5MI0B

A thermally stabilised version of plasmodium falciparum rh5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-step design of a stable variant of the malaria invasion protein RH5 for use as a vaccine immunogen.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
molecule keywords Reticulocyte binding-like protein 5,Reticulocyte binding pro
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B01
1YPZE 3FQWB 2YD5A 1SJVA 3VXUA 1KIPA 1ZT7B 1ZLSL 1R5VB 3W11C 3P2TA 4JPVH 2CUHA 2E7BA 5DHYB 1UQSA 2AKRA 1RZKC 3I2CL 1XF2B 1KCSH 3SDDC 32C2B 1I3VA 1KYOK 4NNYB 5TE4H 1BQSA 2X4PB 4GG8B 4LGSB 4XHQA 3WFBH 1MWAA 3OGCA 4PJBA 1RUQL 4AH2A 1INEH 4CL7A 4HJJH 2X2YA 5GPRA 3VFOA 5JUEH 2F9BT 1Y18B 5CUSH 1FJ1A 3B9KA 4C83A 4ODSH 4L9LA 4L4TE 4D9LH 3MOBL 5FHBL 3L3GB 3F5WA 3ZSTA 5CWSB 3SKMA 3S34L 1NKOA 3DMMC 1HZHH 3L5WB 3PQYB 2NZIA 1KPRA 3MOAH 4W70A 3MUJA 3ZKXB 2WWKO 2Q8BL 5ANMB 4OUOA 2VLRB 4M61B 5EIQA 4EVNB 3O9WC 2DICA 1JP5A 3FB8A 3HE7A 2UWEE 1L0XA 3T8XB 4NN5B 1MJJB 4GRWE 4YWGH 5KW9H 2DLTA 4JHAL 4MA8L 4POZD 5KN5B 3PP3K 2AW2A 3FO0L 3MLUH 1YJDL 2XQYK 4Y1AD 4R2GD 4P4KA 5ISZA 4JRYA 2FHCA 5I18H 2JIXA 5C08E 3KPSE 3DGGB 3T4YB 4J3XA 4RAVB 1R0AH 3EYQC 2OMBA 4OGXL 3T08A 2W91A 1GAFH 3LDBC 1S3KH 2IH1B 1SY6L 4NJ9L 4UU9B 4WJ5A 5BMFL 1T3FA 3IF1A 1JGUH 2BVUA 1U8LB 4LPUA 4OFKA 3O9WB 5IW3A 3TO4D 4I5BB 4TSCL 3DRQB 1T3FB 1QRNA 4M8VA 1FZKB 5HYQB 2WMPA 4DQOL 4K3DL 3HAEA 4HGMA 2AJYL 2CIKA 1NC2B 4G8IA 2VXTL 1R24A 4XGZB 4NZRH 5CJXC 2XPGA 1FLRH 5C0JA 1TJHH 4PJDF 4G43B 3GSNL 4KU1A 4O9HL 1IGCH 3OB0H 4TOYL 1IC4L 1MCKA 5CZKA 1MHPH 4X9BA 5ACZB 3BHBA 4OI8A 5IK3B 1MRFL 5E2WL 1IC5L 5EO9A 4ELMB 5IFAL 1MVUB 1QG3A 2XTJB 4G8FB 4AM0A 1HHJB 1GH7A 4LSTH 1JIBA 2O5ZL 3FTGB 3ISWA 3ZKQD 3VD5A 4PJ5E 3QNXB 4XVSH 5DGQA 1SVCP 1HOCA 3MRDB 4PRAB 1P9MC 4I0KA 2HRLA 3MR9A 1VKXA 3QULB 4K8RC 3VE0B 43C9B 2AJUL 5H2BA 5DJZA 3LZFL 1MHCB 1S7RA 1QLFB 5L2JA 4M5ZH 1JRHL 5IVXE 4QCIA 3BSZH 1OD9A 1XGYH 3IB4A 2BMKA 4O4YL 1QRNB 5DHVA 1BFOA 4Q7DA 2H8PB 4PTUA 3HB3D 4PRHA 1RQ5A 1ONQA 5C0BB 1A7PH 4ZUUA 4PJHE 2BC4B 5DMKB 3MBEC 4AEEA 4FFYH 1DL7H 3BE1H 5CIPB 3D87B 3MRPB 4Y5VB 4E5XA 3RVTC 4JFDB 3TA3D 1MCJA 2NY2C 3MXWH 2UWEB 2COQA 4W4OC 4HH8A 3GHEH 3AU1A 4K23H 4BH7B 4AQOA 4FFZL 4PJXF 1BP3B 4BZ1H 3D5OF 2ICEA 4OAWA 5MI0C 1CL7L 5KSUB 1J1XL 4APQB 5EZLB 2AJXL 2V9QA 1J05B 1TTFA 3VFSA 1DN0A 4N8CH 5FO7A 5INDA 4PRDA 3RWDB 3D3VE 1R5IA 5TF1H 3WLWC 3CK0H 1ZLWK 3LN5B 3O3DA 3ULVL 3IT8D 4Z77A 4X4XB 3V79C 5H94B 1EJOH 2VDPH 1J8HD 4AH2B 5KW9L 1G7PB 1AQKL 1HQRA 2DQIH 3GEWB 1I85A 4YHNB 1VHPA 3I3BA 1I1FB 3O8XC 4JPKL 2YD1A 4QY8A 4LFHG 4G5ZL 2BVQB 3RWFB 2X1XR 1QACA 3F7YA 3FRPA 5HHXL 3QUYD 3IETB 4P4RA 2P47B 3AAZB 2FGZA 3MGOB 2ICEB 1J12A 2P24A 4OAWB 3RWGA 1SJEA 3RZCA 3BO8B 2M26A 8FABA 4PLJD 1N7MH 4JB9L 2W9DL 4P23C 5DK3A 1FFRA 4XPBL 3O0RH 5F7KC 4XCCL 1WVZA 1R6VA 5C0DA 4OGAD 5ILTL 2H2SD 4BA8A 4QRPB 4WFEE 5HHPB 5IJKA 1Q0YL 4L3CA 4OF3A 4M1GL 5TH2B 5JOEA 4KVNH 3MODL 3GKZA 1N6QL 1B0RB 1MCBA 1FN4A 3C6SB 3BGFC 2EEAA 3NCJL 4NHUB 4ZSOE 4GS7C 2VQUA 3B9KD 4J7RA 5DLMH 4AY0A 4LBEB 3GK8L 3DIFB 4WW2B 2HTLC 3KS0J 3KPSA 1PG7X 4ZFZB 5IMMB 1YY8A 5EBWA 5GGSY 4G7YH 4OF7A 4I0PC 3CZFA 4QNPF 1WWWX 2W9EL 3N9GL 5ESAB 4E0RA 3KPSB 3EYVB 3DI2B 4QHUA 5ICXA 1CIUA 4P9HH 4TUJB 3VWJB 1C12B 3EKCA 4YEFA 3ULSA 4MNGA 4ZYKA 4GW5A 4X99B 2EDEA 2APBA 1SBSH 1YJDH 5HGBB 3JTTB 4GKZA 4OZGE 3WKMH 4GAYB 3LZFH 3MV9B 4R4BB 5DC9B 3KJ4C 2CRMA 4OCWL 4WWKA 2JJVA 3GSUB 3GBMH 3PF2A 4OZHE 4UV7H 3QUYB 3G6JF 4MAUL 1T83C 2XFXB 1EO8L 1BQLH 4GAFB 4P46B 1NSNL 1FBIH 3RZWA 3ARQA 1J05A 3S35H 2NMSA 3PGCB 3GO1L 3IDUA 5GRXG 1HEZA 1PY9A 5DURD 1MPAH 3PXHA 1YEDA 4LLVA 5C0CE 4QRTA 1TZHB 3GSNA 3U83A 5F7DA 4MJIB 1B3JA 2X05A 2BNQB 5IHUH 5GZNC 2FX9L 4X4ZA 5T1KA 5I1GL 4L4VE 1INQB 1T5WA 2WNGA 5F1IB 2XWTB 2PXYD 5GS2D 4PV8A 3LIZH 2GKIA 4RGMC 2EXWD 4M00A 1LO2H 2BC4A 2NY3B 3SJVD 2N7BA 1A4JB 4XP6H 1G7HA 1CTNA 1P1ZB 1DQQA 2HKHL 2HT3C 3BN9C 4CGTA 4I0PD 1NFDA 2I5YH 4NKDA 3I6GB 1WBZB 4K94C 5IVZB 3BVNB 1MEXL 1ZLSH 5CFHA 1M7DB 2X89A 4KWUA 4DGVH 1EDQA 1RPQA 4HKXA 2W0LA 5I76B 1U42A 3GHBL 5CIPH 3R4DA 5GS0H 4XVSL 5K9OA 3QEGH 2BSRA 2PYEA 3PGFH 3HG1A 3VFUB 1JPFA 4X9GA 3TH3T 4HIHA 4JZJB 5LXGL 2Y5EA 4ZO9A 3ZDZE 3C5JA 4LRIC 4NFCA 5L0QC 3P73A 1HDMA 3K3QA 1U8KB 5HGHA 5GGTA 1UM6L 1ACYL 4NN7C 1T7ZA 3CLFL 4P2RD 3V5DA 3UYRH 1BFTA 4NKOA 2HLFC 1RZFH 2APFA 3WLWD 5B39B 3L9RA 1W72H 5IOPA 1JV5B 4HIIB 5ADOH 3QUXC 4LAQL 2EDRA 4NQVA 3BJLA 3QI9B 5TGBB 1FNEA 4BQ8A 4UDUB 2WBJA 1BQLL 5ACLA 2A73A 1TZGL 4TRPL 3RA7L 4Z0XA 4M6ML 3DYMA 1OPGH 4L29B 5IB1A 4LP5A 1D5BB 4WV1B 2DF3A 3VGGA 4AMKL 1JE6A 3RU8H 4HWZB 2YHGA 3C8KA 5GIRB 2OXGA 3ARPA 4DTGL 3DROA 5IMOB 2QBWA 4YGVA 3NIGE 5KS9E 2Z31D 1U91B 3THML 5B38G 4YK4B 3V6OC 2MQCA 4DWHA 1MCSA 4G80A 3ELAT 3GRWA 1YMHB 1KCRL 4KI5E 2ORBH 1HK6A 3EJZC 4NC2B 1SM3H 2XYCA 1T22A 3TBYA 1T1YA 4H25A 3UTTD 4Z7UB 4LKXA 2QHRL 2ZOLA 5F9JA 2V5MA 2CSPA 3QFJD 1EEZB 5FYJD 3VFRB 1VSCA 1YECL 1YEHL 1XT5A 1LK3L 1A5FH 2R2CA 3RKDD 1A02N 3H7LA 2R15A 3K2MC 4GG6A 3MACL 1HNFA 4LHQB 5GGUB 1KCKA 2H9GA 4NRYA 5FYJL 3WS3B 1T80A 4C56D 1T1WA 1S9VB 5LWYL 