA 1M67A 2ZB3A 4XIYA 4J1SA 3BA1A 3G1TA 3GNQA 4DPKA 3H9GA 2PGDA 3U49A 4H15A 1E0DA 4J4HA 4IDFA 3NX4A 2FP4A 2WD7A 2F9IA 1I2ZA 1Y8QB 4KOAA 1ON9A 2B69A 4I5DA 3VH1A 5DCUA 4L74A 4MKZA 5KVVA 1VJ1A 3M6IA 1R4NB 1MX3A 3CUKA 2WYUA 4UEKA 5G4KA 3WOHA 3I9MA 4BUCA 3IP3A 4BMNA 4BMSA 4BKQA 3H02A 2GN9A 5ILGA 3OQ6A 3NDRA 1X14A 2EP7A 3KBOA 4N5LA 3F5QA 3PWSA 1AHIA 3PEFA 3RC2A 1ENYA 2NV6A 4AL4A 1ISHA 3QWIA 5DN9A 2W90A 1BXGB 4YLHA 3WXBA 4CLXA 4DC1A 3JD4A 4CM4B 1E3WA 1H6BA 2SCUA 1EY3A 3DFUA 3HLN1 2IZ0A 1U8FO 1EE9A 1HRDA 1VKOA 3ABIA 3PI7A 2W2LD 3CKYA 4B4WA 5COBA 2JCVA 3ZI0A 3JQFC 3K73O 2GF2A 3TFOA 3HG7A 3ROMA 3RWBA 1Y81A 3AOGA 3KTGA 4NI5A 3IBBA 1ISGA 1ENOA 4J3FA 5HWSA 4PG7A 1HDGO 1P1HA 3ENKA 1GYRA 1H6CA 4E33A 4MKRA 1XNVA 4CMHA 4ILKA 2Z1NA 2VRCA 4QSMA 3RUDA 2DUUA 5E0NX 2HMUA 4W82A 4CM4A 1CF2O 4W99A 2HLPA 4QTZA 5I8ZA 2YDXA 4AJIA 3PFFA 5DULA 3DL2A 3KB6A 2EF1A 2QRKA 3GGOA 2HW5A 3NT2A 5KJFA 3HZZA 3HHPA 4E5NA 1N7GA 1T2EA 4W7HA 1LTHR 4PN3A 3I9NA 1H2BA 1ON3A 3R9SA 2PD6A 2WTBA 2RH4A 5C9GA 3EVNA 5K6AA 4OGWA 3ISAA 3Q6IA 3QREA 3DZBA 4A26A 4JFCA 2ZYDA 3RUIA 4WNCA 5I9MA 4LRSB 4JBGA 1VC2A 3G64A 4E31A 3N7UA 3UKOA 4MKXA 9LDTA 1HEUA 3WIDA 3KRTA 4S1VA 1NQOA 1N1EA 4J1QA 2WD7B 1K32A 3BMOA 2F9IB 4DRYA 2PBPA 4EW6A 3GF4A 4ELXA 3TOZA 3GAZA 1LU9A 1HYHA 1I36A 1A4IA 1R0LA 4DIBA 4F3YA 1Y7OA 3TVUA 2GN4A 2PA3A 3OMEA 2C20A 3PHGA 4ALMA 1VJ0A 4YDRA 1H93A 3H0JA 4EUFA 4NG5A 3NGXA 1EUDA 2UZFA 3JQGB 1I32A 1KY4A 4YQYA 1W4ZA 3KLMX 2AQHA 2P9CA 2LDXA 4XQ9A 5JAMA 1GL3A 5LDHA 4J43A 1NFQA 4J1NA 1UR5A 2X0JA 2VX2A 1YQGA 3H9JA 4EJ0A 3RUHA 2XF8A 3TQHA 4HFJA 1XHLA 3DZFA 4CM1A 5CG2A 1A9YA 1ZXBA 3P2OA 4QX6A 1UYVA 1DSSG 1LDNA 1O95A 2W98A 1PGQA 1DAPA 4KTTE 4M8SA 3C85A 2BGMA 3AJRA 5J23A 3LLSA 3GT0A 1X1TA 3WQSB 3IB9A 5T5QA 3ZWVA 3WSVA 1PJ4A 4CMJA 3RUCA 2PGLA 3WIEA 4B3JA 1ZVMA 3BPPA 4E0BA 2FWMX 1QYWA 3DMTC 2Y66A 3O03A 3IKVA 3BTOA 1MGOA 2NU7A 1FMCA 4QIIA 4XB2A 3OBBA 4PRKA 4H3VA 5G4LA 1PGOA 2JAPA 5FFFA 1E92A 2DM6A 3PJDA 1OC4A 5TGDA 2YHIA 2BZRA 2BGLA 5FEUA 4RPLA 4GAEA 2EWMA 4FJWD 2V6BA 4BNYA 5BT9A 5IJZA 2AHRA 3PZBA 2ZJ1A 2X24A 3V5EA 3UN1A 2H1SA 2A9FA 1YGYA 3TF5A 3BTUA 4MVJA 4R54A 1C0KA 1HDCA 1OMOA 4II2A 3WGHA 2G0TA 3AM4A 5JMPA 5DDIP 3PJGA 1JA9A 3E5MA 5GMOA 3S8MA 1KVQA 2H9IA 1DIAA 1F8GA 4N18A 3OIGA 4BO1A 2PZKA 2G5CA 3GF3A 1PIXA 1Y1PA 1HNUA 3B20A 4ZU2A 4GI2A 5A9RA 3ZV3A 2C5EA 1SOVA 1ZBQA 3BMNB 4TQGA 4BO2A 1BVUA 2FPPA 3ROQA 4FJ1A 1DC3A 4RGBA 5A3VA 1Q0HA 5AQ1A 4CM5A 2Y1CA 4GVXA 2VREA 1Y5RA 1PWXA 3BMNA 2DUWA 3AU8A 3QK8A 2P5UA 3MOIA 3GNTA 4IZHA 5CDUA 4B8WA 4A5OA 5KNLA 2GTRA 4J7CA 1TB4A 1TT5B 3N58A 3R0IA 4JWVA 1ZIDA 4GQAA 1IHXA 4CMCA 3D0OA 3Q1TA 5BNIA 1PL7A 4HNGA 2CBYA 3VPFA 5C90A 3IOYA 2J8ZA 2AA3A 4DXHA 3KSUA 4Q3NA 2ZL3A 4NBTA 4WLFA 3VH4A 3JV7A 4LRTB 3S2EA 3GG9A 4YRAA 3FSRA 3GLQA 2VTEA 1T26A 5DT9A 1E1KA 1YONA 4HXYA 3SC6A 3DOOA 4Y98A 1YRLA 1EFKA 5TT1A 3WYBA 1R66A 5KIAA 1LDMA 4NK5A 5I9NA 5BQFA 2D3TA 1F8FA 1ULSA 5KVSA 3A9WA 4OHUA 3FF4A 5EQFA 4J7XA 2J5IA 5KJPA 4II3A 2I6TA 1CETA 4FC7A 4FOOA 5GZ6A 3ZU4A 4IZCA 4CPDA 4J91A 1JXZA 2C29D 1M66A 4IIUA 1LSSA 1NFRA 4Q3CA 2ZYAA 4MIOA 4XB1A 5GZ1A 1DCIA 3RSIA 1X0UA 1LRLA 1SC6A 2WM3A 3DZJA 3OP4A 4OLQA 4HFRA 3MYBA 2TMGA 4DIOA 2NVUB 2V6FA 1SEPA 4RQTA 4EBFA 2ZATA 3IC5A 2ZL2A 2EKLA 4NNJA 1Y6JA 4BO9A 1UP7A 4CMBA 4XEHA 3BMCA 3AI1A 4IY1A 3H9EO 3FNHA 1HDXA 1FC7A 2E4AA 1C0PA 4DQVA 3KYDB 4JNKA 4ZU3A 1GTMA 1SZOA 1HYGA 1X0XA 3JQBA 5A5EA 1N7HA 3JQ9A 3EYWA 4DVJA 5L9AA 2GPTA 1OC2A 5I8WA 4OO3A 4J0EA 3AWDA 3QRWA 1FDSA 1JWAB 4CM6A 3BZUA 4E5MA 5JCXA 2C7VA 5G1QA 4A10A 1DHTA 1PEDA 4UVHA 1HE2A 3V1UA 3AUUA 3VZRA 4GWGA 1NFFA 3PPIA 4RVHA 4D44A 3VZSA 5I9LA 4KPKA 1XKQA 3ULKA 3TFQA 3I23A 1LI4A 5CEEA 3U9SB 1P74A 4DBZA 4NR0A 5JO9A 4IDAA 1QR6A 2GERA 5IDQA 4Y6PA 4IZIA 3A06A 2ZCVA 3QXZA 5EN4A 1KERA 3BAZA 1F06A 4Z0PA 2IDZA 2DBZA 3INRA 1TT7A 4HY3A 4R51A 3P2LA 5KJ1A 4R4JA 3G3EA 3KV3O 2R6JA 4IM7A 4TKLA 2O7QA 1UZMA 1TT5A 1XIVA 1DFHA 2Q4BA 2R2GA 4CM3A 4EUEA 1U7HA 3UCEA 5JMWA 4CM8A 5JC8A 3U9TB 1HZJA 2GR9A 3R9TA 3D64A 1PGPA 5F5LA 1VM6A 2X4GA 3BTVA 2ZJ0A 3L6DA 2A94A 2IE0A 3QWBA 1E6WA 1ZMOA 2EGHA 3GF7A 4BNZA 5B12A 2AEFA 1PU2A 3MJVA 1EEHA 4WLOA 4Y67A 3DAFA 4GX1A 1Q52A 3TRRA 1ADFA 3GH3A 1HDZA 3I52A 4YCAA 3NTQA 1G0OA 1Z45A 3LC1O 3H4VA 4AJ1A 1YL5A 2Q2WA 1GY8A 3L77A 5AYVA 3UICA 4EJ6A 5A05A 3WFIA 4BO6A 2PPYA 3IJPA 1KY5A 2A4KA 3DBRA 5ES3A 1EVJA 4EYEA 4WUVA 2GO1A 3ZWCA 3ANNA 3G79A 1PQWA 3PVZA 3I47A 2ZTUA 3ETGA 3A14A 4CR8A 1E5QA 2O4UX 3DORA 3TT6A 1DEHA 2NWQA 1AHHA 1TYFA 1HWYA 5JSFA 2A92A 4C7JA 1E3SA 2FR8A 1YB4A 3PE8A 1ZH8A 3E5RA 2DAPA 4WLEA 1KETA 3WMXA 5JY1A 3KSDO 2AE1A 1HSOA 1NVMB 1NYTA 5F21A 4GMFA 3V2HA 1FDUA 4Y9DA 2HMSA 2JHFA 1YL6A 3H8VA 4IUYA 2RCYA 1O6ZA 3L9WA 1XYGA 1W2XA 1K5HA 4W7IA 3VZQA 1O0SA 3BMCB 3DFZA 3DR3A 2DC1A 3RVDA 3UGKA 3ZU2A 4AJOA 4EGFA 5T67A 1PS0A 4IINA 3Q2IA 3C3XA 1SAYA 2VHWA 3QW2A 4JCSA 3HDJA 4ZQHA 5FYDA 5E0SA 1R4MB 3INTA 2HRZA 2FHSA 3KTIA 5G4KB 2FW2A 1KEWA 4CLHA 3X2EA 5K0ZA 5ADHA 