5MGBA

Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nad
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
725
structure length
725
Chain Sequence
PRGSHMAEYLRLPHSLAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFTPGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILPGARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDKPIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKEEEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRGIAISFARVGISVVAVESDPKQLDAAKKIITFTLEKEASRAHQNGQASAKPKLRFSSSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQLVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLAPYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPPGTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREVHHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFYAASVGLPTVLEKLQKYYRQNPDIPQLEPSDYLRRLVAQGSPPLKEWQSLAGPHGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural enzymology comparisons of multifunctional enzyme, type-1 (MFE1): the flexibility of its dehydrogenase part.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Peroxisomal bifunctional enzyme
total genus 265
structure length 725
sequence length 725
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2016-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.50 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 5mgbA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5mgbA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5mgbA01
3LZ6A 4KD6A 4PLZA 1P1JA 1V8BA 3VIVA 2O3QA 4WGGA 1F12A 2O2YA 4Z0HO 3P2YA 3U9LA 1OMOA 2C7GA 1NZYA 5CG2A 5BT9A 3DOCA 4JROA 1H6BA 1MUUA 1OAAA 3DHEA 4UVDA 1JAYA 3WGZA 3O03A 3ORFA 1EY3A 1E1KA 2EW2A 3M6IA 3GVXA 1BDMA 3RSHA 1WAMA 2EP5A 4BGEA 3OP4A 1KVQA 2DBZA 4PCVA 4CQMB 1Y8QB 2VWPA 2HO5A 5I9MA 2A7KA 4WLUA 4CV1A 3IUPA 2I9PA 4B3IA 1CQJA 2NUAA 4W99A 1MFPA 4NK4A 1E0DA 4K29A 5F1PA 2NTJA 1NAIA 4XQ9A 2JL1A 4O6VA 1XR3A 1G0OA 3PJFA 4KUGA 2QQ3A 1PZFA 1UXHA 1XDWA 1PS9A 4RZHA 3S2EA 5I7VA 4MDHA 1MG0A 1H2BA 1JDJA 3GG2A 3S2FA 3R0OA 1AHIA 4HNKA 1RM3A 3VDQA 4WCFC 1ID1A 1K6IA 4BNUA 1H93A 4BO2A 4EMMA 1ENPA 1FDWA 4DIBA 1YWGO 2VTEA 3BMNA 4B7XA 4U19A 4ZDFA 2UUOA 5JYDA 5AXCA 1LDYA 5CTBA 5KDRB 3RRVA 1IYZA 2GNAA 2J5II 1OOEA 1XWFA 2F00A 1Y8QA 2H1SA 2NQ8A 3JV7A 4R9RA 4M54A 4W9NA 2NU9A 4WNIA 4D45A 3RQSA 4ZN6A 5IZCA 2OXIA 4Y6RA 2X86A 1GYPA 4MIEA 4D79A 1KC3A 1XA0A 3G0OA 3IC5A 4KUHA 2O50A 4HWKA 2AEJA 1ZZEA 4YT5A 5JCXA 4JCRA 1A4UA 1BMDA 2OORA 3IP1A 1UDBA 1ZSYA 4XRGA 3MYBA 1E7RA 2ZJ0A 4YAKA 1PWXA 3W8DA 4FFMA 1C1DB 4J4HA 2BZRA 3ZWPA 1R0LA 1EUCA 4E5YA 1YQDA 2HK8A 1E6UA 1U3TA 1KEVA 1IHXA 2Y1OA 4XYBA 3T89A 1VJTA 2ZIZA 1UAYA 1XKQA 2A9FA 3P7MA 2WYWA 4N5MA 3WX0A 1NFRA 1XNYA 3O26A 2G82A 1LSJA 4R3NA 5DBIA 3ZNQA 4CV2A 2P9CA 5H82A 4FDAA 1ZO8A 4TSKA 2ZB8A 3RSIA 4L76A 5TJ9A 1NYTA 2JFFA 3C3XA 4FS3A 2YFHA 3TFQA 2JCVA 4RL6A 3PRJA 5A3VA 4IXTA 4CUZA 1J4AA 3UAGA 4DWVA 5F21A 2XF8A 5G0SA 5L7TA 5G1QA 4NG5A 1KS9A 2YUTA 4I5EA 3B1JA 1RWBA 5JAMA 4JCTA 3NKLA 4IQGA 4TRRA 4NFYA 2PK3A 3GRKA 5HWSA 1JXZA 4GAEA 1I3LA 3H0SA 4DBVO 4NI5A 3PFWO 4DMMA 4PZDA 3ZH2A 4S1VA 1K89A 2QYTA 3DEYX 3C7DB 4N7RA 3D7LA 3JQAB 4A27A 1EF8A 4JYJA 3KSDO 4MI2A 3WIDA 5CDGA 2JFHA 2Q1WA 4Z0TA 2J5IA 3O4RA 1KVRA 4LRTB 2YFQA 1QYWA 2VHVA 4CM9D 1GV0A 3F6YA 3ZGYA 4FOSA 5JDCA 4AJ2A 1PJSA 1TYFA 1N7HA 4L73A 5GZ3A 2RCYA 5BNTA 4PVCA 1L7DA 1YG6A 3VKVA 2VSSF 3KTHA 1SMKA 1YO6A 3ZWBA 3KHUA 4CM4A 3FTNA 3LC1O 5G2OA 5KKAA 3SJ7A 3WGHA 3LT0A 4CQLB 1KVSA 4R01A 1CDOA 3WGYA 2HK9A 1TA4A 3F47A 4GLOA 3K30A 2X1HA 3H3JA 3IS3A 2WWRA 4CLDA 5IFLA 4UUPA 1EE9A 2VZ8A 3IBBA 4J6FA 1E77A 3M1LA 3HE3A 1ZXLA 4L74A 1IZ9A 3GN2A 3E9QA 4M8SA 4YJGA 3HP0A 3GVHA 5AOVA 3TZQA 4BGUA 4LVUA 4IS2A 2W8ZA 5I8WA 3QVSA 4OQYA 3IMFA 4BO5A 2P9EA 2OFPA 2AQ8A 2FR8A 4TRJA 2XAAA 5DU6A 1HE5A 4ELSA 4PLCA 1YB5A 4PLHA 4OSOA 5DF1A 3O8QA 3WLFA 2VUTA 1J7XA 5JO0A 1V3VA 4RF4A 3DZBA 4WKGA 1XSEA 3OIDA 4AJOA 4DPKA 3UICA 4J2OA 3DMTC 1Z75A 3OQ6A 1B15A 2DAPA 4E2XA 1DEHA 2DPHA 2WE7A 2GN4A 2AE1A 4M86A 3WYCA 5I7FA 4J1SA 4U0GH 2HDHA 1D4FA 1LLQA 2C7VA 2R00A 4F47A 3HNPA 1U3WA 4YACA 3JTMA 1NASA 3BMQA 1ZSVA 3WB9A 4BO3A 4ZU2A 3A4VA 4JQCA 1XELA 2JCXA 1N9GB 1ENZA 4BL5A 5EESA 3ZNNA 1CEQA 2CSUA 3PWZA 5KJPA 1GDHA 4C7KA 4CLOB 3P2OA 4BMNA 2Z1MA 3IOYA 3QP9A 3PQFA 2ZQRA 1XQ1A 1HXHA 4FOOA 4WCFB 4KP7A 1U7TA 2W90A 4EUEA 5JMWA 3IDSA 4Q1IA 3R9SA 1PL7A 3C85A 2YDXA 1ISJA 4ZICA 3UW3A 4LK5A 1VL8A 2OBYA 4XX0A 4GSKA 4Q9NA 1I10A 3A06A 2CNBA 1RJNA 3LKEA 1VPDA 1MV8A 2QHXA 1PZEA 2SCUA 2EJ5A 2DVMA 2NADA 5ER6A 3IL2A 2WM3A 4WYOB 3Q3CA 1QLHA 2O7QA 4K26A 3D3WA 2OHXA 4MOWA 4XIJA 4CMIB 1DJQA 4EEZA 3UN1A 1SPXA 3VH4A 3KSZO 4RVFA 5A03A 1NQAO 3JQ6A 3U9RB 3NUGA 3U3XA 4OMUA 2ZTUA 1R4MA 2EP7A 2RBEA 2NU7A 3BIOA 4EMLA 4URFA 5J23A 1U4OA 1BG6A 3I23A 1KIFA 4BO8A 1BW9A 4GX2A 3UVEA 2PZJA 5IXSA 2ZL4A 3KEOA 1KEWA 1ZBQA 1WWKA 5K9ZA 3BTVA 1UZMA 2WD7A 3KSUA 2QW8A 1DPGA 4PRKA 5JLAA 4YLHA 2ZYAA 1HDOA 2W3PA 5U4QA 2AG8A 1X15A 1K5HA 2Y1GA 4ZRMA 4EUHA 5A3JA 1A71A 1O8UA 3HADA 3QYRA 3L77A 1TXGA 4E5PA 4J49A 1TEHA 4O1MA 4MVJM 3ZV3A 1NVGA 4W6ZA 5CTCA 2WD8A 2RIRA 4ROSA 3E5MA 4CPDA 5C7IO 3N7UA 4XQGA 2PTGA 4MKXA 4TKLA 4BUCA 4MVJG 4DQXA 3QWAA 1ADFA 4MP8A 3X2EA 