5MI0B

A thermally stabilised version of plasmodium falciparum rh5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
b'VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reticulocyte binding-like protein 5,Reticulocyte binding pro
molecule tags Immune system
source organism Plasmodium falciparum
publication title One-step design of a stable variant of the malaria invasion protein RH5 for use as a vaccine immunogen.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B01
1F4WL 3P4LA 4O51B 4KJQC 4MCYB 4PRHA 1QBMH 3NPSB 4HIIA 5C8JA 3WD5H 1RVFL 2HT2C 4YHYB 3PE9A 2NLJA 1SYSB 4BELD 4DZBB 5IMKA 1MCRA 1EA9C 4YDJA 3KPPB 1WICA 4PV9A 1KIQB 3PJSA 4X99A 4PRIB 1JZ3A 5FM5O 1E4KC 2QEJA 1B0WA 1HSAB 3L6FA 3SPVA 1ZGLP 3TN0C 1YEGH 5CEZE 2R39A 5IMOB 1L9NA 5DD0L 3NTCH 1ITCA 2R2EB 1A4KA 1WAAA 1H8NA 2R15A 3QEQB 3LRSA 4A6YH 2BHZA 1UZ8B 2DBJA 3BXNA 2DQIH 1CVSC 1EO7A 1P7KB 1WF5A 1X5ZA 4NKMB 5I8CA 4EEEA 1DVFA 4BFIB 5B38A 1AGCB 5GGSA 2EDJA 4O4YL 3SGEI 4TUKH 5JXEA 4MA1B 4QY8B 3WN5C 2D0FA 3IYLW 2C7UA 4WEBH 1FO0H 1MJJB 3FZUC 4ZUSA 1OSPH 3QWRD 2AVGA 1ZVHA 3QO1A 4G7YL 1GCFA 3MRCA 5C9KA 1J1XL 5EC2A 4DFHA 2IGFL 2JB5H 3LQZB 2IANA 1BD2B 4Z7OE 1FH5H 3QJFB 4ODWB 2WBJB 3C09C 4M6OL 4X4ZA 3ZE1F 3SBWC 1MCOL 2E9WA 4I4WA 5E9DA 2P5WE 2C1OA 4B7LA 2XN9E 3QQNA 5EU3A 3BUYB 2HVKB 3VFPA 4MA7L 4NKOA 3OAUL 5C09B 1IBGH 4JB9H 2LABA 2NTFA 3EO9L 5JDSA 2VLLB 4PP2A 1JWMB 4S1RH 4ELKB 1ROWA 3FQUB 2GTZB 3G6DL 4ZXBB 3KLDA 4OZIE 3D2UB 4CADB 3VW3L 3LSOB 2WIIB 1GGBH 1W0VA 4DEPC 3MNZB 1FG2A 4ETQB 1GXEA 2QR0A 4ODUA 5T1LD 1VFBA 5E8PB 1NCBL 2CLRB 4LSDA 3ARDD 4XAWL 3DURB 3FL7A 3TESA 1FL5B 3CSYB 2QADB 4HHAB 2BXYA 4KAQL 3CVHA 1T66C 1TJGH 2DQUL 3PQYB 4H1LB 4YHNB 4JCMA 4AIZB 4OGAC 2VDPL 