3MRFB 1WWBX 1BD2B 4GW1B 1SMAA 1S9VA 5C0RL 4LPVA 3CFEB 3CVHL 3P4MB 1ZXQA 2FX7L 1UJTA 2EO9A 3CDYA 5HYJE 3WEXB 1T4KB 1HEZB 2IEPA 4YHZH 5E8OA 1TVHA 4OZHA 2V7NB 1DFBL 3RIFF 2VQTA 4JGJA 2NY1D 3CXDL 3OJMB 2QHLA 3NACH 3RDTB 3GB7A 4P5KB 5HGAA 2AJ3A 4TVPL 3PV7A 5I17B 1KTDA 4LMQE 3EHBC 5GGRA 2FBOJ 2VAJA 4OZIE 4U6TA 2O5XH 5M95B 1IKNC 1D5XA 3BFOA 2K9UA 3CSYB 4OCYL 4NM4H 1MAML 3UTTB 2RIKA 2PXYC 4M6OL 1PAMA 5KJRH 4DW2L 3MREB 3VRIA 3ZDXE 4DGYL 1U8IA 1KLFA 2WANA 3TN0A 3X14A 3MRQA 4PJHB 3C9NA 1P5UA 3GIVA 4EDXB 3NPSC 1X5LA 1U92B 1AD0A 3JV6A 3HNVL 3GMQB 3WHE0 5F6IC 4RWYH 3MRQB 4PJHA 2NY4B 3ZMRA 1ZLUK 1KB5H 5GS1C 1PYWB 5CBEA 3IXTA 1XAUA 2YPKB 3OJDB 3PP3H 4PJGB 4S0SD 2H2PC 1C5DB 1FP5A 1RZGA 2VZVA 1LWRA 1BZQK 1NEZA 3WIHA 2LV4A 3VGBA 2X4SB 4YFEA 3KPLA 4PJ9B 4AL8H 3E6HA 4JM2B 2I27N 3A6BH 5J8OA 4IMLB 2DQGH 4GG6F 3MJ6A 3TA3B 4PV9A 4P5KA 5DRWB 1OWWA 4IMLA 5EC2A 4YDKH 2LAAA 4KKCC 4LEXH 3CFDB 3RX7A 4JY5L 3L1OH 3QBTB 5D70H 4JQVC 4ODXB 4Z0XB 5T1LB 5D93B 4JAMA 3I75A 3SKOA 4AG4L 4R4FL 1FORL 1V3KA 3EW3B 3QZWB 3V6OE 3IDNB 4UT7L 3QSKB 2HT2D 4PGBA 5AD0B 4KI5C 2VITA 5BVPL 4ODTL 3OAYK 3LOWA 4XAKD 1DQDL 4OZFB 3BIKB 3ARBA 1LDPH 3HI6L 4OLWL 4P49A 4FQIL 1E4XH 3QIBB 2ED7A 4FQJL 4APQD 3SDDA 1DBAL 4HMCA 1RZFL 3JWOC 5J6HB 4F15C 4XNZB 1M4KA 2J8UB 4HX1A 3VG9C 2BNQD 4A6YB 4L8SB 2Y25A 4RFEB 1J8HB 3KVQA 2DQHL 4M8QB 3QUKB 1S7QB 1ZA3B 1KTDB 1D6EA 1G6RA 4HK3N 5ALCL 2C3XA 3V6FA 1JMZA 2DN7A 1ZWIB 2H2SC 3FONB 4F7MA 1P5VA 3KNBB 3GO1H 2HFFB 5C0IB 3Q6FB 4OCYH 1H15B 5FGCE 3FJTA 2DQJL 1U36A 3MLSL 4G6JH 5E8DH 5T3XE 4JPIB 4IRJD 2VXUL 3SDCD 2YSSB 2YA2A 4WI4A 1DEDA 2IG2H 3CFCH 4WENB 4XC3L 2VERN 2OX5A 1KC5L 4PGBB 3EO0A 3HMXL 4OCRL 7CGTA 1KB9J 4ZXBD 4U1KA 1G7JA 1JTTA 5GRUH 1L6ZA 3UJIL 1TLKA 2A6JA 1OSPL 2A74B 1EEQA 3S88H 4RZCA 3QDJA 1WJ3A 4PJBE 3C09C 3DGCR 2GJ6D 5AUMB 4RFOH 2BOCB 1DUZA 1OSZB 3NFPB 1S7UA 4NZTH 4P3CL 2R0LL 1NFDF 3ULUH 5BJTB 1N59A 4GW4A 3VRLF 5IBUB 2B39A 5EU3A 5DVNA 4PTTB 5KAQF 5JORA 1H15A 4NQDD 4OZ4B 4Z5RB 5BJTA 2XKNA 1MEXH 4LEXL 1MFDL 4ZPTB 3QDGD 4MA1C 3TO2A 4XX1E 3L3IA 1XGPA 5DGRA 1EXUA 1GHFH 1X4ZA 5L6YL 3D25B 3VFMB 2E8ZA 3O2VL 3RIAF 1U8PA 1CXEA 1JGLH 4D0DA 4Y4FA 4F7CB 5MENA 5ABDE 2PO6A 5BQ7A 3DVGB 3OPZL 2A2QT 3MFGB 4X6DF 3GMMB 2FD6L 1QNZL 2VISB 2WP3T 3BOVA 3KPTA 2HJKA 4Y1AE 1YN6A 3OXRB 3TZVC 5D1XA 1WCBB 4U6HA 3ZO0A 5C1MB 3BMWA 1BLNB 2GK2A 3VCLB 5GRZA 1WZ1H 3MV7D 4MA1B 3GM0A 2CDGB 3VXPB 1P9MA 5ESQA 3OXRA 4KTEL 3BGMA 3KPOB 1UYWH 2P46B 5D5MB 1HYSC 5TE6H 4X6DB 2LU3A 2LVCA 5T1KD 1CFQB 4OIAA 4QWWD 5EU6E 5GRWA 2C1OA 4Y5XB 1FNGA 1G6RB 1BZ9B 1MFAL 1UEYA 5TDNA 4PJCE 1YNTB 2VE6A 3H3KA 3G5VB 2AEWA 3HPJA 1T2XA 2WM0A 4XNUL 3NIFF 1RV6X 3IKCA 1YPZF 1PLGH 4TTGA 1EXUB 4F9LA 4LHUA 2J5LC 5AG9A 4R96A 4HWEL 3QIUA 5C0FB 1NUDA 1RUML 3X11B 1IQDB 2V2WA 4PLJC 3X3FH 4KK8C 4NQEE 5DD1L 1NCWH 5E2UL 3K4AA 4XPTL 4HWBL 3MRMB 1FYTE 5JHLL 1S7XA 1GZQA 4DCQB 5EIIB 1UENA 5TDOB 2O61B 5EU4B 2JB5H 3HHRB 4R4ND 4UNVA 1W0WB 1G7JB 1BMGA 5EZOL 4PGEA 3QCUH 2H45A 3QNYA 5I1DA 4BUHA 4H8WL 4I2XE 4U6VL 3BXNB 1E27A 4JKKA 5FYKE 2Q6WB 1E4WH 1WZLA 1HHKB 3ARWA 3ZTJH 1XF1A 5DRXA 2XXCB 1OGAA 2OL3L 1AR1D 2NXZB 3ZE0E 1I85C 2FO4A 3FO1A 2PNDA 5L8KB 3ES6B 3DO7A 3G08B 3DVNB 3KWWB 1ZK9A 3W9DB 5KBNC 4GRLA 5HYFA 2VC2L 4R7DA 5I1IL 4K3JH 1BVZA 5J3HD 4JE4B 2HFFA 2YKLL 2R69L 4R96B 2B5IB 4GKOA 3QI9C 4XP6L 4CN1A 4IIQC 3RQ3A 3L3OA 3RVWC 4NQDA 3VW3L 2QHRH 3LMJH 1BX2A 3LEVH 4L8BB 3O4LB 3RVVD 5AAWA 1F4AA 1RFDL 2PW1B 5KG9A 5DA4A 5FCSH 4U1MA 3L1OL 4UOJA 4FXGA 3NBNA 4ZAKD 3V5HA 4PJ9D 2E7HA 2KKQA 4L9LC 4MCZB 2F8XC 1X5XA 3ZKXC 4FABL 1Q0XH 3QWOB 4G8GB 4LPCA 1F8TL 3LV3B 3HS0B 3GBNH 4Q6IA 3VCLA 1LK2A 1Q9OB 1LEGB 1BECA 3WO4C 3D69B 2NY7L 4NN5C 3TO4A 2XRAH 1UKSA 2X1OA 3LH2L 5CLWA 1T0PB 1IGYA 1HHKA 4KKLC 1UM6H 3TO4B 5KZCD 2EYTB 2YA1A 3WCYA 1YQ2A 4OLUH 2JB6B 3ZDXF 4XRCA 1KBGL 2DWEA 1MCLA 4JY4B 4OGYL 3PE9A 3HI5L 5H35A 1UACH 1LDSA 2IH3A 4GQPH 4I4WA 3U46B 5F7WC 1NGQL 3ZTJG 4NDMA 2C26A 3VDAA 1I1AC 2A1WL 3T2NH 4UIMB 3B9DA 1FV1A 2JB5L 4EJ1C 1A7PL 5K9JH 3U30B 2VZUA 5ECJE 1AGEA 3NZHH 4DN3L 5J1AA 2CKNA 1NCAH 2WLYA 1U8NB 2ZZUT 2DQJH 2VDQH 35C8L 3QJHB 4XBGB 4LARH 1I7RA 4R4NC 1YDPA 3EO9L 5I71C 5BS0A 2AJSH 1ZV5A 3C6LA 5GS1B 1AJ7L 4Q9RH 3W81A 1MWAB 4QXWA 2I9LA 1RVFL 1N64L 2B20A 4UINH 4DK6A 4PJGF 5EFIA 1GVIA 4O2EB 4LCWD 3IDMA 4R4FH 4QRUA 3ILPB 5D1QA 1DVFC 4OQTH 5E2WH 4JM2C 1T0NB 1TJHL 2DBJA 2IFGA 5CGMA 3CSBA 5DDHB 4TOYH 3WN5C 1WCQA 2MJWA 2YPLD 1UB6A 4BFIB 1QFWI 2X4TB 2XACC 3RWCA 5CCKH 2ATKB 3HE7B 4WU7A 5T3XH 4QWWC 4QTIH 5HHOB 1HH6A 1S9YB 1U8NA 4WV1C 5IR1B 3QFDA 5ANMA 3MA9L 4B41A 5C0FA 4JO1H 1NBVL 5C6WH 5ELIA 5D7IF 3T0BA 2IGFH 1PD6A 4KRPD 5CJOH 3QFDB 1CU4H 4FQLH 4JVWA 2DQTH 4NWUL 5IGXL 1KJ2A 3RWJA 4XC1L 3W0WA 4Y19E 4N9GB 2NY4D 4P2YA 4G3YH 4JFFB 5AWNL 2HRPL 4OT1H 2IPTL 4OB5H 3K4DA 4RA3A 2DQHH 1KJMB 1WBXB 1GL4B 2WK2A 4F15B 3DUSA 4CADB 4PJDB 5CEZE 5JXEC 2QR0A 1OGAB 3HZMB 4H0IA 1FVDB 4DKAA 4LBEA 1LEIB 3IF1B 3QPQD 5BOZG 2QR0B 3ARZA 3ES6A 1VKXB 2EYTA 1I4FA 4N68A 2BNRE 3DRQA 3MLYH 4LHUD 2P48B 2NY2D 2EKJA 1MCNA 3MO1B 4H0HB 3HZKA 5LAXA 4JQIL 1UEMA 2YA0A 3RTQC 4S1DC 1FL3B 