5MHSE

T1l reovirus sigma1 complexed with 5c6 fab fragments
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
221
structure length
210
Chain Sequence
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYAIHWVRQSPLEWLGVIWSGGSTDYNAAFISRLSISKDNFKSQVFFKMNSLQSNDTAIYYCARKEELYGYDGYLFFDVWGAGTTVTVSSAKTTAPSVYPLVPSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Reovirus sigma 1 Interactions with Two Neutralizing Antibodies.
pubmed doi rcsb
source organism Reovirus type 1 (strain lang)
molecule tags Immune system
molecule keywords Outer capsid protein sigma-1
total genus 26
structure length 210
sequence length 221
chains with identical sequence H, N
ec nomenclature
pdb deposition date 2016-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mhsE02
4DUXA 2DIAA 5DO2D 5HDBF 5JW4M 5GISL 4L8SA 4HUWB 3PDOA 2ZNXA 1J1OH 3SE3C 1YDPA 5I1CH 4JRYD 2XQYK 4U1IA 3FO1A 2VDRH 2W0PA 2X6MA 3QEQA 4UUJA 2DDQL 5LGJA 1X5YA 4NPYA 3VFNB 1S7UB 3MOQA 4I2XB 1BFVL 5IMKA 2BNRB 3LRHA 5K9OB 1KB5H 1FQ9C 4QXGH 2GJ6B 1MF2H 4R97C 5GRJH 4Q97A 5HHVL 1N6QL 1CWVA 1VGKB 2XNAA 3GJFH 3T0DA 1MCIA 4NKOA 1X7QB 2BVQB 3CFJA 4X5XA 2P4AB 1U6AL 4EDWL 3OF6D 4GRWF 1MFEL 1DQJB 1DCLA 1LP9B 1NFIB 4Z77A 3QWOB 4JHWL 4OFPA 5DUPH 4D3CH 2FGZA 4LLAA 1F58H 3LEVH 5JW3L 4YIQA 4YHLL 4P2QA 2F54D 3LDBC 3LSOB 5EN2A 4HJGB 4WFFE 1QFUL 1K4CA 4UU9B 3SGDI 5ACLA 1NDMA 3WNMA 3MNZB 1CD9B 1FHGA 4J4PC 4PR5B 5BO1L 5C0CB 4UQ3B 3IRZA 4GW1B 4RFEB 2HMIC 3TYFA 1FG9C 3K8LA 3GSWA 3GK8L 1CFTB 4XPFL 3WXVH 4XNZB 5KS9E 5D1QA 5ERWB 2XTJC 1X5LA 5D1XB 3HUJF 5EDXA 5EZJA 5I9QB 5KSUA 3G5YA 1OPGL 4UT9H 1S8DA 4JFEE 3HMWH 5BJTB 2HT2D 4KMTH 5GGQH 4HKXA 4U05A 5BOPA 1D5IH 3QEUB 3O4LA 3MRHB 3BW9B 3U46B 3TNNB 4ZS7L 5I17A 1W0VB 4I3SL 3L3KB 4DVRL 2O61A 3CH8A 3DWTA 4Z5RA 4JFHE 1YYLH 3MV8D 4QKXB 1MIMH 2VDNL 1Q9LA 4CJ1A 2R29H 1I7ZB 2JK5A 2IH3A 3HPJA 4Z95H 5L2KB 4DKFL 3C6LB 3KPLA 1MJ8H 4QHKI 3TT1H 4LSQH 1NCUA 5HHOB 1I9RL 3FFDA 4WU5B 2PTTB 1Q72L 3EDDA 2XIDA 1XGYH 1EDQA 4PJDE 3VXTB 4ZUUA 4G8GE 4HG4K 3RIFK 4QGTA 2AVGA 5ITFB 3UTTE 3QDGE 2YKLH 1KPVA 4KVNH 2NY2B 5IVXE 2KPNA 5SX4I 1G9NH 3C5SB 5I2IB 2OR7A 3DX9A 2P45B 4P3WA 2BXYA 4R7NA 1U3HA 1ADQH 4HUXA 4KMLB 5FYJU 1LO0L 3VJ6A 3QDHA 4JN1H 4L4TD 4NSKB 3SO5A 1U8IB 4PJ8B 3TVMA 3FCTA 2QHRL 2HFFB 5HBBA 5GHWL 2DQEL 1KCSH 3VG9C 3MGTA 4MAUL 4WUUE 3BHBA 1NGYB 2J2ZA 4RAHA 1XZ0B 5BQ7A 2DQGL 4CVZB 3NFSH 4FP8H 3UTSB 5I1GL 5JO5B 3EIFA 2DM4A 2BOCB 2EYSB 4RFNB 5F70A 3O3UN 4BH7A 3QEHB 5GIRA 4F9LA 2BHYA 4LSPH 3CC5B 2XWJA 4BQ8A 1BOGB 3QP3A 1TVHB 4M7LH 2JB6A 3DBXB 5CBEA 5FGBA 2CGRH 4HKBA 5E24E 1U93B 1AGCA 2VXVL 2E27L 5JW5B 1F2QA 3OR6B 5EFIA 1JTPA 4HQQH 2YPLA 1VFBA 1GGTA 1T6VN 4HJJL 1FNSH 4WFGD 1QEWB 3OB0H 2OXHA 4YO0A 1KC5H 3M1BA 5IR1B 2VDMH 5HHOE 4WWKB 4E42B 4F15C 2VABA 2EDRA 3RWFB 3OB0K 1W72L 3H6JA 3TH3T 3V5DB 4TSBH 3PHOA 1KIUA 5DWUL 5HGDA 5JXED 5EUOA 5HGHB 5B3JF 4MNQB 1I85A 4M8QB 3S36H 3PWLA 1LNUB 1E27A 1G7LA 5GS0H 1JGUH 3IDMA 4TVSa 5EBWB 4YDIH 3RHWF 2YD6A 1NMBL 3KPSE 4LAJH 1A4JB 3D2UD 3U7WL 1KJ2A 1KBGL 3ARBA 3DUSA 1BREA 1LDPH 1X5AA 4H0GA 3SKJH 1OAZH 5EPMB 4TSBL 5DWUH 5FUZH 4JFDE 3WDHA 4TTDC 2P8PB 3I6LD 1UG9A 3BIAX 3LKSB 1KB5L 4Y5YC 4OF8A 1A6ZB 5GGSY 3VXOB 3DO7A 1L9NA 3DX6A 3QEGL 3MUY1 4F80A 3TNMA 2AEPL 1OAYL 4HWUA 4YDJB 4AM0B 3S3PA 2YZ8A 4ODSH 1EBPA 4YDLC 4MQ7B 2HKHL 4HIEB 4OD2A 2XWBB 4UOJA 3WFEH 3VRLF 1G0YR 3MRQB 2H2PC 4Q2ZB 1EVUA 3KXFE 3HI5H 5HHNA 5DYOA 3SDYH 2DQCH 5CZKA 1CICB 1AR2A 2D31B 3JWOL 5MENE 3JUYA 4KI1A 1MCBA 4ODTH 2J88L 5DTFB 1TPXB 1FORH 2OR9L 4PJ7B 4WI8A 2K7PA 4XP4H 5B8CA 3TN0C 3UTQB 3VGHA 2DIJA 3TIDA 4O2FB 4X4ME 3VXRD 1UM5L 1KXTB 3RVVD 5AD0B 4M7ZB 4HUVA 4LSSL 5IMKB 1JGDA 3F7YB 2WWMD 2H2SD 4P4RB 2DQUL 1I4FB 3WFCL 5JOPD 5I16B 3VWJB 2AJXH 3QDJA 1LEGB 1E4XL 2BVQA 4X5XB 2AK1H 3W11C 5DT1H 2UVEA 4KUCD 1EGJA 5C9JB 4Z0XA 2E7LC 5SX5H 3C08L 1T66D 3TO4B 5HHXL 2APWA 2OMNA 2ARJA 1X4XA 2J8UE 4BH8B 5JPNB 3DX8A 3A6OA 2DBLL 1AGBB 4NM8L 5I66B 1UQSA 2FD6L 3A67L 3UTTB 2FB4H 3IAQA 2DWDA 3MGOA 1FSKB 3C87A 5BRZE 4NM4H 1I9RH 3QJHB 4UU9A 2IANB 4UTAH 4RMWA 3M8OL 5JHDB 1F00I 1VACA 5ALBL 2V2XA 3PIQA 4MJID 1OHQA 3ZDXE 2NX5A 5BS0D 1U8PA 1NGPL 1GSMA 3MRFB 3ULUD 3KS0J 1NMBH 1CK0L 4NCC1 1UKSA 5ERWA 3CSYA 4HT1H 2MNUA 2W60B 4LP4A 5F8RC 4PJ7E 3HNTL 3V52H 1KV3A 3VJ6B 4FQ1L 1OTSD 3VXUA 4K23L 4X83A 4X6DB 5T1LB 1YY8B 4UB0L 1LE5B 2I60H 4UDTB 5HVHB 5MENA 4GKSB 1RFDH 2AEQL 4L3EA 5HI5C 3BMVA 1XGUA 5FOBB 3R0NA 4DGIL 4N5ED 1EEYB 2JJSA 1WISA 3WIHA 4AK1A 2MPAL 5IB4A 1CL7H 2MOVA 3QQ4A 5DHYA 4MDIB 1K5NA 3Q1SH 4WRLA 5F6HI 2Y9RT 4Z7UE 4YHNA 1CT8B 4HKJB 1MWAB 4I9WD 2ICWB 1NMCB 1F4WL 3D5OF 4I77H 4XX1E 4QHLA 3RWFA 4RQQA 4HKZA 3QXDB 5INCB 3UPRA 1CGSL 5TF1L 1ZEAL 1YY9D 4R0LA 1DSFH 1RULL 5DA4A 5IW1B 4UNTA 2EDWA 1FZJB 3PWLB 1RZFH 4WDIB 5C07A 3LS4H 4GBXD 5C0EA 3CDFA 3BSZH 3TA3C 5E0QA 1TLKA 4JM4L 3FKUS 4WTWA 4Q9QL 3I9GH 3UJTL 2NY4B 2APXA 3PWPB 2WBJA 3P40A 4W4NA 4YPGA 3C5SA 3MV8A 5E2WH 4IIQA 3UJJL 4HCRA 3P9LB 4KUCF 5GRZA 1BWMA 5E6IB 1BQHA 4JKPH 1FRGL 4MQSB 4PGCB 5H94A 3DUHA 4JFYB 2VR9A 3WIFA 5BXFB 1I8IA 4OUUB 1RIVH 1DDHA 2EKSA 4HUUA 2FEDC 4N5EC 1CLZH 4V1DA 5ADOL 3DX6B 3AMLA 3H9SA 1FBIL 