4WW1B 4MAYD 3TN0D 3FZUD 3B9EA 1AY1H 3WEXB 1JWMA 4WI9A 3P4MA 1NGXA 1I9IH 3A67L 2R4RL 2AKRA 4FXGA 5I1EL 1CFTB 4NT6B 5T1DH 2K1MA 5C0IA 4P5TB 4XXDB 1KC5H 5KANG 4QT5B 1U6AL 4TUJB 2PYFB 4FZEH 4UU9B 43CAA 5JMRA 1AQDA 2APBA 4O2EA 5JHDA 4MJ5A 4DN3L 1QRNE 1Z0NA 3W9DB 1G7MA 3CDCA 4HUXA 4IRJC 4ODWA 1G9MH 3CDGA 5ICXB 3OAZH 4M61B 1URLA 3QDGA 4I2XE 1N5AB 3K46A 3TBVB 5T1LB 5H94A 1OAYH 4OQ1A 1MIEH 4D0BA 3IDYC 3BDBA 1F97A 3G5YA 4LPWA 4YQXH 2I25N 2R9HC 4XVUC 4NO2B 2YUZA 2FHFA 3Q6GH 4KRMB 5EBWA 4R3SB 1WBYA 2A0LC 1FSKC 2PW1B 5MENE 1T2XA 3L5JA 3O6FB 2Y36H 1T2JA 1J5OL 3B5HA 5IBLD 3LKSB 5FYKL 3GMNA 1A7RL 1X6LA 4NQCD 3HG1D 1MFEH 1A4KB 3K80A 3RDTD 1UT9A 1E6JH 2IBZY 4M7JL 4PV8A 4LKCA 3C5SB 5BQ7B 1CLCA 1HHGB 2DQJL 1MVUA 4JM2B 5GS2H 4X99B 2I9LA 2W38A 2UZYB 3ZSTA 3BN3B 1L7TL 3MNWA 4G8FA 4DZBA 1KIRA 4EBQH 2EDOA 1SY6L 1BP3B 5E5MA 4D94A 4OUOA 1FFOA 1EBAA 2VLRD 4CDGC 3SDAC 4HEME 1JN6B 2XZCL 1CXHA 4RAVB 3VG9B 2KQMA 3GSNB 3G6AA 4NWTL 4TRPH 2HTKD 3ARRA 3V5DB 1ZHKB 3LD8B 4WU5B 3VG9C 1XIWC 3WS3A 4Y4FA 4PJGA 3V7AE 4Y5VA 3KAAA 3B6SA 3MRBA 4FNLL 3HE7C 2FBJL 1V3LA 4KHXH 3EAKA 2AEQL 3PWPE 4V2CB 3BOVA 3JWDH 2XZQH 4U1NB 3IDYB 5DJ2B 4JFEB 4XPFL 2PO6A 3N1PC 1EEZB 3KPMA 4XP4L 5D9SA 3HE6A 4JGUA 4K07A 5B3JF 3BPNC 1TETL 1EMTH 4JDTH 5GJTH 5AZEH 3LKPB 4F9PA 2BVOA 1CL7H 5GS0C 3ALPA 2AQ2A 4BJLA 4ZS6D 4EI5A 5AD0A 3BKJL 4Z95L 5EUOF 4ZMAT 5FFLA 1GRWA 3D25A 2AAVA 4PB9L 5JHLL 5I8OL 1F90H 2DL2A 1JGVH 3KPNA 1EAJA 2GTWB 2R0WH 3ZYOA 1ZGLA 1L7IL 3L5WB 5BVJB 5MHSE 2FATH 3MGAA 4HS6A 1MCPH 2YSSA 5DTFB 3QG7H 1C12A 1FNGB 2RGSA 1U8MB 1UXWA 2HTKC 3BP7B 2VERN 5F1IB 4GG8B 1XF2B 4L8BB 1WEJH 5DRNB 5CAYB 3HE6D 3Q6FB 1IQDB 3BPOB 3STLA 3VFUA 2H26B 4UBDD 4JO4L 3MC0A 1MF2L 1X7QA 2CXKA 3SCMA 