1C7SA 5IK3A 4WW1B 3RIAK 1FPTL 1I7UA 2ZUYA 2NXYD 5F7NC 4WW2F 3VXSA 3HE7D 1A6WL 3BP6B 5D7SL 3L5HA 2BDNH 4AJ0A 3SE9H 1IT9L 5E00A 4KAQH 4JZNB 1QBLH 4LVOC 1BIHA 1UG9A 1DBJL 4P4KD 2FGWL 5FXCH 4PJ7F 5I6XC 1YEGL 3H3BC 1KG0B 2PYED 1K9TA 4Q0XL 4EDWL 6FABH 1FYHB 3PL6C 1V7NH 3ZE2E 4IRJC 4QCIB 3MUGB 1HQRB 5HYSG 2PO6D 3L3DA 4X5XA 1DVFD 5I9QC 4LIQL 2H8PA 4PTUB 3HZMA 1FYTB 4LVEA 3KJ6L 2EECA 1KTKE 3CZFB 2ZCHL 4E42B 3GNML 4W4NA 5L2JB 2ADIB 4MDIB 5GRVL 2B1HL 2WUCL 3OKEB 4TNVF 2JLLA 4L3EB 1I1FA 4PJIF 4AIZA 5J4MA 4WY7H 3GSQA 2FEDD 4U1IA 2DQCL 3HPLB 5GJSL 1CVSC 1F4HA 3BD4A 1X7QB 1BEYH 1LO2L 2K7PA 1LEKB 5LGHH 4FZEH 5I66B 1QVOA 2VZ1A 3IJSB 5ETUA 2VLKD 3SDXA 1NFKA 1KIUA 3DLQR 3O81A 2CR6A 1X9QA 4IRJB 2RAMA 1KIPB 1ZT7A 1D7FA 4XPHH 4PFEA 2M8XA 3BAEL 3IDXH 2A38A 1AGDA 4HXBH 5EBMA 3B9KC 3PGCA 1TJIH 3RGVA 5EZLA 3GHBH 4AZ8A 3G6JE 3PDOA 4H1LA 1G1CA 3DMMA 3CNKA 4LLWA 3DO3A 3ARDA 2JTDA 3RJQB 3RFZC 5KSBE 5E4EB 3U1SL 3UTQA 1EO5A 5IEKB 3MXWL 3O9WA 4ODUA 3U4BH 4Z7WF 5DC0A 2EDLA 4YXHH 2J12B 3OKEA 4KGJA 2F74B 3O4LD 3RA7H 4L1DA 2VXSH 4ZO6A 3W82A 4HKBA 4TUJA 4Y5XC 3UXFA 4KKCD 1ZOXA 3V2AR 4WGVB 2ZP0T 4Y4HB 3RGVD 3GBML 4HKBB 3MRIA 3QHFH 1AFVH 1HQ4A 1JNNL 1U8OA 4MNQD 4M4RA 5DQ9A 5CEXB 4HJ0C 1DBBL 1UADC 4TQEH 2Z8SA 2RBLA 2DKUA 3TYFB 3V52H 2BVPA 1IAII 3BP5B 3J7HA 5KTEH 5EO0B 2D7MA 4OCLC 1CFNB 3HRZB 5F7UA 1OHQA 1R3HA 2P5WD 4XMLL 3DMMB 3MV8B 4HWNA 3SJVA 2AI0L 1QBLL 1X5AA 4JQIH 1EHLH 4D2NA 5AZ2H 3LN4B 3X3FL 2Q86A 3L5JA 1RZ8B 2ILLA 3JZ7A 4ZOEA 3KPMB 1M05A 3FHQA 1JBJA 1GGUA 1C8PA 1ZKAA 4XCEA 2VDML 2P8LB 2BHUA 4MNQE 3SDCC 3HNSH 4PUBL 2DQCH 2F19L 5EN2B 2V9TA 4BZ2H 5FGBA 4JFZH 3EYFB 2ICWB 4E41E 1ZVSB 4GXVH 3ARGD 4YHNA 3FMGH 3FQRA 5EOTB 4ZFZA 1R24B 3MPCA 4XGZA 3L7FB 2B1HH 3NH7H 3QI9A 1SJHB 3U48A 4LLUB 1CL7I 1UM4H 1ZEAH 3I6GA 3MYJA 5CJQL 3MRHA 1EH9A 1MFBL 2OR9L 2R2EA 2ED9A 1EO7A 1DQML 2J5LB 5MEND 1CLYH 1R3LA 2CIIB 3RWEB 4UT7H 1RIUH 4XTRC 1FFNB 2J88L 4U0RB 4J8RB 2IQAB 2HJFA 2A9NL 1QSFE 4KY1L 3L5IA 1XF4A 1NUNB 1T7VA 1RZ8A 1CG9A 1F58H 3EJJX 1BM3L 5B3JE 5HJ3B 1FO0B 4UIKL 3QDGB 3ULVF 2BOBB 3MOQA 1J7VR 1OCWL 3RJDA 5JDJA 1JZ5A 3RNQB 3QISA 4PBVC 4ZTOL 5IGXH 3PWPE 1VB9A 2C1PB 4Z7VF 1NAKH 3SGEH 1A3RH 3EAKA 1A7BA 1LNUB 1AKJD 2F53A 1XR8B 1KLUA 4YE4L 5MENE 4R7NB 2GITA 4GKSA 5E9DB 5FDYA 2VXSL 4QRRD 2P5EB 3U7WH 2VDNH 1CE6A 1IBGL 1P1ZA 3IFOA 2EXYD 1RZJH 2YC1A 5I6XB 3STZB 3VJ6B 4KFZC 1BOYA 3THMH 4U1NB 2XQBL 5GHWH 3HPLA 2F5BH 3S3SA 3BKYL 4X9IA 5FKAB 1FNEB 5D1ZB 4NWTH 4KKLD 4Z76A 3WS6A 3K0WA 1UVQB 3VRJA 3QG6A 1VDGA 1T0MB 4JFHE 1GGIH 1HILB 5DFVC 3REVA 3FOLA 2IQ9L 1QP1A 4XAKE 5DJCB 3WFEL 4JRXA 1F3DJ 3DX6A 5DWUH 1S5IH 3D0LA 3WUZA 2L4OA 3LS4L 1BOGB 4XBEH 1J18A 3E6HB 2Q76A 1CS6A 3OWEA 4Y19B 1VFMA 1OQXA 4RAUA 5CCKL 3RY6A 4PJ8A 1SQ2N 2FNBA 3SOBL 4KQ3H 3CH1B 2UWEF 3KYMB 3P0YH 3FQNA 4KXZI 4Z7UE 5F3BB 4F7PA 2AK1L 1AKJB 1AH1A 1HHGA 2HFGL 3TWCL 4GW5B 1TDQA 2R1XB 5DHVH 2DDQH 3DXAE 2WBJB 1FL6A 2BXYA 4L8DB 3PP4L 1KGCE 3LCYA 2AQ3A 2DLFH 4N1HB 1MJ8H 2XXMB 1NGPH 2J6EL 3QUMH 3HLAA 4DKFL 4MHHG 4K3DH 5DF0A 2OS7A 1VFBA 3P9MB 5HDBE 3DVFA 1FG2B 3VA6A 5CHNB 3VFVA 5D71H 2XG5A 4J3WA 1J8HE 4LU5L 1FZMB 3EHBD 1UWGL 4PY8J 3TVMB 4JRWA 3AY4C 4U6XB 4U7KA 4IBLT 5B3JF 1BWMA 2DAVA 1A7QH 1AR1C 3V6ZA 1BF8A 1RZIB 4U6XA 1PX4A 4EN3B 1YNLL 5L2KE 2FATL 3UX9B 2IALA 1DLHA 3MTRA 2XN9E 4Z7QE 4XB8A 1P2CA 1U95A 3X13A 1H0DB 3RTQA 1KBGH 3VWJA 1QRNE 1P4BH 2EZ0C 5C0BE 2I26N 1W2KT 3ARFD 1T04B 3S34H 3MLYL 4S10A 4R4BA 3QIUC 4UILH 1J1OL 4GFTB 2JJSC 3IDNA 4L29A 4P2RA 4IRSC 2O93L 3HR6A 3VGHA 4DZBA 4L3AA 4WFED 4F80A 2EDDA 1AXSA 1KENH 2GTWB 4CVXA 4OZGB 2EH8L 5MERA 2HT4C 3QIBA 3TBTB 3BW9B 2FGWH 4DOHB 2IANB 1QLEL 3LPFA 1YEHH 5ITFB 4YXKH 3VU2A 3PL6A 5FCUL 2HKFL 1C5BH 3IDJA 3T0EA 3ZYOA 4POUB 1HDMB 1J10A 3SE8H 1LE5A 4CNIA 2C9AA 4ZO7A 4JHWL 2GTZA 5HGAB 2DKSA 1JGDB 1INQA 1T5WB 3CLEL 2R1YA 4BM7A 1X44A 5EU7E 4TSBH 2Q7YB 1CLCA 1TCRA 4NBYB 4Z9KB 3OKNA 4Q9CA 1OGAD 2JCCF 4NM8L 2FZ3B 3BKJH 2YZ1A 1IGFL 4UAOC 1QPPA 2FDBP 3O3UN 2FJFA 4F7MB 3UTPE 1MLCB 4TYUA 3ARBC 1U95B 3X13B 4JO3H 5IEHA 5F7YC 4JFQB 4XNZC 3AMLA 5DVMA 1H3TA 1WBZA 3F6LA 5IVZA 1P7KB 5E1AB 1BAFH 4DQOH 4X7FC 5E9DD 1MCIA 2O5YH 3OKMA 5F7LB 4HUWA 1S7SA 5IBTH 3V4PH 4K07A 4G6FD 5T5FL 1OL0A 5GIRA 3CPLB 2V5SA 4G6AC 3VDBA 1C5DA 1MVFA 3SDDB 4QXGH 5TQ0L 3DMMD 4J4PD 3MCKA 4MA3B 4W81A 3QH3B 4JY6B 3HG1D 2VMFA 2DTML 5D2NE 5DD5H 1U8KA 4U49A 3WD5H 1LE9A 5K93A 4LNVA 1I1RA 4OQTA 4ELKB 1SYVB 5F89A 1XEDA 5L9DH 2AEPH 2GJ6B 5C09B 3CLFH 5E4EC 4R6UA 1PG7L 2DWDA 3ALPA 3GMRA 5EC2B 2H6PA 1PLGL 5H37H 3G6JB 3WSQL 4ZFFB 5SV3A 3B9VA 4P3DA 4HK0B 2N56A 5B8CC 1YEJH 2EE3A 5I8KH 3HZYB 4P3DB 4TULL 4NIKB 5KTEL 3BQUD 4LIQE 3V7AG 4PRPB 3CFCL 4XC3H 3X3GL 1WIPA 1AHWA 1UYWL 1U3ZA 4CMMA 2DYPA 2CKBH 4QT5A 3BE1L 3BIKA 2EDWA 4FFYL 1S5IL 4YEEA 3D48R 4OM0H 4MSWA 3GSOA 4G6MH 4PYGA 4X6BA 1FG2A 5C9JA 5F89B 2HJLB 1A1OA 3TYGH 4X6BB 1MCEA 3H9SE 4CU7A 5FUZL 4MJ4A 4G9DB 2J1KA 4P2RE 3D0VA 1JPSH 3GBLA 1NGYA 4BSVB 1X6NA 5EIVA 1ZHLB 3UBXG 3NPZB 1CDJA 5L6YH 3WJLC 1G9MC 4QYOB 5J1TC 1B4JH 2FWOB 2GAZA 3QUKA 3OHXA 3WDIA 1D5XB 1FAIL 4Z7VE 3Q1SH 4XB7A 1NAMH 4QXTB 4WI7A 