3GIZL 3QA3A 1RUAL 3FOMA 4ONHB 4AH2B 3G08A 4LIQL 1F45A 4MZ3A 1B6UA 1XF2A 2QKIA 3HG1D 3PGCA 3L3OA 2XV6B 1A3LH 5CJ5A 3DRQB 1OAUH 1UWGL 3TBYB 3S88H 2Q1EA 3INUH 4H25B 2FCBA 3FRUA 4P2OA 5KSVB 3VD7A 4ONFH 4QT5A 4Z7UB 3R06B 3ULVL 1IZKA 1MIEH 1YEEH 1A1NA 1DQDH 3ALPA 5C9KA 4AIXA 3RWEB 2AS5M 3UTPE 3BT2H 3W39A 3PQYE 1F4HA 1UKTA 5FM8A 1P4BH 4BM7A 2CIIA 3QG7L 1PZ5B 4KJYA 1OTTD 2H26A 3VD9A 4LCCA 1NBVH 2P49B 2QJDA 1LO4H 3MJ7A 4XAWL 4FABH 5D7KE 4WO4A 3WFHB 1ETZA 4NUJA 4Y1AE 2AGJH 4ZPTB 3D39D 5H2BA 3IVKA 3ULUL 4ELKB 4MJIA 1CLOH 3BUYB 3MREA 2YUZA 2AABL 3SO3C 4XNMB 2A73B 3VD3A 1NUGA 1ZV5A 4N90E 5C2BH 5E9DE 3WHE1 3D25B 2BVPA 4UBDC 4NO5B 4U2ZA 5KW9L 3VFVB 4YHIB 4LK4A 1JYXA 3ESUF 1CXFA 3RL2A 1I8LA 3G9AB 1I8MB 4F7TA 3V0WH 4XBGB 1YEJL 3DYOA 1AE6L 5DMIH 2Y5TB 3SE9H 3X12B 3TV3L 3GSRB 2YD7A 4HXBH 4Q9BA 1FSKC 2Z8VC 5CZXD 3GJFA 3B2UD 4NQEA 3IAPA 5FUCE 1FL5B 4JG1H 5DFVD 1XCTB 4LOUC 3WN5B 4R6UA 4QXGL 5DJXA 2P8MA 3EYOA 3OPZH 4HFWB 4DZ8A 4OLWL 1FN4B 4UBDD 4JCMA 3BDYL 1XIWC 5DZNA 3ZMRA 2BX5A 2OR8A 4TOYH 1I7TA 1XF3A 2OQJA 5SWQA 2IAND 4ESKA 1IC5H 3MV9D 1A5FL 3CFCH 35C8L 4DUWA 4NQXA 2UZIH 1J11A 1N64L 3C8KA 1BFVH 4ELME 2JELL 4Q7DA 3L3JB 2ZSWA 3V9FA 2JB5H 1CDJA 3GIVA 1IQWH 4P57B 5JOPE 5I8OH 5IWLC 1VFAB 5KTEH 1JNHB 3RVUC 1MCPH 1A1OA 3Q6GL 4KH2A 5JW4R 2DRUA 1HSAA 4C56D 3L6FA 3ZKXC 4LARL 1TJIH 3SGJC 1JWUA 4JO1L 4MCZB 3WKML 2XN9B 3ROOB 3GM8A 3W0WB 5I8CA 1U8MA 5E08L 1ADQL 2ICCA 4HWBH 3BX7C 2IALA 5IW1A 5JOEA 3KVQA 1J0KA 1N2RB 5FF6A 1AKJA 4S1DD 4GG6A 5K93A 4IMLA 3MRFA 2IFGA 4PJCE 3FN0L 4LCWD 5C0BD 3HE7A 3PP4H 3VH8B 3ES6B 5MHSD 2ZOKA 1FFRA 2XICA 4P2RA 3QIWD 4ODWB 3F12B 4WTXA 1EUUA 2CLRB 4EVNB 1CVRA 4PY8I 5T1MB 1T4KA 1TXKA 5JW3H 4LAQH 1BBDL 3HZVB 1G1CA 5C71A 4G80B 2FYYB 5J6GB 4M1CD 1KCRL 5F6IB 1I8KB 2R15A 4ONHA 3GHBL 4MB5A 3QJFA 1EO8H 5E00A 5T33H 3O0RH 4RGNE 4WV1A 1RURH 1KLUA 3PG2A 4ZS6C 1PKQA 4OIIH 3DURB 2F8OA 3TBYA 4MNGA 1T83A 5D5MF 1ZVSB 4JKPL 1MQ8A 3MTRA 2HTLD 5A43C 3O6KL 4Z7VE 3MLTA 1PG7W 3QIWC 4WWKC 3LQAL 1JGVL 4R4BB 4Y4HB 2FIRT 1X5XA 3GIZH 4JPWL 2XG4A 5GPRA 4KZEH 3BN9C 4ODXB 4WW2A 3W81A 1E6JH 3SN6N 3O41B 5GGSA 1NEZG 3JWDH 1A7PH 1CGVA 3ILQD 3PABA 3O4LE 2H26B 3MOAH 4GKZA 2PO6C 3HAEH 5DMKA 5HYJA 3V5KB 1BD2A 4PJCB 3MJ7B 1I9JL 3ARZA 5CP3A 3T1WA 5C6WH 4EI5A 3G6DL 1B0WA 3T1FA 1INQA 2YD4A 3OJ2C 4IS6B 3LEYL 2BJMH 1YEIH 5HD8C 4KTYA 5D1QC 1AXIB 3UYOD 2YBRA 4LVOB 1G6RB 3LD8B 3KNBA 3ZDXF 3QCTH 3GEWB 1PYWA 1LO2L 2ZUQC 4NGHL 3ZSTA 2VKWA 2A6KA 3MODL 3FT4A 1AP2B 2CGRL 3L7FA 1C16B 1N5AA 4J8RA 5D1ZA 2AKRA 1JWMB 3L95A 3T3MF 3MYJB 2ZZUT 2E7BA 3OB8A 1B90A 1RZKL 2DWEA 3MFFB 3DSFH 4G9FD 3FQXB 3L9RA 5ILTH 3BN3B 2UWEE 5D93C 3B9EA 4RAVB 1CDGA 3ZE0E 4M5ZH 5CIPH 4AL8L 4H25A 4F7PB 4J23A 2V17L 5J3HC 3HC3L 4G6JL 1YUHA 4E41B 5CBAA 1MEXL 2CDFA 1EVTC 4P23C 5DJXB 2ESVE 4L4VA 1QZ1A 4JKWA 3CUPB 5CJOH 2VZSA 5AG9A 4L8DB 1M7XA 4ONGL 4ELMB 4JRXB 4PJBA 3RVTC 2V6HA 1RHHB 4BA8A 4PS4L 1JNNL 1DP0A 2B2XL 3W11D 1NBQA 1ONQA 2WAHA 3P4NB 2IMNA 5B39B 4WO4B 2FB4L 3SKMB 4Z18A 2DLHA 2YC1B 5CHNA 2BC4A 2MKLC 5EZLB 2WANA 3AUVA 4NN7C 5C86A 4Z78B 4HUWA 1CFBA 4U6HB 4NQCD 4I3RH 1B0GB 3EO9H 3EZ8A 2XWTA 2FLBT 2R69H 4HW6A 3RHWK 5JQHC 4Z95L 1UCBL 3NACH 3F7VA 1T6WA 2MQ0A 3I6KB 2BNRD 2NY3B 4Z7VA 5IB3A 5FKAB 3V4UL 3X3GL 3LKPA 4FFWC 1GVIA 2UY6A 2VITB 3EKCA 5FA3A 2KZ1B 5SWSD 1AH1A 2VJXA 3BE1H 2EDDA 2EXWD 4K7FB 2EDJA 1WCBA 4KWUA 4S10A 4YPJA 3RPKA 4G6ML 4NCC2 3V6FA 4ACPA 5GS1A 4TRPH 5TH2B 3IKCB 2DQHL 4NC1E 4XP4L 1WAAF 4XCFL 4WTZA 3RJDA 3VDAA 5B4MC 3SBWC 1CU4L 5EUKA 5E94B 1KB9K 3VCLA 3ARDA 5ANMB 3P4OA 3N06B 2EICA 3MLYH 3O6FA 5EBMA 5FHBL 3QFJB 1NCTA 2PYEA 1F6FB 1GZPB 4XCYA 2NNAA 5HHPB 2CLZA 5J13C 1MJJB 1WWBX 5HI3C 1FORL 2OR9H 3EFFA 2ZJSH 5BO1H 5TGBB 1N6VA 3BH9A 3QQ9C 3PWJB 5DJ0A 2EZ0C 3MRLA 3AGVA 3WO3B 1EHXA 2ZCLH 1OSZB 4OCYL 1T3FA 3QFDB 5FGSA 3WEXA 5C0GA 5DRXA 3O3EA 2FDBP 3WNPA 1IILE 2NW2A 2XPGA 4JAMA 1UM6L 2BMKB 1CDHA 1S7XA 1X6NA 4YX2L 4N5UA 1X9QA 2IFFH 1IAIL 1AC0A 1XF4B 4HKXB 1DFBH 5F96H 1OAKH 4XPGL 3GUTA 2VXQL 1LDPL 4IDLA 3S4SA 5CGTA 1N8ZA 1TZHB 3VFNA 7CGTA 3BKCH 3FO9A 4X6EB 4U1KA 5E8EB 3X14B 1LE9A 2J4WL 1TETL 5ICXB 2FHBA 1S78C 3Q5YA 4KROB 4ZD3L 4NKOB 1UM6H 1YMMA 1MRFL 1NGWB 4KK8C 5IUSA 3S98A 4DVRH 3RNKB 2G2RA 4W6YB 4QO1A 2BVEA 1OAKL 4NCDA 1DQJA 1LP9A 1NFIA 3L5XH 5BZDA 4MHHG 5KSBB 4GG6B 5KN5A 5D9SA 1FH5H 1KULA 3H3PL 4U1GB 4M6MH 4L5FL 3DRTA 5T5NG 3LN5A 1T22A 2DQFB 3LSOA 5EN2B 4Z7OE 1PLGL 3CFKA 3QZWB 1UACH 1KLFA 2GTZB 1IVLA 1MRDH 1TQCC 3BP7B 3FFDB 4OFIA 4HWBA 4N1HB 2UWEB 3WUWB 4NYLB 2EDFA 1SEQL 3MLSH 5TE6H 3LKQA 4W4OA 1RUQH 3T0XA 3NCJH 2X4UB 2EIEA 4DZBA 2X09A 1ODAA 4OD3H 2H6PA 1TENA 2ZG1A 4X6FA 3D39B 1C1EH 3NFNB 3GSQB 4G6MH 1IRAY 1BD2D 5F9OL 4PV9B 4PREA 3REWB 3BOVA 3PP3H 3CMGA 1OAXL 3DI2B 4F7PA 3F58L 3D0VB 5HHME 1UZ8A 4UTBH 3VXME 4FXKA 4KZDL 3HZYA 1JMZA 4IDJH 3AY4A 1F42A 3LB6C 3WHE0 4A6YH 2RJMA 3MGTB 5JDSA 3IXTA 3MCKA 1YJDC 4JDTL 3W9DA 4LPUA 5HVHC 4LLDB 1ERNA 4HIIA 4S2SB 1B2WH 4ZO9A 1Z6JT 3MRNB 1UZ6E 3KLAA 5DJYA 5CKGA 2APFA 3W9EB 3E2HB 4KK9C 1WTGT 4OQTL 5SWSA 5EFIB 3CAFA 5F7WC 3V5HA 3K80A 1NEUA 1CF8H 1GOFA 2IAMD 3BXNB 3GO1H 4JDVB 1TJGL 4GO6B 4KQ4H 1CS6A 3HG1B 3V6ZA 