3B70A 1GZ4A 3NT4A 1O5IA 3G49A 3N74A 5AQ1A 2Q45A 3TZKA 4PZCA 2WTBA 3W1VA 3OIGA 1VL0A 3K31A 1NFQA 1E3WA 1YQXA 1H9BA 2GPTA 3P19A 1E3EA 4BNXA 3R1IA 3PPIA 3GPDG 4DTIA 5E0SA 3T88A 1XU7A 2DUUA 3GMAA 3D64A 4MPDA 1I3NA 1D3AA 4IJVA 2F9IA 4PG5A 3IKTA 3F1LA 3M6NA 5ENDA 4ZJUA 1YOVA 4DC0A 1SBYA 1HE4A 4YXFA 3KOUA 2I65A 1DOHA 1RM4A 1NZYB 1K6XA 1P1RA 4IQ8A 4P4GA 3FNFA 3P5SA 2DFDA 4OLQA 1PJQA 3H8VA 3OJFA 3AM5A 3O9ZA 3VKUA 3JQBA 5CPFA 3QXIA 3WFJA 3BEZA 1Q2XA 2NWQA 1ZMTA 4OKIA 1RPNA 3FBGA 4DIOA 5DBFA 5KJ1A 4PN3A 4E2WA 3DBLA 1NWHA 4GPD1 3WS7A 2OGUA 3RC7A 3GZ4A 5JE8A 5THKA 3C1OA 5B4VA 2R2GA 3S55A 1CWUA 4HFNA 1B8PA 1DRVA 1IB6A 1UZLA 2RHRA 3LYLA 1DC4A 4BMSA 1GPDG 2BF7A 4HXYA 1T4DA 2EIHA 4R1UA 1C1DA 1W6UA 2FR0A 2AHRA 4WLEA 3Q7HA 4HNGA 5TNXA 4YJDA 2BMAA 2NTVA 2P2SA 4YT2A 8LDHA 3DHNA 4YEDA 3ETEA 3GC6A 4LMRA 2GLXA 4E32A 5THQA 1F8GA 4OOEA 2PKQP 2E48A 4PG8A 5JBXA 1C0PA 4N5LA 3NTQA 3W8FA 5KDRA 4IUYA 4FIZA 1LDEA 5JAQA 4BNIA 4OJNA 1FDTA 3VZRA 5CAEA 1OBFO 3ZZNA 2D3TA 1Y7TA 4F6LA 3BF0A 3QVOA 1I36A 4RDHA 2DTDA 2VX2A 1P31A 2EV9A 4J91A 4CM9A 3WGOA 5I9LA 4IM7A 1LU9A 4HFJA 3DXFA 4PZEA 1IOLA 4CM8B 1NHGA 1MFZA 4EGFA 1LQTA 2PH5A 5CP8A 2UAGA 2X0IA 4CODB 4EDFA 1DCIA 5A9SA 4MVJI 2E49A 4RVHA 3FHLA 1QP8A 3LT4A 2ZL3A 2EHDA 1WXDA 3AFMA 3NJ8A 4MVJE 1V3TA 2D5CA 3PGJA 3DBRA 2X5KO 3L4SO 4RORA 2DQ4A 1EEHA 1ZJZA 2PZLA 5DDIP 4BNFA 2Y05A 4JNKA 4E33A 5E0SH 3QHAA 4N18A 3AOGA 4YWJA 3L9XA 4CMHA 5G0WA 1N6EA 3TWOA 3CXRA 1PGQA 2EKQA 3GNSA 3M2TA 4IY1A 3ASUA 5F1KA 2WYVA 3JQEA 4M49A 3RI3A 5GZ1A 3CMCO 2VREA 3S1LA 4MO2A 1NPTO 4Q3EA 1HLDA 3LC7O 1BXGB 1YB1A 3HN7A 4YBZA 1PJ4A 4HKTA 5TT0A 3PIIA 5EJ2A 2Q1SA 4FFLA 4IDFA 4YJHB 4IJKA 1X0XA 2HW5A 4FB5A 4QTZA 5B1YA 1WW8A 4ZRNA 4FD3A 3RVDA 3DBHB 4AICA 4HY3A 2BFPA 3ANNA 1XQ6A 4JBIA 1TT5A 2NV6A 4CMJA 5C9GA 1C0LA 2J5RA 2Q99A 3V1UA 3FCOA 4XRRA 4R41A 4J7CA 1M6WA 1I32A 1P77A 1G6KA 2UV8A 3GF7A 1LRLA 3BXXA 1SC6A 5HA5A 1EK6A 1DRWA 3ENKA 4OMRA 4AJHA 2QZZA 1BXGA 4LK3A 4ND2A 4PLPA 2FHSA 5AXDA 1PS8A 1WZIA 3OC7A 1Z7BA 3K6JA 3I6QA 4WPGA 1EFLA 1Y5RA 1B8VA 4XGIA 5EQDA 5A9TA 4KWIA 2BGLA 3IJRA 4XYGA 2V6BA 5MDHA 3GHYA 5DU8A 1QMGA 2IZ1A 2ZTVA 4ILKA 3MWEB 4L4SA 1KVTA 4AJEA 2YYYA 2QRKA 1BTOA 3CZRA 3PK0A 4NZ9A 4GGPA 3TL3A 5TLSA 1M6HA 5JBWA 3RROA 5B37A 1EDOA 2VNAA 1RJMA 4OO3A 1LNQA 4A7PA 2AA3A 1TT5B 4BQPA 1VC2A 2HLPA 3H9UA 4UULA 4BHTA 4W7IA 4TVBA 2VSUF 7MDHA 1R0KA 4HUJA 3V2UA 1DBVO 3JQFA 1T1RA 4FNDA 1QORA 4JP3A 3ZWOA 1ULUA 2R00C 4MKRA 5I8ZA 2PNFA 4UVIA 2JD2A 4FFRA 4RGBA 4ALLA 2CVOA 4HFRA 2IXBA 2ZQZA 4FFNA 3VTFA 1X7HA 1V9LA 1HEUA 3HQ4O 4IZCA 1JVBA 3DQPA 1CRWG 4R1TA 3VH3A 1CF2O 4BNYA 4P38A 3NEPX 3U4HA 4GWGA 3D5TA 3BHIA 2FW2A 1PL8A 3WTCA 3I9NA 4IDBA 1N6FA 1ULSA 3OQ1A 3NT2A 2NACA 5E0NX 3JQ8A 5LCXA 2RHCA 4FJ0A 3L9WA 3VPXA 3FN4A 4CMCA 3AY6A 3Q1LA 2AEFA 3ZWVA 4MOUA 2EXXA 2F6IA 1MP0A 1I01A 4R51A 4D42A 1IHYA 1JA9A 3GEMA 4XQEA 2J5QA 1JKJA 3KYDB 5A05A 1YH3A 3OSUA 4BVAA 2FWMX 1KERA 1NBOA 2A92A 1FC7A 4YRAA 5CDYA 2EW8A 2BI7A 3ISAA 2X0NA 3UCFA 2ZB4A 2I99A 3PDJA 1LDMA 4PG4A 4JXKA 1YBVA 1YJQA 4OIMA 4ID9A 4ALMA 4FB8A 3FF4A 4J4BA 2ZJ1A 2Q2VA 2UZFA 4NNQA 3PWSA 3UOGA 4J1NA 1UIYA 2POQX 1XCBA 4U0HA 3ON5A 2VUSA 1HTBA 4JBGA 3FPCA 2P9GA 2GGSA 2YZ7A 4QIIA 4UVGA 4CM4B 4DA9A 4GVXA 3EZLA 4C7JA 5BSEA 4BIIA 3KLPX 2J5GA 1TLTA 3LAOA 4E12A 1R15A 2VYNA 3DOOA 1VSVA 1UZNA 4XZ3A 3VZQA 3E6AA 3UF0A 5BSGA 1ZNQO 4NBWA 4I52A 4JSBA 4IZIA 3KEQA 1PZHA 3F3SA 2I66A 3P2LA 4R5HA 2Q2WA 3GLMA 1E1LA 3ZV6A 1BVRA 5KVQA 2OP0A 3UUWA 5U9CA 3A14A 2NLOA 4L75A 4ND5A 2J6IA 1JTVA 4O63O 2YJZA 3A28A 3GDFA 2E82A 5ITVA 3ZI0A 2X0JA 3BMCA 3W6UA 1Y1PA 3ONDA 4M1QA 4U0JA 1ZK3A 1U9JA 4CMEC 5L4NA 2Z1NA 4OYRA 3IIEA 3I83A 5TT1A 1U1IA 4OQZA 3ZCXA 5A4DA 1SG4A 1DRUA 1Y81A 5KVSA 1T2FA 1A7KA 3HLN1 2Q4BA 2CVZA 4FBGA 2DFVA 3U09A 1B14A 4EEXA 1G1AA 5A02A 1GUZA 3I9KA 3L6EA 2DU8A 3ENNA 4ALKA 4NBUA 2VYVA 2GN6A 4FZWA 1ORRA 3FWNA 4I5FA 3W4KA 2DEOA 4Z9YA 4XDYA 3KTGA 3PP8A 1BVUA 1WDKA 1MG5A 1U8XX 4I5DA 1DFGA 3HHPA 4YT4A 1FF9A 5F5NA 4QFCA 1NWCA 3AY3A 3TF5A 2C2XA 2V6FA 3OJLA 3HSKA 3ZU5A 4HC8A 2RH4A 1GUYA 3PTZA 4B8WA 5KJFA 1PGJA 3C1AA 3DFUA 4L8VA 1HYEA 3ANLA 3FDUA 3OMEA 4B8ZA 5IDQA 4J9UE 2PGJA 2VSUA 3GZNB 4Y6SA 4JJIA 2GSDA 1MC4A 4Y6PA 3JCZA 4DMLA 1MC5A 1P44A 3H2SA 2BGKA 2YV3A 4Q3BA 3E5RA 3PFFA 4K6CA 1P0CA 2C8TA 3WTBA 4CM7A 4J43A 3ST7A 2X6TA 4ZQHA 5L4SA 4DYVA 4LCEA 4CLRA 1LLUA 3K9QO 2Q2XA 5AXBA 4S3MA 3AM4A 1GQ2A 1CYDA 2G17A 3GH3A 3KUXA 5CPBA 1YQGA 2X5JO 4FW8A 1E3JA 3KTJA 4RPHA 2FSSA 1PGOA 2YHIA 5COQA 4E13A 5DULA 5G4LA 1Y9EA 5TGDA 2NVUA 1LSUA 1Y8RA 2FP4A 4PLGA 4AJIA 4QEDA 2YDYA 3RUIA 3ONEA 2JD1A 5DL1A 1H5QA 1P1FA 5HS6A 2B0JA 3STHA 1DC6A 1WLYA 1T4BA 3HG7A 1H94A 1ONOA 1Y5MA 3SLKA 4BNMA 4JGBA 2FR1A 1Q52A 4IZDA 3NDRA 3ZNPA 4ND1A 1I2BA 1PWZA 3PHIA 3RCBA 1WZ8A 2Y93A 5EN4A 3ZHYA 4CL3A 1I3KA 3NGLA 2B5VA 2F1KA 2W2KA 1FC9A 2LDXA 3DAPA 1YDEA 2X0RA 4RF5A 1V0JA 3OJEA 1KEUA 3VZPA 1HDYA 4FZWC 3QVXA 3JSAA 4DL9A 4RLHA 4UAGA 3FSRA 4YYZA 1PEDA 3LT2A 3JYPA 3C7AA 3MJVA 3OIFA 1HZDA 1LDGA 4PLVA 3JQGA 3OF2A 3V5IA 2ZYDA 1Y6JA 3QRWA 4ALNA 2CVQA 3LF1A 2D8AA 2ZCVA 3G3EA 3ZU4A 1FDUA 3CUKA 5A1TA 4DGSA 4RVSA 4PRLA 3WGQA 4DLBA 1X1EA 3R0IA 3FBTA 4HP8A 2HMWA 4B4OA 3ITDA 4R54A 5DNAA 3ULKA 4D43A 2P68A 4DI1A 4DPLA 1I5RA 1KY5A 