1A6AA 3V6FB 1M1SA 2GAZB 3V9FA 4Z5RA 4RMVA 3E8UH 3BZFA 4JRYE 4P57A 3TO2B 2FIKA 1F2QA 3B2VH 1IC4H 3LKRA 4ZS7H 5FA3A 5ICYA 2VLJD 2X4UA 3O4OB 2X10A 5L2KB 3V0WL 3L6FA 2YXMA 1VFAA 4Y2DC 2AXFB 5EU7C 1D5MA 4KGLA 4OZGA 1IGMH 1W8NA 4OZIB 2E8YA 5JLZB 2EYRB 3FFDA 5A2KH 1T4KA 1UZ6E 5D1XB 4J23A 4JG1H 3IXTB 4FQIH 3MCKB 4MA3A 1HYSD 5HPMB 1FNFA 3WSQH 4KTYA 3K81A 4HUUB 4G7YL 4JFEA 2RCSL 1YN6B 5CAYB 1QSFB 1FDLL 2PXYA 1T7YA 4TTDC 1M7XA 4X80L 5D7KE 5T3ZL 1CGVA 1A21A 4K2UH 3VXOB 2HT3D 3KR3H 4U1SB 3TPUB 3HKFA 2YMXL 3OMZA 1D9KD 5D5ME 1DLFL 1HINL 4HPOH 1JMXA 5I8KL 1XZ0A 5B39G 1KCUH 4Y4HC 1FO0H 4Y5VC 3D25A 1C5CH 4MLIA 3VFMA 5JTWA 2IADA 3AMKA 3UAJC 5FGRA 2VDRH 1U6AH 4ODWA 4HFWB 4G42B 3U4EB 1QLRA 4DGIL 3QCVH 4ZDHB 5I1CH 4NP4H 2V5RA 1ZSDA 4U1JA 5HYIA 4LPTA 2MNUA 3ARSA 3O6LL 1GC1C 2AK4D 1JHTB 3KHQA 1CDHA 3TIEB 4PGEB 4N1CA 4I3SL 4JJ5B 4YFDB 4MAUH 5IVXA 1Q9OA 3Q0HA 4LSVL 1J0ZA 4X6DA 1ZLWH 3WBDA 5FIEA 2EIZB 4IOFD 1NDMA 1DBKL 4O2EA 3JXAA 5EORH 2W0PA 4Z8FL 1E27B 3QDJE 4JR9H 4L8CA 2W9LA 3QNZA 3LQZA 3MNVB 2V5TA 5C6PB 1FFQA 3PWUA 5CMAA 1KXVC 3EDEA 5IW6B 3IKCB 3MV8D 5DQJA 1NMCC 4U1LB 4HGKC 3AREA 5D2NB 1MQ8A 3ABZA 5DJAA 3BPLB 4ZPTA 4X5WA 4L8BA 4NO3B 4HS6A 4PJFF 1FV1B 3R0NA 3C60C 1CGWA 3C8HA 3LDBB 4MJ2A 1KT2B 4U1MB 2O26U 1X5GA 1KACB 2XZCL 3MX0A 4M1CD 5T5NF 1BX2B 4JDTH 2Z31C 3U9UA 1MJUL 4NZJA 1MREH 1A4KA 5HHXH 3S3JA 4QRQB 2IF7A 3BZ4A 3OG4B 5FHAH 1S5HB 2CJUH 1GZPB 4M7JL 1A5FL 3KXFD 2AXHA 4M9OA 1NDMB 3MODH 1J0JA 4KDTC 5HYJB 4CJ1A 4I2XA 4NCDA 3WIFB 5L7XL 1JYNA 4DKFH 4HDIA 4TUKH 2AK4B 5I1DB 3I02B 4OLXL 3OR7B 5HYJA 2PYEE 3ALXA 3BWAA 2V17H 1RU9H 3WJJC 3KPOA 2W07A 5CMAB 3WYRA 1L4IA 1V3JA 2JB6A 1LEGA 4M6OH 4ODHL 1FZKA 2YD7A 1WISA 3MLZL 3FOMA 3Q3GA 3TBVB 1CN4A 4WGWB 1CDYA 3RX8A 2R23B 4PP1C 2C3GA 1A1MA 3PWVB 3M17A 3DURB 5J6GB 4WCYL 4F57H 4WUUE 2YPLB 4DN3H 4HG4J 5J12B 2PW1A 5KG9B 1CTOA 2JCCE 3JWDL 3JBG7 2FATH 4DTGH 1EGJH 3UTTE 5J1AB 5I1CL 2XWBA 1F11B 3FQTA 4PBXA 3QRFM 1VEMA 1ED3B 1TTUA 5IB5A 1TZGH 1M6OB 4H1LH 5CP7B 2AABL 3FQTB 3M07A 4MXVE 4M7LL 3ARUA 5DMGC 4PG9A 4JZNA 2VSCA 1REIA 1I3GL 5HGDA 4GRWF 2YRLA 3DXAA 3WN5A 1NCBL 3MLTA 2BNQE 2Y1VA 1IC7L 5DUML 2XTJD 4U3XA 4Y1AA 5ISZD 1AIFA 5J12C 3VFOB 5D1QB 5HSFA 4HQQH 4U1GC 4HZLB 1CK0L 15C8H 1LEIA 4X5XB 3L3GA 4WY7L 5EFIB 4U1SA 4QTHB 2KPNA 4L8CB 3G5ZA 4RGNB 2IPUG 4HAGA 3U4AA 1E6JL 5H37G 3DHMA 5I1AB 3Q6GH 4PJFA 1GOGA 4PJCA 4KJYA 3FB8B 1S9WB 4YDVA 5T5NG 5I16A 1Q8MA 1NBYB 2XZQH 1D9KB 3GI9H 3IFPA 2VZOA 3TESA 5JOPD 2XV6B 3RBGA 3SDYL 1LO0L 5I75C 4YR6A 4LSSL 3AGVA 3VXUE 1KJ2L 4ELME 4J1UA 3U9UB 1L9NA 3MLTB 2Q3ZA 1OAYL 4X7EC 4UNUA 1MJJA 1MLBA 2W38A 2OLDA 3WD5L 5HI3D 2CK0L 4RISH 4WO4D 2ERJB 5F21B 5IBTL 3KR3L 2XNAA 1Q72H 1IM9D 3B2UC 5CJBA 1CE1L 5GS0L 3MOBH 5D8JL 3STLA 3AM8C 4JVPA 1VACB 4YHIA 4IOIB 4NM4L 2E6QA 3OGCB 4W68A 4PJIE 1F3DH 4LVHC 4PJDA 3MNVA 3BEWB 3DX7A 3PHQA 4PJFB 5DD5L 1UB6B 4HFUH 4QTHA 1DFBH 5LAXB 4XVJH 4GQ9L 4N0UE 1CD8A 3EO9H 4OCSH 3NACL 2IG2L 1N6UA 2UY7A 1U8OB 5DQ9B 5CEXA 5I74C 5ID1B 4JKPL 2ZUTA 2D0HA 4PIRF 1AO7B 1MI5E 5I9QB 1IQDA 4HG4K 2Y6SC 3AU1B 5JNYA 5FM8A 3PDDA 5E7BA 2DD8L 5HVGB 4K8RH 4Y8AA 5E56A 5CEZL 5CJXA 3AB0C 3W0WB 4ELMA 2EKSB 3F65A 4L4VB 3OX8B 5IQ7L 2HMIC 3RVUD 1OY3B 1NC4B 3H9SB 1G9NL 2R56H 5FDWA 5K59E 2FIRT 5HI3C 1C16B 2ITDA 4DVRL 2WZPD 5DTFA 5CILL 1AGBA 3UTZB 1FG9C 1IAMA 2X4NA 4PJBB 2NZ9C 2R0LH 1MWAH 2GYSA 5IVNA 2IGFL 4QXUL 2Y07L 2MWCA 3B9KB 4PJ8C 4NJAL 4OZFH 5DD3L 1QLFA 4ZXBA 4HS8L 2IAND 3HAEB 2EO1A 2JE8A 1NFDE 2R0ZL 2BRRL 3RGVC 3QDMA 3LKOA 3MFFA 4XCCH 1CZ8L 2NY1B 4HMEA 4QF1A 2OSLB 4X98B 5HHOE 1WZMA 4M1DL 2K7QA 3SO3C 3ARFA 1KJVA 2IPKB 3TO4C 3RPKA 2DIAA 5DMJB 1IAIH 5CP7A 3VXUB 2C4XA 3U6RA 4P46A 2VDKL 4U0QB 1T5XA 1P4IL 1DSFH 4OLVH 5E8NB 3ARVA 1Q0XL 4A2LA 3QXWA 3HC0B 1JRHI 4R26H 3QDGA 4JFHD 5E00B 2B8OT 3E1F1 5T3XD 3HI1A 4HD9A 4APQA 5ITBL 5JZ7C 2BY1A 2FJGB 4XPAL 5JIHA 3NVQA 1YEDB 2R4RL 2ZNWA 4X7CC 5HI4D 3RNQA 4FNLL 4L4VA 3TZVB 3WXWH 5E6ZA 4PLKC 5KVDH 1RUPL 4WDIB 3I6KA 3KPRD 1EVUA 1PKQB 3CH8A 2UYLB 4W6YB 3VG9B 3O41A 4N0FA 4HBCL 4J2XA 4MDIA 4YNYB 3JWDH 5L7XH 1NBQA 3DX7B 3PHQB 3LKOB 2OYPA 3OZ9L 2EE9A 1L9MA 3ARBD 1A4JA 4JN2B 2C5DC 2NZ9D 3Q5OA 5FAAA 1KUMA 4KMTL 5I16B 3HFMH 3E0GA 2J8HA 4HWBH 1J1XH 3OF6D 4X7TA 1CL7H 2QSVA 5C0GB 3MRRA 4PJ5D 1XR9B 1RK0B 5F71A 1PZ5B 2D31B 4K7PL 4RCAA 2NLJA 5CD3B 3V4VL 3CFBB 3SPVB 3SDCA 5E0QA 1K6QL 2VLKB 1R5VA 5TF1L 5C0DB 4K9EH 2ITCB 2DLHA 3W2DH 4PRDB 3RWDA 2D03H 4FMKA 4YHYC 1W0YT 4UB0L 5F1NA 3C6LB 5F7EH 4HIJA 1UT9A 1B4RA 1W72A 2WW8A 1AGDB 5EBMB 1M05B 2MQ0A 5E2UH 3PGDA 1RZKH 3OTTA 5EOCJ 1XFPA 4GBXB 4MB4A 1F45A 1N0LA 3RL1B 5EUOB 5KVFH 1N2RB 3TIDA 5TFSL 5BS0E 4MJ5A 5EB9A 5JR1H 4DUXA 3F5WB 5SWQA 5E6YA 4KHXH 3REWA 4ZNCD 3LPWA 1RFDH 4KJQD 4LASH 4RGOL 5E2JA 1C12A 4QRRB 3ZT7A 1FLRL 5C0BA 2IJ0C 4GKNB 3RI5K 2B4CH 3IRZA 2BSSA 3EOBB 3HNTH 3ZYJA 2IMMA 3FZUC 4NQSB 4IOSD 3UDWC 1KTLA 4PGZA 1DVFB 1XR9A 4Z7NF 5CLTA 4C54A 2ARJA 1KF9B 3MRHB 3QCTL 4MQ7A 2X40A 5ISZB 2Z31B 5ENWB 1CE1H 2H26B 2Z92B 3QIWC 5T3ZE 2FRGP 3WV0A 3LN4A 4K3JL 3UTOA 4HS8H 2O5ZH 3DGGA 3C5JB 3SKNA 4O5LL 5JO5B 3QR2A 1NMAH 5EUOA 3ZE0F 3F7RA 