4EI5B 1B6DA 3QRGL 4ZTOH 3T4AA 4TNWF 2HFGL 4YE4H 4DFIA 1EJOL 1JPST 3F7PC 4Y19D 4YC2C 3MUHL 5D5MB 4HH9B 1YC8A 5IIEB 3GGWB 3WXWL 4JG0H 4OZFA 4G7YH 2A1WH 4X6CA 1GOHA 1UJ3A 2AV7A 1PYWB 4Y4FC 3I2CL 3HAEA 1U3HD 3UTZB 3MPCA 4ZUUB 4YEFA 5IOPB 1JGLH 2JIXD 1GHFL 5DF0A 1IL1B 1BLNB 3D0LA 5J57B 5C0AA 3HC0B 1YEDB 4UDUB 5TF0A 1R3IH 2YPKB 1Z9SA 2EYTA 4ZUWB 3EUUA 4XZUB 3S37L 4BYHA 3ULUC 1TCMA 3LEYH 4NHCL 4G8EB 3U36A 2Z4QB 4YH6A 5DZLA 5J9PB 1OLZA 3U0PB 4WHYG 1I7RB 1Z9MA 2ZCHH 3O2DL 1IM3B 1MCEA 2VWEC 4NGHH 5E4EB 3VXOA 1QLEH 3QIUC 4OD3L 5IVXB 1NGYA 1TJHH 1Z3GH 5C08E 1T2QH 2FBJH 1LVEA 4XVJL 3MRRA 1KLGA 5EOCL 1CFVL 5KVMC 1KPRB 4DOHB 5GIRB 2DQGH 2CLZB 1P7QD 4OKDA 3MR9B 5GSRA 1WTLA 3TN0B 4FQCL 5JPMA 3BH9B 1IC4L 3OR6A 5E2VL 2VLKA 3GKWL 1ONQB 3ARVA 3WIIL 2OMBA 5CSZA 4Z76A 1RZJL 2WWKT 3AREC 5IHBA 4Y5XB 2B1HH 2VLRA 1PG7X 3JWDL 1N0LA 3DGCR 2D7TH 2CUHA 3MNWB 4I4WB 4WFFD 3U2SB 1IAII 1I9EA 3OXRA 3GUTB 1C08A 2EIDA 4WNQB 3GMOB 5F7HA 3MRJB 4M6NH 4EDWH 4H88L 1WBXA 4CMHC 2UVFA 4YDLB 1MOEA 2V9TA 2Q3AA 3LKPB 5C3TA 3ABZA 5TDNB 3D85B 1TQBB 2A74B 5FM4A 1IGMH 4L3CB 4TNVK 1N5YH 4ENED 4JPVL 2MJWA 5I1LB 3KDMB 5JW4Q 2YOCA 3V6FB 4JHAL 1WZ1L 2G2RB 3T8XB 4OCWL 2VDOL 3HA0A 1ND0A 1OGAB 4KUZL 1KCRH 8FABB 3U9UA 3BPCB 4Q9QH 5GRXG 4TOYL 2HTKC 5J3HD 2Q8BH 2W0KA 4Y4HD 4L8CA 5I66A 3P4OB 5MEQB 1E4WL 1YNLH 5JLZA 4N1CA 5DVOA 1OWRM 2OXGA 4M1CC 4P46D 3GSNL 4BFBD 3NFPB 2NNAB 2VTFA 4OFDA 4O2CA 1J0HA 2C3VA 1U58A 4WEMB 1IM9D 1FAIH 3CCHA 3TYGL 4PD4K 1ITBB 2VDPH 3VRJA 2E6QA 1L7IH 1PX4A 3PV6A 1U95A 1I1AC 5GGTA 4OLZH 2BSSA 3KWWB 1NAMH 2YD5A 4Y8AA 4L4VE 2GTWB 4L9LA 4C56E 3SDDA 5E4IA 1NBVL 5HD8D 1F4YL 3QUZA 1OWWA 3WNKA 4JQIH 5IJVB 2DJUA 3OG6B 4G6FD 4JJ5A 2DL2A 3MRPB 1WLHA 4B0MM 4ZAKC 1YQVH 4PRHE 1MH5A 4S1SL 4WHCA 5CD5C 1H5BA 4Y5XC 4MA8H 4P3DA 4G6KH 3F7YA 5MENB 2B7DT 3GZKA 3L3DB 3RGVC 1PEZA 3X14A 2Z8RA 1MI5E 3QNZA 1MVUA 4K23H 4X6BA 4GRMB 1UM5H 4Y19B 4CNIA 3HNSH 1F02I 3IAGC 1XF5A 1WWCA 43CAA 3B5TA 4EUPB 2VDKL 1P9MA 1QSEA 4Y16D 3VI3F 1NBYA 5MEPA 5LAXB 3T08A 5BZDB 3V5HB 1JCKA 5L9DL 2C26A 5CEXA 2HG5B 2OL3L 3HG1A 1KPUA 3D3VA 3C5ZC 2WUCH 1UJ3C 3KR3H 4KTEH 4U0RB 4H20H 4QHLB 1AJ7L 3CFKB 4MJ2A 4N8CH 3ZHLA 4XP9H 4LKCA 3SY0B 4LLQA 3WS3A 2ENYA 4ZNCD 5GS0C 1WAAE 5JHLL 4XNXL 1KJ2L 5DZOA 4PJAA 1OTUD 5ESAA 3AC0A 1ZTXH 5T1DL 2ZPKH 3ARGB 4NM4L 1F4AA 1D6VH 3BDYH 3X11B 4JREC 5J6HA 1MJUH 1UT9A 3MJ9A 2APVA 5BRZB 4JHZA 3BZ4B 1FO0H 3CSYB 3GSXA 5KSAA 3QUYA 2X4SA 4Y4FB 3QAZB 4PJFB 3P9LA 2Q86A 5KS9A 4MNQD 4OJFL 2GHWB 5K9QG 1KYOK 5L6YL 3SE9L 2BVOB 1YPZE 1X5JA 4WW2C 4JY5L 4TYUA 2IF7A 3B8YA 4XVTH 5A16B 4DUVA 1R6VA 5ICZB 4NQSB 5CP7A 4LASH 1U8QA 4X6DA 1RIVL 3FO1B 1P6AB 2AJ3A 1BVZA 1S5HA 3ARTA 5IVXA 3SGKA 1JGUL 3I6GB 3DVIA 4XMPH 1IEHA 3P4MA 3LEXB 2OZ4A 3UBXB 3IF1B 2A0LD 1U92A 1RU9L 1VKXA 4NHUB 5D2LB 4NKMB 1A7RH 2EH8L 4O2EA 5GZND 3HR6A 4XP6H 3S35H 3VA6A 2W38A 4YGVA 1NPUA 2APBA 2NTFA 1R3LB 5F6HJ 1KCUH 1DBBL 3QXWA 4ONFL 4PY7A 1NCBH 1QBML 5C0RH 3HLAA 1GIGL 4YNYA 3L7EA 5EC1B 1HNGA 2IJ0C 3MROA 1RVFH 4PRPA 5C0JB 2Y06L 4LEOB 4PJGB 1T5WA 1F4WH 2Z93B 3P0YH 1IAOB 1S9YB 3O9WD 3WE6A 1PZ5A 4RISH 4U6VH 3F7RA 1P4BL 3M07A 4XP5H 4MJ4A 4OCNC 4N8VG 4X9IA 5L88L 4P46A 2W1NA 4ODBD 4X6CF 3UTOA 3RUGA 4YHOL 1AXSA 3FOLA 1CFTA 3UC0L 1HDMB 1XGPA 4Z7WB 4Q9RH 3AMKA 3GHBH 3UJIH 4XZUA 1NKOA 2HRPH 1G7MA 3QDGA 4Y5VC 5FIEA 4OIIL 2AV1B 4G7YL 2HJLB 2J3SA 3U9UB 1HKLH 4OUUA 2MHAB 3VW3H 3QNXA 5EWIH 1RJYA 2FO4A 4JY4B 1CXIA 2EDEA 3WL9A 3WFCH 1Z9LA 4OF3A 3AROA 5DEFA 1C5DA 1EFXB 5DJ6B 3R8BB 4UT7L 1MSPA 5I17B 5ISZD 5C08D 4KZDH 3O3DB 4HLZG 4PTUA 1J10A 1YYMH 4JVUA 4KROC 4XXCA 2IAMC 5MI0C 3MRGB 4D9QE 3RAJL 1HIMH 2G75A 1J8HA 1GGYA 2Y6SD 3VFGH 5DQJB 4UV7L 3C09C 2J6EH 4CDGC 4PB9H 3TFKD 2NY0B 3QEQE 2Z35B 1XR8A 1VFMA 5I1EL 3RWHA 2WBJD 4X7SL 2YRPA 4QTIH 5D7SH 2PNDA 5FYKL 4E5XA 3IJSA 4U1SB 4S0SD 4M3KB 5HHOA 5EIIB 5DD6B 2XZAH 1H5BB 5F1NA 4XBPA 5TDNA 4JFQA 1T0MB 2BSED 3HNVH 4XCFH 3QNZB 4OLZL 1LWRA 5D1XD 4NO0A 4C83A 2QR0A 3L5WB 1II4E 1A22B 1OSPH 4BSVA 4J4PA 1UENA 3EYUL 4P5MA 1ZT4A 2C1PB 5DQ9B 4P57A 5I18H 3DTXB 5HVFB 1F2XK 4WHTA 5HYQA 5E9DA 4K9EC 5D6CB 1K4DA 2VXTH 3DX9B 4JM2B 2DS4A 5SV4A 1ZS8B 3NABL 2B0SH 3GI9H 3D25A 1S8DB 4JY6A 1MHHB 4Z9KB 3FAWA 2FX7L 4ZFOA 4JANA 3O3BB 2X4TA 5CGMA 3WS3B 1JNLL 2Z92A 4XPTH 4PJAB 4PJ9A 5M95B 3QG6A 1U58B 5C0CA 2A0LC 1IAKB 4JHWH 3VXSB 3X11A 1DFBL 3CSBA 4YBQD 5F96L 4XPBL 1SMOA 1TVHA 5C7XL 4G42A 2MCG1 5JW5A 3IU4L 5KSAB 5H37G 4R90L 4G9FB 5DS8B 5L2KA 5I30L 2P24A 4KVCH 2V9RA 4K3DH 3SGKC 4X4YB 1E4XH 4XB7A 4QNPE 1HHJB 2XTJB 5D1XC 2F8XC 3QEUA 3TVMB 5GGVH 1JV5A 4KDTC 1KSRA 5DEGA 1XH3A 2GSIA 5IVNA 1U8QB 3GO1L 4HC1A 5KSAD 5KJRL 4LSSH 2V2TB 4P3DB 1CLYL 4CVZA 4IHOA 5KAQF 4GRMA 5DMGC 3W0WE 3O45A 3EGSB 4GRWE 5FKPA 1LGVA 1V7ML 5T1KA 1S3KL 4QRRA 2XKNA 1U93A 3UTSE 3TZVA 4LLUB 4RDQF 4L1HA 4JFFE 3UBXI 1KPVB 5L8JB 1KTLB 2BXZA 4PJHE 4P49A 1CGXA 4QTIL 5FYKH 5IF0A 3GSOA 5E1AA 3ARRA 1S7VB 3ROLB 5C0RL 4ORGA 3HLAB 3RVXC 4MA1B 3KHOA 3IDXL 3VFGL 1NUDA 2CK0L 3WFEL 1LEIB 3EO9L 3O41A 2OJZL 2EO9A 2P42B 4Z7OF 4LEXL 4AJ0A 4LEOA 4PJGA 1ZOXA 1U8MB 5D6DA 3BHBB 4WFHD 1P4IH 2AXFB 5D93B 1AQKH 4HMDA 3UAJD 3UTSA 4P4KA 1AXTH 3OZ9L 