2JAHA 1T2FA 4I8XA 2HAEA 4E5PA 3KETA 2BF7A 3KYCA 2B4TO 3WX0A 5A1TA 4PLTA 1VE9A 4CMIB 4MVJM 4BKOA 1YDEA 1DFGA 4HNKA 4F46A 3GC6A 4QO8A 3RUAA 1PX0A 2WYVA 1I3LA 5GZ3A 2WDZA 3DHEA 4YXFA 5L7TA 4FGWA 3V1YA 1U2GA 2Q34A 4WLVA 2G82A 4Q39A 1Q51A 2EJWA 3F9IA 1MV8A 3TLFA 2X7HA 3C1OA 3KTHA 4GKVA 5FI3A 2HMVA 3H81A 1OAAA 4PG5A 1R6DA 2I67A 1LSJA 1XG5A 4RPHA 4IJWA 2GLXA 4DYVA 2OORA 4G2NA 3R6DA 3BHJA 4F6CA 2Q2XA 3Q7HA 4EMPA 2O2SA 4BNTA 1DIBA 4JXKA 3WNQA 3CPSA 3M2TA 3JQ8B 4WJZA 5JYEA 3UW3A 2J5KA 3GEMA 1N9GB 3DHYA 4TSKA 4ZQFA 1C0LA 1YOVB 4FJ0A 4DPMA 4WOKA 4CL8A 1H6DA 2GYYA 3WGTA 1WNTA 2D59A 4G2RA 1DPGA 3RUEA 1ZXLA 1GFSA 1I24A 2Q2VA 4I52A 1ZK3A 2A7KA 4FC6A 1DLIA 4MVJP 5COAA 3D3EA 5FWNA 4RYFH 3EMKA 2C2XA 3SLGA 2C07A 1YE3A 3UCFA 3CZMA 3HFSA 1L7EA 2FR0A 1EVZA 2P68A 2UUOA 3OJLA 3TT7A 1X15A 4JJTA 4XD2A 3PJFA 1HYEA 4P4LA 4R5HA 2VNAA 1XQ6A 4PFJA 3X2FA 3JD1A 3PGJA 4B4VA 2C59A 1I8TA 4Q9NA 2HJRA 4MVJG 5U4QA 5ER9A 3GZNA 3GG2A 4OKIA 1DRWA 1U3VA 4AJNA 4J4TA 3JQ8A 3PGXA 4DGSA 2CUKA 2WEKA 2Y1OA 3C1TA 1ZSVA 3DBLA 5L3ZA 3RC1A 1PJ2A 4Z0HO 3OA0A 3C7CB 1EVYA 3BMQA 2IZ1A 2V6MA 3I3OA 2IEXA 1MB4A 1GUFA 1ZK1A 4FB5A 4YJFB 1LDEA 2C7GA 1R12A 5BSEA 2P9EA 3QWAA 4QEDA 4K2NA 4BMVA 3D3WB 1ZEJA 2IXBA 4BNUA 1PQPA 2DBVO 1QRRA 3ZW9A 1P9LA 3LSYA 3PEAA 1P3DA 4CUJA 2WYWA 1JVSA 2YW9A 4I9UA 3GN2A 5IDXA 3WS7A 1LLUA 4MVJE 2O3QA 4JJFA 2EERA 3TJRA 2Y99A 3EW7A 5DOVA 1I33A 1EDZA 4R5MA 4CQMD 2IRWA 1ZCJA 3QIVA 5IG2A 2X6TA 4JBIA 4NIMA 5H83A 3S1LA 4JJIA 4F47A 2B37A 1ZNQO 2P5YA 5KKCA 1QYCA 3JYQA 3ZWBA 3PQEA 3TOXA 4BNLA 1LRJA 4EDFA 1DUBA 2GNAA 2FZSA 1DC5A 4N7RA 1FJHA 1PJQA 3FF6A 3I6QA 1WWKA 4GLOA 1XSEA 3Q3CA 2HJSA 3WJAA 4YT2A 2BELA 5CEFA 3T88A 1P33A 5DCWA 2VSUC 3K8XA 5AXAA 5IXYA 1MLDA 1U8XX 1MFZA 4ND3A 3N74A 4R41A 3TZ6A 1ZSNA 4LN1A 4XGIA 4NQZA 2WJPA 3ITDA 1BHSA 3LYLA 1MUUA 2VWHA 3ZHXA 3SWXA 4BNNA 1TA4A 3QWDA 4B79A 3R3SA 1B8UA 2ILTA 2B5WA 4N5NA 4OM8A 4Y6SA 5DF1A 3WG5A 1FDTA 3GR6A 3T7EA 4BIIA 2J5RA 1K3TA 2PLAA 3T4XA 1G1AA 1Y5MA 2JFGA 4CJXA 3ZWWA 1MC5A 1X7DA 1AN9A 1KVRA 3MJEA 1LBEA 1RM4A 1WVGA 1LSUA 4FN7A 1C14A 2ZL0A 3FDUA 4CMEC 2B83A 3M2PA 4WCDA 2Q46A 2V6GA 3PFWO 4ZQEA 4M49A 4CUKA 5JAZA 1UYRA 5DUCA 5INFA 4OMUA 2GUGA 4ZDFA 1ADBA 1OD4A 4FGSA 4F45A 2Q1UA 1GUZA 1EQ2A 1DDOA 1VSVA 4K6FA 1SOWA 3DBRB 4YJHA 3TZKA 2Z95A 3BMQB 4ITUA 3VPHA 5I7FA 5LC1A 5TJ9A 4BNKA 4Z6KA 3OQBA 2I5PO 1UP6A 5B4VA 5JBXA 3SX2A 4UVIA 4JBHA 4QIJA 3IJRA 4R9SA 5DU6A 1HDRA 4WCFB 4CMEA 4YT5A 3D4NA 1CJCA 4I1IA 4NPCA 1P1FA 5IDYA 2XXJA 1XU9A 3HNPA 4EI2A 3COSA 3L6EA 3I9OA 4R1UA 4WECA 5L4SA 4WNIA 1BSVA 1LNQA 1GPDG 4M1QA 1VSUA 3OHSX 3OM9A 3PQDA 3LT2A 1W6UA 4BL5A 2PD4A 3ICCA 4RZHA 4CLDA 2EP5A 2Q3EA 1EBUA 4LMPA 1NVTA 4D0SA 5JBIA 3JD2A 4IDDA 1GQQA 1P1KA 3O38A 4Z3DA 1N6FA 1CQIA 2E37A 2I99A 4J0FA 2QYTA 1O9BA 4NBRA 1YQXA 2PTGA 4KD6A 3BEZA 3WGZA 1DHRA 3WWYA 4YBZA 5KJCA 1YWGO 3VIVA 1P1IA 4R3WA 2FZWA 1TEHA 1GZ6A 1TXGA 4Q3DA 4CLEA 3STAA 1RYEA 3QVXA 3GHYA 2FZEA 2UDPA 2ZB7A 2EKQA 3PHJA 4EMLA 1PZHA 3UVEA 3LDHA 1UIYA 3I4FA 4AFNA 4PCVA 3RJ5A 3WDSA 4RQUA 1PL8A 2UAGA 3PLRA 3LC2O 4CV3A 3VVBA 3JQEA 3WGYA 1DIHA 2Y93A 4NU5A 3RSHA 1HZDA 5KWEA 4FDAA 1DC6A 4Q0GA 2B5VA 3QYRA 4A03A 3TZCA 2D5AA 4OG1A 4KP7A 1ADCA 3ONEA 4M54A 3B70A 3ZWNA 2VQ3A 5IN4A 1M76A 1YH3A 2VWPA 3IUPA 4OOEA 3HQ4O 5L45A 1PJSA 3FNFA 1YS4A 2X9VA 2QRJA 3KTKA 3FWZA 3V5NA 1QSGA 4AG3A 1D8AA 2HMWA 2X8LA 5U9CA 2G76A 3U09A 1SBYA 3WBBA 2F00A 3F4BA 3KYDA 1I01A 4FSHA 2G17A 4I5FA 2CFCA 4YTEA 3ZNQA 4BO0A 3OC7A 4KWBA 5L53A 4A0SA 4Q3BA 3FNEA 4IDGA 2Y1GA 2NNLD 3VPXA 1CEQA 5L7YA 3G1UA 3KSZO 5F1PA 3CH6A 3H6KA 4XJTA 1I2CA 1B16A 1PZGA 4AVYA 5B4UA 2CMDA 4ZHSA 4TWRA 1KYQA 1G0NA 4IZBA 3HDHA 3JQBC 4XR4A 1D1SA 4URFA 3JQDA 4AJJA 2YDYA 5CHEA 2VSUE 1JWBB 2PNFA 1QLJA 1K0UA 1K2WA 1H2HA 4MVJD 3VKVA 1KBZA 4L8VA 4E30A 1IB6A 1VL8A 1O5IA 2I9PA 1KEUA 4DWVA 4JLWA 4XYBA 2VSUF 1Z82A 3WICA 4BO3A 2VWGA 4XCVA 4CV0A 3E1KA 3OH8A 1YB1A 1D7OA 3VH3A 3WFJA 3F3SA 2GZ1A 4E5YA 1RYDA 1V0JA 1C3VA 4RVGA 4UEJA 2GGSA 4GHNA 4WPGA 5B4TA 1XNWA 2X22A 2QW8A 2DTXA 2FY8A 2VYND 1VL6A 4I9NA 3S2FA 1GR0A 2CVOA 3FHLA 5L40A 2YHUA 4IQ8A 5KJ6A 5A5FA 2AQKA 1ZK4A 5I7EA 3TRIA 3WR5A 1BMDA 1R16A 3RC7A 1AUPA 2IXAA 4JIGA 3PHHA 5DBFA 2WSBA 4W4TA 4Z0MA 3JD3A 1O8UA 5F5NA 3IL2A 1DBVO 2D2IA 3PHIA 3UH1A 3ZHZA 4HBGA 3MEQA 3PK0A 3OJ0A 1PL6A 2J5II 1FC9A 2Q49A 4GX5A 3DB2A 5T8KA 5JS6A 1NWHA 2VHXA 4I9HA 1E1NA 5JXWA 3AY6A 3E18A 1YQDA 4BV8A 3NT5A 3PYXA 3NTRA 1YB5A 1MXHA 4M89A 2CD9A 4FOSA 1FC6A 5AXDA 3DJAA 1DRVA 2NLOA 1CIVA 1NHGA 3DBHA 4ND4A 1F12A 3RBZA 2TMDA 4NZ9A 2NUAA 1NQAO 1U3WA 4BQRA 4EZBA 2DFVA 4OQZA 1HTBA 4ZQBA 1WPQA 1IUKA 3QVOA 4Q3EA 1HLPA 4JVTA 3KUXA 1GYQA 3WYCA 3ZHBA 1WXDA 4J16A 2DBQA 1HDOA 1MG0A 2X0IA 4GVLA 4HC8A 4MJLA 1Q0QA 1YJ8A 4IXWA 1UZNA 4Z0TA 1EK5A 3GEDA 4YAGA 4R3NA 5CPFA 1JLLA 3FCOA 3OICA 3MCVA 5DZKH 3S2IA 1UAYA 3NRCA 1E6UA 3OSUA 1ISJA 2GCGA 3GRKA 2JKVA 4YJGA 4QFDA 3PRJA 4OKNA 4PLVA 4P22A 5U1PA 3ZV6A 1YKFA 1K89A 2QZZA 1H0KA 4GX2A 1JTVA 3VVCA 1SNYA 