2DL9A 4XCEB 2NY3D 5F7DB 3SJVB 3SCMB 4PJXE 4LCWE 1NC4A 4XPFL 1K3IA 4H1LB 3TVMA 4EXKA 5I1KH 3WJJA 5JPNA 2P1YA 3SCMA 1IQWL 5JIPA 2BVYA 4GRMA 3UC0L 5FA4A 4JFFE 1RJZB 4AEIH 3UJJH 1QSVA 3O3BB 5EOQL 4ODHH 4WCYH 5D7LB 3S97C 5DUBA 2VSDA 3PJSA 4M3JA 3ARRA 1A2YA 5B8CA 1RHHA 2D7NA 3D39A 4MXQC 4O2CB 1IAKA 4XMPH 3QHZL 1TJGL 1HZHL 3FB5B 4PLOB 1NC2D 1IARB 2GY5A 1WFTA 4X7TB 3RGHA 1JCKA 4PJ8D 2JCCB 1U8HB 4Z7UF 1KJ3H 1F13A 5EUKB 2MKLC 2X4QA 2BVTA 5IFHH 5DT1H 3CC5A 1XCTA 4XCNB 4PR5A 1MVUA 4FRWA 2VKWA 4JFFD 4LDLB 2OQJA 2WWMC 3BESR 3RY6C 1MSPA 2YBRA 4Y4HD 2X7LB 3RGVB 1NMBL 2VH5L 1Y0LA 3TPKA 1FSKB 2C1PA 3F62A 4IHOB 1ZHNA 4KROB 1CD1A 1HHIA 4LLWB 2B0SL 2P43B 1ADQL 2Q86B 4Z7QF 3O6KL 1MY5A 5EUOE 1EVTC 4XBPA 3RNKA 3NZHL 4PLNC 2Q7YA 3HNSL 1F5WA 4OGZA 1BFSA 1LO4L 3DETD 2R0ZH 4PD4J 5I17A 1VERA 5E6ID 1UH3A 4MJ6B 4WEMB 2I07B 3ULVH 1FAIH 4RISL 3Q6GL 4KKAD 5DO2C 3ROLA 2WUBH 3BPNC 4K71B 2EZ0D 4QHUB 2R39A 4WEBH 1Z0MA 2G9HA 1MWAL 3PGFL 5BXFB 3DSFH 1JUFB 2A6KA 1XF5B 4XXDA 1FSKC 1G7HB 1Q9WB 4JPKH 5EWIH 3IJSA 2Z0BA 3RI5F 1SJEB 2RJMA 5ID0B 3AY4A 3GK8H 1JHKH 2DB8A 3T0DA 5J0BA 4IRSD 4ZFOB 1UKTA 2AGJL 3MRKA 1RJYA 3FT2A 3LSOB 3CPLA 1NGXA 2B1AH 1C08A 3G6AA 5ALBL 5FF6B 3C5SB 1N6QH 1YJDC 2CXGA 4X5LA 3OXSA 2CLVA 2CD0A 2MCPH 1GRWA 2ESVA 2V2XB 2J8UE 4QKXB 1X5HA 3U7WL 2FL5A 5C7XL 1CQYA 2WBJC 5L8LB 2AJVH 3SJVE 1B0RA 3ULUF 4XPBH 3BH8A 2LTQB 4OLYL 2QADB 1RZIA 4CU6A 4P2QB 4EN3A 4XVUC 4A6YH 5HBBA 4H88H 3ARDD 4XBPB 1BOGA 2JJSA 4W4OA 5A40E 2X89D 1J0HA 1E0OB 1S78D 3N0PB 3EDKA 4HPOL 1L6XA 1NAMA 5D2NC 2Z93B 4RGND 3F7YB 4V1DD 3KXFB 4PRIB 4P2OC 5IB1B 4P59L 3O8XD 5FEBA 4IDJH 1CGSL 2GI7A 2UZXB 4AEIL 2EH7L 4CU8A 1KN2H 2Y36L 4M6NL 3RWHA 1CLZL 2CIIA 1M7DA 3RWEA 4OI7A 1G84A 2A6DB 4L8DA 1T1WB 1T2QL 3NCEB 3V7MA 3EYQD 4MXWH 2VITB 5GRYA 2EC9T 2AXGA 1RJYB 4O58H 2OZ4H 5K59F 2IANA 2A6DA 2E9WA 4NO0D 2XI9A 5F9OL 4JO3L 4LSRH 1U3HA 1Q9LB 4FN0A 4P9HC 2P5WA 4V2CB 4PY8I 3QUXB 3CFKB 2AP2A 1NLBL 2L7JA 1CLOL 3QPQC 5F9WB 4FQPA 1FN4B 3C6SA 3G9VA 5MP6H 3GNMH 5JQ6H 1HSAB 4JREB 4QHKI 3GSNB 3V7AE 3DVIA 3UPCA 1EJOL 2IWGA 3MV7B 1UJ3B 1RI8A 3QUYC 1UXSB 4D3CL 5C0AB 3F7VA 1Y6MR 3TBYB 4U6YB 3RDTA 5IEHB 1UXSA 3OKNB 2F53E 3HZYA 1HSBA 4NO5A 3Q48A 3CH1A 1DBJH 3QQ4B 1BIIB 4LQFL 2V2TA 2CMRH 4OLZH 2E9BA 1FZJB 4GG6E 1K4CA 1LP9F 3BKJL 3KYOA 4BSWA 3UTSD 3CVHH 3OKDA 1NFDB 1IRAY 1YC8A 5L88H 1SEBB 5BZDA 1LILA 2Q7NA 4WWKB 4EN3D 2EE6A 3L7EB 5D7LE 2C3HA 4Z76B 1QHOA 3WIIL 3SQOL 2M2DA 1CFVL 2A6IB 1KCVL 3GI8H 5MERB 3MRFA 1QFUL 1MCRA 2R0KH 2HJFB 5DMIL 4N5ED 3S36H 3LKQB 2ATPB 3IXAB 3T0AA 2X09A 5E08L 4J4PA 2ESVB 3P9MA 1V8HA 4APQC 4FQQA 3QFJE 3HAEH 2Z8WC 3IXAA 4YC2C 1KOAA 2A0LC 4UT9H 3QUMB 4I9WE 1NKRA 2OXHA 4R9HA 3ECBB 4XC1H 2VR5A 2NR6D 2AJ3B 1DJSA 2ZUQB 2AQ2A 2E9JA 4U0RC 4CBPA 5BV7C 2YUXA 4L5FH 5A2LH 2BVEA 4OCMC 4F37F 1JYXA 3OSKA 5HVWA 2NY5L 4MMZC 4HK0A 4XPAH 2EIDA 4KMTH 1XIWD 3QDJD 3WKNA 3KNBA 2EDHA 3GMRB 2NY6B 4ZUVB 2C7UB 1SEBA 1YMMA 3CU1A 4X7SL 4H5SB 5CUSL 4M43H 3IU3A 4U7SA 2HN7A 3QIBD 5C3TA 2YMXH 3DPBA 3EO1A 1B90A 1EZVY 2P5EE 4OCXL 4ZAKB 2O5XL 4WWID 3IJYA 3TFKD 1FLTX 3GJFB 3QXDA 5TPWH 3ZYZA 1KELL 1T03L 4F9PC 4YPJA 2NX5E 1PYWA 4HJJL 4LGRB 2B0SH 4RNRA 4ZS6C 5FF6A 1GAFL 1E4KC 1RZGB 3JWOH 4L4TA 4MD5A 1IVLA 5D1XD 3BRGC 5DD6A 1ZLVH 1UFUA 3KDMB 5IKCB 2DI7A 4HUUA 4I8DA 4HV8A 4PGDB 2LFGA 5C2BL 4JQXC 3H6JA 4OKVA 5B4MD 3FMGL 1MCDA 1NPUA 1A1OB 4XP1H 4EKXA 2EIZA 3V0WH 1AGFB 4DVRH 4KPHH 2XA3A 4DAGL 2D9CA 3RHWK 4PUBH 3LRSA 4Q0XH 4EDWH 6FABL 4PJ8B 1ZHKB 2IAMA 3F7QA 1URLA 1D6VL 1DEEB 1E6JH 1N64H 1VESA 3BRDA 1JPTL 2I60H 1JZ3A 2XZZA 1L0YA 2NY4C 4ERSH 3HPJB 2D2OA 1NMAL 3AUVA 4M02A 4ZUVA 1I9RL 3CFIC 1LQSR 4ENED 4FZ8L 4PRHD 4JFQA 3ZDYE 5C0IA 2GY7B 2VZSA 4NGHH 1PW3A 4QXTA 1H8SA 4JO1L 4PJ7B 4PJ5B 3JVGC 4WHYG 1MCOL 2CLRA 1JL8A 3TN0D 3I9GL 1H3PL 3FHAA 5IF0B 1BGXH 3UBXA 3QIWA 3KYKL 3LKPB 4XCYB 2XN9B 5TE4L 3DARA 4NO2A 3GMQA 1Q9LA 5DEFA 4R8WH 1GGTA 4XMPL 5FOBB 4YXHL 1F4XH 1MHEA 2B5IC 3EO0B 3CX5J 4JFEB 4BSJA 1SHMA 3QUMA 4ODSL 1JGVH 2F15A 3O4OC 5BVPH 3S96A 5T1DL 1XCQB 3BWAB 5FYKU 2LAGB 3UJJL 3T0EE 3VFPB 2UUDH 1CFVH 3D0VB 3GI8L 3G5YA 3QO0B 3S96B 3F58H 4GMSL 1U8QB 2W65A 1TQBC 3S3PA 2MHAB 3LD8B 4GMTH 1IM9A 2KZ1B 4K8RD 4PGCA 1CXFA 5IG7B 5KSAD 1BZ7A 4CRPA 2AV1B 5HY9B 4UIKH 4QOKE 1BIIA 3QJFB 5F9WC 3LKRB 4ZUWA 3OHXB 3QIBC 5C08B 4N5UA 4ODWB 2KQNA 3S5LG 2F54D 1I1CA 3S37X 3VWKC 5FYLL 4PGJA 1YYML 1U8PB 4D0DB 5C08A 4TVPD 2CPCA 3DBXA 1BBJA 1XGQB 4HLZG 5GGTH 1YNKH 3BZFB 3KLAB 4P57B 2PR4L 3O11B 4BJLA 4G8GD 3FB7B 3AVEA 2DJSA 1RJLB 2NTFA 4JRXD 3GDBA 4N90D 4TQEL 5E5RB 3ZTNH 1MIML 1PQZA 4NHCL 1DDHA 4UBDD 5CBAA 1LHZA 5F96L 1BLNA 3E2HB 5KSAA 4FQQB 4XVTH 4KUCD 2BNRB 3MNWB 3WLBB 3WFEH 3BGMB 3CU7A 4PGDA 5DK2B 2P49B 3BKCL 2R4SH 3TCXA 3DV4B 4PGCB 5SWSA 5KVFL 4LIQH 5ESQB 1HWHB 2PTVA 1INDL 2WQRA 4MMXC 4JPWL 3WFCH 5IESH 3Q3GB 3O8XB 3T3PE 4LLDB 1U8QA 1JPGA 3CCHB 3MJ7A 4ZTPH 2X9XA 3SOBH 1OAZH 2ZSWB 2DL2A 3LB6D 5JHDD 3RL2B 3RUGF 1Q9KB 2HKHH 3DBXB 4P0DA 3EFDL 5BVJA 2B7DT 1S7VB 4KDTA 3S4SG 3RHWF 3C5ZD 3MV9D 3SE4A 2VZ3A 1AHWB 1F11A 3C87A 4FTVB 4HFWA 5IB2B 2AGJH 1BJMA 2JK5A 5C08D 3V5HB 2ZG1A 