4RGMB 1QFPA 4X98B 2DIBA 2LU4A 4AM0A 4ZTPH 3H9YA 5FUCC 4PJCA 4HK3N 5J6HB 1BAFH 1CZ8L 1S7SA 2VZ1A 4QNPF 2VN7A 4WI3A 4HKBB 5TE6L 1QRNB 1A4JA 1HQRB 1X4YA 3BH8B 2R2EB 3QUMH 3QUKA 5L2JB 1SJHA 5B38B 4H5SB 1KIRA 1U3HB 3RWCB 3R1GL 1G6RA 4D8PB 3CU1A 3JV4B 3B8SA 4O51A 2VDPL 5DMGD 5FK9A 4WWKA 2E6PA 3C5ZB 3K74B 2BRRL 4XPAH 5D1ZB 2EEAA 2B1HL 2BNUB 3H7BB 4XWGH 1NEZA 3UCRA 3I6GA 2ILLA 3EDKA 4QXTB 4GRWB 4L29A 5TQ0L 4JFOA 2DKSA 3ZT6A 4JFDD 2WLYA 5CZVL 4MD5B 1CBVL 4KRLB 2XWJB 1D5XB 3MLWH 4GXUN 4GQ9L 3AXLB 4ODUB 5FXCH 1VERA 4YGVB 3DX7B 2PR4H 4AL8H 1BBJB 5IBTL 4MA7L 1ZEAH 2OM5A 4Y4HC 4NZUH 2EXYC 2EE2A 3KJ6L 3CUPA 3S34H 3N1QC 3GBNH 5JPNA 4RX4A 1KTDB 1ZANH 1U8LB 4W68A 5E2WL 2G60H 2XTLA 4ELMF 3UDWA 3MCG1 4KPHL 3MRCB 1CGUA 4XXDA 4R96A 3HNVL 4OLXH 4L4JA 2XWBA 1QRNE 2CMRH 2YD3A 3QDJB 3DARA 1A6UH 2OZ4L 3K0WA 3P30H 5AAMA 1DTUA 5DUMH 4GXUM 3NAAH 4LDEB 1HDMA 1MCHA 2Q76A 5C9JA 1Z3GL 2V9QA 3FRPA 1K8DA 3BJ91 4JFPB 3STLA 5GJSH 2QQLL 4AQ1B 4M5YH 1ADQA 3HS0B 1DBJH 1LO3H 3WKNA 1H8NA 2VXTL 1EBAA 3FB6A 5GGTH 2ORBH 3RNQB 5JQ6L 3VXPB 4R4FH 4X0KB 3B83A 4P2OC 4YHKH 4GOSA 1FE8L 4NDMB 2HFGH 2M1KA 5B3NA 2EYRA 1XGRB 5IFJB 4M93C 1M71B 4BZ2L 2F54A 4TUJB 4JVPA 5HJ3A 1WBZB 3T2QA 4NQTA 5T1LD 1LO5B 4WFED 4PUBH 1NUNB 1LO0H 4JFXA 2EE3A 3SJVA 3DYPA 4BFIB 4JGUA 3KYMA 4U3CA 7FABH 4LVNC 4MLIA 3D9AL 1ES0A 3RIAK 1BIHA 1RZJC 3WNNA 5D72H 1FFPA 1P4LB 2EC9T 3N0PB 5C09A 1TIUA 1R3KA 4LSTL 3HZKB 5CEZL 1WEJL 3KPPB 5HHPA 5LCVH 2XYCA 5LXGL 5EO1B 2NXZD 3AREB 2A2QT 4OTXL 3LKRA 1YECL 3ZZ1A 3U1SH 5C0AD 3B9AA 2GJJA 5CD3B 3LS5L 1OSZA 3CSPA 2QR0B 1IGTB 3JUZA 3OKEB 1NL0H 3BI9X 2EIBA 2YWZA 2BMKA 2V5YA 4Z78A 1IKFL 4JM2D 3TLRA 1MWAL 2VXUH 5E9DB 3WJLC 2LFGA 4DQOL 3ARDC 3I3BA 1MIML 2VDNH 2WV3A 5SWZB 1R5VA 2MCPL 4FZEH 4Y0GA 1DBAH 1T7YA 2DQUH 2NY5L 1J0JA 3EYVA 1BGXH 3CFEB 1Y0LA 4DKAA 4RMTA 4OZIA 2OJZH 5CJQL 4FFWD 5E95B 5T1LA 1H8SA 4RAUA 3ARYA 1OTTC 4I77L 3GMRB 4N8PA 5CAYB 1QSEE 2AXFA 1MFBL 2X1OA 3VFWA 4GXVH 4Y4KD 4G43B 4XVJH 1N26A 5LWYH 1J9CT 1IMHC 5I8EB 1XIWD 4LHUB 1ZK9A 2R1WB 3QUKB 4UINL 1QNZL 4LCWB 5C0BB 1GGBH 1T1ZA 5FYJH 1L4IA 3S36X 4JLRA 4M6AA 1ZHLA 4EI5D 2GTZA 4N8VB 4NFBA 3DXAD 1MCOL 1FVDA 2HT3C 4PGCA 5H94B 3HCVB 2LU3A 1HXYA 4GLRH 1I1FB 1MCNA 2J1KA 3D39E 3H9HA 5D7LD 3QCVL 2BNUA 1M7IB 3H7BA 4L4TB 2A9ML 5AUMA 1KGCE 4DZBB 4L3EE 1A14L 4NJ9L 3G6JF 3MRLB 3KPNA 2UZIL 3NPSC 5FOBA 4BZYA 2CDGB 2AJVH 2R1YB 4M93B 1Q9OA 3RDTA 4OM1H 1NCCH 1S7XB 4PJ5E 4Q6IA 5TFSH 3FRUB 4EBQL 3PXHA 3SCMC 5T5FL 4OFVA 3EAKA 4NUGH 1Q0YL 2BDNH 4HS3B 3DPBA 5IBTH 1MJ7H 1RUKL 1A1NB 4ODVL 4XWGL 2BNQB 4PLJC 3CXDH 4Y4KC 1HYSD 1NMAL 1U8HA 1LEIA 4HGKC 4XPHL 2NXZB 4HKZB 5INCA 5DMJB 5CZVH 5EU4B 3HPLB 2N4IA 4XTRD 5HYJE 1XF1A 3BUTA 1EERB 1R24A 3SDAB 1H3VA 5DJZA 3V0WL 1BZQK 5C0DA 3SDXB 1YMMD 3GNML 4MJ5B 5KN5B 4F7TB 4MA3B 4WFHE 4GW1A 3DRTB 4Z8FH 4OD1H 5DUBA 2ZG2A 1J1XH 4KAQH 1ROWA 3S37X 5E6IC 4JM2F 3EW3B 3QB7C 3STBA 1P7KA 4L8SB 5KSAC 3C5ZA 5I1EH 4WWID 4FZEL 4U1IB 4F3FA 4H8WL 4WFEE 4PP2A 4L29B 1KG0B 1RUQL 5IMOB 1GGBL 3L1OH 5IEHA 4GRLC 1CXLA 4Y2OA 4LLVA 4K3EL 4RNRB 4M7LL 5GGVL 5ITBH 5FUOL 4Y5YA 4RIRB 3O6LH 3D0VA 2JCCE 4C58B 5I75B 1IE5A 1RIUH 5F89B 3E0GA 2XY2A 4XMLL 2FH6A 5HHQB 4RZCA 4J3TA 3O2WH 1VFAA 4NKIH 4XC3H 2P8MB 2XT1B 3ZKQD 4LLDA 4HV8A 3RVXD 5KZCB 2ERJB 1C7SA 1KTKE 4JZNA 1JI2A 1HXMA 4P46C 3SKNA 2VLKD 1G7PA 5C8JB 1Z0NA 1P7HL 1U91B 3EYQC 3O4OB 5JPMB 3HZMA 4ZUVB 2Z91B 4UIMA 4QWWC 1V05A 3V6ZB 5E8DH 2OX5A 2ZCKL 3GKWH 3CVHH 4MHHI 3EOBA 2Y5TA 4H8WC 4XNQA 4IJ3C 1H15A 4MA1C 3GIVB 4CU8A 4YC2B 3GI8H 5L2KD 3O9WA 2B4CC 4ZMAT 1J5OH 5J11C 32C2B 1KCUL 1BAFL 1CZ8H 5D7KD 1MRCL 3SCMA 5JMOC 4MX7A 1SY6H 3MRMA 3OKMA 3FFCA 1BQSA 1U41A 4X4ZA 1R0AL 5F7DB 5TE7H 1PKOA 3MMEA 4JRYB 1QFWM 1RVFL 3BW9A 1PQZA 1BVLB 1MREL 5CJQH 4CW1B 5J8OA 5GS1C 5HJ3B 3BAEL 1LDSA 1XAUA 3C8HA 1VGEL 2AABH 4GRLD 3SOBH 3FB7A 2EYTB 1TZIA 3K81A 2CXKA 4HWBL 1T1XA 1UYWL 1IJ9A 2C7UB 3HC3H 3WLWC 2P46B 5IP4A 5HHMD 1Y18A 5FCSH 1DBJL 1T5XB 3PQYA 2FGWH 3O6FC 4UNUA 1T1ZB 1FZMB 2DM3A 4OGYL 5E2TL 3ZHDA 1F97A 3MLTB 1HHKA 2O93L 3IJHB 2ADFL 12E8L 5D7IB 5IWLA 3CH1B 3U4AA 4PBVC 4QWWD 4EOWH 2J6EL 2ATKB 3QHZL 3V5DA 4H1LG 5CSZB 4Z76B 1C8PA 2W59A 4JFEB 4NQXB 3CSGA 4CN6A 3RZCD 1U2HA 1T1YB 1X5IA 2GITB 4CL7A 3THMH 5F3HA 4WHDA 4ZPVA 3Q5TA 2W0LA 1UB5A 2YUXA 1I9IL 4MXQC 4PG9B 3JXAA 4U33A 4NQUA 4KKBD 4KHXH 4KPHH 1EGJH 3G5ZB 4AIZA 1QFUH 5FYLL 3K1KC 3N9GH 4ERSH 3GSVA 3OBAA 3N50A 1CFNB 4PRID 4U2YA 1T66C 5F88A 3L7FB 4MNQE 5MP6H 5C0ND 3W0WA 5FYKD 4KZEL 1H3UA 3LMJH 1KUMA 5E5RB 4G43A 4MJ5A 1AKJB 4LSUH 4BH7B 5AZEL 3MCLL 2BSRB 4P2RE 5GQBA 4L8CB 2NY5C 4KKBC 1J1PH 4Q9RL 3IFLL 2IQ9H 1JPFB 5IMMB 4GT7A 3I75A 3EFDH 3RZCC 2A6KB 1P7QB 4LPWA 3QUZD 3VI4E 4PLNC 5F8QC 1R0AH 4ZODA 3H9HB 1X5GA 4P99A 3IDIA 3TA3A 4UTBL 1IQDB 5JW4N 4Y19E 5EB9A 4X8JB 5E8OA 3S34L 4PTTA 2HKFL 1G0DA 3H7LA 3IDXH 4UQ2B 1JHLL 4Q6IB 2MMXA 5KVFL 1D6EB 2E7MA 2XFXB 2VISB 5I1AB 4X6DF 2CDFB 4M02A 3QIWA 4B50A 2CUMA 3B3IB 5E2TH 1EEQA 2BNQA 3WUZA 4L4VB 4PJXF 3DNKA 2I9LA 4LASL 1KNOA 4FQIL 4I48A 4I0PB 5DDHB 3B9KB 3UTTA 3P77B 1PLGH 2DWEB 3M17B 5FDWB 3KLHD 1BQLH 4NOBA 4OM1L 5JHDA 3GSUB 2PXYB 1RUPL 4U1LA 5HPMB 2IPUG 1OAZL 