1IKFL 3RVWC 5H2BB 2VKXA 2OR8A 3S6CA 1D9KA 2O5YL 1D5BA 3LZFL 1ETZA 3C2AH 4HCRA 3PWVA 2PW2B 2X4NA 3SDXF 3EDKA 4MWFB 4WUUE 3BO8A 2XZAL 4N9GB 4M4PA 5MI0C 3RDTC 2VO5A 3BEWA 4HT1H 1T5XB 3GIZL 4JAMA 4F9LA 4IRSD 3Q1SL 4LF3A 5DEZA 1NBVL 2K9UA 5TE4H 1AI1H 3RUGA 2CDFB 5FO7B 1ZKAA 5C7XH 5C0ND 4I0CC 2JIXB 4RISH 5BZDB 5E94B 1DEDA 1DQDH 1ED3B 3BZEA 4L9LA 1JV5A 4Q6IB 3S3SA 5HHOD 2P46B 5CD3A 4OFYA 3TCLA 1R6VA 4XCYA 1NCNA 1NC4A 1CT8A 5LGJB 3STZB 3CFJA 3BD4A 1I7RA 3EFFB 1MQ8A 2GQHA 3MRNB 5AEAA 2LTQC 3JBG7 1QSVA 4YUEL 3QIUD 2GIYA 5B8CA 2XWTA 4QNPE 2PTUA 3BH8A 4WDIB 5DJ8B 2AXJA 3KJ4B 2UUDK 4FFWC 5E2VL 1G7HB 2BC4B 1GGIL 1H15B 1ZSDA 2B4CH 3D85D 3HAEB 1U8KB 4I48B 4KKLD 5TDNA 4BZ1H 1TJHH 1JIBA 4BYHA 5EULV 5EPMA 3SJVA 5EWIL 4HPYL 1OQOA 3LIZH 5CJ5A 5F7NC 1TCRA 3ZKMD 5D6CB 4M03A 2W1NA 2V9TA 1LMKA 2XNAB 4JQIH 4N90E 4HUVA 3LQMA 3EJZC 4KH2A 1BQHG 3WL9B 1TZGH 12E8H 1F2QA 1CLZH 3UBXI 1OAKL 2P5EB 4P2QA 4JG1L 3MYJB 1ZT7A 4GXVH 3NN8B 3VJ6A 5FA3B 3C60A 4GJTB 2QQLH 3WLWD 5IWLA 3KVQA 1N7ML 2JELL 3TPKA 4DKFH 5JPNB 2GAZB 4R6UA 2ZSWB 3EZJB 5HHOE 3RBGA 1YEKL 3N85H 1H3WM 5JW5A 1BMGA 4TOYL 2P24A 3P4NB 4NQUA 3U48A 2JF1A 1TQCC 1I8IA 1C5BL 3QDJA 1WCBA 4M43L 1ZE3C 2AGJH 3BPLB 4AEIH 2X40A 5BW7A 5DUPL 1KLGB 3M8OL 3U36B 5BV7B 5EZLB 2DTSA 5ICZA 3MCKB 2R8SH 1R3IH 4R4FH 5CBAB 1J88A 4XNZB 5HJ3B 1B4JL 3I6KA 5E6IA 2HMID 4Z0BH 1J86A 4GBXD 2NXZC 1YEHL 2YOCA 4XCCL 1WITA 3U9PL 4AG4L 1IGJB 3IJHA 2FH8A 4UTAH 4MS8D 43C9B 1YMMA 3MUJA 2FJFB 4EQ2A 5CEXA 2ZG3A 2VUYA 4MNQA 4NNXA 3IFPB 3FO2B 3RWDB 4PJ5D 3TV3L 3IDXH 3GMRA 4LLDA 3QPQC 5LWYH 2H2SC 3MOBL 3QAZB 4LGRB 2CLVB 4ODVL 4WFHD 2CKBL 3FT4B 4JFQB 1MHPL 2DM3A 5E08H 1BQSA 5DUBB 2O93L 2ADJB 3B3IB 3FONA 2D7MA 4BQ6A 4J3TA 5F7YC 3VRIA 1ZVYA 