1M6OA 5AZEL 1I8KA 1UXWA 3EUUA 5D6CA 1EFQA 4P46C 4N8VG 1CFSB 1FZOB 5INCA 4UQ2A 1MFEH 5DO2D 4JY6A 2BRRH 3HC4L 3L3KA 1HNGA 43CAB 3QI9D 4OLUL 4I3GA 5MEQB 1OM3L 2A9MH 3ARXA 3UP1A 2OM5A 4NKIL 4GG8A 3PWJA 3UCRA 3S7GA 1D5ZB 2R2HB 3TBWB 2VL5B 1AGFA 3VH8G 1QSFA 2CO6B 3HMWH 3DV4A 3KWWA 3I9GH 4NZDA 2VL5A 1AHWC 1K3ZA 3HC3L 3BEWA 1M7IB 1EAPB 5E2VH 1R5WA 5ACMA 1OAQH 3R06B 4XPGH 4DN4H 3NCCB 1EAPA 2GSGA 4G8EB 4NT6B 1ULVA 1A0QH 3TT1L 4MVBD 1MHHA 1DQJA 4EVNA 3GMNB 2V2WB 4OIIL 4I18A 1OAXH 4PJ5A 4ZDHA 5DQDL 1S5HA 3BMVA 1KT2A 4WUKH 4K7FA 5GISH 3BKCH 5CSGA 4MJIE 3HMXH 5SWZA 3O2DL 5HGDB 1IZJA 1FL5A 4GO6B 4QRPD 3LKSA 4TPRL 1ZA6A 2DTSA 3WUWB 2DQUL 4Y7MA 2YRPA 3BUYB 5CEYA 5I19L 5KVEH 3QDJB 1YY9C 5CINL 3VXPA 1QZ1A 1KCRH 4XMLH 3ILPA 4MQXD 1R5WB 3RKDC 3CSPA 2W9DH 2QADD 5I15L 5I8OL 2HYMA 4BZ2L 3D69A 4RSVA 4YXLH 3VXOA 5AZ2L 5HYQA 3V5KB 3RDTC 5C6TL 3HR5B 1AQDA 1T20A 1K8DA 5C07D 1F4WH 4DKDC 4JZOA 5CEZH 4LSTL 2IPUK 3BI9X 1IGFH 2P8MB 2HT2C 1UKQA 5IB4B 2Z91A 4EXPX 2ZG2A 2ZUSA 4FQHA 1Z9OA 3FFCA 4HJGB 1MJ7L 2G5RA 3ULVE 3VMPA 1FGNH 2K1MA 5I0DA 1OB1B 4NKIH 4R0LA 5HI4C 4GAJH 2K3TA 2YD4A 3FB7A 4WIQA 2OJZL 3T1FA 1I8KB 1UXWB 5D6CB 5SX5K 3IFNL 1VEPA 2XZQL 1KN4L 4ODTH 4R0LB 4YR6B 3KLHD 4WO4A 4Y0GA 3ZT5A 2EXYC 1CFSA 5F6IB 4S1SL 4WI2A 4AT6A 1K5NB 1FCGA 1KCVH 3KS0H 3QEQA 2FJGA 3HUJF 4NUGL 4JGMA 5DJYB 4JFOB 2VABA 1U0QA 2HAZA 4ETQB 3QIUD 3OB0K 4BH8A 1ACZA 4OLYH 5K9KB 5BOPA 4KV5E 2R9HD 1JGVL 3X3GH 3SGDH 4D9RD 1FO0L 4M7LT 4MB3A 4ZUUB 4G3YL 2LE9A 1RZJL 4NQDE 2HTKD 5AEAA 4F58H 2HLFD 3MRGA 2H1PL 3QDGE 4MNHA 1EGJL 2VR4A 2QSQA 5J13B 3MGTA 5CILH 4YWGL 3BHBB 1GGCH 1FHGA 1P6FA 1UQSB 3MCLL 4WWKD 4NQXB 4MA7H 4Y4KD 3RVUC 1FIGL 5KSUA 2W0FA 1A4KB 1NL0L 1KB5L 3RVVC 4U4BA 3SGKA 3FTGA 3QXUA 2EDXA 1NCCH 4RGNC 4V1DB 5HPOA 1K6QH 1F97A 1MLBB 4WO4B 4GSDL 2OL3H 2WAHA 4YC2B 2ZUVA 3PGDB 1EO8H 4P48A 4XAWL 5E5UB 1G1YA 5HHQB 4C83B 3WHXA 5FM5M 1VADA 5IBLD 5E8EA 2KBGA 1BHGA 4RFOL 5FUOH 1CK0H 1A6WH 3INUL 3OGOE 3GJEA 1BFOB 4Y4FC 2XTJC 1M7IA 3HNTL 1BAFL 1Y18A 2QSCL 1P4LB 2X9WA 2VXQH 1F4WL 1FL3A 4P2OD 1IKNA 1B4JL 1B6DA 2R9HC 3RUGA 5EZIH 4YBLB 2RFXA 4NUJB 5HHVH 5J9PA 3PWPB 5D7JA 1XF3A 1KYOJ 4BQ6A 4JKWA 5IMKB 1S7WA 4YFLF 5TQ2L 3QG7H 3ZHLA 5J11B 1N4XH 1U3YA 3GMOB 4JM2D 3T77B 3QHTC 4ONGH 1RUPH 3OX8A 1W0WA 4RMTA 3HI1B 1RZ7H 3WUWA 2AKRB 1UACL 1QOKA 5SX4I 3E6FA 1WLHA 4AK1A 3MZGB 3F58L 4GMSH 1JZ7A 4YIQB 1X5KA 2QEJA 1J5OH 1P4IH 2EKSA 1JYVA 1U41A 3DV6A 1N2RA 4IS6A 3VGEA 1OVZA 4MAYB 2PKDA 3V4VH 3WKML 3EJZD 2ZPKL 3QWRA 5ERWB 1CR9L 2Q8BH 2IPTH 1RIVL 2BK8A 4PRHB 3B2UD 5GRJL 3W9DA 4KUZH 2FO1A 1I8MA 4L9LB 1XGRB 3QDMB 4L3EA 4MNGE 3IKKA 5CWSA 3SKMB 4Y2OA 2ADIA 4QOKB 3VFGL 4ZD3L 4IDLA 3EOBA 4X99A 4CKVX 3MYJB 4OF0A 1LD9B 3H3PH 5SWSD 3VG0H 4JCMA 2OP4L 4EZMA 5KS9A 4RWHA 4QF1B 4O51B 1LD9A 1H8OA 2ZJSH 1ZANH 4NPYA 4LLQA 4ZTPL 5CZVL 5KSAC 3T2OA 5INDB 1HXMB 4LPXA 3QWOA 4X83A 3SEPA 2JIXB 4I3SH 2VKXA 3I6KB 1Y6KR 3WL9B 1CXHA 5LBSH 4OV5B 1JWUB 1AO7D 3WL9A 4PJEE 4BH8B 4LCCA 2NY1C 3NN8A 1AD9B 3DV6B 4MGXA 3WFCL 1PKOA 1J87A 2DMCA 2YN5A 5IESL 2CO7B 3GUTA 1OGTB 2V9RA 4OJFL 1FNHA 4X4ME 1JK8A 1U8JA 3S37L 3L5WA 3B83A 3W0WD 3H0TB 5GSVA 3IFLH 1ONQB 4ZXBB 2BFVH 4NQSA 4RGNE 4YDIL 1Z0NA 3RUGB 1UWXK 4C4KT 4AIZB 1XGUB 5EBLA 3SDCB 3EYUL 4Q6IC 3N1PC 3UC0H 4D9QE 4B7IA 3LQAH 3NPSB 1AO7A 5D1ZA 4RBPH 1KEML 4U3CA 5LGJB 3INUH 3QUZC 3AS1A 3KYAA 4PR5B 4QEGA 1J5OL 3MACH 4PJFE 3FT2B 4ZPVA 1YN7B 1A6ZB 4FQXB 2W60A 4J4PC 1OAQL 2XTJE 1HHJA 1UWEH 2BSTB 4WHDA 5F93C 1QO3B 5D96B 4E9LA 4CDHA 2UV3A 5F1KC 1H3WM 3H9ZA 1RULH 1I7ZB 4MAYA 4NQCB 3REWB 2VUOA 3U7YL 4LRNL 5JPNB 1AFVL 1JNNH 3S8WA 2R2BB 1QSEB 2QQLH 2WIIB 4M5YH 1UM5L 4YDLC 1FRGH 5HVHB 1ES0A 2QTEA 1ZANL 4O4YH 3EYVA 3I6LD 4NKDB 4LLMA 5BRZA 3SKJH 5GGQH 1G7LA 2Y4SA 3MRCB 3N1MC 4ORZC 5CIPA 2A73B 4ZFGH 8FABB 5FHBH 3GSUA 1HQ4B 1FFNA 3VXUD 4NCC2 1D5BA 3MGOA 4OBRA 3SGEI 4W6XB 5LBSL 3MUHL 2JCCA 3VRJB 3QRGL 3FT3B 5A3ID 3HLAB 4XAWH 5E8DL 4WFFE 2D9QB 1A7OL 3SQBA 1WWCA 4KHXL 1A1NB 1KPVB 5I8CB 2WUBL 3O4LE 4IEFB 1MPAL 1MUJB 4F8QA 1QRKA 3QXAA 3B9AA 4FQ1L 2VIRB 4O02L 4NRZB 4JCLA 4JQXA 3MLUL 3TZVA 1LO5B 4OM0L 1H9VA 5J89A 5F1IA 3W39A 1LNUA 4TSAL 5DD0L 5H94A 3NN8B 5DD1H 1PBYA 2APVA 1I7ZA 4R7NA 4YXLL 1CLOH 4MJ6A 3WO3B 2ZOLB 1V05A 1DLHB 3RVWD 4M62H 2OR9H 1FC1A 5IMLA 3K46A 1ORSB 4YDJB 4RA0C 3BPOC 2VL4A 5C0JB 3P77A 5TE7H 4PJEA 2V7HA 1A9BB 1N4XL 4FFVC 1HIML 4Y5YA 1NGWB 2IAMD 3QQ9D 4JHBA 3FT3A 1I7UB 4U2ZA 4A6YL 1WAAA 4DAGH 1FDLH 4P5TB 5IWLC 3OBAA 1RUQH 5DJ6A 1Y6NR 3JTTA 2HFTA 4GKZB 5C0NC 3VFUA 5J57B 5FKAA 4JANB 4EBQL 1AXSB 5CJQH 3TNMA 1NJ9A 3U0WL 3G6DL 3CC5B 3ARGC 2ZWLT 5CHNA 5IHLB 1QBMH 3G5XB 3UMTA 2YEZB 1I3RB 2R1WA 1HXYB 3G6AB 1NGXB 1AE6H 1SBBA 1IL1B 1J9CT 1OAYH 4HLZH 3N9GH 2W9EH 5M7QA 1AGCB 2VYRE 3QIWD 3S98A 1IAOB 4LLVB 5FUCC 4ODVL 5HDBF 3V5DB 1AXTL 3FAXA 3OG6B 1QYGL 3GKWH 4MJIA 5FA4B 3VFGH 1W8OA 4MDJB 5HGHB 5IT2L 1ZTXH 3BKYH 4ZTOH 1KV3A 5D7LA 2CK0H 2Q87A 2WIIA 1RK1A 1Q0YH 1DBML 1U58A 4Q2ZB 4XPGL 4JREC 5C07B 1KNOB 2NW3B 1F3JA 5A1AA 2IBGA 3UROR 1FGVL 4N0RA 5CD3A 3BO8A 4QGTA 3PWPD 3O6KH 5T33L 3GMLA 1HILA 3VXRD 3X12B 3ULUL 5IMOA 