4MB4A 3MGAA 5CHNB 1JGVH 3SE3A 5FM5O 5DD0H 5FM5M 2OL3H 4OGAC 2J8UB 2F15A 4LRNH 5CBAB 3V52L 2HT3D 4KK8D 5KVEH 3QNYB 1A6WL 1NMAH 5HGAB 3K8MA 1IAOA 3I6KA 1QR1B 4XMKH 1EMTL 1IC4H 2L0DA 2W07A 4RISL 4U6VL 5B38G 1PEWA 1BZ7B 1MPAL 1N6UA 3OKNA 3F65A 3PWPD 4M7JH 3TP4A 3RQ3A 1E4KA 3U7WH 5E8DL 2VXVH 3KLDA 5I1HH 5D2LE 2C9AA 1RY7B 3G6AA 1SVCP 3MLRH 1UJTA 4J3UA 4HBCL 3VXQA 4NZRH 3D2UB 3ZKXB 4BSWA 5HDQL 1X44A 3QXTA 5D2NA 3S96A 4NIKB 2XWTB 1FZMA 4J3VA 1HYSC 4ZNEE 2CDEB 4FQXB 4KTDL 3MA9L 1CT8A 4OZHF 3BP6A 1FVEA 5I8KH 1FYTE 3IF1A 1UXSB 4D9RD 5DVLA 2AXGA 4JREB 3PE9A 2JJSC 4LP5A 4NNYB 3KPSA 3UZVB 4AZ8A 1G6VK 3UPRB 2PYFB 5CILL 1YPZF 4UIMB 3TJHC 1R3LA 3KYOB 4PJHF 3QFDA 2IANE 4XBEL 3SDCC 1RZKC 4ZPVB 4YNYB 1IGCH 1T2XA 1YN7B 5KOVC 4D0CB 5TDPA 1XF4A 1QBLL 4GW4B 1FGNH 3VFOB 4U1HA 1EHLL 3QUYC 5HVWA 1T5WB 4LKXA 4X7SH 3QFJA 4QRSB 3LIZH 4I8DA 3OKMB 3TYGH 1OP3H 2R29L 2VAJA 1WCBB 3D69A 3THML 3U4EB 4NQVB 2VR5A 3FOLB 1SJXA 2ZCKH 4ODHL 4P5MB 1CFSA 3VXSD 5KSBF 1G84A 1NFDE 2D7NA 3BGMA 5GGUA 1INDL 3T4YB 1WVZA 1VSCA 4KHXL 4X6DE 1AI1L 5TH2A 4D9LL 2XZZA 4YHOH 5C6PB 4A6YL 3NGBC 4XC1L 2DYPD 1V3JA 3B9KC 4P5TA 3V7AE 3VI3E 4KI5E 2QL1A 2NY6B 3LIZL 3SEPA 1EXUB 4OLVH 2VO5A 4TVPH 5EUKB 4GKNA 1DANT 1U8NA 2FO4B 5FECB 5L0QB 3WD5L 3RWDA 4OCLC 3R06A 4OGXH 1RZJH 3C60D 2CIKB 3U9PL 3IJHA 3SKOA 3BP7A 1FJ1A 1RSFA 3F8UB 3SO3B 4EN3D 4NQEE 4LLWB 2ZKHL 2JCCF 3IDGA 3IKKA 1EA9C 5EZIH 4NC0B 1YEGL 3FQWB 3BIKB 3LOWA 1CDBA 5JXEA 5DC0A 1VCAA 3HMWL 4C59B 4MAYB 3SPVB 4JO4H 3QIBB 3U4BH 4KK5D 2NQCA 3U0WH 2IBBA 1ETZB 4NUJB 2JIXB 1HH9A 1SBSL 4MSWA 4LQFH 3T4AB 5HI3D 4JGMA 3ARFA 5DUML 2B8OT 1HI6B 4YHML 3QQ9D 4JO2H 3BFOA 4BQ6A 1N0XH 3W2DL 1FG2A 1FZOB 3S4SB 5BOZG 1LO3L 3T77B 5D8JH 4JFYA 4IHOB 1GHFH 3HAEB 1KNOB 3MRNA 5CEZH 2NX5E 2DI9A 1BD2E 3L3GA 4RMUA 2PW1A 3NIDE 3S7GA 2P48B 5IMLB 5E8PA 4RGOL 5IVZA 2XG5A 2VDQL 1QO3B 2ED7A 2EE6A 5KSBA 4Q6YA 4JM2A 3QXAA 3CFBA 2YPKA 5TE7L 2R0KH 3VDBA 1T22B 2DQFA 4NM8H 1D6VL 3NBNA 1F3JA 4G9FE 5GS2D 4HUNB 3KPQB 4ZFOB 1G7JB 1VEPA 3G5VB 4NQEB 4OZGE 3MRDA 1PAMA 3KGRA 5JOFB 1DANU 1UC6A 3P9MA 1JPSL 3MLVL 5CZXC 1U9KA 4LHUG 3I3EA 3W39B 1AI1H 4D9LH 2V2WA 1FFOB 2VDRL 2WINB 1NCWH 4BQCA 1URLA 4WTZG 3OHXA 2X7LA 3VFMA 4KJYB 4HWEH 4IRZH 4LSDA 2FL5A 1S7RA 4Y89A 1F3DJ 5GRYA 3SE8H 1FRGH 5J9PA 4QRPD 3BD5A 5IKCA 4YXLH 3JWDC 4N0YL 1JV5B 1T89A 1WFOA 3B43A 1CD8A 1TNNA 4HS8L 2I9LB 4KTDH 1H3PH 2P5ED 3HNSL 1QBMH 4I0PA 3CIQA 5DDHA 5ETUA 2X4RA 2VB5A 2FBJL 5IOPA 1AGEB 3P77A 4UMGA 4PUBL 4G9DB 5D1ZC 4OT1H 5EIQA 2VZOA 2DOCA 3P11L 3ZE2F 1QPPA 3DVFA 1NSNL 2NYYD 1A3RH 4MWFB 5EUOE 1SYSB 2OTWA 1KCVH 4F57H 4S0TD 3A6BH 5DR5L 3BT2L 4J3WA 4HMCA 8CGTA 1V7NH 3LV3B 6FABL 4M6OL 2NW3A 3WSQH 3ULVD 4PJ5A 5KVDH 3GSNH 2Y36L 4WNQA 1AGFB 1UJ3B 4M3JA 3VMPA 5I15L 1PG7L 3TZVC 1CXHA 3IXAA 4QRSA 1ZANL 1BECA 4X98A 5L6YH 5C6TH 2YHGA 4ZYKA 3NA4A 3QDJD 2DN7A 1LP9F 3MJGX 3OKOA 5JIIA 3K3QA 4UDUA 4ZFGL 1Z0MA 2VLKB 4W4OC 2GCYA 3MQIA 3BP4A 5I1IL 3GSNB 1FO0A 1O7SA 5EZJB 2L7JA 2BSTB 4S1RL 2X1XR 4F7EB 2D3VA 4TNVF 5D2NB 4LRIA 1TMCB 2M2DA 2QV2A 3FMGH 4Y16C 2BK8A 2QQKL 1A1OB 1MFNA 5T5FH 3TA3D 3FQUA 1HSAB 4U6XA 2AJYL 1HINH 1JRHL 1QFOA 2C3VB 5I75C 4RBPH 3MV7B 1MVUB 3RI5K 4NNYA 4WWKD 3BPLC 1F6AB 4JFXB 3HI6L 1YYLL 1X7QA 2PYFA 4QOKD 3MACL 3PV6B 5IBUG 3KDMA 2VC2L 4QRPA 1CGWA 1K8IB 4FQQA 2AK4D 3V0VB 4DAGH 3EYQD 1QSFB 2ZUYA 1L6XA 4Z7NE 1NLDH 4P2QB 1MCOH 4GQPH 4BFEA 3OXRB 1BQLL 2DMCA 3ES6A 4U1HB 2P5EB 2VSDA 5FA4A 3MRJA 4WI4A 1CICC 1QBAA 4WU5A 4XRCB 5DJ8B 1GH7A 4JKKA 1G9EA 1V3KA 3NFPA 5I0ZA 5BCAA 1OT1A 3LPGA 1FFQA 4JN1L 1GRWA 3KYNB 1NFDF 1MCFA 1J1PL 2AQ3A 2W9EH 3TWCL 3ULUE 3VXTA 3CMOL 4FRWA 1IC7L 1V7NL 2VL4A 4JPKH 1DQQA 5I30H 1U95B 2E9IA 5CMAA 5FB8A 3PUCA 2FEDD 4JFPA 3STLB 3VFSB 4R26L 1ND0B 4K7PL 1UA6H 1X5ZA 2ADGB 1A9BB 4JKMA 4HMEA 2XN9E 1NH6A 1IQWL 3K7UA 2NXZC 3QQNA 3TCXA 1FGVL 4ZXBB 1N5YL 5FO8B 1RIHL 5HYSB 3I3DA 1KXQE 4M43L 2FWOA 5FYJD 1MHPH 3CVIL 5JO5A 1H5BC 3UBXA 2PYEE 4NNPL 1KF9B 2RIKA 5DLMH 1XGQB 3RWGA 5DD5L 1EZVX 1I7ZA 4PP1D 1CLYH 4LU5L 1VFBB 1YJDL 4X9BA 1NLBH 4Z7QE 4F2MB 4YO0B 2JTDA 1FFPB 1P4LA 1HH6A 2VH5H 4F7MB 1PGRB 5BMFH 3CVIH 4M62H 4NQSA 1J8HE 1BX2A 1I7UA 4MJ6A 2ICWJ 4LMQE 4KROD 1OM3L 3VFUA 3ARBC 3KNBB 5F9DC 2LTQC 4DGVH 4LLMA 3WBDA 1TVBB 1KELL 5F21B 1OTSC 4EN3A 2VZ3A 3B2UC 1IGTA 2CDGA 1OCWH 2R2CA 4K3EH 1JUFA 4LOUD 5CSGA 1A47A 1SYVB 3QO1B 3PP4L 2YPVL 3L9RB 3BDXA 3S5LG 3QUYB 2YR3A 4PGBA 3ZKMC 3LVEA 4YHMH 5K59E 1SHMA 4R8WL 5CINH 1U2CA 5E8NA 4HDIB 1QKZL 2NW3B 4YAQB 1JHTB 1K3IA 4PRPB 5C0JA 2DQCL 1EAPB 1ACZA 3ARDB 1LO4L 5DC4B 4L8BA 4FS0A 2YEZB 3NIGF 1NGXB 3ARPA 2VLLB 3FRPG 4FXGA 2FJGB 2KKQA 4V2CB 3QPQC 3QUXD 4ZYKB 4OD2B 4IOIB 2X4QA 3BJLA 3NCBB 1MFBH 4FTVB 3S8WA 2DL9A 3ZYJA 3VGEA 1IT9H 3BPNC 4NKQB 3ELAT 2R1WA 5GHWH 2FEEI 3MC0A 3NVQA 4PIRF 2P5WA 2YMXH 3QZWG 2NTFB 3ZTNH 1QFHA 5KS9B 5CWSB 1UYWH 2X44D 1FV1B 1CBVH 1KXVC 3KXFD 2A9NL 2ZOLA 2AJZB 4X99B 2G5BA 5I71C 3PHOB 1JNNH 1VFOA 5J12C 4QRUB 4DJMA 1RZ8B 3QDMA 3CPLA 4KJQD 5DRWA 3LEXA 1K2DB 1EFXA 4GAJH 3HMXH 4YJZL 5KANI 2P5WE 2N7AA 4ZDHB 1JZ4A 2AK1L 2P5EE 2FO1A 3RUGB 5IG7A 1P4IL 3BN9D 4X80L 4YFLF 2H8PA 4KQ4L 4QHMB 4WGWB 3K8KA 4HK3J 4Y4FD 