4HKBB 2I24N 4CVXA 4ISVB 5EOQL 5E2UH 3GRWA 4RFEB 4N1HB 1QA9B 4FQLL 3ULVL 4KK8D 4DEPB 3VI3E 1HNGA 3RGHA 5ESVB 1JGEB 3QWQB 1MHCB 5D1XA 2XTJD 1FL3A 5ISZA 1YEFH 1AHWA 1A7QL 5DMIH 2XQYG 3KYOA 1HHJA 2EDQA 4G7YH 4LLWA 4OIBA 1OM3H 3RP1A 4QOKE 2YKLH 1CXIA 5IFAL 4WGWB 2W65B 1WSST 3MLSH 5B3NA 1MCCA 4PGEB 2R0LH 2GJ6D 4HWZB 1AHWB 4X8XA 1U95A 2IPTH 3F12A 3VXOA 3ULUE 4R90L 4DCQB 5IV2B 2H2SD 4HIHB 4TVPD 4OV5B 5GS1B 2NY7L 3TC9A 3GNML 4Y4KC 4ZUVA 3MJ9A 3MXWH 3D85B 4P9HH 4PJAE 4TULH 2CIIA 3FQRB 3L5XH 4YBQC 5KS9B 2NZ9D 3GZKA 5IFHL 1NBQA 1BOGB 3MRPB 1U3HD 2NX5B 4U7KA 4KVCH 3DARA 3PDGA 4PJFE 4GKZA 4MNGB 3WE6A 1AGEB 4NDMA 2EIDA 4YDVA 5HPOA 2WMPA 3UJTH 1YUHA 3P40A 1OB1B 5D2NE 3BQUA 6FABL 4PB0H 3WIHH 3BPNB 4FXLA 3VI4E 2AXGB 4QTIH 5I71C 1UZ6E 5I16B 3HPJA 1NMAL 4U2ZA 1OGAA 2MFNA 5C08A 3R1GL 1UB5B 1CE6A 2A83A 4LMQE 4V1DA 1T1YA 2NXZD 3MUY1 3IVKB 5T3XL 1FZOB 4TNWK 3N1QC 2JK5B 5DRZA 3OXRA 4WHYG 2OM5A 5EU4A 2ZKHL 3MQIA 1KC5L 4Z7OF 5A2IH 3UYOD 2V7HA 1D5IL 2A6IB 4MHHG 1MRCH 1T7YA 2E8YA 2X4PA 3REVA 1TVHA 5D4QA 3WFZA 5TE7L 1KB5H 2XTJC 2YRZA 3DUSA 2ITDB 2DQHH 3PWPA 5D96B 1QFUH 4YX2H 4Y4KD 3SKJL 3I84A 5JIHA 2FB4H 4PG9B 2PKDA 4XBPB 1AR1D 4NIKB 5KOVC 3JUZA 2BDNL 4PJDA 1EH9A 2EDBA 3B83A 1RULL 1SEBB 5DMKA 1HINL 3QCUH 5DYOA 2PYEE 5DJCA 1BF8A 3GGWA 1TNMA 4XNYH 4P2QB 3UJJL 1IM3B 4HLZG 5ACZB 3H9SE 4Z7QE 4YHOL 5JMOC 4ZFOB 2F54D 1XGPB 3KXFB 5I0ZA 1A6ZB 3GGWB 3SEPA 3MLPA 3HI5L 1CDUA 1U8IB 4XC3L 4HLZH 1G7IB 1JJUA 2O5XL 4Z5RA 1H3GA 4F7CA 2HFGL 2ZUWA 3VXUE 1RJZB 1Q0XL 1BIIB 1CDJA 5HHVL 4M93C 4E41A 3VH8G 2YD8A 3SGEH 2X1PA 2I07A 3FO0H 5HGAA 5E4IA 1KN4L 5FM5M 3NZHH 1GJIA 1G7PA 2Z4QA 4YFLI 3CZFA 2YWYA 4OCXL 3STZA 4OSUH 3ZZ1A 4LSVH 4U31A 4F80A 3RIAK 3E2HC 3X13B 1FL6A 4NC0B 