5TF0A 2ITCA 3MV01 2GTWA 4CVXB 1A14H 2VXVL 1IC7H 3QUYA 5DUMH 5EU6A 3SGKC 1DBBH 1IL1A 4ZFOA 4HWZA 4NKMB 3TNNB 1A22B 1U6AL 1KPVA 2RGSA 2Y23A 3MLXH 4UZGA 2QQQA 5DUPH 3KYNB 5HYSB 3O3DB 4HHAB 5EU5B 4JDVB 4MA7L 3FFCE 4FS0A 4QRTB 4C58B 1G9NH 3O6LH 4IRSB 1T1YB 4H25B 1DP0A 5IQ7H 1RUMH 5T1KB 2OR7A 4FG6C 3KYMA 5SWQB 4PV9B 1NMCB 3FB6A 5C07A 2D4DA 2HT4D 2W59A 5HHVL 3QEQE 2SEBA 4JHZA 1NGPL 2W0KA 5KSVA 1NAMB 4P3CH 2Z8RA 1A6PA 4AEFA 3DJ9A 1MRCL 3EO1B 2X1QA 2MQ3A 5L0QB 5BV7H 5BV7B 2QSCH 1EMTH 3SE4C 3K1KC 1OARH 5TE6L 4JPWH 2V17L 4GLRH 2QADC 1CICD 3VW3H 1FH5H 5DJDA 5ENWA 1CXIA 4OFDA 4YDIH 1EERB 1MQKL 4BFEA 1UWGH 2DLGA 3VI4E 1JGEB 4TUOB 4DZBB 3HC4H 5E7FA 1P7QA 4JRXE 2CLVB 5SWZD 2NPLX 3TNNA 1OOAA 4U3HA 3NCBB 3CUPA 4LKXB 1JN6B 3DIFA 4WW2A 2F58L 2EH7H 3IJHB 4RAHA 2Y7QA 1YMHA 4X6CE 2ICWA 5GGQL 4PG2A 3QZWG 1FAKT 4QO1A 3OKYA 2E6PA 4RAUB 2DM7A 3MNZA 1GGIL 4Z7UA 3FN0L 3CSYA 3GB7B 1BF2A 5DRNA 1FCCA 3U2SB 4R26L 3FQNB 4YJZL 2Z93A 2X70B 4NSKA 1CYGA 1A9BA 2VWEE 2DM2A 4KROC 1YQVL 3T0EC 3VH8A 1G6RH 5IJVA 1XGTB 4QHMB 4NSKB 4H5SA 4HC1H 4YK4C 1OAXL 5I75B 3JUYA 5GZOD 2ENYA 5FB8B 5T3ZD 1CGXA 4WV1A 4QHLA 3F6IA 5FUCE 1C5BL 4UV4L 1RZKL 1NDGB 4OQ1A 5DWUL 2IAMC 3QQ9C 2D7QA 1V7MH 1AD0B 1IKFL 1I8IB 1N8ZA 3NABL 1NH6A 5GRUL 1LE5B 3ECBA 1DCLA 3UYPA 1DQLL 4UOW1 3MBXH 4G9DA 1WTGT 5E99H 3T04D 5FECB 3KYNA 5HYSA 1QRND 1JWSB 1RSFA 2I60L 2EEDA 1JNLH 5FKPB 2VDPL 5C0AE 2HLAB 4D8PA 5T33H 3CUPB 4PRPD 1ZT1B 5C0CB 2WP3O 4ACPA 2D7OA 4NQCD 2F8OA 2GITB 1MCWW 4GKSB 5ESVB 4PRID 4UQ3A 5JIKA 3SGJA 4YDKL 4D0BA 2GJZA 1XH3B 3IDGA 3Q6FA 3IVKB 1A6AB 2FD6H 4XVTL 3RAJL 2FJFB 3B6SB 4WHTA 1MQKH 4HPYH 1WIOA 4N0CD 3IU3B 4RMQA 1T1ZA 4ZG1A 3MLWL 4Y16B 2YS4A 3FCTB 4PRPA 1A6TB 1RIUL 4JFYB 3BDYH 1AXIB 4L3EE 4KDVA 3BP7A 5ICZB 2N1KA 2AQ1A 4P23B 5GS0D 1IGTA 1OGAE 4YO0B 1I9JL 4OGAC 1OAZL 5T5FH 2HLAA 1CXLA 4OZFA 3QUML 3T3PF 5DK2A 2CDGA 4HXAL 1CCZA 1ZHLA 5IKCA 4MAYC 2NTSP 4LCWB 1MHEB 2GUOB 4KKNA 1SYVA 4GS7B 1NAKL 3D2UA 4OFYA 1A0QL 2A0LD 1B0WA 4J3OC 2LQRA 1P84K 4S1RL 1G0DA 5DYOA 4H0GA 4PB0L 5GGRB 3NAAH 1J0YA 4MLSA 2I9TB 4JG1L 5D6DA 5DJ8B 4F7PB 4L3ED 3L3IB 2FYYB 3A67L 4X7SH 3C2AL 4LLAA 1ZWIA 2QQNL 2VXVH 5E4IA 4TNWF 3UTTA 4RFNC 3ILQC 4XP4L 4GOSA 1BD2D 2CLRB 5E2VL 4RBPK 4E41B 4ZUWB 1DQLH 1IGTB 2J7LA 3K2UL 2YUWA 1RJLA 4KTDH 1QLEH 5DUPL 3LRHA 4LKCA 4RQQA 3O6ML 4FQ1H 3ULVD 3B8SA 4K3EH 4FQXD 5CBEB 4YXKL 1Z2KA 5B38B 2X4RA 1U93B 2CUIA 4HIEB 5KVGL 1EUUA 4HV8B 4GBXC 2W65B 1EV2E 2I24N 2VWEC 2DBLL 5DRXB 3P9LA 4HH9B 2I9TA 1IM9B 4LCWA 4D0CA 4MD4B 3LQZB 4Y2DA 4YHML 4J3TA 3G5YB 1JNHA 2HFEA 4D0CB 1MFDH 1WC7B 3DUUB 5E8PA 5DRZA 4OLZL 2ZUXA 2NY3C 3L3JB 4D9RE 5GGUA 4NCC1 5GJTH 4G42A 3U4EA 3OKDB 1YPZB 2D7TL 1BBDL 3U0TA 3WO4B 1XGPB 3SKOB 1YZZA 4ZOBA 4LDEB 1W0VB 4YQXL 4PJ7E 4KK8D 2ZCKL 3GRWH 4FXGB 1AE6L 1ED3A 5HDQH 5JA9A 3L6FB 5KSBB 2FSEB 4PB9H 3O11A 1EAJA 4FTVA 1QBML 4N0YH 3EJYD 5JW4N 1YEJL 4OGYH 4QRSB 1JF6A 4UTBH 2R0WL 4LOUC 5DJXA 4OD2A 3B43A 4FOMA 2PXYB 2IBBA 2GIYA 2PCPB 4G7VL 1NEZB 2Q6WA 3IDXL 1IEBB 1QEWA 3ULVC 1MAJA 4WI6A 4J3SA 2HA1A 5GGRY 2ADFL 4LNRA 4HX1B 1IGYB 1NGYB 4DEPC 4MQXC 4MS8C 3WDHA 5AUMA 2HTKC 1F2XK 3G08A 1Z6JT 2WV3A 1Q1JH 2PR4H 2VR9A 4P2QE 4NN7B 2ARJQ 3TC9A 3RL2A 4KVCL 3R06A 3MC0A 3ZTNL 3UTSB 5E8PB 1JPGB 3MJ7B 1OTSC 1WGOA 4G6KH 1ACYH 1KIRA 1PJ9A 2OTWB 2AJXH 3D3VA 3NIDE 5FGCB 5MENB 1KULA 3X14B 4KK5C 4MCYA 3ZE1E 4BFGA 4K94L 3QUZD 2ORBL 4H88L 1YNKL 3MLXL 3D39E 2OBGA 2WBJD 4EEEA 5L8JB 4LKCB 4Y4FB 2W0FB 1T7XA 4F7CA 2DBLH 4U1JB 2NR6C 1JPSL 4LSRL 1TETL 2WBWB 3OAUH 4QRQA 5HGGS 5FUZH 5IJKC 3O2WH 1LO4H 4XNMB 5SWZB 1HHHB 4L4JA 2NX5A 1OTTC 2BDNL 2VLRE 1OLLA 3C60A 4RZCB 4Y4KA 1WBYB 3V6BR 4JHWH 1CLZH 2ARWA 1RUAH 3PWUB 4YHPB 3UTSA 4RMWA 3OAZK 4R0LC 3M8OL 5BMFH 3DURA 5J6GA 3AXLB 5DJ8A 1AY1H 3FL7A 2ZUUA 3VXSE 5KVMC 2QLVB 1TXKA 4XZUB 3AXLA 2DQGL 1O0VA 3CJJA 4KV5F 5C0EB 4N8VB 1A3LL 1FFPA 2AV7A 1OP3K 1F58L 3IGAB 1CICA 3KPPA 1KEMH 2DYPB 1RURH 2WINA 3R8QA 1YEFL 3QUZA 4NZTL 1S7XB 4AYFA 5HHMB 4WWKC 3LKPA 5TJWK 2AXFA 1KJ2B 3PABB 3GSNH 4L4VD 3IS1X 5DLML 3DXAB 5BS0B 4MXQD 1OB1A 3NCMA 4N9GA 4G8FA 3JV4B 5A16A 4ONFL 3T0WA 4UTBL 5E03A 5DJYA 4KVNL 4YBQC 2ZOKA 3K80A 4OKDA 1MJUH 3O3AB 5HI5C 1PEWA 4GQ9H 3PWNA 3BPLC 4P46D 5LVEA 3WFBL 5GGSB 4ZQKA 4FXKA 4IS6B 4UT6H 5IBLC 1J0IA 1S7UB 4OIBA 3C8DA 2DQDH 3GSVA 3TJEL 2J88H 4OI9A 3T3MF 4N8VA 2YPLA 4NKQB 5FFLA 4LQ1A 2VLME 3IGAA 3QAZB 2R23A 1FNSH 1B2WH 1HH9A 1ZGLA 4FTVD 4LSDA 3TV3L 2XQYG 5K9JL 5IB3B 3IDIB 3FO0H 5ALCH 4OCXH 5MEOB 5DVOA 5B3NA 1T1XB 1NCAL 2NCMA 3M1BA 3QHFL 3BN9D 1TITA 3C60D 2XZAL 3TGXA 3VWKD 2VLJE 5KSBA 3EZ8A 3HTLX 1A7OH 3WN5B 2VJXA 3WJLA 1V7ML 12E8H 4JM2F 1BJ8A 5EIIA 4NZRL 3VFSB 2W92A 3W5NA 4MYWB 4MCZA 4C56E 4EIGB 1B88A 3MBXL 3CXHK 5DEGB 3D85D 5SX4H 1FIGH 5D7LD 3O6MH 4HGWB 4UILL 4UBDC 3F12A 1ZLVK 2UYLA 3EOAA 4FTVE 4NWTL 3DX8B 1KPUA 1JTOA 3NABH 4R3SA 5GS2H 4NZUH 1N26A 4PTTA 3LPGA 2H3NA 4PREB 4LSPL 4OGXH 5DHVB 1LP9B 3FOMB 2J4WL 1HH9B 1ZGLB 4JFXA 1NANH 2NY5C 4LHJB 2F54E 2XPGB 4KKAC 3WFDL 4J6RH 4FQJH 4M48L 4WFHD 5JA8B 1HH6B 1SVZA 5ID1A 2RFXB 3LAFA 4NUJA 1P4LA 3D3VB 5HDQL 2QL1A 1CD0A 4YH6A 4Z95L 