1GCOA 4NJOA 4U7WA 5EPOA 5FUSA 3DFZA 1GYRA 4FN8A 4GMGA 2EERA 2IEDA 3MOIA 5KNLA 2NU8A 4U0KA 3TPCA 4WJZA 1IE3A 2JD0A 2VHZA 1C3VA 4JVTA 4UUNA 1PU2A 4GL4A 4MP6A 2QG4A 5L40A 2F9YB 4YJGB 5HBRA 4IJUA 3U4DA 3GEDA 1QXSA 3W4IA 4H3VA 2OOSA 2JAHA 3VZSA 2WEKA 4P8RA 2ZK7A 3ROPA 4IINA 2HKIA 3H5RA 1YBMA 3QWHA 2VWHA 4QIJA 3V1YA 4UEJA 3GVCA 4BQRA 4NMHA 4II3A 1QG6A 4ZGWA 2CD9A 2PGDA 5IDXA 1NR1A 4XYLA 4W7HA 2VZ0A 4U6SA 1W2XA 2C82A 1JWAB 4GGOA 1O95A 3OA0A 2Y1DA 1PR3A 3GAZA 1EZ4A 3PYXA 5DN9A 5G0UA 4DXHA 1QV6A 3PHLA 3GAFA 1T2DA 4PGFA 4UREA 2GZ3A 3SEFA 3WG9A 1HZJA 4I9UA 4OKNA 2FBMA 3DZHA 1YOVB 4OXYA 1R4NA 2VHWA 3LQFA 2EJVA 1DXYA 3SLGA 2AW5A 3Q0EA 4BO9A 4DLLA 2G0TA 4CMEA 3ROKA 5KJCA 3CTMA 2GASA 2D4AA 1GTMA 1UXKA 1YDWA 1BRMA 4ND4A 4BO0A 1GY8A 1HYHA 2B83A 2HJRA 3CH6A 3WMXA 1SAYA 3GQVA 4Z6KA 4BKQA 1EK5A 1R16A 7ADHA 3GF3A 1XIVA 3GEGA 3E03A 2FY8A 1VJ1A 3OFSA 1DHRA 5G0VA 4JWVA 1VSUA 2BLLA 1HDRA 3TDKA 3A1NA 5EQFA 3S8MA 1EF9A 5EERA 3WWYA 3RJ5A 4AJPA 4U1AA 1E3LA 1IL0A 2PGLA 3SVTA 3R9TA 1XG5A 4U5QA 2UDPA 3I5MA 3RC1A 3ANMA 2H9IA 3RAJA 4D0RA 2VWGA 4NFHA 1KETA 2HCTA 3GF4A 1TG6A 3KYBA 1FJHA 2EF1A 4EITA 2PBPA 4G2NA 1RM0A 1UDAA 5T64A 4I08A 1DO8A 3VOSA 5KJEA 4B4WA 4RPJA 4EZBA 5IZCC 1GADO 3ZW9A 4HV4A 5DP2A 3WBBA 1HNUA 3ZWYA 3HFGA 3TZHA 4ELXA 3OQBA 2GCGA 1ZEMA 1HL3A 3NTRA 3SC6A 2HJSA 5HTOA 3QJ5A 4CQLA 3F46A 3H0QA 3D3WB 3WBFA 5ICSA 2IEBA 5C3MA 1NX6A 5ES3A 1ONPA 2R6JA 3V5EA 4CJXA 1J6UA 4CL8A 4L6WA 2VWQA 1WP4A 3G1TA 5JNLA 1LRKA 1V6AA 4BB5A 1T2EA 5TIIA 2AQKA 4DBZA 3AI3A 3E18A 5C90A 3LC2O 4I1IA 1KC1A 4IJWA 1UYTA 2OBNA 4R9SA 2J3KA 3MJ4A 5I7EA 1K2WA 2VT2A 3GY0A 1DDOA 3LF2A 3RSTA 4E31A 3NYWA 4XR4A 3DO5A 4TWRA 4ZDDA 1ZMOA 2VTDA 3ZV5A 2GZ1A 4QO8A 4ALIA 1PQUA 3GGGA 4E6PA 4YAJA 1XO6A 2FN7A 4IS3A 1ADBA 4GX1A 4RVGA 3WYBA 5JC1A 2ZTLA 3TFOA 4BV9A 4RV9A 4CM3A 1V3UA 1A5ZA 3BAZA 3KQFA 3GMSA 5L4LA 3G1UA 4CM5A 3QW2A 3VPHA 1ISIA 4R69A 1I30A 4D44A 2O3SA 4MIOA 1XX4A 2OP1A 1F14A 1ZK0A 4FJ2A 4II2A 3BYZA 1M76A 1AXGA 3PQDA 4J0FA 2F9IB 5H83A 4AVYA 4NU6A 4PLWA 2O48X 2DUWA 2D1YA 4K6FA 4R4JA 4BNKA 2E37A 4IBOA 1I24A 3CIFA 3ZWNA 3GOHA 2C5EA 2IDZA 3I1JA 4XB2A 2NVWA 5DZKA 2AEMA 2J8ZA 1A9YA 1VE9A 2A7SA 1PQPA 5T57A 1Y9AA 4YR9A 2ZQYA 1PTJA 4QXMA 2GERA 3GHHA 4L8KA 3ZW8A 1IPEA 3GDOA 3MTGA 3T7CA 4AJJA 5K6AC 3LVFO 4K1LA 1R4NB 2V6MA 4LN1A 1OD2A 1GPJA 3SJUA 1LSSA 3OETA 4OGWA 1FMCA 3QKAA 1ZCJA 4JCOA 4CMGA 2DT5A 2Y0CA 4KMSA 4FN7A 5IKLB 4IDAA 4WCZA 1NPYA 1M75A 3U9TB 1ENOA 4HBGA 1NP3A 1K6JA 1H9AA 5BQFA 3AU8A 4F3YA 2GRAA 3GGOA 1EVZA 3FNHA 1A4IA 5A9RA 4I4ZA 1I0ZA 1S6YA 3KBOA 4Q3AA 4UVHA 1FDSA 1DHTA 4CLRB 2F6QA 4OSPA 1U3UA 4BO1A 3UCXA 2Y68A 4R1NA 2YQ5A 4MINA 5FYDA 3PGQA 5EINA 4J7XA 4IDCA 2B69A 5JS6A 2Q3EA 3TNLA 5JAIA 4Q3NA 2XXJA 4FR5A 4O59O 3H9QA 5ILGA 1NR7A 1P9LA 3ETGA 4H7PA 3VVBA 1XLTA 1W4ZA 4E3ZA 3VPGA 3K50A 3L4BA 3B6ZA 2HMTA 5IJZA 1GV1A 5TS3A 2BFOA 1VM6A 4JJFA 1DIAA 3GNQA 3LLVA 4XGKA 4DREA 1C14A 1UP6A 3DBRB 2VZ9A 4WE3A 3FNEA 3JQ7A 2FZSA 1BGVA 4AJKA 3ZU2A 2O3TA 2CF5A 1HDZA 3FWZA 4H15A 4YB8A 4FC7A 4OL9A 4KNPA 2E4AA 5KIAA 1W73A 1XGKA 1Q7CA 4Z3DA 3VVCA 1B3RA 3UCEA 2DTEA 3QWFA 4E4YA 5T6BA 1ZXBA 1ZW1A 5T8KC 1XU9A 1CETA 3WDSA 4AJ4A 3NGXA 3AOEC 1DUBA 1PX0A 4QX6A 3T3WA 1DIRA 1GCUA 2BH9A 2HMVA 2Y1EA 3Q11A 2DLDA 3JU1A 2PR2A 3JQGB 1WMBA 2PH3A 1WDLA 2UUPA 3E8XA 1HZZA 4KTVE 4YAIA 1VKOA 1GFSA 1W8DA 1EBUA 2WDZA 5MGBA 3OM9A 4MIYA 4NNJA 3WJAA 4EYEA 3DR3A 3IP3A 4RYFH 2DBRA 2CF6A 1B26A 3DZKA 3V2HA 3ZWCA 2UVDA 1LLDA 4RLSA 3WXBA 3U9SB 2EWMA 3VDRA 1KVUA 2A35A 4E5KA 3B1KA 1AUPA 3JQCA 1LI4A 9LDTA 3ADOA 3H65A 2C20A 4LGVA 4BNZA 2BI8A 2B4TO 1EVYA 3G79A 3JD2A 3X2FA 4FFOA 1QYXA 3K5PA 1HDXA 3PJDA 3T4XA 1BXZA 1DAPA 1PR9A 3AI1A 2C59A 3WFIA 3ZV4A 1HETA 4OM8A 1M2WA 1ON3A 3TOXA 2VOEA 5FWNA 4N54A 4BKOA 1QLJA 3KXDA 5ILOA 4KPKA 4PLFA 3KRTA 1X0VA 1KY4A 1C1XB 4KUEA 4RPGA 5DCYA 4QT0A 4TVOA 3GZNA 1CJCA 2NSDA 3RFXA 3VHRA 1Q51A 1YE3A 1ZK2A 3E9MA 3DMTA 3EYWA 4GLLA 3OHSX 4YJFA 3DJAA 1UP7A 3HWRA 1K39A 4IGEA 3JQAD 1UXGA 3D4NA 3KM0A 6LDHA 5ITWA 3GRPA 3KTKA 1ZIDA 2HRZA 3OJ0A 4DUPA 4OH1A 3UHAA 4AG3A 3M6MA 4CQMD 5DUCA 1O9BA 2YV1A 2ZB7A 3WNQA 2B37A 1GR0A 3G17A 2FPPA 2GR9A 4A03A 1HE2A 2P5YA 4UUMA 3W8EA 3O38A 4XD2A 3ROMA 4UUOA 1FC6A 1X7DA 1DC3A 2GO1A 2IZZA 3H6KA 1EE2A 3RASA 4ONEA 2WE8A 4P4NA 4CM1A 1HLPA 4NHEA 5I9NA 4NPCA 2GN9A 4YT8A 3ST9A 5L45A 2YV2A 3INTA 3VPFA 1FCFA 3EVTA 5TX7A 4CLHA 4D0SA 3MT6A 3GUYA 1PGPA 2J5GD 2C29D 1A9ZA 3JD3A 3M1AA 4FN4A 2B36A 3ZWMA 3T4EA 2VYND 3JQ8B 3QXZA 5COBA 2B4QA 1GL3A 1VI2A 5CFZA 1ON9A 5INFA 3C8MA 2CMDA 2HRBA 3PWKA 4J3FA 3V1TC 1D8AA 3K96A 1T2AA 4OOFA 3AU9A 1IULA 4YRBA 4NJMB 3KB6A 3WR5A 3PVZA 3WSVA 4L4RA 1N8KA 4CMBA 1ISHA 3HJAA 3PYLA 2VOJA 1F0YA 1M67A 5B4TA 1WVGA 3IAHA 5JBIA 3CKYA 1DIBA 1T25A 1Z74A 1E7YA 4QSMA 4JCSA 1YRLA 3F4LA 4W82A 2J5IB 5DUFA 1DFHA 3NDIA 2H63A 4XYMA 1YB4A 1ZEJA 2O3JA 3SC4A 1OI7A 3BTSA 3L6DA 3HFSA 5F3RA 3ICCA 3I9JA 2ZL2A 3KZVA 4CUJA 5DP1A 4FNBA 4J7UA 3WWZA 2IYOA 3DAFA 4D7AA 4RDIA 4Z9FA 4Y8VA 2QQ5A 1E3SA 4AJLA 4WLNA 4PLYA 2VYVD 5JCJD 5IG2A 3QVTA 4GI2A 3EW7A 4J1TA 1ZH8A 1X14A 1GYQA 2VRCA 3FF6A 3MOGA 2LDBA 4ZQGA 3GGPA 4P4LA 5JC8A 3GVPA 2I67A 2J5SA 2Y1CA 1ISMA 2Y99A 3EY4A 5KVVA 4RVDA 1NAHA 4PFJA 1MX3A 4G2RA 2JHGA 2P5UA 1Q0QA 1YJ8A 1UH5A 