5HHXH 1I75A 3C60C 2ARJB 2CK0H 4BH8A 3L7EB 1IGJA 3TC9A 4LF3B 4Y1AA 2MHAA 4UT6H 4N0UB 1HINL 1JRHH 4RWHA 5ID1A 3RWHB 4GMSL 3DETD 3QUXA 3T65B 3U48A 5I1DB 4D0BB 2Z92B 4J6RL 5GGVY 4N0FA 3WUWA 4GS7C 3FQNA 3HR5B 43C9A 3T0EA 5ENWA 5GRUL 2XQBH 1GIGH 1BQUA 5TGBA 1C1EL 1DQQB 1YEIL 4F15B 3C9NA 2CQVA 3QEQD 3BO8A 5HYQB 5J1TC 5CIPA 4HZAA 2W60A 1B3JA 4GAYB 5DQJA 5ACZA 5DTFA 1WK0A 4FOMA 3UZEA 3OGCA 4JDZB 4Y16B 3HI5L 2ZUTA 1WICA 3IJSB 5J06A 5HYSA 5I1KL 4U6YA 3CLEH 4PJDA 5F9WC 3BISA 4UDTA 2GSGA 2J8UF 5J1AA 1S3KH 3RPIA 4XCEA 3NPZB 1IGIL 3R4DA 2JCCA 1X5HA 1ZHBB 3RNKA 3WS6A 2R0ZL 1HEZA 4I3RL 5D7IE 3QDME 4LIQE 1GZQB 4HFUL 1NBZB 3WFBH 3HB3C 1ZVHA 5F9AC 3ZHKA 4TQEH 1G7IB 3X3GH 2VLRE 1D5MA 1PD6A 4JZNB 3RP1A 1EO8L 1DE4A 1KBGH 5DRNA 1MI5A 2ZJSL 4ZD3H 1DN0A 4NYLA 2YWYA 5EO9B 2UZXB 5GGRB 1F11B 3O45B 4HQQL 1BOYA 3DUUB 5HSFA 5ELIA 1UM4L 4A2LA 1OAQH 1EEUA 2DDQH 3LKNB 1SYVA 3QO1A 4KY1L 1SJEB 4HGWA 2J7LA 4WJ5A 5AYUH 4NQED 4PV9A 2ADGA 3ROLA 5KS9F 4QYOB 2A6DB 1FP5A 3FT2B 1QA9B 4P48A 4R7DB 1M7DB 4HX1B 3KHQA 4X4XA 4KI5F 1AQDB 5EULV 4PJHB 2FX9L 5BXFA 1A14H 4NJ9H 4L9DA 1DL7H 4GRWH 2AK4A 4MQTB 4YDIL 5AZ2L 4N0CC 3FOMB 1AGDA 1KCKA 4JFOB 2DQHH 1MUJA 1T1XB 2IC2A 1KIQA 1AD0B 1MLBB 4AEHL 3SDXF 3GMPA 4MD4A 4OCRL 2XQBL 3CX5J 2R0WH 3GMLA 1L7TL 2F5BH 4WUUA 2CRZA 4MQXD 2RR3A 2P24B 1UXWB 2VLRB 3GBNL 4X4YA 1IGFL 1T89C 4BZ1L 3P11H 4KQ3H 1BM3L 4YHZL 2IAMA 2AJZA 5CLTA 1H3WM 3QXDA 4MS8C 1NEZB 2GAZA 3TA3B 3QG7H 1N0XL 1QFWI 2AI0H 5E8OB 4P4KB 2MCPH 4OLWH 4PJXB 4RWYL 3RUGF 3A6CH 3MLUL 4QTHB 3FQRA 4NRZB 4WI7A 4ZPTA 1MCWW 1D6EA 4C4KO 4I13B 2DTML 2EIZA 2VAAB 2VQUA 2I5YH 1BBJA 1ZA6B 1YNTB 3WNOA 4Y8DC 1P2CB 1S78D 3NA9H 3E8UH 4N1EA 1RZIB 4P2OD 1ZT1B 4POZD 2BVTA 2NLJA 3QAZC 2GY5A 1I3UA 3U0TA 5JA9A 3LKOB 1T2QL 1OP9A 3JWOC 4I2XA 4R96B 1HCVA 3MNVA 5D8JL 3MRKA 1KTRL 4PR5A 3OAYK 3GMQA 4FQHA 2HN7B 2DYPA 4JQXC 1NAKH 1MHEA 1BIIA 4XCNB 2YZ1A 1CR9H 4P2QD 2DQJH 5CWSA 5CIPB 5AZ2H 4PG2A 4M1GH 4MA8L 4P59H 4CN4A 4M48L 4OCSL 1YEKH 4K7PY 1P7QA 3O11B 4I4WA 2PCPA 3NCJL 3FO0L 3CU7A 4LRIC 4EXPX 1AO7D 1R3JB 3MRHA 5DD1L 1I7TB 1ZLWK 4LVHB 4NN6C 3LKRB 1OARH 4XNYL 4M7JL 3NGBB 1XGTB 4D2NA 4LSRL 2CR3A 4P9ML 4M62L 3WFHA 3FB5B 5DHVH 4GBXC 4L8SC 1MFAL 3Q48A 1KN4L 2HH0L 3RGVB 3OKEA 1ZHBA 5EOCJ 2C4XA 4KRPD 5CP3H 4XGZB 1IKNA 2X4NA 4TVPL 5DQDL 3I84A 4XNMA 4Y2DB 2NY2D 2X9YA 1S5IL 2EDYA 4DOHE 3FB6B 3OR7B 2ZKHH 3KPPA 5KZCD 4HJGA 3EYVB 1VFUA 3LN9A 4S1QL 2AERT 5T3ZH 3BQUD 3SOBL 1VADA 3OPZL 1YEGH 3B6SB 5I1DA 4AEFA 5FDWA 5I8CB 2VLJD 1QRKA 3HE6D 2QADC 3RIAF 4HGMA 4YHYB 4JQXA 3HMXA 4U1LB 5HPMA 1AFVL 2C1OA 4QXUL 4UNVA 3L3KA 2O61B 4RFEA 3O8XA 5DMIL 1T7ZA 3FMGL 4GAFB 1TTGA 3L3HB 3LHPH 2ZUWA 3BIBX 3CFCL 1MNUH 3NZ8A 3BZ4A 1IGCL 3RKDD 2J12B 3DMMB 4YFDB 5GS0L 2VKXA 1AQKL 3EYOB 3VXPA 4G3YH 4EVNA 4G8FA 1J0IA 1B9ZA 5T1KD 4HPOL 5BJTA 5IJVA 3ARFD 1FN4A 1A6PA 3O6LL 5FGBC 4AEIL 4EDXA 1Y0LB 5A16A 2GIYA 4XMKL 1PX3A 1IEAB 4WUKH 4PJDB 3CK0H 5DHXB 4ZG1A 4XC3L 3K46A 5E6ID 1WWWX 2JCCB 4WVRA 1J8KA 3EYFA 1T21A 4U1MB 3OJMB 1CDUA 2YRLA 4PPTA 5MEPB 5FECA 2UWEF 4HBCH 1TTFA 3S6CA 5I71B 2QSTA 3C60A 2CIKA 1U8OA 3SBWA 1ZGLP 3N1FC 3FB8A 1I3GL 4Z7NF 2Q8BL 4J2XA 4KXZH 4MAUH 4HHAA 4XTRC 1ZLWH 2HFFA 5E99L 1CCZA 4OLUH 3VXRA 3AM8A 5I74C 1J88A 1R24B 4M8QA 3X3FH 3VXUE 4OZ4B 1YECH 3ULSA 2XA8H 3R8QA 4FQPA 4F58H 1JYVA 2V7NA 5DFVC 1UWXK 3CC5A 5I8EA 1DQDL 1RD6A 1D9KC 3KJ4B 5IJKA 4YXLL 1OW0A 4GW4A 4J6RH 3VFOA 4E41D 4S1QH 1QSZA 4H88H 3BKJL 1V7MH 3TIEA 5IROC 3FT2A 1MRFH 1R5VB 3QQ3A 4PJGE 4DWHA 1Z5LA 3QI9B 3WIHL 3DIFA 2VABB 4JN2B 1I1FA 1AP2A 2HVKB 1G7HA 1MQKL 1WFNA 3RX5A 3U4EA 3L3GB 5FGCE 1S5HB 5B4MD 3PL6B 1WZ1H 1PG7H 4HC1L 1RJZB 4LMQI 3TBVB 5D1ZD 3ILPB 1U92B 3FZUD 5F93C 4EOWL 3JTTA 5CBEB 2VDQH 2VLJA 2E7HA 2EDHA 3IU4H 3GMLB 4NNPH 1AR1C 3B9KD 4IRJC 4NN7B 3KPQA 5IHLB 5ADPH 3UP1A 5HHQA 5DJAA 3O4LD 5KW9H 1MCSA 3P9MB 2B4CL 5C08A 1JPSH 4QHUA 1DVFA 1FC1A 1NJ9A 4GUPA 3CNKA 1KB5B 4PJBB 2IG2H 5LWYL 1WBYB 3PWVA 2WINA 5I1GH 3ARQA 3S37H 1J0ZA 2QBWA 4P3CH 1DQMH 5IHZB 3ARDD 4OCRH 1N4XH 4AG4H 1BD2B 2DLGA 4I0KA 3P4NA 2F5AH 5CINL 5TPWH 1QQDB 3IDNA 5CD5D 4DGIH 3K2UL 3SDYL 1AXSB 5EA0L 5F89A 1J5OL 3RGVD 4HS3A 1WIUA 3O9WB 3FL7A 1LMKA 3BAEH 3O6MH 3V0AC 3QCTL 4JY5H 3SCMB 4ZS6D 4YDKH 3U30C 2HRLA 2X4PB 4PFEA 5EU4A 4FG6D 1EHNA 5C0IA 1H3PL 2YRZA 3L95B 2NY4C 5LGHL 1VADB 3BPNB 3NTCH 2WUBH 1OM3H 5C0DB 3ZL4H 1QO3A 1T7WA 3EFDL 1TNMA 4ZUTA 5T3ZE 3UPCA 2VC2H 4JZJA 2DLFL 3UJIL 3TVMD 4GAGH 5I16A 2QADB 4YHYC 1OCWL 4CDHA 2CRIA 2NX5B 5HHNB 2CK2A 1G7QA 4ISVB 1FCGA 4PJIE 3UJTH 4TULH 4NFCA 4Q0XH 2R4RL 5LGHH 4B5EA 3NIDF 4S1DC 1G6RH 4HZLA 2PO6B 5A3IC 1IEBB 2Y06H 1JF5A 2F53E 2F5BL 1ZHKA 3SCMD 2XRAL 4N90D 1J1OL 4RX4D 3TN0D 1YY8A 1RPQA 5C0FB 2AJSH 2FL5B 4XP5L 3UZQA 1CVSC 2R2BB 1TZIB 3GMMA 2LTQB 5ID0A 3O3EB 4KU1A 3TT1L 5IW6B 3QI9C 4TPRH 2O26U 1ZT4B 2C1PA 4ETQB 1KENL 3HAEG 2IPKB 2ATPB 1FGVH 1AY1L 5IB3B 2BZDA 3CH1A 4FQLH 2HT4C 1MCJA 5ETUB 3OAUH 3FFCB 2VITA 3QWRA 4HHAB 1AGEA 4MS8D 3B6SA 2IANA 2YA1A 5HHMB 2JB5L 1LE5A 3CZFB 2OI9B 4P3CL 3D18A 1C5CL 1T1YA 3PWUB 4KMTL 5GS0D 3MRBA 1JPGB 2VLKE 2HJFA 3JTSB 3BGAA 4NT6A 3VXSE 2ZNWA 2QQLH 3RVWD 4JO1H 1K5NB 1AGFA 3IDJB 1NCNA 4AEHH 