2VUTA 4OOFA 3TPCA 1PGJA 4Q3AA 3ASUA 3H0SA 3QQPA 1XCBA 2YHIB 1W0CA 1IYZA 5F1OA 1C1XA 5EPOA 4BOYA 4Z3KA 2O3UA 5A9TA 1F0YA 2LDBA 3C24A 1CDOA 1DOHA 4Z9XA 1GYPA 4BHTA 1V3VA 4PZCA 3Q9NA 2YQ4A 4K6CA 5THQA 3SJUA 4I42A 1XELA 1VRGA 4HADA 2EIHA 4L4SA 3SBOA 1Q2XA 1B14A 3JCZA 2J5QA 5CP8A 3WG9A 5CTCA 4WCZA 4L8KA 2OUIA 1X7HA 3ASVA 3FN4A 2PK3A 4RPGA 2CNBA 4BGUA 2NVUA 5A9SA 2ZQYA 5BNTA 1LUAA 3DZKA 3MOGA 1ONPA 1IE3A 1HETA 2OFPA 3H2ZA 3A4VA 3DOJA 4J4BA 4JCTA 4KMSA 4YT8A 1RJNA 5INIA 3IDSA 1PGNA 3I83A 2GZ3A 3AUAA 2UUPA 3PWKA 4FFOA 3BF0A 2CVZA 5TRTA 4BO8A 2WE7A 3GPDG 4MOUA 3NTOA 5A4DA 1FF9A 3AOEA 4I08A 3U4DA 1LA2A 1H9AA 1Y9AA 2Q99A 3W8DA 3O8QB 3VPSA 4A27A 4E3ZA 1UJMA 3HN2A 2FSSA 3TZQA 2AQIA 4JCQA 3ZH2A 4LK5A 1NPDA 5ICSA 2I65A 4R68A 1BTOA 5ITWA 1B8PA 3PIIA 1IPFA 2UV8A 4U0JA 3LAOA 4RF3A 2NTVA 3RCBA 4Z9YA 4DC0A 2DPHA 4FNDA 4BNJA 3A1NA 1EF9A 5CDYA 1MC4A 1U4OA 4B4OA 3P7MA 5JCJA 1HF3A 1QXSA 1X13A 4TMFA 1SB9A 2VYVD 3WJ7A 4FFNA 4ALJA 5KTKA 3GK3A 4NH4A 4QXMA 5C37A 5TJHA 1U5CA 3UAGA 4NBVA 4JN6B 1EK6A 3E03A 2NU6A 2YUTA 4C4OA 4JJGA 2EJVA 1Y8RB 3AUTA 3H7AA 4B3HA 3QY9A 4L4RA 1E7RA 3QVWA 5TX7A 5K6AC 3NDJA 1M6WA 1SB8A 4MINA 8ADHA 2F6QA 3HE2A 1WZIA 3ST9A 2OHXA 4PRLA 4RO0A 1NX6A 4XGNA 1N2SA 1LC0A 3H65A 4IBOA 2FR1A 2GDZA 1CWUA 1U3UA 2Y1DA 3GEGA 3OJOA 4QECA 1J49A 4TVBA 3Q9UA 5G0UA 5DU8A 2HKIA 4JOTA 1A4UA 1UYSA 1MJ3A 1N92A 4YYZA 1Y9EA 3I6IA 4YR9A 3T7CA 2X23A 4E6PA 4FCCA 1V3UA 2ZIZA 3AI2A 1DIGA 3QHAA 1VRWA 2GN6A 3WTCA 2P2SA 3ETEA 4UULA 4WCFC 3VTZA 2OP0A 3HE3A 4GMGA 1YL7A 5HA5A 4XWYA 3C7AA 3EAGA 4CLOB 2D0IA 3JQFA 1P45A 4E2YA 1XDWA 2B4QA 2VRBA 4M86A 4DA9A 4BGEA 4OSOA 5GY7A 4H7PA 4M55A 2BD0A 1EF8A 3V5IA 2VZ0A 2DTEA 2P9GA 5INGA 4B7CA 3PLNA 2BI8A 3P5SA 3HN7A 2B0JA 4LGVA 2CY0A 4AJKA 2DTDA 5IXSA 3QP9A 1SG4A 1PR9A 3KEOA 3H3JA 5BSFA 2E49A 3ONFA 2OOSA 4NHEA 5ICMA 2AG5A 4FIZA 3PDUA 2BFOA 3U9LA 2F6IA 4DLLA 5ER6A 1A5ZA 4O59O 3FTPA 4RL6A 4L0QA 4GGPA 2BFAA 4N54A 3EGOA 5T8KC 2ZQZA 3IIEA 3L0DA 4HX5A 1LQTA 2VSSA 1YG6A 2VSSF 3JYPA 2WD8A 3U0BA 2A81A 4BGVA 2B4RO 3K5PA 4A73A 4ZDCA 1ENZA 3UHAA 2Y0EA 1JKFA 4CMAA 4F6LA 5C7OO 2VWQA 1K6XA 1VL0A 3OFSA 4BO5A 2VUUA 3AI3A 5A9SB 1WP4A 1XWFA 2O50A 5C3MA 1DO8A 1UP4A 3ORFA 4RDIA 3ZN2A 1UYTA 3QVSA 5IN5A 1FCFA 4C7KA 2UVDA 4TZTA 2BH9A 4XR9A 1FK8A 3I4CA 4BNWA 1XNYA 1NR7A 3E8XA 3SC4A 3DTYA 2EW2A 5EQDA 5G1RA 2ZQRA 5JLAA 4WASA 3DAGA 2JD0A 3H5NA 4HP8A 4NFSA 4OH1A 4RDHA 4HWKA 5CDGA 2NU9A 5IZCC 4MIYA 1KC1A 3PWZA 2JL1A 3RASA 3KOUA 1U7TA 2EGGA 3LT4A 2ZTLA 2I3GA 3S2GA 3QWFA 3F1LA 4PIVA 3GDOA 1W8DA 3SJ7A 5TS3A 3FWNA 3HRXA 1V35A 4RLHA 3AK4A 3FTNA 2J3HA 1YBVA 3GZ4A 4PZDA 5AXCA 3SVTA 5KDRA 5DZSA 3ZNPA 5DBGA 3QWHA 3ADPA 2Q1TA 1T2DA 1XGKA 2AG8A 2Y0DA 4L73A 2EW8A 3JQ6A 1UAGA 3KTDA 4BQPA 2FOIA 2GASA 4FB8A 3IP1A 1A9ZA 2JHGA 5AOVA 1Q0LA 1NAIA 4KDFA 2VRCD 4PLZA 4XDYA 4J49A 1E3IA 3D4PA 3RC9A 4IDEA 5CFZA 1LDBA 4FZWA 5DKPA 1GADO 1MG5A 4GWKA 4IS2A 2HSDA 3TV5A 1AGNA 1HLDA 3LZ6A 2OBYA 2Q4EA 5EL0A 4YRBA 9LDBA 2VYVA 3P85A 2BRUA 4KUHA 1HE3A 4R9RA 2D5CA 1JVBA 3GVHA 4JCRA 3HP0A 3AY7A 1ENPA 3Q0GA 3JQ7B 2VZ9A 1IL0A 1J5PA 3BIOA 2C8TA 4WLUA 3NJ4A 3VH2A 3H3FA 4BNHA 3Q1LA 2HCTA 4E4YA 3DBHB 1P77A 3W6UA 2Y1FA 3RBXA 3R0OA 4D41A 4RF2A 3W8FA 5DTPA 4JGBA 4YJDA 4ZQGA 3GDFA 4LCEA 3ZW8A 4FPXA 4CM7A 2I66A 3HFGA 4DL9A 4N5MA 2F1KA 1BRMA 3L4SO 4IGFA 4QT0A 2C2YA 3L3SA 2OBNA 4DYDA 3JU1A 4GSKA 4GM2A 3WBFA 2ZCUA 4OSPA 3MWDB 3TWOA 3MZ0A 4CM9D 2Z5LA 2EG9A 4LSMA 2DU8A 2XPCA 4ZVVA 5I7VA 1U9JA 3UUWA 3DZGA 4RV9A 5CAEA 3FPCA 3WMWA 4ALNA 3R6HA 5JAIA 3IUSA 1DJQA 1NASA 1A7KA 2DLDA 4BB5A 5B1YA 4R1SA 3E82A 3ICPA 2V7PA 4PG4A 1S7CA 3N6RB 1KVTA 2O4CA 3WGIA 2VN8A 1DC4A 1Q7GA 1U2DA 2CVQA 1N9GA 4QFCA 1RM5A 5L95A 4R69A 2NADA 3UXYA 1EUZA 2HK9A 3GUCA 2CF5A 3DMYA 4B7XA 3DC2A 2PWZA 4CM9A 1PIWA 1R0KA 4L6WA 1DFIA 3Q0JA 3W6ZA 2YFHA 2D1YA 5HS6A 3SLKA 5JY6A 2JJYA 1PZEA 4AJLA 1VLLA 2W2KB 4IZDA 1I3NA 2AE2A 3AM3A 3VC7A 1A7AA 2O3TA 4BNIA 3AOEC 3GVPA 4J1TA 4RVDA 1RJMA 2R00C 3WLFA 1CYDA 4WK6A 5JC1A 3M6NA 5G0WA 5A03A 3NJBA 4AJ2A 1EBFA 3AFNA 4CR6A 1CQJA 4G5HA 4CV1A 1UUFA 3MOYA 3MTGA 4CMIA 4PLHA 4JP2A 3FR8A 3KLPX 2PKRA 4GPD1 4IJKA 3QJ5A 3ENNA 5IF3A 1HDYA 3D4OA 3GUYA 3GGPA 5DL1A 3L6OO 1WDKA 1PJ3A 3C8MA 5TT0A 1OBFO 1P0CA 2NQTA 1DB3A 2GSDA 3PTZA 2WE8A 2UYYA 3V2UA 5C7LO 3OETA 2DBRA 5DOZA 3V8BA 2VSUA 1PZFA 3U4HA 2RH8A 1BDBA 2PH5A 1YBMA 5G1SA 3G49A 2Y67A 3NKLA 3W1VA 4JK3A 2AW5A 1GDHA 2J3KA 1NZYA 2JD1A 2EKPA 3DBVO 4MDHA 2FBMA 2J5GD 4YT4A 1P31A 4K26A 2YQ5A 4KNPA 3F4LA 1J7XA 4U1AA 3PXXA 1H6AA 3C1AA 1GEEA 3OJEA 1E7YA 3WGOA 1PJHA 2J6IA 3QA9A 5T57A 1JN0A 4E12A 4DQXA 1ULUA 3ZWMA 4DREA 3AFMA 2EHDA 3WGQA 5JE8A 1E3LA 1H9BA 4IMPA 5EINA 4U0GH 2NVWA 3GMSA 4JYLA 1FDWA 5JDIC 1D4FA 4EJMA 2DKNA 3H0QA 4NDNE 2CF6A 4KQXA 4YVFA 2OO5A 1ONOA 1E7MA 4MVJF 5KJEA 4XGKA 1ZFNA 1ZK0A 2Z1MA 1GUYA 2QG4A 4BKPA 1K6JA 1IY8A 3TVWA 3OJFA 4R01A 3O26A 4UEOA 4WCFA 4ND2A 4RVFA 3RFXA 1LDYA 1WMBA 4RJTA 4X54A 5TIIA 3MJTA 1B3BA 4WKGA 3HINA 4ESOA 2C5AA 2Q1SA 1ORRA 