1O89A 3LU1A 2QX7A 2HK7A 3DBLB 4WEOA 2GTRA 2FSVA 3NV9A 3I47A 2PLAA 3WLEA 5DCWA 2G5CA 4Q3CA 1R12A 1LJ8A 2EGGA 4OXKA 4ZDEA 3AI2A 1XHLA 3H02A 1E3WB 1QYCA 1Z6ZA 3LLSA 5INIA 3OICA 4XA8A 3H81A 4GM2A 4RF2A 3WOHA 5KVCA 3WQSB 3ZN2A 1NPDA 4ALJA 1BXKA 5CDSA 4FCCA 1B0AA 1N92A 1AE1A 2XXBA 1E7MA 1T1SA 2E6UX 2C2YA 4NH4A 2G76A 3Q2KA 3RBXA 4BB6A 2VSSE 3QMJA 1AHHA 4JBHA 5JO9A 2O3UA 1Z73A 2TMGA 3QY9A 4A10A 2TMDA 4EUFA 1L7EA 1PL6A 1A7AA 3DONA 4GSLA 3AM3A 5L7YA 3UXYA 3H0UA 4RYFA 5G1RA 1HYGA 3W6ZA 4PVDA 3GFGA 4U0GA 3ZNOA 1Q7BA 3TV5A 1J5PA 1JWBB 4TQGA 4CV3A 5LDHA 4WZ8B 1E5QA 5DTWA 1EQ2A 1Y7OA 4IQ0A 4EJ0A 1UXIA 5JY1A 5DKPA 1KBZA 5TJHA 1MJ3A 4ZDCA 4XJTA 2AQHA 3AUTA 4D46A 4Q39A 4TMFA 2X4GA 4OAQA 5HM8A 2OUIA 4J9VA 3IJPA 4G5HA 4E2ZA 2CFCA 5HRUA 3EZYA 3M2PA 1UXJA 4U6QA 3SXPA 3PLRA 2VUUA 2PWZA 3DC2A 3STAA 4ELWA 3JD4A 4LCJA 2Y67A 5KTKA 1HF3A 1P1KA 2EGHA 4WEQA 3DTTA 1L1FA 4NU5A 1UYRA 3QWBA 4CR6A 4BKUA 1EVJA 2PKQO 1RJWA 1IUKA 5T67A 3DAGA 3PZBA 1SOWA 3F5SA 3I52A 2EKLA 3KTIA 4O0LA 5JW6A 1D1SA 5IDWA 3PEAA 5AXAA 3RIHA 3GKBA 4HX5A 1NVMB 4XB1A 4F45A 3BA1A 4E21A 1MB4A 1Z82A 5KOIA 1EUDA 2DBQA 4JP2A 3AJRA 1WDMA 1UJMA 3KYCB 3QWDA 3L3SA 5DBGA 1PIXA 5L9AA 4DQVA 3BTUA 2DC1A 1NQTA 4YPOA 4HADA 3Q0JA 3H9EO 1EUZA 3EVNA 1E3IA 4EJ6A 1BDBA 3NJDA 3H3FA 2C07A 1SOVA 3OMLA 2G1UA 3Q2IA 5FEUA 1UYVA 1X1TA 5CG1A 3U62A 5KWEA 3WGGA 4HNHA 1CQIA 3K92A 1V35A 5A06A 4GHNA 1UDCA 3VH1A 1YKFA 2W98A 3FRJA 5L51A 4R3WA 1KEPA 4FPXA 3P5MA 3R6DA 4YA6A 2PD6A 4E2YA 3COSA 4YAGA 3CSDA 3WMWA 5JAZA 4H16A 4Y98A 4KDEA 3WIEA 3LK7A 5TRTA 4AJ1A 2WJPA 2HMSA 4YJHA 1ZK1A 3DORA 3C24A 2GYYA 1NFFA 4XDZA 4R16A 4XKJA 5C37A 5L3ZA 3JYQA 3PHGA 5F1OA 4BO4A 4J90A 5JDIA 1DAOA 3JD1A 5DT9A 1MXFA 3JQ9A 3TSCA 1E5LA 3EMKA 3VAZA 1LQUA 3H9JA 5TQVA 4G81A 1N1GA 2EG9A 1O94A 1GQQA 3TVUA 1PJ2A 1ONNA 1OFGA 3EAGA 5TF4A 2BD0A 4EI2A 1R66A 3D1LA 4X54A 4YQZA 4BNVA 5BR7A 2X58A 2YW9A 3VC7A 3B20A 4MVJA 4CQMA 4CLXA 2FPIA 8ADHA 4ZDBA 4LVCA 1N1EA 2X22A 3S2IA 4GBJA 4LISA 3QVWA 4DIFA 1VLLA 4IMPA 1R37A 1GZ3A 3RUFA 2WD7B 2ZKLA 5G4KA 5HS4A 1F06A 1TB4A 1YBAA 4A2CA 1ADCA 4MVJH 3SLLA 2OL4A 3T8AA 4YRDA 2W2LA 3HE2A 3IAVA 4LSWA 4M89A 1AXEA 4XEHA 3PZKA 1AGNA 3OT6A 4CMKA 2NVBA 1DJNA 5DCUA 3HB4X 4Z9XA 1HSZA 3GT0A 4L4XA 3BMNB 5COAA 1J0XO 2CDCA 3AFNA 3H5NA 2OMEA 1SZJG 4F46A 3HINA 3L4BC 1U5CA 3KV3O 4RCNA 2XOXA 5EMHA 2IZ0A 1P74A 1R6DA 3Q0GA 1U2GA 3WGIA 4K3WA 4J0EA 4RPKA 5JXWA 3AWDA 2P4HX 3RBZA 5BSFA 5IN5A 5KJ6A 1YGYA 1FDVA 4IIVA 4WCFA 4RVUA 3TQHA 4EBFA 2Y66A 1I8TA 3I9LA 4YAEA 3JQBC 4K28A 1ENYA 1SB8A 4KQXA 1QRRA 3OBBA 2O3RA 1X0UA 4JJTA 4J1QA 1UR5A 4YJFB 1OC2A 2VCYA 3D4OA 3F4BA 1EDZA 2D2IA 5GZ6A 3DDNA 1U8FO 3DHYA 3ICPA 1U28A 1C0KA 2GD1O 4OHUA 4UVEA 2GDZA 3GDGA 3AUUA 4BGVA 1H2HA 3PJGA 1WNTA 1RYDA 4P22A 4WLVA 4EMPA 1B16A 1E1NA 1U3VA 4NDNE 1H6CA 3T7EA 2W2KB 4Y9DA 2DM6A 4FC6A 3UH1A 3CMMA 1NNUA 1B2LA 1C0IA 3DZJA 4Z0PA 3RU7A 4MVJF 1SZOA 3WNVA 1ZVMA 4JOTA 3RKUA 3KYCA 3UKOA 2VSSA 4NJMA 4DC1A 1RM5A 4WUVA 1K32A 1O0SA 3SBOA 5IAAA 3Q9NA 3JYOA 4U18A 2CZCA 5BNFA 1ISFA 5G1SA 4QECA 2HU2A 3L0DA 3OEYA 3WYEA 5JSFA 2GN8A 2Q49A 1PJLA 4OG1A 2I3AA 4BNLA 1LX6A 3A9WA 3EC7A 1PJHA 5GY7A 5JDCC 3LDHA 3QIVA 1GU7A 1LEHA 4R1SA 3R3JA 2C54A 4BMVA 1Z45A 4BNWA 4LSMA 4XJSA 4JN6B 3BZUA 4RCVA 3ROQA 1ZUD1 3TRIA 3Q6IA 3INGA 2VNSA 2DBVO 4AFNA 4IDDA 4DLAA 1GEGA 3RC9A 1D7OA 2BFAA 2VRBA 1LBEA 5CHEA 1E7QA 1ZJYA 4IZHA 4INAA 1N6DA 4WOKA 5FFFA 3GUCA 4NK5A 4RQTA 1HDGO 4JIGA 5DOVA 2X9NA 3KETA 5U1PA 4E0BA 1LA2A 1ZK4A 3RU9A 2O23A 1H6DA 4JCQA 3DBHA 3F5QA 3ZHZA 1PGNA 2J3IA 1LSOA 3B1FA 3FI9A 3ONFA 4ZD6A 3AY7A 1ZSNA 1VRWA 1IPFA 2Z95A 4IDGA 3GR6A 4G65A 2V6GA 3RUCA 3S2GA 1E6EA 3IQDB 1SCUA 1P0FA 4MXIA 4IDEA 1B7GO 1P45A 3CEAA 2RAFA 3E9NA 1NM5A 1Q7GA 4JK3A 2DTXA 3TT6A 4LRSB 4D41A 1JKIA 1X13A 4NEKA 2AE2A 3C7CB 2EEZA 3DZFA 3GLQA 4KTTE 3SWXA 2P91A 3QWIA 3U0BA 4PLTA 2YQ4A 4LW8A 4NQZA 3DBVO 1LXCA 3HDQA 3OJOA 5K0ZA 1OD4A 1YL6A 1HKUA 4DRYA 3PE8A 2NP9A 5B4UA 4WNCA 4QQRA 3NX4A 5JPIA 5C7LO 4WK6A 3AK4A 2ZYGA 4CM6A 1G0NA 4RJTA 3IB9A 4HFMA 4FQ8A 5G4KB 2IYPA 4E30A 2QRJA 3WQRA 2IEXA 1P3DA 1JN0A 2NU6A 3PYMA 1PJCA 4UEOA 2YHUA 3OECA 4GMFA 2PFGA 1LRJA 3GN1A 4B4UA 1HDCA 4IZBA 4XQCA 2Z5LA 1F8FA 2X23A 2NTNA 2ZATA 2C0CA 3N6RB 3O8QB 3WJ7A 4DPMA 1A72A 2DUBA 3TVWA 4ASIA 1JAXA 1AN9A 1GAEO 1DLJA 3NJ4A 4BO7A 5CEEA 5JMPA 3NT5A 2DKNA 3H2ZA 2FMUA 3ASVA 2WSBA 2O4CA 1HNOA 2EKPA 3I9MA 1WPQA 2QRLA 1RYEA 2B5WA 4IXWA 1E1MA 2P4QA 3VTZA 2DPGA 3PZRA 4JFCA 2O2SA 3F9IA 2AMFA 3MJEA 1QKIA 3TJRA 2JAPA 3RFTA 2D59A 2Q1UA 1WZEA 3F1KA 5DTPA 3MCVA 1BWSA 3HZZA 1N7GA 3IUSA 1SB9A 2UYYA 2ZTMA 3ZWXA 4A73A 2PPYA 2QYSA 3JYLA 3BMQB 1JQBA 1JVSA 4FSHA 3K8XA 2VQ3A 2FZEA 3RD5A 1TT7A 1JLLA 2ILTA 1K0UA 3HDJA 4WOJA 5L95A 2BRUA 2PKRA 3ZHBA 2VSUE 1MGOA 1NVTA 3QE3A 3MJTA 1IZ0A 4BNJA 2PD3A 3PXXA 5DZKH 5CEJA 3EHEA 4Q3DA 1VKNA 3CZMA 4MJLA 4ITUA 4OXNA 1VRGA 3KTDA 3PI7A 2BFMA 2O7SA 3DZGA 4NBRA 2V65A 4DVJA 2CE3A 4GX5A 5C5IA 1DIHA 2X7HA 3PGXA 1ZFNA 2NVUB 4A26A 3C1TA 3E82A 2D0IA 2OZPA 1PZGA 4TROA 4KWHA 1YL5A 3LSYA 1X7GA 2AG5A 3K2EA 3BTOA 1DFIA 3JQDA 5FI3A 1D1TA 3DL2A 3ZWAA 1U7HA 1H0KA 2J3JA 4BNTA 2IRWA 3JQ7B 1QV7A 2ZQQA 1ML3A 4KQWA 4JLWA 4PIVA 1P1HA 3U4CA 1BSVA 3V8BA 4WLFA 2YY7A 5I7SA 4PG6A 1JU9A 3MTJA 4M55A 3PQEA 4Z3KA 