1S7WA 3RU8H 1RUML 3DI3B 5GSVA 1KJVB 3HRZB 3QHFH 3T0BA 4HJ0C 1MRCH 1T20B 3W0WD 3QI9D 4YWGL 5CEZD 1NC2B 4PJ7F 1ORQB 2LAAA 1A7BA 4X8JA 2IMMA 3L3OB 3ULVF 1OB1A 2C7UA 4JEGB 3HMXL 4GMTL 1KJ2H 3REWA 3VW3L 3WDJA 1FCCA 2V5SA 4P2OB 4O9HH 1RMFH 2XFXA 5DT1L 1QUNA 2P8LA 3OF6A 1KACB 4TSCL 4RFOL 1S7VA 1HHIA 3NABH 4JFFB 4ALAL 1MWAA 3FQUB 3QRGH 4ZTOL 1I1AD 2NCMA 3CX5K 3TH2T 4MXQD 4ZO7A 2ATKA 2B1AH 4Y88A 1XGQA 1CDCA 1ZKAA 3QA3B 5DLML 4P2RD 4M7KH 1NC2D 4G8IA 4ZSOB 4UV4L 2AQ2A 1FIEA 2XTJE 3ARSA 2PXYA 2OTUA 1QQDA 3IDNB 1DVFC 2HLFC 2QSVA 2JELH 2CO6B 1FIGH 3IJYA 2MQCA 5D7JB 4XWOC 4OLYH 2OCFD 3EOYG 3MV8B 1BX2B 3D48R 1VEOA 4Z0BL 1N3NA 1CTNA 2A73A 5I1HL 1BQHB 1BF2A 1N7ML 2FH8A 3DLQR 3WMSA 3VFRA 1O7VA 3OAUL 2E9JA 2D03L 3VFVA 3BKML 3IDIB 1FL3A 4FFVD 3Q6GH 5DRZB 1C5BH 3O81A 4NPYB 4PTTB 3TBVA 5L2KE 3BD3A 1AC6A 3T0ED 3VGAB 1HSBB 2IBGA 4HAGA 4PJ8D 1LO5A 2FX8L 2VRAA 5D72L 4OSUH 5C0NC 2E7LA 5KSVA 1FBIH 1S9WA 1TCRB 2ZP0T 3TPUB 2PR4L 2J8UA 1BVKA 4PG2C 4U31A 4FMKA 2WWKO 2CLVA 3TCLB 4OTXH 3DHJA 2CDEA 4FQXA 4HIXL 5ANME 5KVEL 4YQXL 4NN5B 4HC1H 2R8SL 1S5IH 3RTQB 5F71A 1Z9OA 4LL9A 2E8YA 3W9EA 3HE6A 4YWGH 2FIKA 1YA5A 2G9HB 2JJTC 3DJ9A 4DN4L 4OQTH 1A02N 4RRPA 2OI9C 4NRYB 4RMQA 1XFPA 4HUKB 5T33L 4ALAH 2ADJB 5H8DA 2ZSVA 2AAVA 5CJOL 4WEBH 5D5MA 2E27H 3MNWA 3ARFC 4ORZC 5HYIA 1AFVH 4RGOH 4S11A 5AWNL 1RZFL 2BY1A 1WZLA 5C6TL 3PWPE 2BVPB 2DMBA 3LB6D 1O5DT 3EO1B 3RZWA 4I48B 3JVGC 4NDMA 2X4PA 1D9KD 2OJEA 3LH2H 4OLXL 3B9KA 4P5TC 4X7TA 1BZ7A 2KBGA 3OKNB 1IGIH 1HHGA 4OZIB 2GT9A 4FZ8L 1BLNA 5MEND 4D0DB 3MSPA 4PJGF 4HF5H 3X17A 5KAQG 1JF6A 2Y1VA 3T4YA 3RZCA 1A7NH 3PWNA 4APQC 5CUSH 4DKEL 1I9JH 4HDIA 3VXQB 3HFMH 5SWZE 4LSVH 4AYFA 4JPIA 1PY4A 5IFHH 3FZUC 5FYKE 5BV7L 2ED9A 4GJTB 4NHCH 4KMQA 2PO6A 1QACA 3GMNB 1KN4H 2HH0H 3HZKA 3SGEH 4TRPL 1Q72H 3BEVB 2X70B 3L5XL 4FQ1H 2PTTA 1EFQA 5GJTH 1A6AB 1CFSB 2MWCA 4MAYA 4XVUC 1OT2A 4QEGA 1OLLA 4O00A 3A6CL 2A6JA 1G9MH 3MLUH 1NFDB 4MNGB 4AENA 2V5MA 1IKFH 3U6RA 4HCRH 3VRLE 5DD3H 3DXAA 3ISWA 3O4LB 5LCVL 4XPBH 1H3TA 1KOAA 1TJGH 4L3AA 4LGSB 2J5LB 4W6XB 1JWUB 4BZ1H 2XOTA 1A7QH 4FA8A 2FHCA 2NR6C 1JTTA 4IRJA 4P5TD 1JN6B 4DFHA 1BZ9A 1P84J 1CK0H 2JKXA 1S9VB 4GG6F 4QRTB 4RAUB 1D3CA 1RURL 1ZGLA 1BFSA 4HD9A 4GKZB 4YDKL 2PUQT 5LAXA 1AIFB 2ICEB 1CFQA 2KH2B 3CDGB 4FXLA 4P5TB 1WWAX 3MZGB 5LJYH 4N0UA 4M61A 4DKDC 1INQB 1E6OL 3PGFH 4NC1C 1YMME 3T65A 4I0PD 4LCWE 4GSDH 5C0BE 3M1BB 1KJVA 1N7MH 3HRZA 4K3JH 4KC3B 2YD1A 1D5ZB 4RWYH 5EBLB 1T03H 1M7IA 1I8KA 3A0OA 4M6ML 1DEDA 3BGMB 5GGUB 5FO7B 5IVZB 2DI8A 4WV1B 3PL6C 3GSXB 1MFCH 1YMHA 5GGTL 2R1YA 4R2GD 3ZTJH 1YEHL 2NZ9D 3ARGC 4RNRA 1S7RB 1QLRA 5I0DA 4XVSL 5EG6C 4QHKJ 1IBGL 5CUSL 4JJ5B 1UFUA 3HI6H 2C4FT 3OZ9H 3EJJX 4RDQG 4ZOEA 4L3ED 1I3VA 1G7JA 4LPVA 3ZE2E 4MDJA 5M94B 2AJYH 2HFEA 1MF2L 5GRJL 3BEWA 3CXDL 3GKZA 4QCIB 4Y7MA 1MIEL 1YEEL 3GB7B 4X6BB 4Y19A 3FT4B 4CNIB 3QEGH 4AEIH 5GGSB 3U7YL 4YHPB 4LPTA 4PD4J 43CAB 4GFTB 1CE1L 2JB6B 1U91A 2PW1B 3HB3D 3DBXA 4J3SA 4OLVL 5DGQA 4YXHL 2HMID 1BP3B 2XACC 2F74B 2YPLB 1F58L 2GJ6D 3TZVD 1UVQA 5B39A 3CFBB 1QEWA 4JE4B 3TM6A 1HH9B 2QEJA 3MRQA 1WFTA 4Q2ZA 3IDYB 2X1WL 5TQ0H 1DE4B 2Y36H 4E41A 2IFFL 2HTLC 1CXKA 4PRIB 4JRXE 2FATH 1DN0B 4ERSL 5ICYA 1CE1H 4NO2A 3OTTA 3OSKA 3DVGB 3I02B 3WE6B 1FNLA 1P5UA 2R2HA 2WMPA 1GCFA 1IGYA 1AE6H 4HAFA 4F3FB 4ZFGH 2DQIH 5JHDD 5IB5B 3OHXB 3KPRA 3OKOB 2R56H 5IBLD 4FQ2H 4C55A 4KK6C 2W9DL 4MWFA 3FB7B 4KAQL 4RAVA 4CMMB 3EDJA 4F58L 4JO3L 4RGNB 2BVOA 3H42H 4JB9H 4OQ1A 1Y18B 3IT8D 1JHKH 1HHHB 2CRMA 3LKSA 1AHWB 5C0AE 4CN1A 1ZWIB 3VWKC 5M7QA 1CDIA 1JYNA 1KIPA 2QLVB 5LG1A 1OOAA 1PFCA 4Z7VB 2PYEB 4O4YH 4ZOBA 4OI7A 2YXFA 3VMNA 4UT7H 1AD0A 1MLBA 2H32H 4DVBB 5D2LA 5E2JA 3VGDA 3VFMB 3HUJB 1RHFA 2X2YA 3P0GB 1DQLL 3HZMB 3VU2A 2XZQH 1NCWL 1UZ6F 3GNMH 4WUUB 3AM8C 3ZKND 4JFEA 2PO6D 2XI9A 3RVWC 4IRZL 2BSTA 2XXMB 3DV4A 5I1JL 2B1AL 1B0RA 1U8PB 4KKAD 2FJFB 2D7OA 1NC4D 4U6HA 1MHCA 1FYHB 1B0GA 5C7XH 2WBKA 1D9KA 1GGIH 2E3VA 5IJKC 3VFTB 1FPTL 4Y2DC 4ONGH 2OTPA 3UTQA 2EXYD 2VLME 3IFOB 4E5XB 3HN3A 1ITCA 5AD0A 3RDTC 3FO2A 5FKAA 4AMKL 4X7FC 3BDBA 4OF5A 3SJVE 3S9DB 1ZSDA 1RV6X 3TBWA 1MJJA 2GT9B 1F6AA 2YKLL 1LD9A 2QHLA 5ACMA 1YMMB 1ZGLB 4BSVB 1WJ3A 4PRNA 3P0YL 4PJ8C 4NQDE 1UH2A 1ZT7B 3JV5A 1K8IA 5ILTL 4G6AC 5DRXB 2NY4D 5D6CA 1P53A 2JJUA 4LAQL 4I1NB 1J87A 4WI9A 4JY6B 4LLYB 3PQYB 3QPQD 3JSSA 3QUXC 1Z2KA 3VCLB 2ED8A 4KGLA 4PJIF 1V5JA 3MGOB 1CIUA 5C09D 4YHNB 5HPOA 1S7QA 2OP4H 3Q3GA 4POUB 1JWSB 1S7TA 3RGHA 4ZO6A 3VRIA 4PGDA 3MNVB 2FSEB 4FFVC 2A6IA 4FQHB 4RQQB 5MI0B 5K33A 3SGDH 3QPXH 4ENEC 5DSCB 2CKBB 1PSKH 4KRMB 3MRGA 5FHBH 4G5ZL 3MV9E 5D7LB 3STZB 2G75B 1VDGA 5IESH 5TJWK 1PW3A 3IB4A 2VR4A 4ZFFB 1FNHA 1ZMYA 3LN5B 4H8WH 2I26N 4G8GA 3ZTJG 4YUEH 2X89A 4HIHA 4XHQA 4OI8A 1U3ZA 5J1SC 1IEAA 2XZCL 5TDOB 1R5IB 2E5EA 5KVGH 3CK0L 3K4DA 1CE6B 4YR6A 3SHSA 2ZCHL 4QRQB 5EOCH 3CVHL 2A83B 4KDWA 4PGZA 2BERA 1KT2A 2AEQH 4QRPE 4U1MA 1R5WB 5D5ME 5D7JD 4NBYB 1TJHL 1LP9E 4PRIE 5JDJA 3V6BR 4MDIA 2AQ1A 4LSUL 2BFVH 1PBYA 2ICES 4AMKH 4MAYD 1SM3H 2Z31C 1A6TA 1J86A 4GQ9H 3MBEA 5DJ2A 3LS5H 3MUGA 4O58L 2X4TB 3QR2A 4J12A 4L4VD 1JPFA 5IMMA 3I50H 3RWIB 4DW2H 1JNJA 3IETA 