3LHPL 4K9EC 3LEVL 3FQWA 5LGHL 1VPOL 4CVZB 5IWLA 3KPPB 1NCTA 4J3VA 4N90E 4OM1L 5MEOA 4F7TA 3X11A 1CBVH 3QDHA 3UZVB 4M5ZL 3QA3A 4F2MB 5GGVY 5IB5B 4YUEL 5JIIA 5L88L 5FM4A 1G7QA 2CGRL 5EU4A 1BQUA 4OFVA 4F57L 3RTQD 3F12B 4YDLB 1KJMA 1GGBH 4JRYB 3WHE1 5IVXF 2OMNA 3IFLL 3MSPA 1R5IB 2ZKHL 1JWUA 1K5NA 5DEGA 4JFFA 3O41B 1EX0A 3E6FB 4N8PA 1AD9A 3A6CL 3RWIB 2NXYC 2VXUH 4KH2A 3R1GH 3TLRA 2DS4A 3BP4A 3BSZL 3U30C 5DDHA 2J6EH 1NC2A 4G8IB 2RR3A 1SBSL 5EZJB 1Z3GH 2VQ1A 2AERT 2ENSA 3UJTH 1FJ1B 5D4QA 1T0NA 3QUXD 3G5VA 1H5BB 3AREB 1J8KA 2BVQA 1AR2A 4JQVA 4XZUA 3RWFA 3SDDD 3MV9E 1MCPH 5CD5C 4CVZA 2EDBA 4E5XB 4BKLA 4NDMB 3ULSB 4IJ3B 2X4TA 2BSSB 3RWCB 3D9AH 5JHLH 1CGSH 5CZVH 2PN5A 2N7AA 4FQHB 5LGJA 1R3JB 4EQ2A 3CDGA 3O6FD 1JVKA 2H32B 4CAGA 5J9PB 4XNUH 4Z7VB 4UINL 3W5MA 2B4CC 3AROA 5JPMB 4I0PB 2H32A 2X4OA 1H3UA 1FVCA 5EA0H 2EIBA 3QNXA 4X8XA 5FO7B 2DIBA 4ZXBC 2VLLB 4Z78A 4L3CB 1YDPB 4CADA 3RWIA 3AREC 2A77L 5HHMD 3WNPA 3ARDB 4LASL 4GBXA 3KPMA 2X1PA 3Q2CA 4B5EA 4DKEH 3EDFA 5DJ2A 5AYUL 1OP9A 4NQCA 5I74B 2X42A 1RJZA 4PJIA 4URTB 1TFHA 2Q8AL 2HVJB 1MI5D 1BJ1J 5DUBB 1OP5H 1L7TH 5C8JB 5LWYH 4C56A 2JELL 2VZTA 1A6VL 4WFGD 4P9MH 3SDAB 3CD4A 4OTXL 1UWEL 5DJ0B 5I1AA 3HMXA 3MO1A 4P4RB 2Z91B 1N7ML 4JB9H 3MRGB 4M7KL 4X6DE 1K8IB 2EDKA 3SDXB 4QOKA 1T1XA 1JF1A 4TSAH 1QR4A 5EUKA 5D7JB 3RUGE 4LFHD 1H3VA 1ZVHA 5EBLB 4F2MA 5I1HH 4XCNA 3FO9A 5DSCA 1YY9D 4O51A 5F7HA 1EEUA 5IV2B 3VXRE 1KG0A 4OZGF 4HCRL 3I84A 5A2IH 4OLEA 1P4BL 5TH2A 5GS1A 4KRNA 4JLRA 2YXFA 5IV2A 2GK0B 1JF5A 2JIXD 4Q6IB 1PKQA 1E4XI 4LPYA 1BPVA 3GGWB 4JFOA 2HWZH 2YD2A 2EDJA 4HZLA 2VLJA 3VD7A 4HFUL 5K9KA 4G8GE 5E8EB 2CDEB 3QO1B 2MPAH 5CJOL 2C4FU 3EOTH 1B2WL 2VLJB 2W1NA 4DEPB 4DW2H 1WAAE 4PG2C 5C07E 3R0MA 3M45A 1YUHA 4TRPH 2FR4B 2F8VA 3G6DH 2HG5B 3EJYC 3D18A 2FLBT 1E4JA 5D9SB 4ZUTA 5CD5D 4M7ZB 1GPOH 1T6VN 1KGCD 4YBHA 5HGBA 4MNHB 2NY5H 2MMXA 4ZOAA 3GSQB 3QFJB 5DD0H 2VLKA 3LQAC 4LARL 2ARJB 3MRIB 4KRPB 4F37K 2HTLD 5IROC 1R3JA 2DYPD 5ADPL 5IFHL 1JF1B 2H26A 2IQAA 1NGQH 3HFML 1NJ9B 3C8KB 3QP3A 4X4YB 3P0VH 3SPVA 3BP5A 4RDQF 1N5AB 5D1XC 1DANT 1QFWL 3HCVB 4HWUA 4MX7A 3K4ZA 4NHUA 2XY1A 3SE9L 4Y4KC 3DOSA 1XMWA 4WU5A 1TZIB 1JNLL 4MJ5B 9CGTA 1MCQA 3ET9F 5EORL 2WIMA 5DTFB 2BXZA 2Q76B 2R8SH 1ZVSA 4LCCB 5FGSA 3RL1A 2B4CL 3LD8C 4YAQB 5FCUH 1NCDL 4HEME 4PLKD 3NCYP 3VFTB 3SGJC 3J8F7 4Z95H 5FYKL 3O3BA 1AY1L 4YAQA 2EEBA 4LVNB 3SDAA 4L4TD 4BFIA 3ARGA 5C2UB 1QSEA 3QCTH 5CSBA 5DI8A 1HN1A 1WITA 4AENA 2X44D 3TYFA 3VWKB 1MFCH 2P44B 1S9YA 5AZEH 3BVNA 4Y4FD 5GXBB 2OJEA 3QAZC 3MRPA 4Y5VA 3TVMC 5EU6D 3T2QA 5E70A 1PX3A 4M3KB 1CDIA 3ZKMC 1QYGH 3GKWL 1WT5C 1IC1A 2P24B 4KXZH 1XF4B 2JJTA 1KTLB 1FGNL 2R2EB 2GJ6E 2UZIH 3U7YH 1OT2A 1C08B 5ITBH 5EDXA 1I3RA 1U3HD 2YEZA 1TNNA 4LAQH 5F88A 1A6ZA 4R8WL 3HE6B 4TULH 5DC4B 3MCG1 5JOFB 1PG7H 1AGCA 3S4SB 4H8WC 4Y2DD 3SO5A 4JGUA 1Q94A 4MX7B 4HUKB 3U0WH 5JOFA 1BGXL 2D7PA 1QKZH 1HCFX 1EMTL 1FYTD 4MJID 1SEQL 3TIDB 2P8LA 2F5AL 4GRMB 3CVIH 2I07A 3BDXA 4UUJB 4C56B 2Q3AA 3TV3H 3MA7B 3OAYH 3ESVF 5F3BA 5D6DC 1A7NL 5F96H 4PRIE 4NO5B 4XNXH 1ORSA 4YDJA 1F3JB 3BIBX 3MA7A 4P9HL 3VFNA 5J56B 5KAQG 4FQ2H 1K4CB 3H42L 5C9KA 4JKMA 2LABA 3DECA 4AENB 1ORQA 4TNWK 3IETA 4CDGC 4RWYL 4MNGB 4ZYKB 4JKLA 1I8LA 2R4SL 4JFEE 3JV0A 2QKIB 2NW2A 2NLJB 2BVPB 5ADPH 3U0PA 4I3RH 1X6LA 3VMOA 3OXSB 3BQUC 2A77H 2AXGB 3QXTA 1MNUH 5CINH 4OIIH 3WEXA 5F1NB 3DX9B 3A67H 3BW9A 5CGYD 2KUTA 2AJSL 1GPOL 4Z7WE 3ZLQC 2E9IA 1NL0H 5F7FA 4C59B 2OTUB 1HYRC 5FECA 1S9XA 3LN5A 2NY2B 1HXYA 1NEUA 3EFFB 5F6HI 1PVHA 2XWJA 4KAQL 4U7MA 1MI5A 4UDTA 2G5BB 4MQTB 3MLVL 3TZVD 3V0VB 2O5YL 4MD0B 1R3IH 2BNQA 5D7IB 3L9RB 4KKBC 5F1SA 3DSFL 1YUHB 3C5ZA 3STZA 3VJ6A 3TA3A 5BCAA 2F53B 4Q2ZA 4Y19A 4HCRA 4NJAH 1KCLA 3QQ4A 5D9SA 4ZUTB 4Z7NE 1EHLL 4O2CA 1YMMB 4XXDB 1GOFA 5IIEB 3PNWB 2VRAA 2UUDK 5D96C 4MZ2A 5IJVB 1IGIH 3AAZA 1CFTB 1ETZA 1U58B 4LCYB 5KSVB 3A6CH 2ICWJ 4EN3C 1T1ZB 4ODVH 3P3YA 3MV9A 3MUY1 3WIIH 4WNQA 4JZJA 1R3LB 1DUYA 2OL3B 1C7TA 3P4MA 4FFVD 4NUGH 4I77L 1QSEE 4F8TA 5FYJH 4UI2A 3MRKB 1CG9B 4YHZL 3PG2A 4HIHB 5DD6B 3QQNA 1AO7E 1MI5B 2H32H 3DX9A 4NKMA 2A9NH 1DBMH 4S1RH 1JYWA 2Z9TA 2C3VA 3BAEH 1Z5LA 7FABL 2P5WB 3MJ9A 1G9MH 4PJXA 1QQDA 5GZND 3OB8A 4XT1C 4UT6L 1Z5LB 1JV5A 3QG7L 4OFIA 1GIGL 1YEIH 4YHLH 5FO9A 3RVTD 3ILQD 3W0WE 4KQ4L 3EYFA 4TUKL 5DRWA 3PJSB 1XR8A 5BS0D 3D9AL 3CFDA 5IOPB 4EOWH 3FONA 3P30H 4M7JH 2CRYA 2G75A 2WSKA 1P2CB 5BRZB 5E6IC 1ND0B 4EQ3A 1RAMA 4OFYD 2G9HB 2OZ4L 3PNWA 1DLFH 1HCVA 4DKEL 2ADJA 4HKJB 5FB8A 4Z8FH 1MCHA 1S7TA 3AC0A 4GSDH 2F54A 3LS5H 3CVHB 1K2DA 2JJUA 4ZMAT 4EI5D 4ALAL 2J3SA 5MP6L 1I9EA 1U91A 3LEYH 5ITFA 4HUMB 3VXTB 3NA9L 5FO8B 1IEAA 5JQHC 1IM3B 2HJLA 2HH0L 4OD1L 3DHJA 1LVEA 4BK5A 5DVKA 4OKVB 4MXWL 2A6JB 2Y7QB 1P84J 4BSVA 3WXVL 3ULUD 1B0GA 1I1YA 1RUAL 2G5BA 3MROB 1CGTA 1RIHL 5EO1B 3AM8A 3TEUA 5BW7A 4X6CA 4NQEA 2DMKA 5E99L 2QQKH 4Y2DB 3LS4H 4NKOB 3QEHB 1FZJA 1LDPL 3HI6H 5CJ5A 1JZ6A 1BJ1H 5GGVL 1TETH 3CIQA 1RK1B 3ARED 1NAML 1KIQA 4ZAKA 3HE7C 2BERA 1AKJA 1JFQH 3GIZL 3IDYC 1ND0A 2J6EA 1QA9A 4HKZA 4JFPB 4X6EB 5C09D 4WHTB 2DKMA 5ICYB 3LQAL 4WFFD 3UO1L 1XGQA