4ZHSA 3D4PA 1BW9B 3KLMX 2PV7A 5KCZA 5CDTA 3RFVA 1MXHA 3CPSA 4BO6A 5IN4A 4PG7A 2I3GA 1SO8A 4W4TA 3EUWA 1YXMA 4I5GA 5DOZA 3QLJA 4RO0A 2Q46A 2X9VA 1OZAA 2W2LD 4YCAA 4YDRA 3I4CA 1KOLA 4NFSA 9LDBA 4QFEA 1MA0A 3FTPA 3U4IA 2GUGA 3MJSA 5DU4A 3ZDFA 4BKRA 2B35A 3HRXA 3JQAA 3G64A 2Q50A 1N2SA 4WASA 2X9GA 3TOZA 3UFXA 4BKPA 4FFPA 2ET6A 5JFOA 1UUFA 1SEPA 3VPSA 5FIFA 2PZKA 1E92A 3E1KA 2NNLD 1JKFA 5A5FA 4J16A 1DB3A 2W4QA 1UP4A 3D0OA 4XIYA 4L9RA 1BHSA 3BMOA 2GZ2A 2JHFA 3R9QA 1O8CA 5L53A 1LDNA 1GUFA 2CDAA 3HUDA 4R68A 2AXQA 5INGA 1LC3A 3D3EA 1C1XA 1HRDA 3I3OA 3RJ9A 1YONA 4D3DA 5ICMA 4NBTA 2CBYA 4A0SA 4MVJP 3BHJA 1TVEA 1ARZA 1GEEA 1Q1NA 4QO7A 2IODA 2OO5A 4CMAA 1UYSA 4GKBA 4UEKA 4RPLA 5IF3A 4MKZA 1SEVA 3PHJA 3ZU3A 1ZKMA 4TKMA 1I33A 3QQPA 3ITKA 1WMAA 4TRMA 5B12A 3H7AA 3QV1A 1I2CA 3BHMA 4BV8A 2ZCUA 4C4OA 2I6TA 5TSDA 4GKVA 1N5DA 1Q0HA 3ABIA 3MOYA 4I42A 4B3HA 5DZSA 5A04A 4KWBA 2HMUA 3NRCA 2PD4A 4CR8A 4Q0GA 3GVIA 1FK8A 3NAQA 1LTHR 5EL0A 1A27A 3RBVA 3KYDA 3NTOA 4GQAA 4B4VA 4BNGA 4ZVVA 3DTYA 4GWKA 5C7OO 1ISGA 4CV0A 2VT3A 4WLOA 4IIUA 1LLCA 1I3MA 1QSGA 3TL2A 3H0JA 1H6AA 5JY6A 1EVIA 4FJ1A 2C5AA 5H81A 4GVLA 4GH5A 4ND3A 3RWBA 4TZTA 2HUNA 5ENVA 2X5OA 3WGTA 2H5LA 3L07A 2YHIB 4FJWD 3DZIA 2IXAA 2CDBA 4XYEA 3JQ9C 1PJTA 2VSUC 3BPPA 1HSOA 3DOJA 5JDIC 3QK8A 4B7CA 4CUKA 4D3SA 1R4MB 3FPLA 5EIOA 1IY8A 1CIVA 5A9SB 2BHLA 4JX8A 3KO8A 1T2CA 3GFBA 4NR0A 1OC4A 2A94A 4CM8A 1ADGA 2XPCA 4CR7A 3K73O 2A4KA 4QFDA 3AUSA 5JCJA 1UAGA 1YL7A 1Q0LA 1K3TA 2J3HA 1U2DA 3TZ6A 5AYVA 3QA9A 4ESOA 5IZ4A 2H6EA 2VN8A 2VRCD 3HN2A 4IGFA 5ADHA 4ZU3A 2AQIA 3RUAA 4MP3A 3U49A 4DQUA 1KYQA 3CE6A 3L6OO 1PJBA 2BELA 3AUAA 2GF2A 3RUEA 1PS0A 3OEWA 4BNNA 1VL6A 4XGNA 4WECA 3GMDA 1DLIA 2BGMA 3RUDA 2WYUA 5IDYA 4AJNA 3PLNA 4J2HA 1E7WA 1T26A 1I2ZA 1XYGA 3AW9A 4XR9A 5GMOA 3P85A 3GA0A 3KVOA 3PJEA 4BNHA 4ZA2A 3R6HA 1O6ZA 4QUKA 3RKRA 3QSGA 1QYVA 2FRDA 3SX2A 4XCVA 5TC4A 1GZ6A 3WSWA 3ZWWA 2I76A 3ADPA 3HB5X 2FZWA 3GPIA 3JYNA 2JJYA 5F5LA 4L0QA 3W4JA 5JYEA 3RC2A 4KZPA 4U8GA 2FPGA 4KDFA 5KKCA 3V2GA 2FOIA 1TI7A 2CY0A 3K8ZA 4LMPA 3MFMA 1F17A 1DC5A 3OA2A 2CUKA 1XNWA 3NDJA 2J5KA 1U4SA 2Q4EA 4BS9A 1EFKA 1HE3A 3CINA 2QIOA 5T5QA 4YQYA 2QZ9A 3I6IA 3MEQA 1EBFA 1J49A 1P33A 2F9YA 1XEAA 2Q34A 2X24A 3H5AA 3BMOB 3Q9UA 4B79A 4DYDA 1W0CA 5G0TA 3RUHA 3WQQA 4CLEA 4B7UA 2RH8A 4K9DA 2HSDA 3NJBA 2NQTA 1P1IA 5BSHA 4Y67A 4TZKA 3TN7A 2I5PO 4J4TA 4IMRA 1XNVA 2Q2QA 1GD1O 1MLDA 4NIMA 1YS4A 5FF9A 1RKXA 5T8KA 2HQ1A 3AOEA 4GX0A 2V7PA 1E6WA 5IXYA 3PDUA 5CDUA 2BKAA 1B3BA 5BNIA 3HDYA 1DSSG 3LT1A 3D5QA 3TRRA 3EGOA 3DMYA 4A5OA 1QR6A 4TRNA 2JKVA 3FR8A 1Z7EA 1FXSA 4FGWA 1M66A 3DWFA 6ADHA 2B4RO 1E7SA 3R3SA 1CERA 1DIGA 3MZ0A 3V5NA 4XWYA 3VH2A 3GK3A 3FR7A 5LC1A 1JW9B 1VJ0A 1B8UA 3GNTA 3TZ3A 3UGKA 1EMDA 2Q35A 4M87A 2D5AA 2VHXA 3MWDB 1GQYA 5AVOA 3QREA 1NQOA 3JD0A 4ZQEA 3I4FA 1HT0A 4JYLA 4YVFA 2Y0EA 2ZL0A 4D3FA 3K2BA 3H9GA 4JJGA 2EJWA 2HAEA 1N9GA 3GG9A 3FD8A 2WMDA 2ZB3A 1YG8A 1NXQA 2PZMA 1QYDA 3TT7A 4CLOA 4RZIA 1HWYA 3TLFA 4RQUA 3IKVA 3ETDA 1S7CA 5L7WA 2X8LA 3U5TA 3PHHA 4I8XA 1YVEI 2PY6A 1PQWA 5LDGA 4I9NA 4F6CA 2A81A 3TZCA 3E48A 3N58A 5FI5A 2PA3A 3MJCA 1SNYA 4ZQFA 4AL4A 4NBVA 5ER9A 2O4UX 2JFGA 4EW6A 1R0SA 4IPTA 4W9NC 3OH8A 5K6AA 1LC0A 4R5MA 2Y1FA 5CEFA 4E5NA 2JCYA 3WICA 4BGIA 4WCDA 4E5MA 1LUAA 4CMIA 4FGSA 3Q1TA 4K2NA 1T24A 1LDBA 3DB2A 5A5EA 4O5OA 4N5NA 4BOYA 3FNGA 1EQUA 3PIDA 3HDHA 4YTEA 1NTOA 4KOAA 3INRA 3ZHXA 2IE0A 4B3JA 1PIWA 2Q1TA 3EDMA 4MVJD 4Z0MA 1U5AA 2Y0DA 3WG5A 1Y8RB 4EJMA 3TDCA 3EK2A 3JQFC 2NM0A 1PSDA 4ZQBA 2PG8A 3T8BA 1NHWA 2VHYA 1NQ5A 3BMCB 3I9OA 1PJ3A 4I9HA 3PEFA 4RF3A 3H4VA
chains in the Genus database with same CATH superfamily
4HB2A 1YT5A 2E1RA 1XNGA 1DKOA 1J9EA 3GT3A 1NXVA 4DDHA 5LWQA 1F12A 3O0DA 1PLLA 2XCIA 4JASB 4HH1A 4D9BA 5CG2A 5BT9A 3DOCA 4HYQA 4JROA 2FPGB 1H6BA 1MUUA 3DHEA 1N9KA 2ATCA 1H0RA 3O03A 4LXTA 1J8VA 2W6ZA 5BR4A 3IOEA 3KXIA 2EW2A 1E9EA 2FSHA 1XLTC 1R6XA 4H7KA 1WAMA 2EP5A 4BGEA 1FNNA 3KOXA 2IY9A 1KVQA 4R98A 4BE4A 1IJEA 2VWPA 1V5FA 4OUKX 5I9MA 2KM1A 4GG1A 1NJ8A 3RAPR 3VHXA 3VSAA 2G1KA 2ID7A 2MR5A 5BXYA 1E0DA 5F1PA 5BSVA 1USIA 3TZEA 3G1WA 2F3SA 2JL1A 2JLZA 4O6VA 3GFQA 4KUGA 3OZUA 4YMIA 3S8YA 1U0HC 1UBGA 3DVAB 4FX2A 2A2ZA 1UXHA 2J9YB 1YUMA 2HA0A 3I5YA 4G24A 2ZJAA 4RZHA 3DCJA 1QRUA 1QO0A 4UUAA 4Z86A 4H7DA 4XVCA 3M3PA 3R7NA 1H2BA 4KO4S 3S2FA 2QL9A 3VDXA 5IJ0B 5K1ZA 1KDYA 3R0OA 1RM3A 3ZBPA 1M1YA 3ZDCA 1K6IA 4I1UA 1IBKB 1NVVR 2A3RA 4EMMA 3FOEC 1ENPA 1FDWA 4DIBA 1QQTA 4B7AA 5LYJB 1PNQA 2H2HA 5FWAA 3ANYB 3TQFA 5TDHA 3VR4A 4DHEA 4ZDFA 2QUIA 4KE6A 3KPJA 3IQGX 3EQ6A 5JYDA 3ZHVA 2ZWAA 4BY9E 5CTBA 4GI5A 3ZXYA 1VXRA 2B94A 2GNAA 2YHSA 4L50A 1SHKA 3L1HA 4OHYA 4D45A 1IVSA 3E0QA 1Q83A 2PTHA 1CQZA 1GPAA 1XXLA 2BZ0A 2NO4A 3KAQA 3NHJA 2OXIA 4G0WA 4MIEA 4D79A 1WUJS 1RJFA 3P9CA 3C5VA 3IC5A 2O50A 1ZZEA 2WSLA 2VBGA 3DNMA 3ZH9B 4JCRA 1MBZA 1DDIA 3IP1A 3HP1A 3AHCA 4U2GA 3MYBA 5CFQA 3VJMA 1KZHA 1P0QA 4MYCA 2X8JA 4D9KA 3CX8A 1G8GA 5EY5B 4ZREA 2JBAA 3AVPA 4J4HA 5EWLA 4DA7A 4DJJA 4NBKA 3ZWPA 1FQOA 1JLRA 1R0LA 3LQ1A 2Y0PA 4R71A 4J8PA 3RAEC 1JQJC 5ELXA 2D7DA 3OI7A 1VKJA 1E6UA 2G77B 4CXMA 3H2GA 4YJ2B 4FQ5A 3KAJA 4RAOA 3S27A 1VJTA 1XKQA 1UAYA 2A9FA 3P7MA 2WYWA 4IRXA 2OK8A 5K6RA 5C5DA 