4LLYA 4P99A 4JM4L 1DQQB 5E94A 4OD1L 3DYOA 3OR6B 3ZYJA 3U2SA 3GIVA 4C83A 3G6JE 4YLQT 1A4JA 4GQPH 4M7LT 4UDUA 5I74C 3WXWL 2P48B 1CG9B 4FFYH 3RUGB 4P9HC 4KJWD 2NYYD 1A1MB 3DI3B 1M71A 1VA9A 5MEOA 1X6NA 5HYEA 1YMME 3K7UA 3IFNL 5F7MC 3U6RB 1AGEA 4NDMB 4YDVB 2EE6A 5C71A 3QUKB 4JY4B 5FYKE 4LSTH 4Y88A 3QCTH 3H9SB 4MCZA 1TZIB 5KS9A 3DETC 4RDQG 1CXFA 4F58H 5JXAH 1FHGA 3BAEH 4ZO6A 1YY9D 1D6EA 2H2PC 1CICA 4DGIL 2RFXB 4PJ9C 5GGUA 3O6FD 3SE9L 3BRGC 4H1LH 1YJDH 4OCMC 1ZLSL 2VC2H 4HJJL 4R8WL 1CN4A 5DLML 3ZL4L 4XPTH 4OGAD 4PGEA 4KJPD 3VWKD 3VDCA 1H5BA 1EHLL 5JUEL 3D39A 1FNGA 3GFUA 2B2XL 5FGRA 2HFFB 4RZCB 4DAGH 1IGCH 5C1MB 4JPIA 1FN4A 5C0AA 4Y2OA 5DHXB 3GHEL 4LSUL 2Q87A 5CGTA 5D1XB 5FOBA 1M7DA 5EDXA 4S1DD 3DGGB 4FZ8L 4Z7NE 5IHUL 4ENEC 4NN7C 4JY5H 2CKNA 4R96B 3WFEH 4JZJC 1IJ9A 1KPRA 3JTTB 3IAPA 5IHZA 3V2AR 5KVEL 2OK0L 3BW9A 5JZ7D 4L8CA 3LV3A 4KJYA 3BQUC 3ZKXC 3T8XB 3MLUL 4YJZL 1E28A 1PLGH 5J06A 2NW3A 1AI1L 3TIDB 1EEZA 3KPMB 2KBGA 5EUOE 4OZHF 3T0EC 4ZSOE 1BAFH 2DLIA 3VFTA 1JTTA 5IKCA 4RISL 3TO2B 2M26A 5HYQA 4OCRL 3JV4A 3TBYB 1OPGH 2H1PH 2XICA 4JZJA 2ADIA 3O8XC 1I1RA 3UXFA 1KYOJ 1MCQA 4KGLA 4Y1AA 2E3VA 3SHSA 5SX5H 3VXTB 1IEBA 4MQXD 3QUXB 4XRCA 4PGBB 1DUZB 1I8MB 1V8HA 3O4LB 4HZLA 1P53A 2H8PB 2PNDA 3HFML 4LCCB 3O45B 4NP4L 5IWLC 2F58L 1OAYL 2ARWA 4L4TA 2C5DC 3QIBD 3BN9C 2QSVA 1GHFL 4FA8A 3A6BL 1S7XA 3NCCB 1JZ4A 5J1SC 3O2VL 2VDQH 4JKPH 2EZ0D 4NBZB 1JBJA 3AFLA 4Q58C 4Y1AD 4HFWB 3BGMB 5F9JB 3VFNA 1A14L 4Z78A 4YPGA 1DBKH 2VWEE 5J9PB 3RWGB 5IFJA 5TQ2L 3BSZL 2NY6B 1MWAA 2PUQT 1LILA 1MCIA 4HMEA 4AT6B 1S8DA 4YHIA 2IPKB 4XGZB 3QHFH 4QRSB 5GGRB 3LB6D 3H3PL 5HHPB 1JZ5A 3N1MC 2ZWLT 2Z8WC 1VADA 1PDKA 3NACL 4CDHA 4O02L 1VEOA 3W81A 3WIFB 4NO2A 4S1DC 4C56E 