3JQ7A 4PLFA 4CLRB 3R9QA 1B15A 2E6UX 3MJSA 2DUBA 1ZW1A 5B37A 5EJ2A 2PGJA 4E32A 1N5DA 2DVMA 2JCYA 2QHXA 5COQA 3ETDA 1I3KA 3P19A 4K9DA 3T8BA 1XX4A 3E48A 1B8VA 1C0IA 3OECA 3E9QA 5BNFA 1V8BA 4UUNA 1OD2A 4W9NC 4ZN6A 1SPXA 2PR2A 3PQFA 4YJHB 3ADOA 4A7PA 5BSGA 4MP8A 4IQGA 4UUPA 3TNLA 3HADA 5EESA 4IDBA 1JKJA 1QYXA 3SLLA 2GZ2A 5IKLB 1GPJA 4LSWA 2OL4A 4WEOA 5TLSA 4YACA 3JQAB 3B6ZA 2NVBA 5G2OA 4FN4A 3D5TA 5KDRB 2DQ4A 3TN7A 1NHWA 4ALLA 3K2BA 3DO5A 1PQUA 3L4BA 1GCUA 4H16A 3CEAA 4ONEA 5CDTA 2VCYA 3JQAD 3FNGA 1YG8A 2BGKA 5A02A 5DCYA 2Q45A 2HDHA 1EDOA 2VHYA 4WYOB 4CODB 3JQCA 1PSDA 1ZZEA 1NWCA 3GMAA 4NFHA 3KYCB 4TKMA 3LVFO 5TF4A 1FDVA 3GLMA 1UXIA 3CINA 4OIMA 4W6ZA 3H2SA 1Z73A 1KEVA 2A7SA 4U5QA 1QV6A 1Z75A 1UH5A 3BXXA 3DDNA 2NACA 3WTBA 1ZJYA 5CEJA 4WE3A 4XQGA 4JP3A 4DI1A 4MP6A 4XQCA 4LW8A 2AQ8A 2CE3A 5JO0A 5JBWA 2P91A 3NUGA 4FBGA 3H9QA 1TG6A 4MVJH 4YPOA 2FPGA 1P1JA 1B26A 3JQAA 3LKEA 2YJZA 4YWJA 4RVSA 2Y05A 3RJ9A 3WQRA 4D3FA 3QXIA 1DRUA 4DBVO 3NAQA 4FQ8A 1ZUD1 3FI9A 2YV2A 1E1LA 1MP0A 4XJSA 3RQSA 1EFLA 3EY4A 3H9UA 5A06A 1Z6ZA 3GZNB 5JAQA 4DLAA 2X5OA 1Q1NA 4PLWA 1U28A 4EITA 1O89A 5JYDA 1WZ8A 3NJ8A 1ML3A 3HDYA 3W8EA 6LDHA 1E7SA 4IJUA 4YEDA 5KVQA 2F9YA 4R16A 4PLYA 4D3DA 4U8GA 4K29A 1JAYA 5DNAA 1TVEA 1ONNA 2JFFA 4BKRA 1YO6A 2X86A 4WGGA 2X58A 4BB6A 4IDCA 4UVDA 2RAFA 2NSDA 3I9KA 3EC7A 1DXYA 1NAHA 2PZMA 1WAMA 1ZSYA 4GLLA 3K8ZA 4PLCA 5L4LA 6ADHA 1RJWA 1I5RA 4NJMB 1S6YA 3W4IA 4RF5A 2BI7A 3PGQA 3DEYX 2VYNA 4LMRA 3KQFA 1ADGA 3ZGYA 3ANLA 4E13A 1EVIA 2XAAA 2DEOA 4ID9A 3F6YA 3I9JA 3V1TC 2VOEA 4R1TA 2J3JA 1E1MA 3H0UA 1BXKA 3T3WA 1Y8RA 1DAOA 2PY6A 5THKA 3GHHA 1P1RA 2C82A 2NM0A 4IXTA 3BHIA 4J9UE 1HE4A 1U3TA 1A27A 2XXBA 4XZ3A 4YA6A 7ADHA 5L51A 1NNUA 3MJCA 1EE2A 2CDBA 2W2LA 3K2EA 2HQ1A 3EK2A 2D8AA 4UAGA 1NVGA 4YB8A 4XYGA 4ND5A 1X0VA 5JPIA 4EMMA 1U4SA 4D0RA 4XYEA 1DIRA 2C54A 2ZTMA 3A28A 2YFQA 4FFRA 4NBUA 3RIHA 1JW9B 1SEVA 4KQWA 1PJBA 2QQ5A 3KO8A 3AUSA 1YBAA 2RBEA 4P8RA 3RBVA 3WYEA 1NZYB 1KVSA 2O7SA 2RHRA 3K92A 4EEZA 5TSDA 4I4ZA 1TI7A 3KZVA 5TQVA 4IS3A 3AU9A 3CMCO 4WLNA 4PGFA 3HWRA 4WEQA 1B3RA 2C0CA 3GDGA 5EMHA 3RFVA 3RROA 3CTMA 3ZWXA 3GY0A 5JDCA 5LDGA 3IMFA 3STHA 5CG1A 5H82A 3GOHA 4D7AA 1LXCA 3P5MA 2ZB8A 3GA0A 3RAJA 3O4RA 4EUHA 4CQMA 1WW8A 1ID1A 1XR3A 1ZJZA 1I3MA 4BGIA 3GGGA 4XRGA 2ZB4A 4FS3A 1T1SA 4KZPA 3RI3A 4L4XA 3JSAA 1J6UA 4QFEA 3O9ZA 3UCXA 3UOGA 3QV1A 4QQRA 1RKXA 4AJ4A 5CDSA 1KC3A 1HZZA 2PKQO 3OMLA 4J7UA 4O63O 2NU8A 3AW9A 3ST7A 1WDMA 4E2WA 4PVDA 1SMKA 1VJTA 3OIFA 4NMHA 3AY3A 4GH5A 1EMDA 2BFPA 3NDIA 1NPYA 4KUEA 4J2OA 4OL9A 3ZU3A 4DLBA 2X5JO 4KDEA 5IDWA 1E77A 4K3WA 4XQEA 5KKAA 2CDAA 2Q50A 1UDAA 2X0NA 3DONA 3JQ9C 4NJOA 5HM8A 3U5TA 4RCNA 3Q11A 4U18A 4DPLA 3TZHA 1HL3A 2NQ8A 5BR7A 1BW9A 2HMTA 4TRNA 2JD2A 1LDGA 2E48A 4JROA 2ZYGA 5FI5A 3JD0A 3P2YA 4PLGA 2IZZA 1VI2A 3BTSA 4CMGA 1T2CA 3JYOA 3D3WA 4BNVA 1GZ3A 5A3JA 2O3SA 2VHVA 3DMTA 3KVOA 3QLJA 2VT3A 4NK4A 1E7QA 4YJGB 1IHYA 4OYRA 3SXPA 4O5OA 3IQDB 2O23A 2VSSE 4DMMA 3AM5A 2HU2A 1E3EA 4J90A 5ENDA 3WSWA 3I9LA 4ZDBA 1CERA 4E2XA 1HE5A 4TZKA 4PG8A 3DBLB 3ZWYA 4XRRA 5JDIA 5DP2A 2VT2A 4WOJA 4CQMB 2AEMA 1XA0A 1PS8A 2J3IA 2X5KO 3L07A 3PZRA 4L75A 1VKNA 4L9RA 4S3MA 1JKIA 1IULA 3BHMA 3KTJA 1XO6A 4TRMA 1A71A 3PYLA 3TDCA 2H5LA 1BWSA 3GVIA 3E9NA 4B8ZA 4GX0A 3S55A 1ZO8A 4IMRA 1GQ2A 1IPEA 4OAQA 1H94A 1L1FA 1B7GO 4IGEA 4KWIA 4O6VA 4WZ8B 3W4KA 5DUFA 1UZLA 1NBOA 4R1NA 4TROA 4UUMA 4MXIA 1E3JA 4CM8B 2Y1EA 3LK7A 3K30A 4MI2A 4NFYA 3ZCXA 5JW6A 4FJ2A 3KEQA 3Q0EA 3NGLA 4MIEA 5DTWA 5FF9A 3HB5X 4OXNA 1OOEA 4YAKA 1WMAA 4GKBA 4UVGA 4DTIA 4BNGA 4ND1A 5KOIA 2OP1A 3UFXA 2NTJA 4D43A 2Q35A 1UXJA 1H5QA 3QE3A 1YOVA 4YQZA 2QX7A 3ROPA 2O2YA 5T6BA 3KXDA 4YAIA 3QMJA 4U19A 3ZWOA 5A04A 1T2AA 2HK8A 3DXFA 2AMFA 4PLPA 3C7DB 1M6HA 1PJTA 5G0SA 5F3RA 2QQ3A 4E5KA 1Q7BA 4UUOA 3GPIA 1I10A 2V65A 1U1IA 3NEPX 2EJ5A 2PV7A 1Z7EA 1DLJA 1SCUA 2D4AA 3OQ1A 4BO4A 2ZK7A 1QV7A 5HRUA 1M2WA 3PZKA 2Y68A 3DOCA 4ASIA 1Z7BA 1XU7A 1X7GA 4RPKA 1E3WB 1N1GA 1LSOA 4ZD6A 3MTJA 1SZJG 2PH3A 1T25A 5G0TA 2H6EA 4MPDA 4INAA 1WZEA 2BKAA 3ZWPA 3EZLA 3O8QA 4FR5A 4BS9A 4BVAA 5DBIA 3WGGA 2VUSA 3K6JA 3VAZA 2DFDA 3VTFA 4P38A 3HSKA 3IS3A 1NQ5A 3RRVA 1V6AA 4TRRA 2EEZA 1Z74A 2RHCA 4HFNA 4HV4A 1WLYA 4ZGWA 3PYMA 1ISFA 3EZYA 3GVCA 3K50A 1ARZA 3M1AA 2OXIA 2W8ZA 1K6IA 4GL4A 4UVEA 2R00A 3RD5A 4AICA 2FPIA 3CZRA 2FSVA 3RU9A 3ZZNA 4M87A 1ISMA 1I0ZA 3ANMA 1Y8QA 4FNBA 1KVUA 1D1TA 3G0OA 2WMDA 4BNXA 4RCVA 3ONDA 4J6FA 4FD3A 2Q1WA 5G0VA 3LT1A 4PG6A 4RVUA 1QORA 1J0XO 4ROSA 3CMMA 5TC4A 2QRLA 1GCOA 2VZ8A 3JQGA 3LQFA 3OIDA 4LCJA 3D5QA 3PIDA 5CPBA 4TRJA 5LCXA 1LLDA 2HO5A 3LU1A 3T89A 1NP3A 4Y8VA 4I5GA 1QYVA 4Q1IA 5FUSA 2J5SA 2ET6A 2PD3A 3CIFA 2PZJA 4U6QA 1QLHA 2QIOA 2VOJA 1KS9A 4U0GA 4ELSA 4FFLA 3NV9A 4O1MA 2GRAA 2HK7A 3LC7O 4KWHA 5EIOA 5BSHA 4XYMA 3LLVA 1EZ4A 3GRPA 4JYJA 1LJ8A 2BFMA 2J5IB 1NQTA 3BMOB 3EVTA 3KYBA 4OXKA 5HTOA 4ELWA 1EQUA 1EUCA 3HB4X 1UXKA 3K96A 1GZ4A 4XIJA 3VOSA 1YDWA 3F1KA 4CLOA 1KEPA 