4UTRA 5EFZA 4OPMA 1FXUA 4I4CA 5DBIA 4ARAA 2XZDA 5EHZA 2QG9A 2GM3A 1NVAA 5TJ9A 1KARA 1O94C 3T3HA 421PA 1XT6A 4HQKA 4A2WA 5CLQA 1W2GA 1OASA 3A1SA 1DTWA 3SWWA 1FYXA 1OVMA 5A3VA 1X1QA 1UADA 4LHSA 4LJYA 1JTEA 5FRDA 5C18A 1J06A 4IQFA 5EJ9A 4WT7A 3JSXA 2W11A 4FT2A 3S28A 2WZCA 5L7TA 1KS9A 3WRXA 1GTRA 1QFZA 2C8KA 1RWBA 4H77A 4G0XA 4LRQA 1ULAA 5FPQA 4YRZA 2AWNA 5JAMA 2Y1KA 4NFYA 1L0BA 1S2OA 2PK3A 4TTSA 2O8DB 1JXZA 1O3YA 1Y6GA 1ZHOA 4CE6A 1U65A 4CKCA 2QD1A 4DBVO 3PRKE 1FFHA 2B3TA 4XM0A 5HP4A 4WBNF 2HF8A 5EP2A 4GL2A 1K89A 4L8WB 2PQ6A 4BRZA 3ZGVA 2PUDA 2DMRA 3LDUA 3C7DB 4JFAA 2NV2B 3L7IA 1JJFA 4YJ3F 1J9ZA 1QRDA 2V7QA 3MWJA 5EPEA 4MI2A 3K5WA 4XUCA 2QD5A 2VR1A 1YJCA 2B2XA 1XMIA 2ZAYA 5CDGA 4MUKA 4ZVTA 2NPIA 4YASA 4WADA 1YGPA 2RKOA 2XGGA 5A2GA 1F4PA 1N25A 3QUCA 3O2QB 3OQIB 1EX9A 1GV0A 3THYB 1PFYA 1I5OA 1PJSA 1Q7RA 3LXRA 1SUAA 4YGXB 5H3CA 4EHLA 4L73A 4MWSA 5IPFA 2RCYA 2GMWA 5IVDA 5F7XA 4ILEA 4ZZ3A 1L7DA 5AW7A 1TW2A 1CZKA 3KKOA 3JAWB 1JPUA 1O9HA 1P2VA 4CM4A 1U8TA 5JG7A 1ORHA 3T5DA 2V45A 3WGHA 2FKNA 1KNXA 1TVKB 5H1YA 5HQ3B 3B6MA 1X92A 4WIAA 1TA4A 4CN9A 2Z08A 2X1HA 3H3JA 3IS3A 1SXGA 3CLVA 4NU8X 4X5OA 1E8DA 1EE9A 4UUPA 3NHFA 3MGCA 2O5VA 3QX8A 5A3QA 5BSTA 3HE3A 1DX4A 4XFJA 3TDMA 1N7IA 2WP8J 3CZPA 1Q52A 2D5LA 2G04A 1Q84A 6YASA 1I4TD 4C4AA 3THYA 1RP7A 1X7YA 1RWKA 1UFRA 1UMBB 5BY2A 4A15A 4K3UA 3DOHA 2ARKA 2CFIA 5E4YA 2Q29A 4LVUA 5IC5A 4X20A 1OHHD 2E85A 5K8VA 1BS9A 4H17A 1SKMA 1UZUA 1SVWA 4PYNA 4KXYA 1O87A 4M60A 2OFPA 5DU6A 3BPTA 4L5CA 4HGYA 3SS8A 5HNKA 4DZZA 4L27A 3HNOA 4OSOA 5DF1A 5FO1A 1ZJWA 4DC9A 4AMZA 3COYA 1G6OA 3ZGLA 5JO0A 4Q4AA 2XCLA 1IMOA 3V8VA 2JEZA 2FNAA 4KH1A 2BUAA 4K9QA 4WKGA 1C3LA 2GA8A 3GI1A 4LGYA 3E9RA 4N7BA 4AJOA 3KT8A 2OQRA 4LVNA 3D6FA 5JCPA 1MX5A 3LOUA 4NY1A 5H9VA 5JSYA 2R0QC 2F4VB 4TLAA 4B6SA 1ESEA 2DPHA 2VPYA 4M86A 3WYCA 2HXYA 3ZDZB 2HEIA 4DMUB 3PD0A 1G63A 5AKKA 1EPUA 3ZE1B 2OBLA 1OAOA 3HNPA 4DNXA 4BO3A 3H9BA 1SVSA 4P3YA 5AVQA 4B3FX 2H7VA 1TKAA 2Q5IA 4JQCA 2BHTA 3ESCA 4Q6BA 3TUZC 4ODIA 2FQQA 2IDJA 4BL5A 5HXAA 5JH7F 5AKLA 1WETA 3OU6A 1M2VA 4RXMA 5KJPA 2BL4A 2OUKA 4CLOB 1E8MA 2IYEA 4R2HA 2H2AA 3A1EA 1XQ1A 5DW3A 3DV2A 4M8NE 3SR0A 3AINA 4FOOA 4EUEA 4KP7A 3R9SA 1OR8A 1EAMA 4Q1IA 3QTLA 4G85A 4W5WA 3FY4A 1ISJA 2BMDA 3LQKA 1U6KA 3DVQX 1PJZA 1IXZA 2R4QA 1IAVA 1OBHA 4XX0A 5LQUA 2NUBA 3KJGA 1CUYA 1WX1A 4DCJA 1I10A 1BD4A 1IXRC 1K1EA 2CNBA 2IYYA 1ZIOA 3IP8A 4EA6A 2R6GA 2YXNA 2QHXA 3FLEA 3U7QA 4C2AA 4DLSA 5HSGA 5L3QA 2SCUA 2EJ5A 2DVMA 4YJ3B 4WDQA 1C7EA 1YRYE 3FIUA 4AKHA 5AK5A 1E1QD 3Q3CA 4K26A 4WYOB 3L1JA 2OHXA 5FUXA 3FCCA 4B47A 1DJQA 2OCKA 2WU1A 1JYFA 1Z6PA 3K8YA 1R5OA 3UN1A 2QVZX 3VH4A 3KSZO 4QULA 3LPDA 1J39A 1IHOA 3U3XA 3RM3A 2ZTUA 2JASA 3BIOA 4IKOA 4PPYA 1ZGCA 4UASA 1U4OA 4B09A 4J75A 1XKLA 4HQNA 1ZIPA 4B3CA 2PYZA 3JZFA 3UVEA 2B5OA 2HIMA 1RQXA 3ASZA 3D6TB 3Q5GA 3KEOA 3KL2A 1Q6YA 4ARVA 5IXSA 3VU9A 4H0FA 2ZL4A 1R0XA 2Q41A 3LKDA 3QVUA 1BA3A 1KA9H 1QJ4A 4YS6A 4PRKA 2QW8A 4IOJA 5K3CA 3AFGA 3PR1A 2ZYAA 4ZHQF 2ODNA 1HDOA 4CIBA 4CYMA 1PLJA 1Z0UA 2NSLA 4CG2A 2BH2A 3C6XA 3WL3A 3BOSA 5EE9A 3GLHE 1ZRSA 4WINA 4ZRMA 5K5EA 2CT8A 3PNYA 3HADA 3KWJA 1TXGA 1LW6E 4E5PA 4J49A 5CIQA 2IK8A 3VZBA 1D9XA 2BAGA 2VPZA 5CTCA 2HRCA 3F2IA 1PN3A 1DRJA 1V5GA 4F06A 2R86A 3UMFA 1TJPB 2B8WA 2WJYA 4ROSA 3E5MA 3ZOKA 1CW2B 2Q8PA 3DVSX 3D2CA 3GJXC 3IHLA 3EXG1 3O73A 4MVJG 5EI5A 4BUCA 3GJYA 3B70A 1YQUA 2O8FA 3N74A 4K6MA 5AQ1A 1XLUA 4ZARA 1XNHA 3TZKA 1CZOA 2WWVD 3R75A 1SU6A 4RYLA 1TIKA 2CYBA 2WTBA 1T0PA 3STWA 1SHJA 3W1VA 2K4MA 1E3WA 2GPTA 2P2LA 1RWXA 4BNXA 2Z4TA 1L1RA 4BUZA 4RVCA 3HCPA 4KXMA 4LOHA 5E0SA 1W6RA 1XU7A 2DUUA 2FK8A 1DNPA 2FPIB 4WNAB 4C88A 3T88A 4KN5A 4UJ5A 1J20A 1I3NA 3A6HA 4IJVA 4EUNA 2FLWA 2FZ4A 4NONA 5SZKB 3GCZA 1Z0DA 3LNTA 1VL1A 2H7YA 3ABRB 2ZS9A 2PL1A 5ENDA 1NBMA 4DOMA 4HN2A 3L8CA 5EXPA 3WBKA 3HJTA 4BFSA 5AVTA 1JHXA 1RM4A 4BQIA 5BUZA 1NZYB 1K6XA 1P1RA 2A5DA 2QR2A 5AM3A 3SQWA 1PI3A 3C3YA 2B30A 2DFDA 1PJQA 2PPVA 3FNFA 3P5SA 5B64A 4DY6A 3AM5A 3JQBA 3OFVA 3D8UA 1GLVA 2FYTA 5FL7D 3QXIA 3AEQB 3HGMA 3FYUC 2J30A 2I03A 4HK4A 5BSMA 3WK9A 2A0KA 2NU9B 4OKIA 5CCEA 4MQ5A 2JGDA 3ZIDA 1K88A 4NICA 4AO6A 4M83A 4MUNA 3M6VA 3H13A 4E2WA 4GPD1 3R5KA 4X62B 4NCAA 3AUXA 1FC0A 3H5LA 3HCAA 1JDSA 3PQ8A 1EVKA 1IXYA 2IOQA 2P3QA 2QMOA 1ZA1A 1IY2A 2PS3A 2VQ6A 3BE8A 1K8YB 1KAHA 3S55A 5GIPE 1B8PA 4RTLA 3IKLA 4MA4A 1TK2A 3FUUA 1GPDG 1SHLA 2BF7A 5M5BA 2J32A 1CIJA 2AHRA 3R5SA 1Q14A 4KWEA 3VU8A 4NCBA 5YASA 4YJDA 2PS9A 1TM4E 2NAPA 2P2SA 3HZRA 4JLPA 1JILA 4YT2A 1E0KA 4H7IA 4DSUA 3N6RA 4P7BA 2GRUA 1QF7A 2OQ2A 3G8CA 1Y3FE 4RE6A 2GLXA 5ERGB 5KO2A 4OOEA 2E48A 2VK8A 1CS0A 1FX0A 2BZSA 3NTQA 4N5LA 4CV1A 2HQRA 3N8HA 4FIZA 4IUYA 5KDRA 3TTUA 3FLMA 1Z28A 3DZ8A 3RLIA 2YZMA 3TQRA 1V6CA 1FXWA 1AUOA 2D3TA 1SBNE 2QT1A 3EXHC 1B0UA 1UFQA 1WHTA 2FRXA 1IIBA 1DO2A 1WCIA 2IXDA 4PO1A 3AZQA 2OD9A 3CUYA 1TEVA 1HQYE 1LK0A 3RV4A 3WGOA 1SVOA 4IV8A 4CM8B 5HM6A 5AI0A 2WSSD 2CLFB 1CVRA 4AECA 1P9RA 2PH5A 2X0IA 4QXPA 3RYTC 3NTXA 4CODB 4EDFA 3JAMA 3SSNA 2E49A 4KXQA 3LT4A 3ZPXA 4BMNA 5JXGA 5DRYA 1WXDA 3AFMA 4REOA 3ABOB 1V3TA 3GJQA 4BX2A 3DBRA 3GJ7A 3L4SO 3PNQA 3FSGD 4FYXA 2DQ4A 1EEHA 4LA4A 4TV9F 2GEBA 4W8GA 2Y05A 5FPSA 4JUIA 1N75A 3ZKAA 5E0SH 4CIAA 3ORRA 