4LPCA 4K94C 1SY6A 5JDSB 3PDGA 2R4RH 4LLMB 5F7NC 2BNQD 3QG6B 4PRHA 3E1F1 4J4PD 3BPLB 5T3XH 5K9KB 2IPTL 3ZLQC 2PF6A 5IFHL 1XEDA 2CIIB 2F58L 3DSNA 2M26A 5GISH 2EEBA 4WCYL 3KPRB 1EPFA 1XCQA 3QUML 3MV9B 5D7LE 1E28A 2NY6D 5I1KH 3EOTL 1K9TA 2FR4A 4G9FA 3GJEB 4WW1B 5D2NC 4NQDA 3QFJD 5IB2B 1NDGB 4R4ND 1GC1C 1YNKH 5DJCA 1Z5LB 3QI9A 1FV1A 1IKNC 1T7XA 1ZLSL 5I1AA 4JN2A 3ECBB 5EU6B 1I7UB 4MJ6B 1XH3B 2GSIB 4V1DB 5EU5A 1YDPB 1ZWIA 3LN4A 1IAMA 4NO0D 2CXGA 4M5YL 3NTCL 4PP1C 1G9ML 5J56B 3RTQC 1YEFL 1FE8H 3ZDYE 3MR9A 4DEPB 3MJ9L 4CJ0A 1FGNL 3C8DA 3H42L 4NP4L 2EC9U 1J8HD 1UVQB 4MA7H 2DICA 1U8OB 2Z8SA 3GK8H 4XPFH 1J05A 4RRPG 3L3IB 3UTSD 4PJBE 4F7MA 1IAIM 3DMMD 2F19L 3OQ3B 3MXWH 4HXAH 5C08B 4ZOAA 1FDLH 3OKKB 4AEEA 5T3ZD 1I7RA 3ZYIA 4O02L 4NQCB 4X4MA 4I18A 4PRIA 4MMZC 1UEYA 5A3ID 2IPUK 3GMOA 1LK3L 3QUXB 2NTSP 1HWHB 3ZYZA 1OL0A 1MRDL 1M4KA 3HKFA 3NIGE 3FO2B 4DZ8B 4D94A 1ZGLM 5E5UB 1OF2A 1SQ2N 1KPRA 1IM9B 4IOIA 1KELH 1IL1A 3EJYD 1DJSA 1S7SB 2BVYA 4YBQC 3WYRA 1FNEB 4WGVB 2H3NB 2EDXA 4OI9A 4ELKA 1KJMA 2N1KA 3H0TA 1GL4B 3KYAA 1EJOH 3C8KB 5A2FA 4D9RE 3QO0A 5L9DH 3C6SB 4QHNA 4I5BA 1KN2H 5DHVA 4X0KA 5JXAH 4PLOB 1NGQL 1HYRC 4OZFG 2EYRB 4HIJA 4R2GC 4M4PA 5ABDE 4QXTA 1SEBA 2YN3A 2RGSA 3L6FB 4RMSA 5GGRY 3QISA 2BNRA 3PDDA 5T1DH 1KFAH 1T04B 4OAWB 3SDCB 1W0VA 3B9DA 5F7FA 1VGKA 2XNAB 5F7UA 1D5BB 3LRGA 3MLZL 4N8CL 4Z5RB 1MLCA 2K3TA 3VRJB 4GS7B 3MBED 4OCWH 3U7AA 4P23B 4UOW0 2CR6A 1NCDL 4UILH 4UIKH 5D7LA 4ZQKB 4HWZB 3JWNC 2PXYD 1UCTA 3V8CA 4K2UL 2QQQA 2X05A 4HZLB 3ZE0F 5TDPB 1KTDA 1WBYA 4YUEL 2D9CA 1EEZB 1AHWC 2WIIB 3UO1H 4QOKE 2ARWA 1LILA 5C0FA 4FFYH 5FHAH 1DLHA 3LPFA 4LBEA 5HVGB 3TBTB 5A2IH 5C70A 3EDFA 3UAJC 1BGXL 1A21A 3TPKA 5GGRA 3TBWB 5DVKA 3CJJA 3GMMB 5ID0B 2ZUQB 1GPOL 3P73B 4C56B 4JQVC 4E41E 2HLAA 4LVOC 4PRBA 3RA7H 4XI5D 3B5GA 5D1XA 1JK8B 4BSJA 1VHPA 4L4TE 4F33B 1RK1B 5CEXB 3PJSB 4IOFC 4NBXB 4E0RA 3C2SA 2EECA 1ZVSA 1U8NB 4RGND 5FGRA 3VG0L 1F3JB 1NAKL 5AYQA 3QULB 1AY1H 2DM2A 1A6VL 4HBQA 2VL5A 1MI5B 3S3SA 2C3GA 1S7QB 3I50L 2N7BA 3Q3GB 1I9IH 1QLEL 4LLWA 1K6QH 3RJQB 1UCBH 4X8XA 2SEBB 2NYYC 4M1DL 1A3LL 3HR5A 1HE7A 1QTYT 2V2WB 3MRBB 5DD3L 2DB8A 2C3XA 1DEEB 4GAGL 4BFIA 3UDWC 2MKWA 3S35X 3WUWG 5DMKB 3MV01 2VUYA 3WHXB 3DV6B 3F12A 1BQHG 1S9XB 4GAYA 4QLRA 1QLFA 2ITCB 3N1GC 3LPWA 2RAMA 4LNRB 4HUXB 2D4FA 4ZFFA 1UGNA 5C07E 1FVDB 3T1FB 3ARFB 4N68A 3TEUA 2IAMB 4R26H 2VWEE 5EWIL 3Q2CA 1GGCL 3AREA 1JBJA 3OV6A 4OF0A 1A0QL 4WY7L 3BSZL 5HGHA 5F3BA 3CLEL 4EZMA 1FAKT 1ORSB 3JBG7 2CO7B 4QRQA 4M9PA 1LNUA 2DD8H 1BJ1J 2AKRB 3RVVC 3U4BL 4M5ZL 4GW5B 2NY3C 3ARBB 3DUSB 3SDDD 3CLFH 4AIOA 1P2CA 3BQUB 3OGOE 2Q86B 4HWNA 2P8PA 4K2UH 1YUHB 5CJ8A 2CKBH 2LAGB 5ESQA 1BFTA 3G5VA 4FNLH 4MNHB 5L8LB 4ZUSB 3HPLA 5EO0A 4JO3H 5F7KC 5HI4C 4ZSOE 1MFCL 3SGEI 2VDLL 5CCKH 1CR9L 4CKVX 1FFOA 2BOCA 4P2CG 3OWEA 5EBWA 1M1SA 3SQOL 3WFDL 1OP5K 4NHUA 2EDOA 1P84K 4HGWB 3HE7D 4P4KC 5D7JA 4OZGF 1GC1H 4OGXL 1L6ZA 2Q7YA 5EH1A 3ALWA 4LQFL 3V6OC 4PJHA 5I76A 5IR1A 5HI5D 5EZOH 1RFDL 1WITA 3EOAB 5JHLH 1QYGL 5FUZL 2XKSA 3INUL 3NH7L 2I9TB 5DC9B 2NLJB 1MJ7L 1X5KA 5KG9B 2EDQA 4U1JA 5HGDB 2X89D 1UACL 2XA3A 2QADD 3S5LA 4Z7WF 3ZE1E 1T0NA 1SY6L 1OB1B 2RFXB 4LCYB 1FO0L 4HJ0D 3FB5A 3NZHH 3GRWA 5FAAA 3WXWH 3LQZB 5BW7A 4RIRA 3RGVA 4CRPA 1MCLA 2EE9A 4XCNA 2EKJA 3T04D 2W0FA 3PHSA 1UXWA 4MVBC 4Y4KA 4MXVE 3V0VA 1NUFA 3LV3A 1WT5C 3UX9B 5EC1A 5IVOA 4YXKH 4PGEB 3PXJA 3DO7B 1E4KC 5FA4B 2WIIA 1S9YA 4POYA 3BKJH 5C1MB 5I15H 1DBBH 1DSFL 1RULH 4XRCA 5DJ8A 4XBPB 2Z91A 4APQB 4NZRL 4JDTH 2HYMA 1UA6L 3BZFB 3ULUF 1LHZA 4IRSC 3GMQB 4M7KL 3P4LA 2YC1A 1QFWL 3UBXG 5J4MA 1F5WA 4U0RC 3ZDZE 5J0BA 1OTUC 3BP4B 3T2NH 4UAOB 4F33A 4RMRA 3SGJA 1OGAD 4QHNB 1P5VA 1JF1B 2HJLA 4Q6IC 3WN5C 3CD4A 5D7SL 4FFYL 5FHAL 5J11B 1E6OH 1HQ4B 3V4UH 3EO0A 1OAUL 1UWGH 4LCUB 4I2XE 4M00A 2FATL 5EU7E 5LBSH 1C5DB 1TETH 1RJLA 3HI1B 5AYUL 1EUTA 5IEHB 4F9PC 2HWZH 4JRWA 4OGAD 1T04A 4OAWA 3SDCA 1A9EB 4NWUH 2IADB 2HN7A 3Q6FB 4PJIA 2EO1A 4PTUB 3FHQA 1S9WB 1TCRA 4MD0B 4BKLA 1FH5L 4JPIB 2W9DH 1T7VA 4YBLB 2RCSL 4NN5C 4U1NA 1QSFA 1Q94B 4G8FB 1FNFA 2C5DC 4X7EC 3C09B 2YSSA 1H9VA 4PJAE 4EDXB 1E4JA 1XR8B 1MAML 2H1PL 4OLUL 1R3JA 4JM4H 1M6OA 5DD6A 2FIKB 2OYPA 5IEKA 1T0MA 3EHBC 4N0RA 2YA0A 4PRDB 4PLJD 3DGGA 4OZHB 4DN4H 2LU7A 4MNGE 2C1OB 4N9GA 4EN3B 4UOW1 4KK9D 4EI6A 3U7YH 4WDIA 5FKPB 3EYFB 3O8XB 4OCYH 2H6PB 4WEUD 4LLUA 2EDTA 4GW5A 3DYMA 1HILA 3T3PF 5CEZE 3OKYA 3QHFL 5DD1H 3NOIA 32C2A 4C4KT 3OR7A 1N8ZB 1TZHA 4KRPB 5E6IA 5E8EA 4OBRA 4O5LL 4XH2B 4JANB 1I8IB 3WS6C 4FXKB 1CFNA 1QHPA 5F88B 4OT1L 5DEGB 5FO8A 4FNLL 1EAPA 1GXEA 5JXEC 3H9SB 1IC1A 4HH8A 4HEPG 2WQ8A 3N85H 2VDML 4JO2L 2VLRD 1KYOJ 1YN6A 1TTUA 4OIBA 3VXSA 1XT5A 5DJYB 1T21B 3Q5OA 1JZ2A 2Q20A 2W65B 1ZXQA 4XAWH 2WLZA 5D4QA 4YPGB 5ESVA 1SJHB 1MY7A 1WCQA 3REVA 3ZT5A 1K3ZA 2VDLH 4OV6F 4GXVL 3AY4C 2VQTA 5A2KH 4HUUB 3LKQB 2B2XH 1KB5A 1WF5A 5JUEH 3JZ7A 2GI7A 3UEZA 4QY8B 1P1ZB 3QEQB 4UUJB 5LGJB 2DQIL 5BW7C 2APTA 1J12A 1JMXA 5FO7A 5DRWB 1T0NB 3E6FB 3WD5H 5K9OA 4K94H 3J8F7 3ULSB 3AB0C 2A6JB 2B5IB 3QIUB 2H2PD 3RBSA 3MJ8A 3HC0A 5L2JA 1UB6A 4TSAL 4BQ9A 4NNXB 1F8TH 2P5WD 2ICWI 4MDJB 4NRXA 1MJ8L 3RRQA