2PKQP 3H5AA 1A72A 2FMUA 3MT6A 4XDZA 5DP1A 2YY7A 3T4EA 1GV0A 3L9XA 3PDJA 3VZPA 3PJEA 4FZWC 3KHUA 1BGVA 4ZRNA 2OMEA 1K39A 4CV2A 1LLQA 3U9RB 1HXHA 5FIFA 4P4GA 1E6EA 4B4UA 1IOLA 3PHLA 4Z9FA 3IKTA 1HNOA 3D1LA 2W4QA 4CMKA 3RSTA 2CDCA 5T64A 1OZAA 3FRJA 3DQPA 4UREA 1C1DA 1XQ1A 5KCZA 1P0FA 1ZK2A 3INGA 2VHZA 4PVCA 4OXYA 3K9QO 1BXZA 2PZLA 2RIRA 4CL3A 1I2BA 4U6SA 1ISIA 4ZA2A 1B0AA 4HUJA 1MFPA 3ZHYA 3ZU5A 4MP3A 4D79A 1G6KA 5EERA 2W3PA 2DT5A 2J5GA 4ZICA 2G1UA 1V3TA 1QYDA 1LX6A 4JCOA 3QVTA 2X9NA 3RKUA 2BHLA 4NEKA 4NJMA 2IYOA 2ZTVA 4IIVA 5JDCC 4HFMA 1ZKMA 3FD8A 2QYSA 2DPGA 3I1JA 4D42A 4DMLA 2JCXA 2PFGA 1PJCA 5JCJD 4IQ0A 3M6MA 3F5SA 3RFTA 4I5EA 4KTVE 2GN8A 3DZIA 3WNVA 5JNLA 5L7WA 4GSLA 5JFOA 3BYZA 3RU7A 4DUPA 1NPTO 3DTTA 4CUZA 3M1LA 4XA8A 4GGOA 1RM3A 3GQVA 1GQYA 2GD1O 1GD1O 3TSCA 2F9YB 2Y0CA 5HBRA 3EUWA 5C7IO 3GFGA 1NM5A 1UXHA 1T4BA 3U62A 2ZL4A 4U0HA 4ALIA 3OEYA 4IJVA 3IAVA 1HT0A 3B1JA 3E6AA 4FN8A 3I5MA 4FFMA 3R3JA 3MJ4A 2WWRA 1O94A 4AJEA 5K9ZA 1R37A 1B2LA 1MXFA 1M75A 1T24A 2H63A 5HS4A 1IZ9A 5AXBA 2NTNA 3ZV5A 4RZIA 5ITVA 2AXQA 1UDCA 4ZJUA 1KIFA 4XX0A 4RLSA 3GAFA 1AE1A 4AJPA 1XEAA 2VTDA 3HJAA 3ZNOA 1E5LA 1OFGA 2CSUA 4PZEA 4XYLA 1BW9B 4YAJA 1YVEI 4D45A 3DZHA 1PS9A 3TL3A 1RPNA 1UXGA 1W73A 3L4BC 3V2GA 5CTBA 2HRBA 8LDHA 3ROKA 3KM0A 2O3JA 4P4NA 3GFBA 5ENVA 1C1XB 3HDQA 1NR1A 3JYNA 1N6EA 4LK3A 3DHNA 3WLEA 1WDLA 4BNFA 1JU9A 4OQYA 4K1LA 3CSDA 1IZ0A 3VHRA 1O8CA 1VPDA 2W2KA 3SEFA 3VDQA 4A2CA 5MDHA 1DJNA 1LC3A 1F17A 3OF2A 4XKJA 3WWZA 2HUNA 3D7LA 5E0SH 5IAAA 3MWEB 4NBWA 1HSZA 4YRDA 3LF1A 3U3XA 4E2ZA 1RM0A 1R4MA 4GBJA 4OJNA 4MVJI 3TZ3A 1X1EA 3W4JA 4CR7A 3NT4A 4JQCA 1N8KA 3RKRA 3U4CA 4G65A 2YYYA 3ZV4A 7MDHA 2ZQQA 3CXRA 2FN7A 1PR3A 4G81A 3R1IA 4FW8A 1XLTA 3GN1A 2B36A 1Q7CA 1R15A 5KVCA 3DAPA 5ILOA 3VDRA 4YJFA 5DZKA 4ZDDA 3U4IA 2X1HA 4FFPA 4HKTA 2O3RA 3FPLA 4B3IA 3QSGA 1AXGA 4K28A 5H81A 3WQQA 5C5IA 2IEDA 1JQBA 1QKIA 2P4QA 1F14A 4HNHA 4RF4A 2P4HX 1KOLA 3RUFA 5TNXA 1SO8A 1RWBA 3ON5A 2JFHA 4BV9A 4D46A 3OT6A 3G17A 2IYPA 4JX8A 4BO7A 4OMRA 4RYFA 3T8AA 3Q2KA 2OGUA 4CLRA 5DU4A 2BLLA 3B1KA 1JDJA 4ZDEA 3HUDA 3NYWA 1JAXA 3F47A 1TLTA 4J9VA 4CQLB 4DQUA 3WB9A 5AVOA 2B35A 2YV1A 1GV1A 4ZRMA 3EDMA 3E9MA 1PJLA 1LEHA 2YZ7A 3FBTA 3PP8A 1E7WA 4JSBA 4DIFA 2X9GA 2EV9A 1D3AA 4LISA 5IFLA 1BXGA 4LVCA 1LRKA 3ZDFA 2IEBA 3K31A 3OEWA 3VPGA 2XOXA 4B7UA 2EXXA 4CQLA 4TVOA 5IZ4A 3IAHA 5F1KA 2A35A 1UDBA 4MOWA 4YAEA 2POQX 2NP9A 3B1FA 4IPTA 1L7DA 1HKUA 3H5RA 1LLCA 2OZPA 3GNSA 3JTMA 4EEXA 1GU7A 1NXQA 2IODA 3OA2A 2E82A 4U0KA 1BDMA 3LT0A
chains in the Genus database with same CATH superfamily
2WIAA 1P44A 2LUOA 1KFJB 2WKWA 2DGDA 4PR3A 3JTEA 4KUGA 1KQPA 4G5GA 1CP2A 1FYWA 4GOKA 4XQ0A 2IUFA 5BUQA 1BVRA 3AV0B 3MCUA 4TWZA 4C07A 1FSGA 3GD7A 3QTBA 1H23A 5CU7A 4OFBA 4BLOA 1QMGA 3LF2A 1QP8A 2W6QA 3A37A 1TJPB 1QH8A 3CZ9A 5HIMA 3FBGA 2QRQA 1DMSA 2G9VA 1EVEA 1YHZA 3NC0C 3S5UA 4X7MA 1B8OA 2NSJA 4ZZ1A 3QKRB 1Z68A 1AXEA 1CB0A 1OFTA 4O4IB 1GPWB 1RYNA 2BMAA 2OEPA 1QF7A 2H4WA 4JDPA 1QFSA 4WJLA 1CZLA 1J4AA 1GZHB 1P7ZA 3Q8WA 3F46A 5C8YF 5EXXA 4JLPA 2CJYA 3B3FA 3D6NB 3F5FA 3CE6A 4NENA 1SM4A 2IHNA 4ADSG 1BX3A 3U7FB 3E7FA 1CRWG 4IX9A 3P0EA 1OI7A 4LJKA 5IC4A 1Z6GA 4UMEA 5E1OA 3LX5A 1VHLA 4IL5A 2AEJA 5FAXA 1TFRA 7GPBA 4ZOLA 2VDUE 1FFHA 2WZQA 3NALA 3TQSA 1ZN9A 2DRIA 1AKUA 1C7QA 2FQWA 3OBIA 3TEMA 4PTYA 3SE7A 3TR6A 3R9KA 1Z5ZA 2CZCA 2IF2A 4QO7A 4U7WA 3EX7C 2FKNA 2ZB3A 4B6EA 4EAAA 1ESNA 2XTZA 3RGWS 2MSEB 4BBZA 2FQQA 3GNQA 4O3FA 3RRYA 1JMVA 3H9GA 1SU8A 4MGZR 3SM3A 4H15A 4J0DA 1QP4A 1L1RA 2IOFK 4J4HA 2UZ4A 3KJGA 1XLTC 2AYZA 2EWVA 4QOFA 1RZUA 3KKNA 4M0PA 4X8HA 2F1OA 2DUJA 1K68A 5DCUA 2DWPA 4L74A 5IFKA 4H27A 5CYGA 4B35A 5CLQA 3M6IA 1R4NB 1MX3A 1SIBE 1JAHA 1MIOA 2WYUA 3CUKA 2WFAA 3D1JA 3DZDA 2P6PA 5FJJA 4BUCA 4ZI3A 3FPJA 1Q14A 2OHGA 1FZTA 2P7HA 1FMTA 4FI3C 5KC8A 4BKQA 2GH1A 3BEOA 2ZFUA 2YZMA 4D9BA 3OQ6A 2HU8A 4KNWA 3CTPA 4LHSA 3ADKA 1E9EA 2AOUB 4CE6A 2EP7A 2QD1A 5DLPA 3PC7A 1EB8A 3R9IA 2FW8A 5IT5A 5K8IA 5JQGA 1KI6A 2KPOA 3F5QA 1M2VA 1KFEB 1OWNA 4EW1A 4BEBA 1ULAA 1PLJA 5JBQA 3R3XA 3GLGB 4YCSA 2H1RA 3AVPA 4FYIA 2EKDA 4JBLA 4KCGA 4O4HB 4YNBA 4B83A 2OBFA 3K94A 4AL4A 5CJPA 4BCDA 1C3OB 1TEVA 2RONA 3URMA 1NC3A 2OHIA 3G0GA 4FGUA 4TL6A 4CLXA 1I7SB 1CE8A 1LI5A 4FFBA 5LP6C 3DM5A 4JYAB 1GSOA 1U65A 2WG2A 3EY9A 2MOKA 1ELOA 1EY3A 4N0PA 1J8FA 1G21B 2V7UA 3QUAA 1XYYA 5G53C 1WB5A 1VE1A 1YVUA 4L57A 1F1JA 1U0NA 2JCVA 1ORTA 4HG2A 2QV0A 2GMWA 5CW1A 3UYLA 3TFOA 2YIVX 1N6IA 4JLSA 3ROMA 4W5WA 1Y81A 2YH2A 5EUCA 3KTGA 4QPDA 4NI5A 4TL8A 1ISGA 4JOSA 1GZ7A 4QLOA 4UBLA 5HWSA 3F2VA 4IV0A 4PG7A 3NYRA 1KQGA 3IAS1 4L3WA 2J33A 3O2QB 5D6NA 3ZY2A 4POOA 4MKRA 3ROGA 2Q62A 2AMVA 5ALSA 5EHIA 2F8TA 1T8UA 3PVSA 5AW5A 1GT91 3K9FC 2PZEA 2BFBB 4BV2A 4LKRA 2C88A 1MVLA 4FFVA 2HLPA 4LMBA 4ETWA 5CD9A 5FBKA 4M1WA 3EQ7A 3EARA 3PUKA 4HHEA 3P0IA 3KE8A 2NO6A 3PGVA 2D6FA 4B0PA 3S5JA 3HVKA 4JQOA 4TV8B 3PFFA 4G5XA 1IY9A 3LMKA 3LQ4A 2R7NA 4FHGA 5DULA 3SJZA 