3AVQA 4YWJA 5BWCA 1BMFA 1N6EA 4M1SA 2UXBB 3TWOA 2GI4A 3NZEA 5IVPA 4XUEA 3GNSA 4IY1A 3M2TA 5F1KA 2JLSA 3ASUA 4P3OA 4TKUB 2IHKA 2ZUCA 5GZ1A 1WJGA 2ONCA 4N82A 4BEBA 4UHHA 2FW1A 4YUZA 4RJLA 5DW0A 5LQRA 2C7PA 2ZSUA 3IV6A 2O59A 4W5HA 2FPXA 4DG8A 2HPVA 3HN7A 2XRYA 2J08A 3PIIA 1SXQA 2Q1SA 3NONA 1NOIA 3NHAA 5F2EA 3HH8A 3S7ZA 2D5BA 3G2OA 3CEJA 3DDHA 4YJHB 2R8RA 4YUWA 2W5UA 4FB5A 1HC7A 4QTZA 2QMEA 2ZWVA 2A58A 3FSEA 3RVDA 3U81A 3LPNA 2JLXA 3DBHB 5KOHA 1USWA 1ZN2A 2QLBA 4HY3A 4LNUA 3ANNA 1KS2A 4JEMA 1PR1A 3DMNA 5K51A 2Q5QA 3K35A 4A8HA 5EXXA 3W9YA 1II8A 4AU1A 3AETA 2ZWMA 2EJTA 3V1LA 2Z9DA 3FOBA 2Q99A 3FCOA 1Y3CE 4S24A 1CBUA 1MAWA 4NNOA 1TDJA 4WVFA 1U80A 4HDMB 1NVUQ 3KQHA 2C9ZA 3FZYA 4LYYA 4DR1B 3UK7A 1GCIA 4QWWA 4OI1A 3TOSA 5A4KA 1QBKC 1DRWA 3ENKA 3VR2D 4CF5A 2GS9A 4OMRA 4ND2A 1E2IA 4Y2YA 2FHSA 1KPIA 5CBPB 3HO1A 5GPBA 4UEQA 3ER9A 3OC7A 1WV1A 4US1R 3I6QA 3O92A 2QJWA 4JJKA 3V4PB 4LFBB 5KTNA 1AZSC 2W8BA 5EQDA 2BGLA 3MFQA 5DU8A 4HS4A 2ZTVA 4FYKA 3CF0A 2YYYA 2PE5A 5JBWA 4PZUA 5CIYA 4F3CA 5D3KA 3VU3A 3FYDA 1EDDA 4O4LA 4PICA 2VNAA 3EWIA 1IBSA 2PVPA 2VDPB 2XHEA 2ZITA 1RJMA 2XCRB 2HLPA 3H86A 4W7IA 5KI6A 4DW8A 7MDHA 2XJ4A 1AF7A 1FYDA 1TTHA 3OX3A 4UTOA 1HOTA 1UK6A 5ESXA 2CLOB 3UMVA 3NRJA 4GFDA 4LJRA 4A6EA 3QUSA 3H04A 3EYAA 4PYJA 2R00C 1XMPA 1ZGZA 2JD2A 4UEWA 5BSRA 1QONA 1Y9ZA 3GLTA 3PFCA 5LXTB 3DV9A 4XSGA 3TTWA 1CY7A 2CMFA 3VTFA 3GRAA 1X7HA 4NPAA 4LJ4A 4UBOA 3V34A 4LTMA 3VSCA 3DQPA 5HHTA 4R1TA 1D9ZA 4H08A 3G2JA 3MMNA 3VH3A 4BNYA 5BURA 3RADC 5EKTA 3JWIA 5CMLA 3NEPX 5J40A 4AWAA 1VG1A 4L0DA 2DX7A 1ZOPA 2RGDA 4DEVA 3T1TA 3GFPA 1K98A 4CF3A 2ZIAA 3ZDEA 1ZYUA 4KQ2A 1IEQA 3LI2A 4MRNA 3NT2A 3G68A 2WYIA 1C50A 5JUWA 2RHCA 5I9BA 4F4IA 1FFWA 2QSJA 4FJ0A 4DCNA 5KWSA 4C5BA 4OLBA 3P9RA 1KFCB 1Y5IA 1RI3A 1W85A 1IZ8A 1L5RA 4KVGA 5EHNA 1WU7A 2PUTA 3OZVA 3ZWVA 2AFIB 1OA0A 1Z4LA 1T0JB 3DBIA 4REMA 1C7IA 5C53B 3ZI4A 1L9KA 3EZFA 2OESA 4XQEA 2J5QA 1JKJA 4JLAA 3ZI7A 4ENPA 1ML4A 1RHRA 2FWMX 1KERA 1NBOA 3G7NA 3HB0A 5CDYA 1Z88A 1X42A 4OU5A 4HAWA 3IELA 1UKVY 2G7ZA 1KI6A 3AP2A 3IT0A 1FRQA 3D7SA 1L8QA 4FZ3A 1LDMA 4HNSA 4OIMA 1YBVA 4PG4A 5FUYA 4IDOA 3DF9A 3QG5A 4JP1A 5AUQA 3TBHA 5KNBH 4J4BA 2Q2VA 1K66A 4B3DA 5GONA 4NNQA 5TGTA 4CEIA 3D2LA 3TD2A 2H85A 1CUJA 3A2MA 5DPMA 5K0SA 4KREA 3KFXA 5JWOA 5ALEA 3I4LA 3SF0A 4JBGA 1WQ1R 3ISTA 4KPYA 2YZ7A 4C5CA 3IQEA 4DA9A 1MVOA 3EZLA 4DQKA 2RC5A 4BEWA 4BIIA 5BSEA 1I7QB 1OIWA 1L3CA 5LP1A 3AMVA 1R15A 2VYNA 3DOOA 1VSVA 5JQGA 2F55A 3E6AA 4NEQA 1J8MF 4NBWA 3GLFE 2Q07A 2H1IA 3SEZA 2PQ0A 1TM3E 1PZHA 3N2GA 1EJ0A 4I8IA 5D5QA 2UVPA 5E38A 1SA0B 5CRIA 4X3OA 3IURA 1OBCA 2XMZA 5DO9A 3QEOA 4DT1A 1CUFA 3DKPA 5KVQA 3IBSA 3R9WA 2PAFA 3THWA 3UUWA 3NC1C 5HKBA 5U9CA 2OYRA 4DY4A 1ILEA 1W8IA 1WF3A 3B5IA 4P80A 5D51S 4JB0A 1JTVA 2YJZA 3DV0B 3KAKA 4PQYA 4RD4A 5CA0B 1RJDA 1JR3D 3V1MA 2NO7A 1C3OA 4HLUC 2PS1A 1ICIA 2B92A 3ONDA 1TVMA 3CA8A 4D92A 1U9JA 1MEEA 2QBYA 3UMYA 1OXSC 1OLUB 3T0GA 3UJNA 3H42B 1FNMA 4FHGA 4AKIA 3D7MA 3ZCXA 3DLIA 1RYZA 1MABA 1FSPA 1Y81A 3FUTA 2VH5R 2QR5A 5KVSA 1E3MA 1BE6A 1UPXA 4X1OA 4KQGA 1IB0A 4V2IA 4FBGA 4DMHA 4N0QA 3U09A 3NTUA 1RCUA 2ERXA 1WXQA 3DMHA 1B14A 3LYHA 4NDAA 1G1AA 1QOPB 4I50B 4EEXA 1GUZA 5A02A 1FNDA 1KP9A 3GBSA 3ZTWA 2L82A 1G5RA 2IWRA 4KR7A 4GPTA 5ILQA 3OD1A 4I5FA 1X6VA 1QIDA 3OURA 3NHLA 3U9SA 2P9TA 1AF4A 3GBVA 4K40A 4OFXA 4NH0A 3KTGA 4TXNA 1RRCA 1U8XX 5KYVA 2OFOA 1ZRMA 5D5HA 5HE9A 1WTAA 1BCSA 3LBAA 2W9XA 1NUQA 3INNA 1E9RA 1P39A 4C0AC 4AYXA 4G8CA 2FEOA 1MR3F 4BTEA 4DHWA 3DPSA 1IUPA 2X2OA 1MD9A 4QAJA 3CJQA 4MJ7A 3U19A 1NT4A 2FPRA 3EEFA 3QPCA 3TF5A 3HSKA 3F8SA 4FLEA 1JHAA 1VTKA 2CYCA 3PC2A 3ZD9A 2YRWA 2YHBA 2A30A 1JEOA 2R7AA 1HYEA 2OGZA 2XGMA 4K9PA 4YRRA 5E6SB 3FDUA 2VBCA 1Z37A 4TQGA 2P2NA 3KEFA 1DX6A 1K3FA 3PEVA 3RRMA 4QGBA 4Y6SA 3B48A 1G3UA 2CXXA 3NBXX 5CFNA 4FUQA 2IV2X 4D4GA 4DR7B 4LK2A 3TBKA 4KMMA 3LUBA 2QKYA 1N5LA 4LYFA 1NYLA 4G01B 4UD6A 3TRJA 2CZGA 2QTLA 3PFFA 3NIDB 5DIZA 4E7PA 5KYKA 1EHCA 1P0CA 3T3MB 3ESYA 4CM7A 2EYUA 3N8DA 2NTEA 3F49S 2D0OB 1PV2A 1UKAA 3LRXA 5KTPA 3MYRA 2FW6A 4S3MA 2CK3A 3C5WP 1GQ2A 4Q15A 1W44A 3HNRA 3AEZA 3OZGA 3OIUA 1U8YA 4NYIQ 2HA4A 5COQA 4ENWA 1KEEB 2FWJA 2YJGA 3KK0A 1Y9EA 3H5VA 5DULA 4I9FA 4C6TA 3R4VA 4G8JA 3DE6X 1LSUA 1RYBA 2FP4A 3DCNA 4FFVA 1NTRA 2V74B 2YDYA 4GZ3A 4HG2A 4INZA 3BXEA 2Q5LA 4KBYA 4QEDA 4YREA 1QPZA 3WIOA 5DL1A 1H5QA 5BMVF 3STHA 3UG7A 1WLYA 2ZI7A 3HG7A 4HAZA 3SLKA 3AB8A 4BNMA 3DLAA 3L84A 2WIFA 1CEXA 2H06A 2O0MA 2VH2A 2YR0A 2QQFA 4I3FA 4JGBA 4ND1A 4TXJA 1PWZA 5CR9A 5JSQA 3U5ZB 2WWTA 2Y93A 5EN4A 1CYEA 3MILA 1I3KA 1J23A 1ES9A 2F1KA 4MMZB 2RI6A 2W2KA 2ALJA 4IWNA 4V24A 2VSFA 2DY0A 3KUDA 1XVVA 2LDXA 2X0RA 3B5JA 1KEUA 2QL5A 4FFDA 1HDYA 3JVEA 5H8WA 2GN2A 1T8PA 3QVXA 1NXWA 1QE5A 2IW1A 4BU1A 4DL9A 4UAGA 1Z4JA 2YWXA 3I34X 3L92A 1KAGA 4WK4B 4YYZA 2QDXA 1UODA 2FN9A 2H0RA 2HA6A 1RRKA 2Q5EA 2X8BA 2ZSDA 3K0BA 4TLCA 4TUYB 5F9FA 1PT9A 5JU6A 2IOYA 1IRIA 1JEQB 4KQKA 2VAMA 1N57A 3JRWA 1OROA 5IH3A 3EFEA 4GLJA 5J4LA 3V5IA 3H18A 1Q57A 1Z5PA 2O7RA 3V9AA 3IULA 2Q8NA 4Y2QA 1RHQA 3SHOA 4ISBA 4C0QC 1KK3A 3JAWA 1V1RB 3HB7A 3QRWA 1Z0ZA 2ZCVA 4FCTA 4YXWA 1C3JA 5A1TA 2PEYA 3WLLA 2H2IA 5KWIA 1RQPA 2PMCA 4MW9A 2VJMB 2Z04A 3EUEA 4E33A 4X66B 4Y1EA 