4MNTA 1AS2A 2EF1A 3GGOA 2WKSA 1NW6A 3NT2A 4BEJA 4BBPA 2IYEA 2G3YA 6AT1A 3L0SA 1PV2A 4QD3A 1POXA 4W7HA 5AI0A 3I9NA 1D6NA 3TXAA 2PD6A 4EMTA 1YQWA 2WTBA 2RH4A 3EIUA 5DISB 5IVDA 1CF4A 1U80A 4HL6A 2QZJA 1F0KA 3ITNA 1Q1GA 2MSKA 3T7AA 5BMVB 4P3YA 3C97A 2VYQA 1RRGA 2WU1A 3K1ZA 4PYIA 4WNCA 2VPYA 2OBMA 4LRSB 5T4BA 4GR9A 2BEJA 1KJ8A 1THMA 4JBGA 5AJTA 1CRLA 2BN4A 2ZSAA 3W9BA 4D3ZA 4N4AA 4MKXA 1HEUA 2B6HA 3AERA 2PQ2A 1N1EA 3K0FB 1PF7E 2GBFA 3SU8A 3T3MB 2PBPA 3FAZA 1Z5NA 1Y8CA 1JDUA 2QVXX 2GYVA 2C4NA 1ST2A 1HYHA 1I36A 4EYQA 5INTA 2WF9A 3QHQA 1GGEA 2BR5A 3AJ8A 4F3YA 5HTKA 3UG6A 2HPAA 4Q9KA 3OMEA 3PHGA 2G25A 2BIFA 2LWIA 3PU6A 4BVHA 2P6OA 5EJ4A 4YDRA 1PT8A 3H0JA 3CCCA 3EGXB 4WA8A 3NGXA 1EUDA 4G09A 3TH5A 1I32A 2I80A 2IQIA 2ORYA 3PKZA 3U7JA 2P9CA 2QJWA 3QMPA 1GL3A 4J43A 4EPWA 5IVIA 3LBIA 2VX2A 2CXOA 1XTSA 1LBHA 2HTFA 3ANXA 4IFIA 1N2XA 1TC2A 1Y3DE 1P4SA 2OGTA 3RYIA 4YLYA 1NOIA 2V59A 1B6TA 3TQHA 3ZJ5A 2ZRKA 4QDJA 4YV2A 3L6CA 3U7IA 4MTCA 5CG2A 1AUQA 2YHBA 3BEDA 3IVGA 4MV1A 1J22A 2C31A 4S24A 4B6GA 1P0PA 2ZBDA 1JLMA 2F4NA 3CG0A 1UBJS 4XWAA 1PGQA 1V1MB 1X9HA 4WK0B 3C1UA 1ILEA 3LLSA 3ZUPA 1YA6A 2B78A 3ZBUA 3H19A 5T5QA 1DVRA 3PR2B 4RIGA 3WSVA 4FXOA 2WB4A 1I7DA 1NBIA 3GJ7A 4CMJA 1IM8A 3BPPA 3A4TA 3SPXA 3ZGXA 3DV2A 4LKOA 5DLQC 3IKVA 1GZ5A 1E18A 2J7PA 3BTOA 3BWXA 4XB2A 1TECE 2EBUA 4PRKA 4LXHA 4NX2A 4Q4LA 4Y9UA 1M6YA 1XQXA 4RK5A 1NVXQ 4EUNA 3RIEA 3ACDA 3M89A 5TGDA 2F2TA 3R9XB 3A36A 5E3HA 2QBYB 2XBMA 2BGLA 3ROZA 3DB1A 1ULZA 1L7PA 2CLCX 2ZS7A 1UBUS 4MQ4A 3QXJA 5H70A 2PFSA 4RXTA 4MRSA 3FSGA 3T9AA 2V6BA 2XQJA 1ZGBA 3PUJA 4KK3A 1CJBA 1A2QA 2R11A 3H5OA 1FY2A 4A6XA 4PEVA 4IIDA 1G4UR 3UN1A 2A9FA 2R751 3R0XA 3NBMA 4MUEA 4MVJA 2R4QA 1G5QA 2PUAA 3KWFA 3OEHD 3LUCA 3PJGA 1DWOA 3SKVA 4CG1A 5GMOA 3A1WA 4Z1MD 1KVQA 2H9IA 1F8GA 1I4EB 4N18A 5BSTA 5F2OA 3FCCA 4BO1A 2G5CA 3A4MA 1QHIA 4EHKA 1NQWA 2QNIA 3B20A 3B51X 3A1VA 4YJ2F 4BN5A 3OQOA 5JH7F 3VNVA 4UE6A 3T5DA 1DDGA 3EVEA 5HCNA 1BVUA 2JIBA 4FJ1A 1DC3A 3JARB 4RGBA 1EESA 3ICEA 1D2AA 1TRHA 1ECJA 4UBMA 1M5RA 3QF4A 3M6UA 4FHEA 2VREA 1RWNA 2RDMA 1Y5RA 3ZCUA 4ENQA 3BMNA 4YP0A 3EPHA 3QM1A 1W5SA 3K9GA 1SOMA 3FYTA 5KNLA 1XDGA 4J7CA 4LPKA 2XITA 1IQ0A 1TB4A 4JWVA 1RLJA 4FTWA 1IHXA 3GLSA 1T0PA 1J0CA 4LECA 5BNIA 5EMNA 4BP8A 2JLYA 2CBYA 4YRRA 1KQNA 3HJRA 4AKIA 5ELLA 1KAMA 1D0IA 1AZWA 1O6FA 3AKYA 1MJGM 4QXAA 1XPUA 3DF9A 2ZL3A 1NXSA 2ZSBA 1W4RA 3R2JA 4NE7A 3L6RA 4YROA 1EZ1A 4YRAA 3S2EA 3KSBC 3RWMB 3GLQA 1T26A 3TRJA 5F64A 2XNHA 1RI1A 4FGKA 2WVJA 4HXYA 5FI1B 3MS7A 4DR7B 1EFKA 3WYBA 1V4VA 1R66A 1Y4DE 2WI8A 4G24A 4ZPXA 1C3OA 3RR2A 1ZRMA 5JCZA 1E9FA 1VL1A 5HKOA 3QTTA 2H7XA 2VRNA 2O8EA 2ZUTA 5BQFA 3IA2A 5KVSA 3IQZA 1JHDA 4GMHA 1GG5A 2FFAA 1RWKA 3LNCA 3B85A 4G86A 4TS4A 3A11A 4UMFA 5EQFA 4EAQA 2J5IA 4FC7A 3OPYA 4R2LA 2ZIWB 4B6QA 1Z2DA 4CPDA 1U81A 1JSRA 3LCRA 4K9SA 5JU6A 3HA7A 5G02A 2A86A 1LSSA 4I99A 4XB1A 1L7AA 5GZ1A 4IVQA 3VSEA 2FW7A 1X0UA 3L02A 1UJBA 5KOYA 4OLQA 3KTFA 5FUVA 4HT3B 1XZLA 1V16B 2PJDA 5DYYA 3L41A 4QVKA 3IUBA 3N2LA 3MJHA 3NHZA 3MXOA 4RZ3A 3BXEA 4HK4A 4JLJA 5E8RA 1LTQA 3R5XA 5KVAA 1VGRA 4AYWA 3G9UA 4MQBA 1XRQA 1K63A 4RQTA 4RD6A 5DM0A 1D2HA 4NNJA 2WJZB 1Y6JA 4FDVA 3ED1A 2ZWOA 3D7SA 1DQSA 2EDCA 2BFDA 1NF2A 2BTQB 2QP9X 3KFXA 1UIRA 3KJHA 4UCFA 4QUJA 4BN4A 3FNHA 3IT1A 4DDHA 1FC7A 3EIWA 5CB4A 1C0PA 1NF3A 3KSMA 3SHVA 2I3ZA 3KYDB 3SFTA 1GTMA 1HFEL 3ABZA 4MS4B 1FMFA 3VMMA 3CSSA 1N7HA 1Z17A 2IOQA 3JQ9A 3N8GA 1OTHA 4KXYA 4WN9A 3LY5A 3ESZA 2NSLA 1M1NB 2JJ2A 4PIMA 3ZLTA 4DVJA 5I8WA 3VJRA 4QDXA 2P90A 2VJLA 1S5PA 3QRWA 1FDSA 2QT1A 4WMLA 1S3GA 5DBOA 3MF4A 2JAQA 3K5WA 4YCLA 2Q41A 3QBJA 5LQNA 4A10A 2FWBA 1DHTA 3KELA 2FW1A 4YMIA 3ROTA 2BGNA 4MLCA 1T29A 3BGOS 4GWGA 1NFFA 3PPIA 4BQNA 3M1YA 5FUWA 4M0LA 3O9VA 1L8LA 3F4KA 4NENB 4OPMA 1M0EA 4X1IA 1XKQA 4KPKA 3A3PA 3GLUA 4WK4B 2BDTA 4B76A 1AM4D 5CEEA 1LI4A 5C53B 3G0DA 5H9VA 5PNTA 1W85B 2A7XA 4Q24A 4GLJA 1PD1A 1VCNA 5A62A 1W47A 1OLSA 1ZA1A 2HSEA 4LJ8A 4NR0A 2GERA 3IT3A 4GI7A 4LTMA 5IDQA 5IJ0B 3KOMA 4Y6PA 3GJ6A 5EN4A 1M6VB 2Y4OA 1KERA 3REOA 2AXNA 2JW5A 3C43A 3EE6A 5J58A 3E7WA 1KWGA 3ESXA 3RM3A 2DBZA 4ZRDA 2XMSA 3PENA 5FR2A 5AFSA 1IY1A 4D0GA 5MN5A 3CR7A 1NUTA 1Z4MA 2UZ0A 2XT6A 2JJ1A 3IQIX 1L8OA 3B9PA 1TT5A 4DA6A 2NUAB 2R2GA 4Q19A 2DLNA 1PT6A 1YS7A 1U7HA 5JMWA 1U0SY 1XD2B 1V95A 1W4AA 4RH3A 4OIFA 4K8OA 5FPPA 4BMXA 4F0JA 4ZICA 1HZJA 2LKCA 1BKDR 2GR9A 3D3JA 3D64A 1JG6A 5AJYA 5F77A 1PG5A 4K7JA 4BVGA 3OCYA 3QEMB 521PA 4BLRA 3PTAA 3QPAA 1IOWA 1VPEA 4KE7A 3EIEA 3QWBA 4D9JA 5F5XA 2EGHA 4RMJA 3KHSA 4LZOA 4BNZA 3KB2A 4LHZA 2HADA 1UPUA 3T3NA 4Y67A 1T36B 4DUGD 1FSPA 2A9QA 5DXJA 5IKEA 3COYA 1A7JA 3FOCA 3GH3A 2V3CC 2NX2A 1QYRA 1HDZA 4AJ1A 1C9KA 1Z45A 2OCLA 2CL0X 2GYWA 2YIDA 2ISSD 4HRXA 5DGXA 5EKDA 1ODJA 5AYVA 2VAVA 3A2NA 1JDVA 3ETJA 5J2TA 3FRIA 4YRFA 4MARA 1U0FA 1YI1A 3N0WA 1RFGE 3B6IA 1TCVA 1Z15A 1XK6A 1XT6A 3K0BA 1MNAA 3NM6B 3C5WP 4HSEA 1JT2A 4AXXA 3RVBA 1CRPA 3GLGA 3EVAA 1PQWA 3ETGA 2W48A 3TLAA 