3ITDA 2QZPA 4R54A 4DI1A 4D43A 4AAYA 2ECPA 1E9VA 3D6JA 1GCOA 3UMMA 3EPKA 2RBKA 3GJTA 5DTQA 5FUSA 4O4IB 4ZC8A 2VDOB 3TUJC 3TX6A 1NBME 1K6EA 5HQ3A 1YFLA 1BNCA 2IEDA 1FNCA 4U0KA 1C9NA 3EIOA 4RD1A 3TPCA 1ZGBA 1IE3A 3R3YA 5IBRA 3LPMA 2QRPA 2BRUC 2IXFA 4S2EA 1BX0A 2PMWB 4UPEA 4COOA 1H4VB 1T5DX 4KWTA 4DIMA 2QTFA 2FKAA 2GCIA 2WJVA 1G8MA 3QGMA 4G86A 4PBRA 3I8XA 4BFWA 5IYZA 4TYWA 1I0LA 1LJLA 4YJGB 4D2IA 4I3GA 2JAHA 2PWPA 4G1EB 3BIFA 2ZK7A 3ROPA 1Z6AA 2W00A 5A0VA 1R88A 1BFKA 1OZFA 3KQYA 2O0LA 3A6LA 4G0QA 3WRVA 4DA8A 3BKWA 4QIJA 2VJMA 3FBWA 1BD3A 3FFAA 4NMHA 1Z68A 3FCXA 4II3A 2YVKA 4ABTA 1DUIA 1EFTA 4ZGWA 1VFPA 2BHNA 1NR1A 2WTAA 1JL3A 5F1YA 4XYLA 2C82A 3S7TA 3UB3A 2GRJA 1T4MA 2X15A 1E20A 1O95A 1Y48E 4LJ8A 4M37A 4WJLA 3HCFA 5GJWC 4IHKA 3PYXA 5DN9A 4NZPA 1SKBA 4DIDA 1M2OB 4I81A 1W5AA 1G21E 1V9SA 3QJYA 4MW5A 3PHLA 4RZ2A 1WXWA 2ZJ5A 4PGFA 1LX7A 4C87A 3NWBA 1CJVC 3B13B 3CT4A 5KWJA 1GDTA 1YOVB 3PHBE 4EB6B 3L1KA 3ACDA 1HEIA 2EJVA 4MJ3A 3DKVA 3SU8A 4TLEA 3HCOA 2AW5A 2P3OA 5AICA 2HJGA 3M82A 1U31A 3BRSA 3OCXA 3Q0EA 3ZCUA 5FH9A 4CMEA 3ROKA 2CXSA 1ULTA 4R7ZA 4O4HF 4RNDB 1V7PC 4ND4A 5D00A 2GBFA 4DRXA 4IIXA 1HYHA 5FBQB 4HVLA 4YV1A 1OXBB 2HJRA 3L7MA 2R6ZA 3C2QA 2QYOA 5HE8A 2BV3A 3GQVA 3LA6A 1EK5A 2JFWA 3MCTA 1QUEA 3CNQS 3PB3A 1SWVA 2R6AA 1VCOA 4MI3A 2HBYA 2C3YA 4MXDA 3RVNA 3C15C 1L8XA 1DHRA 1F4LA 3EXIB 1RBYA 1NVEA 4TV9B 4NMXB 2JI9A 1RHUA 2I6SA 3PC6A 3M6MD 3H2HA 4YLEA 4F2HA 2F8SA 3S8MA 3X1MA 4UTPA 5IWCA 4AY2A 4AJPA 4KGDA 4U1AA 3HWWA 3PV0A 5ISMA 1E3LA 2PJUA 1IL0A 4FHEA 3RVKA 4BZPA 4KRGA 2PGLA 3HB1A 4TMKA 2FEKA 3SVTA 4XVRA 3R9TA 1SPBS 4G1MB 3WC4A 4I4TB 2H9IA 3HKCA 3RAJA 5LIPA 1JSRA 5J2TF 1X9HA 4BLQA 1DQRA 4NFHA 3HHEA 4YMLA 2C78A 3KYBA 1FJHA 1NW8A 3EX7C 4DS3A 1ONBA 5GJCA 2VEOA 3WXMA 4AN4A 4G2NA 1AKWA 1UDAA 1XKTA 4I08A 1Q0SA 3VOSA 4Z4CA 1WUKS 4CT4B 1P3Y1 5IZCC 2XLCA 1M73E 5DP2A 5LJIA 2C9BA 2ZB2A 3KSBC 1ZIYA 2IITA 2R8EA 1RLOA 4P3KA 3OQBA 3NHBA 1O57A 3AWIA 4S35A 1A04A 4A36A 3H0QA 1KSFX 3EQ9A 1CXZA 1YZFA 3WBFA 1MVLA 5ICSA 1GPYA 4LWOA 1WTCA 2C3MA 3V5EA 5PGMA 3FDZA 1SBTA 2BE7A 2Y8EA 3B3QA 4OB6A 2RCNA 1Y8AA 4TS1A 4AKSA 5MN4A 1K4YA 2ZRBA 1G7RA 1D0SA 3PEEA 3OFNA 3A4NA 2HWUA 3CNOA 3VNQA 3IMCA 2FVYA 1H1LB 3KR0A 2JGEA 5JRDS 5J5VA 3UHPA 2XUIA 1E2BA 1Q44A 2WTMA 2PT7A 4XLLA 3N2ZB 2OBNA 2CLHB 5F76A 3FUCA 4YN3A 1TIPA 3A31A 1K2WA 3AUFA 5DTIA 1DDOA 3LF2A 2O7VA 3LHDA 1AKRA 1P7WA 3NYWA 4XR4A 3TBFA 1Z25A 2UYOA 1LPBB 4JNCA 4AD8A 4TWRA 4ZDDA 2RK3A 1Z16A 2QMQA 2VTDA 5JCOA 3JXEA 4Y9TA 1QJCA 4YP6A 1JHUA 2QAGA 2WMYA 4JCCA 1GAWA 4MQ4A 1WMFA 1H2WA 1W9MA 2FQWA 1DZIA 2HIGA 2OXFA 4ZCQA 4NXMB 3UG6A 4MLPA 2O06A 2ZANA 5BYBA 4ZKEA 3KKPA 1SCIA 1G8AA 3TFOA 5F2KA 4DV5B 3EXG2 3BAZA 3FNQA 2HH9A 1DQYA 5TPWA 3ZDBA 4OXXA 4MWBA 1E4VA 1QP4A 1VE7A 3IEUA 3RWOA 3VPHA 1ISIA 2IP1A 3GELA 4R69A 2O3SA 3UUGA 4N3BA 3VMFA 1W0KA 1Z5VA 3R7WA 1F14A 5KYUB 5IVHA 3BYZA 1M76A 3BL8A 1MO4A 2IHUA 4J0FA 2PRJA 1JKXA 4IYJA 3GCWA 4N3NA 3FLBA 5GP1A 1FEZA 5H83A 5CJJA 1ZI9A 1N2OA 4TSFA 1CE8B 5C34B 1B2RA 1VRVA 2DUWA 2XQIA 4K6FA 4LX8A 4R4JA 3WNDA 4Y2UA 1B8OA 4BNKA 4BWVA 2ODAA 3GUHA 2E37A 4F3RA 2BGTA 2PL9A 1J8DA 4L28A 2H2WA 3OHPA 5F35A 3S2ZA 3BQNB 5MN6A 2IDZA 1KK2A 2N1BA 2PU5A 1NMZA 2NVWA 2Y1LA 4QBFA 1MF7A 1MB9A 2YL2A 2ZBDA 721PA 1A9YA 2AYZA 3SHWA 4D97A 1PFUA 3R40A 2BKEA 3U80A 3U0VA 4X84A 1PQPA 2QNIA 2WAXA 3BXZA 1YZVA 4RHXA 3UUFA 5FI0B 1M2HA 4D8YA 4L8KA 3C3AA 1W96A 3GHHA 4DGQA 3T5GA 1MDBA 4WAUA 2IYQA 4A6XA 4MV1A 2XUKA 5K6AC 1Q19A 1TCUA 4QNRA 4UBMA 4LX0A 3LVFO 1I7LA 1VIAA 1Y34E 5K0LA 6PFKA 1R4NB 4ZQIA 4LN1A 4F4JA 2A1TR 1GPJA 5E1MA 1LSSA 3OETA 2REBA 4JCOA 2WC1A 1UJ4A 2ANBA 4FN7A 1KH2A 2SICE 1BEUB 1TM7E 4ENSA 2FJ0A 2ISQA 1DS6A 4ADSG 1DOAA 4DWOA 4YO7A 1H9AA 2ZYTX 2O8EB 3BQ9A 1BC5A 1FFXA 1FU8A 4ZWNA 1EVZA 1JQLB 4HAOA 4XI9A 3SSOA 2W58A 1ZUNB 4OHCA 4UOQA 1I0ZA 1CR6A 3AT1A 4FEAA 1G17A 3GZTB 4MV4A 1U3UA 1P9WA 2Y68A 3MLEA 5KYYB 4ACAA 1E6MA 1XTKA 3FTDA 1PD0A 4CG1A 4G41A 4H4DA 3PGQA 3UJ7A 5EINA 1P62B 3W7AA 1FJ2A 1Y98A 1YSCA 2D1RA 2WYOA 2TS1A 1JJVA 4IIHA 4KIGA 2QN2A 4Q3NA 2WTNA 1VOTA 2BKXA 2XNDD 4O59O 1WCIB 2HQBA 5E8JA 4Q4LA 1NZDA 3MTAA 3VVBA 4OJQA 1N6IA 4Y2PA 3VAYA 1W4ZA 4HJXA 3ZY3A 2HCRA 3ICWA 1KKMA 5CW1A 2N3ZA 1CLEA 5TS3A 1SXJC 4JJFA 1C4XA 1DIAA 3GGJA 3LLVA 1CJMA 4KU4A 4LRUA 1C14A 1ADYA 2OM6A 1YZUA 3DBRB 1JH9A 2V7UA 2BR4A 3KTFA 1SBZA 1JFVA 2P41A 3GEPA 2A1UB 1BGVA 3NOOA 1ND6A 1TO6A 1FFXB 2O3TA 3AKYA 3L06A 4GQBA 4EDHA 1NRIA 1PVOA 1LFAA 4JEHA 2E7ZA 3GLVA 5EYPB 3TVYA 4GKKB 4MROA 4OL9A 3HKBA 3BBLA 2ZG6A 4KNPA 4V0OA 3E9DA 1G8FA 1W73A 4Z3DA 1Q7CA 2B6NA 1C1HA 5LIRA 3QPWA 4RH1A 3SQMA 1G5TA 1GO2A 3CB4A 4JDUA 1EUYA 1P72A 1JLHA 2QS9A 5T6BA 3HJHA 1LLFA 3FOAA 3PPVA 2JJ8A 4M7PA 3WMFA 4Z49A 4Z7JA 4QLAA 4W7SA 9ABPA 3OPYI 3BICA 1GCUA 7ABPA 3Q7EA 4RIFA 3TGLA 1ZH6A 3Q11A 4G5YA 5ALGA 2PR2A 3JQGB 2JHPA 2PH3A 2OENG 4JR0A 1WDLA 2QTVA 4JAVC 4KTVE 4YAIA 2XE8A 6REQA 5AK6A 4EYEA 2IJGX 3ECCA 4U4AA 3QLEA 1B26A 4MKFA 2IH4A 4CWAA 4MHSA 4YRBA 2QX4A 4HTFB 1J8FA 3WWCA 2GFIA 2WIBA 2QLLA 2ZS7A 1L5OA 2MINA 3CW2A 1KYTA 1LKZA 3H65A 4LGVA 4UHEA 5FOXA 4EFDA 4YMTA 3ZQUA 4EFKA 2IH5A 1K7EB 1SCKA 4CG3A 1G8JA 5IKPA 3X2FA 2C8VA 1VQ1A 4FFOA 3K5PA 4PYLA 5ED0A 1HDXA 3KJHA 2YNMA 4P4TA 4UM7A 5HKKA 4KHPB 1AB6A