3CPEA 2Z6QA 2BFWA 2CFOA 1ZI6A 3CW2A 3AHFA 2HW8A 1JQKA 1EAMA 2O4UX 2VUIB 4JEIA 4D0LB 3DORA 4ZCSA 1AHHA 1TM7E 1ULBA 3LOUA 4L0MA 1HWYA 1Z0JA 4BMDA 2A92A 1CDDA 1EGMB 1ZD9A 1TJ3A 1ZD1A 3SICE 2CJWB 3PE8A 3BF8A 2NV0A 3D6VA 4AYTA 4WLEA 3WMXA 3CONA 3GI1A 3KSDO 4D26A 4ZZ3A 4N5DA 4GMFA 2HMSA 4IUYA 1YL6A 3DVAB 3DCNA 5TEWA 3QEKA 5AM5A 1V8ZA 4G0XA 4EHHA 4EI7A 5JNTA 2FSUA 4QDZA 2J0UB 1W2XA 3VU9A 1K5HA 4Z1OA 5C9ZA 1O0SA 2XRYA 3F7OA 3KC2A 4X85A 3RVDA 3ZU2A 2Z2KA 4OBEA 1NV8A 4AJOA 1Z12A 4F1KA 3CRRA 2XGGA 4Y1RA 3RIGA 5B36A 4FZRA 3K70C 4H18A 3KT6A 3C3XA 4J8PA 1DT5A 1Z6XA 4PZLA 4JCSA 4UW9A 1DCKA 3GFQA 1R4MB 4RMGA 4BLQA 4NMWA 3NVDA 1OVGA 5GIOE 3ER6A 5D00A 2H4ZA 2FHSA 1A2OA 1KEWA 2B5OA 2VAWA 4CLHA 3MWEA 4JY7A 5P8WA 5ADHA 4I8XA 4ZOLB 1W36D 5FA5A 2HAEA 2QZSA 3L1HA 1NIPA 2BF7A 3EF1A 2H3HA 3HCFA 5AUQA 1EX9A 1L5VA 3IX7A 2JBHA 2QYOA 3WK7A 2ZROA 1J7JA 1CJUC 1VE9A 3I73A 4NHOA 4PONA 2NZVG 3Q87B 4RA9A 5HUHA 1YDEA 4KR0A 1XPOA 1B0PA 2HSGA 2VDLB 2Z2ZA 3GC6A 4B6RA 1GTSA 3WL7A 2WYVA 3HXPA 1M34A 3HY6A 3N28A 1RXUA 5CYOA 4YXFA 4FGWA 3V80A 1U2GA 3Q85A 4WLVA 5AW8A 4KO2S 3RABA 3F9IA 3VR2D 3RSZA 3TD6A 4R83A 1R0ZA 3C1OA 1GLNA 3O95A 4MS3A 3KTHA 1BH2A 4Q12A 4GKVA 4A6EA 2X76A 2J9RA 3K0FA 1OAAA 4UDXX 4ZOLF 5HW0A 1LSJA 2E2WA 4C6SA 1QHSA 1N25A 1O5TA 2OCIA 2B8JA 3ZEIA 1OLUA 4F4HA 3JWIA 4ZVNA 4ZCLA 1XEWX 3Q7HA 1FUYB 4OMCA 3EZ2A 4PX9A 4UPEA 3GJTA 2VA8A 5L6LB 4IHKA 4WJZA 1EAYA 2FSVC 2W6CX 5HZHA 2AOVA 3OTQA 1I0IA 4BUJA 1X94A 5DASA 3K16A 4HNSA 3RHTA 2VJQA 3I6MA 1KPIA 1V71A 4WOKA 1E62A 1YBFA 1P5ZB 3KEGA 3WGTA 4EG8A 1XN4A 4R31A 2J6BA 1H69A 3AESA 4UFNA 2OD7A 6Q21A 5KHAA 3EXIB 5EI5A 1W5FA 4EHDA 3DP9A 1I24A 5C1IA 1XZHA 4HEHA 2Q2VA 2W4MA 2Y0BA 1ZK3A 1UQUA 3CNQS 5KOJA 4QASA 1DLIA 4UKDA 5FWNA 4CNQA 4HDOB 4Y1GA 1FUEA 3IPLA 4GBGA 1JHOA 2OKCA 4HDNA 4P9NA 5E1DA 1YNSA 5ELMA 3CZMA 1RQGA 1WP9A 2UUOA 1W44A 2VH2A 3OJLA 4M0UA 3WMRA 3AUYA 5JATA 3CRW1 5FUYA 1NUHA 4XWGA 2WV7A 4XD2A 2LGJA 3PJFA 2TYSB 4OK3A 2I7DA 2O1XA 1E94E 4ZEVA 1PFYA 2WA2A 4PFJA 1HKHA 3WGVA 1OXBB 3SX0A 2C59A 3PCTA 2LXNA 1XO6A 4MVJG 1EVKA 3SNHA 3V4OA 1KY2A 4HNTA 5A4FS 5FA6A 2MINA 3DE7X 4HXEB 4RQAA 3NRJA 2OESA 3A3NA 2ICAA 4K9PA 1N0UA 4GP6A 4DGSA 4RD4A 5L3ZA 1GA6A 1PNOA 5C31A 3RC1A 1T0IA 1Q11A 1J9ZA 3I3OA 3Q7QA 2IEXA 4NL4H 8OHMA 1FQJA 5BSEA 5SZIA 3BBLA 3D2BA 3HH8A 3SIRA 1RLOA 5FOSA 5LXTF 3U39A 2C5HA 1KYZA 4K2NA 2ZUVA 4AU1A 4BMVA 2IA5A 3D3WB 3GCGA 3HEMA 4U3JA 3RC8A 1PQPA 2DBVO 2E4XA 5BOSA 4MQ6A 5ALPA 5C2JB 3LSYA 3ZW9A 5FTMA 3G2LA 3JWPA 5SYNA 1JVSA 4JVSB 3GN2A 2XLCA 5IDXA 5DCLA 2X0DA 1QWOA 2B2NA 3JX9A 4MWTA 3AKEA 3G9TA 1U02A 2I33A 3I8OA 4R8RA 2CNWA 2PQ0A 4R5MA 2ECQA 4DMHA 4UARA 2BEWB 2UYQA 2X1VA 1NJ6A 4NIMA 4DT1A 4FBMA 5BWBA 3HFJA 2WOJA 3TRKA 1V4BA 2B37A 4U2DA 4U1RA 4KE8A 5F3DA 3JYQA 3TOXA 3L8DA 1JEOA 4JXJA 4Q9HA 5LXTB 2FZSA 3FIUA 4XI9A 2V7EA 2PMBA 2XW6A 3HCNA 3LYAA 4EHFA 1TAQA 1YNOA 3Q3CA 1QK3A 4YT2A 3WJAA 2QT9A 1FXWA 2J6CA 4S0XA 5CVEA 5DCWA 4AKEA 3FOFC 2VSUC 1XTQA 1U8XX 1R6XA 3F3KA 3F6PA 5CBPB 4PZAA 3GA7A 3K6KA 1SZCA 3AQ4A 3AR2A 2Q4OA 4OYYA 4D25A 2EJTA 2WJPA 3ITDA 3C4VA 3LYLA 1MUUA 2VWHA 3I3SR 2DR0A 1M2FA 3HU3A 3ZHXA 4AKGA 4UE3S 4RY8A 2XYVA 4BNNA 3QWDA 4B79A 3D0RA 2OV2A 1AKQA 2PZGA 4WA7A 3DMDA 5JI2E 1GPYA 4W5QA 2H29A 4ME6A 4Y6SA 1QGOA 2JLCA 4ARSA 3CH7A 1VP3A 3KQHA 1K3TA 1PK7A 4MYTA 3W06A 3HZRA 5AJWA 2AFHE 2QB5A 3CJTA 4ECEA 3NBKA 5ECDA 4BAZA 1E8NA 2RFLA 4QTTB 3ZWWA 1MC5A 1A8UA 1AK9A 1X7DA 5KNDH 4C5AA 4EY6A 1BGXT 1WCXA 3AETB 1EHIA 1LBEA 1RW4A 3MFQA 4PSKA 1L6RA 4KIWA 3H86A 2PEYA 4OSEA 3OZVA 4C5CA 4ZYXA 4OU5A 1HA3A 3M1IA 3NHUA 4H1TA 4WCDA 2V6GA 4LJRA 5DUCA 3O1HB 2C4MA 3VU9B 2VAMA 4HB4A 1Z38A 3OHMA 1JPJA 4L2IB 4L4ZA 5A3RA 4N7MA 3IBGA 1VSVA 1A0OA 5FWAA 3BX1A 3QITA 1X42A 4B4DA 4BQIA 1NQUA 2Z95A 3BMQB 2XE7A 4ITUA 4Q0MA 2R47A 5FBZA 4OHFA 5TJ9A 4BNKA 4Q4DA 5FDFA 1BAPA 1UP6A 3G7NA 3SX2A 4E09A 4UVIA 2RGGA 4JBHA 1VJ5A 3OQIA 4KRGA 5K3DA 4B75A 4MQMA 4CMEA 3Q8KA 1RWXA 3ZDQA 1Z2OX 5LIPA 4NYMQ 2ONKA 2JRCA 3WIVA 2J0VA 3HNPA 3VV2A 3TDMA 4EI2A 1HPLA 3I9OA 2WJIA 4DV5B 2ZGVA 3GLRA 5L4SA 4NOLA 1BSVA 4TKUA 1GPDG 1WHTB 2E9SA 1J0DA 1VSUA 4M1QA 5LYJA 1EQAA 1T9GS 2A59A 3UMJA 4EY8A 2FFQA 1H4TA 1C0EA 2XCRB 2PD4A 3D2LA 4RZHA 3ZZ1A 3D8SA 2D2VA 3TRHA 3WV4A 1TEZA 1QZ3A 3I04M 4CGYA 2HXYA 2XR1A 3DBOB 2JRLA 4L8YA 2JKZA 2ZSDA 3MBKA 3JD2A 1NX9A 1QIEA 4EQ6B 3QU2A 4WACA 4Z3DA 4MW7A 1NNI1 4U9UA 1CQIA 1IJBA 4JFAA 2WUVA 1E1RD 2CLMB 5FAKA 4J0FA 2QYTA 4D80A 1G5TA 1O9BA 4NPAA 1EG2A 2FG5A 2PTGA 1XROA 3EIHA 1RCTE 3H5TA 4NQRA 3WGZA 4WBNB 1YZ3A 1R0CA 3RH0A 1P1IA 4E1AA 4RV4A 1G9SA 4RELA 3SHFA 3B9QA 4R3WA 1QIHA 1GZ6A 5HZKA 1Q57A 2FNAA 4TX1A 1BMQA 1RYEA 4AMYA 5JALA 3N9IA 5LFAA 2UDPA 3V4ZA 3JVDA 3E58A 4ATNA 1JSCA 2IIQA 1PZHA 4M21A 4YRJA 3L4JA 3I4FA 1UIYA 2HZBA 2J45A 4L5AA 4PCVA 4RQUA 3WDSA 1PL8A 3A3KA 3LC2O 2WHRA 5LLTA 4GBMA 4LIPD 4CV3A 3VVBA 1N2JA 3UG7A 2Y93A 1CHDA 1VLQA 1TRKA 4W1RA 4FDAA 4L6CA 1BS9A 3QYRA 1JH8A 1QJ4A 4ECAA 2D5AA 1M7GA 3CVYA 3DZCA 4KP7A 3HV2A 5F9HA 2NO5A 3BVPA 1TTHA 2Q6OA 5THXA 3N5CA 1US8B 3OFNA 3EWAA 4NTZA 2W6ZA 1M76A 1YH3A 1Y1SA 4OOEA 4MKIA 4FGLA 1OWOA 3AF4A 3FNFA 2X9VA 3KTKA 2QN3A 5CJ2A 1BZYA 1KDOA 3V5NA 2X8LA 3QFRA 5C46F 4ZVRA 2G76A 2JH3A 3CPHA 2ZZMA 2IEAA 3T9BA 1XWWA 1X1DA 2CNKA 3F4BA 4BC1A 1I01A 2XUFA 3QNUA 4BO0A 3OC7A 4TS3A 3I0ZA 1MO6A 2DMRA 2NNLD 3V1KA 1QO0D 3AILA 3FMIA 3H6KA 1Q91A 3WOVA 2Q3HA 5IUJC 3FLBA 5B4UA 1PZGA 2QTCA 4MHOA 1APBA 3KDPA 3VV3A 3C3KA 1CT9A 2D13A 4G9GA 3T34A 3A8TA 1OE0A 2BV3A 2R6AA 3UHJA 3O3MB 2BKEA 3P4XA 1M1UA 2FUEA 1LS6A 4URFA 1T91A 4HWRA 3H8JA 3QVLA 4AJJA 5DTIA 3F3YA 1U4NA 1K5GA 5B1EA 4ZOBA 2PNFA 4DLKA 3SZOA 2PKYX 3I6ZA 1H2HA 3AP1A 4IWYA 1XMJA 4ENPA 4C0QC 4JC0A 1U28C 3WQHA 2GHIA 4WL0A 1FX0A 4ZAXA 4RPIA 1Z82A 4YPVA 3DVAA 4CV0A 1P0QA 2HMYB 3DOIA 4Q7LA 2MDTA 1F9AA 2JLBA 1WEHA 2NZ2A 3I39X 1OBHA 5ECYA 3F3SA 1WF3A 5GWXA 1B1CA 1MHTA 3AVWA 1V0JA 1R6UA 1SURA 3LLUA 4L8GA 4UEJA 4FP9A 2GGSA 4MUAA 5AIAA 1WZCA 2BJVA 3MWDA 4J0GA 5TQJA 3CLKA 4Z49A 2MINB 1PL0A 2FX2A 5J1SB 3GP8A 2LR0A 2VDKB 3UAOA 2XE6A 2QW8A 2DTXA 2FY8A 2XNKA 1VL6A 4KACA 3CZAA 1GR0A 3CNOA 3EWNA 4Q4AA 4R05A 2CVOA 5F2EA 5FPYA 3T0IA 2QAGA 3W1EA 1RKUA 2XOKA 1AURA 3FHLA 5L40A 1GPNA 5KJ6A 3MYYA 3HSSA 1ZK4A 3ISTA 4M22A 2B7LA 4RZXA 4ZEMA 4KXNA 3AIKA 2RSLA 5A5GA 2ZVJA 2CUNA 1JEAA 3PCRB 3L0BA 4K81B 4RU1A 3HKCB 1E1RA 3T35A 3GUVA 3WSTA 4CWAA 1DOAA 1O8UA 4R84A 5I4BA 1DBVO 5H3HA 4MA4A 1WJGA 3UH1A 3UM9A 3ZHZA 5KYXB 2J09A 4WCVA 3DYBA 3I42A 4WKCA 4DADA 3J81A 4MRAA 1SZDA 5JS6A 4UDNA 2ZIFA 5A71A 5KWJA 1E1NA 4IGIA 4B5KA 3H04A 3AIOA 4FEYA 5K4AA 1YB5A 1MXHA 2O8NA 4M89A 5TPWA 2GBLA 5B3AA 1WB9A 5F3WB 5CH3A 2G1AA 2A78A 1YI8A 4HDRA 4LXTA 1NKTA 2QQGA 4WBSA 3AGQA 3ZJUA 4H7HA 2ZWPA 3ES9A 4AKTA 1A9TA 4O2RA 3A7EA 3DWGA 4JD5A 4EF4A 2P0AA 4OQZA 3BQNB 2GKSA 1VPWA 3KKLA 5E6UA 4DNPA 4BJ5A 5C52B 4L9SA 4YMWA 1NDUA 5ALXA 4AURA 4JI8B 3RT7A 1GYQA 2O8DB 4OXRA 4J16A 4Z0NA 2P69A 1MG0A 1YUNA 2D74A 4ZTZB 3FPSA 4GVLA 2UVPB 2NO7A 4MJLA 4IEFB 1YJ8A 1Q0QA 3C3PA 3DEZA 1I4LD 1HG1A 1DI0A 2OCGA 3GEPA 3HJHA 3IPYA 1VHTA 1WE2A 2MJLA 2JIRA 1MMFB 3KWMA 1R6BX 3GEDA 1NV9A 4Y6QA 4ID3A 5CPFA 1S1MA 3F74A 3P32A 3W8RA 1MT3A 3AUXA 3VSCA 1YMUA 3EBOA 3YASA 1JE1A 2OWEA 5EE5B 4L3VA 5JTTA 4KLNA 1YZYA 1H2YA 2PJZA 2AN9A 2KI5A 3RVQA 4DVGA 1STOA 2GCGA 3GIWA 4GM1A 1UBFA 2B4AA 2QL5A 5KU1A 4QFDA 1FP4A 1GKKA 4OKNA 1N3IA 1OXTA 1FE8A 4DNXA 4XFJA 2R62A 3F78A 2JFBA 4GX2A 1P73A 4K6HA 4OOFA 5AM0A 4CDGA 3ASUA 1BJKA 2NMVA 4JU8A 3V7NA 3QQPA 3QE0A 3RWOA 1XCBA 3G5AA 4Z3KA 2V4UA 3SQWA 3BK1A 2O3UA 1EXDA 4B09A 1F0YA 2AI3A 1OXXK 1FL9A 1YU9A 3C24A 1ZW6A 4PQRA 3A6FA 3MT0A 1TL7C 4Z9XA 1AKMA 2AN1A 5AD1A 1V3VA 2GF9A 3E22A 3Q9NA 1G5PA 1WMEA 1SVIA 1ZHHA 3PQ4A 1P2BA 2C0QA 1L4YA 1TD9A 4CN8A 4LXGA 4G0YA 3MM4A 4YRCA 2EIHA 4GYKA 3SBOA 2AJLI 3WL5A 1RR6A 2YMMA 2M6LA 3H2JA 2G9RA 4M37A 3VR5H 1TX4B 3WG9A 3PD7A 1ND6A 1O95C 2PRIA 2PK3A 3LG2A 1LUAA 3DZKA 3NPMA 5FKJA 1HETA 2YINC 3A4VA 3PX7A 2EU8A 5BQPA 3TUZC 2H3EA 3VTKA 5TQ2A 3OTOB 2N42A 2H1IA 3T0FA 4IX1A 5B1SA 4UBNA 1N2GA 2UUPA 4PZPA 4U2FA 3BFKA 4BRUA 3O4GA 1G8KA 2WE7A 3ECCA 3GPDG 2H7YA 5CFOA 3LTEA 2OSVA 1MABB 5A4DA 1NNSA 4PXAA 1H9AA 1Y9AA 3SSNA 4ZXFA 1KRWA 2QX4A 4KQ2A 3HCCA 2R86A 3I0MA 3LFUA 1UJMA 4G97A 3HN2A 1G7SA 4MW9A 3SKYA 2FSSA 4HDSA 1P6XA 2FJPA 1P62B 4J0IA 4R9VA 3TZQA 5KYUA 4HVAA 5LMNB 2PUDA 3THXA 2I65A 1BOFA 1X3LA 4CTJA 4X65B 4HRVA 4F11A 1MRNA 2NTVA 2DPHA 4FNDA 3KAQA 1O9GA 1GU0A 3LYHA 2W0SA 4S1PA 4J03A 3VR3A 4X6UA 1J8DA 1JHPA 2H9YA 4I6GA 3H11B 3PC2A 1WM1A 4HPJB 1NZJA 1CSEE 1FIUA 1QXSA 2AIRA 4TMFA 4ALJA 1OFCX 3MJDA 4QXMA 1PBNA 4DUZB 1AA9A 1XUOA 2LCIA 3H2GA 3QENA 4FINA 5KAPA 5EXPA 2QT0A 4C4OA 1A95A 3EZGA 2EJVA 2EBWA 1L5ZA 2X3FA 3H7AA 5K6AC 3QVWA 1ML4A 5NULA 1NY6A 3NDJA 1M6WA 3RFFA 1SB8A 2XUHA 4FQ5A 4MINA 5LWHA 4D1YA 1N33B 2OK7A 4HDRB 4PRLA 2IBSA 1DGQA 4FMPA 4ZI5A 3UJ8A 3H5LA 1ZNYA 2FR1A 1CWUA 1U7PA 3C0KA 3GEGA 3IQHX 4QECA 4TVBA 5G0UA 3SZMA 1QHYA 1Z63A 1UBKS 3WISA 1KXZA 5J2UB 1MJ3A 2ALJA 4RKWA 4D8UA 4ZCRA 2P40A 3TLKA 5CHYA 1F2UB 4OX9B 1ZXXA 3I6IA 5KNCD 2AJTA 3UUEA 4YRSA 4YCMA 4ZJZA 3EEIA 3UKJA 1T3HA 2ES4A 1XMPA 2G71A 3QHAA 2ZIZA 4LA4A 1U1CA 2EKZA 2HWWA 4R1OA 2OP0A 1YJXA 1FYXA 4LMAA 2I4IA 4HDSB 4LNUA 4GMGA 5HA5A 2P9TA 2ZR7A 3MGCA 4L08A 4N6OA 1ZGJA 3QNMA 4ITRC 1P3Y1 4LX8A 3R7DA 4EG0A 5KMGB 3MT9A 1IOVA 1QGED 1WKBA 2NN3C 1RWMA 2B4QA 2O0JA 1Z6PA 3P9PA 4C0WA 2E87A 2FOXA 4BGEA 4BX0A 4H7PA 4M55A 4V38A 5KHLB 1EF8A 2VZ0A 1Y3BE 2P9GA 4M9SA 1KFCB 2ANCA 2IPLA 2QGNA 3P5SA 5CK5A 1BKYA 1OZFA 3I28A 3QUCA 5JZBA 2ID8A 1SG4A 1PR9A 2QN6A 3HKBB 4RZSA 4DSTA 1YFLA 3B2NA 5FPHA 4M3NA 1UFKA 3SYRA 1RJEA 2HU7A 5I01A 3K09A 1QPZA 4FIZA 5H3CA 4LQDA 2O8CB 3GBVA 2GI4A 5ER6A 1A9QA 1A5ZA 4O59O 5HQTA 3ROXA 3AVTA 2XTAA 4L0QA 1JHUA 4HN4B 1FX0B 3EGOA 5LU8A 4KRXA 1YMQA 1W96A 3T9FA 1M34E 4FILA 4HDMA 3BSSA 4OUKX 3L8MA 1YG6A 2VSSA 2B4RO 4FSXA 3TSOA 2O1EA 2QPOA 3OJXA 5F33A 2J9FB 4LY0A 3UHAA 5HQ3B 1W9MA 1ZPDA 3EYAA 3QFCA 1NG9A 1XTTA 2O2EA 2WMOB 4YV7A 1PJ8A