4U1MA 2GT9B 1Q9LB 4XB8A 4HIEA 1JI2A 3LKNA 3TBVA 5IESL 2BHUA 4HUVB 5JQHC 2CQVA 2XA8L 1CDHA 2DLTA 4FQHA 1LP9F 1JHLH 1U8LB 5FKPA 2P7TB 2Y1VA 4PRAB 4GAYB 4IEFB 4NO0D 5D7JA 5MEQA 2BY1A 2OMNA 3GUTA 3NH7L 4XAKE 5DGQA 5FYKU 2BRQA 4IMKC 3TPUA 1NJ9B 1A22B 2XZQL 1ZSDB 4YE4L 5LKNA 4Z0BL 4CAGA 4K7FA 4L4VE 5FB8B 3MV01 3BH8B 5DEFA 5DVMA 5E8EA 5CKAA 2C3HA 4N0FB 4A6YA 2I60H 4EDWL 1OTSD 5GJTL 2VL5B 1P2CB 2A74B 4QCIB 5H8DA 4KDTC 1XZ0B 4JLRB 3VGEA 4HXAH 1RK0A 1JV5B 2DMKA 1MHEA 5E8PA 1MHHA 1U8QA 1UJ3A 2HH0H 2DMBA 4RWYL 3K4ZA 2C1PA 3LSOA 3RJQB 4BZ2H 2MKLC 2KL6A 1H0DB 2GTZA 4ZFOL 5EORH 3BI9X 2VLLA 4OV6F 1KCRL 5TJWK 5DMGD 1DBMH 3F65A 5HTSA 1UADC 4FQLH 4YAQA 2PN5A 2X4QA 3BVNA 2UYLB 1OCWH 1Q72H 3QXUA 2UWEB 3GSWB 5ALCL 3ZTNH 3RRQA 1U91A 1U8HB 4UAOC 3JSSA 1JWSA 4PRIE 5CGYD 1G7JA 2AJZB 1MEXL 4CL7A 3G5VA 2XZZA 5F89A 3WNNA 5ACLA 3REWA 5IEKA 4QWWC 4DVBB 2CK0H 4G6FB 4Q9CA 3FQXA 3SDCD 1XCTB 2BXZA 4RGNE 2M8XA 2AK4D 2OSLB 2Y25A 2DWDB 2RHEA 5H37G 2VLKB 2NTSP 3MXVH 5F97E 1RZIA 2XTJB 4J4PC 3IDNB 1DQDL 2SEBA 2DI8A 3BD5A 3C08L 4CMMB 2FECI 2XFXB 3CXHK 4G6JH 3KPSB 4DUVA 4NZUH 4OCWL 2NY1C 3KJ6H 2ORBL 5I1LA 3PJSB 2HYMA 2WQ8A 1K5NA 1IC5H 4LNRB 3MRMA 5KSAD 4BQBA 4PB0L 4WUKL 3CGTA 2XY1A 1ZT1B 5D9SB 1HXYB 3BWUC 5DJ2A 2NXYC 4TVPE 3V5KA 5L8LB 3CU1A 3WKNA 1GZQA 1JGDB 3CFKA 5HDBF 3BKML 4KI5D 5L88H 3GHBH 3U4AA 4HPYH 5J6GB 1G1YA 3TFKD 3LIZL 4WFEE 5IVZB 1KJ2L 1YZZA 3VGGA 2HN7A 5B39A 1KB9K 4NO0B 5GSRA 4R0LA 2BVQA 3HUJE 1FFOB 4YZFF 4LVOC 4LPUA 1C7TA 4Y16A 3SKNA 1UVQA 5C0CB 4XPAL 3RY6C 4G8FB 2VXTH 1AHWC 2EDLA 5KG9A 5I8EB 2I9LB 4K7PL 1EERB 5KVDH 3QUMH 2C4FT 2NY1D 5FUOH 2BSSA 1JYXA 1UCBL 4F57H 2P8LA 4Z76B 3UJJH 3ME0A 5EIVA 3SY0B 3T3PE 5DD1H 1RJCA 3E6FB 3OV6A 5D7IE 2W9EL 3O6FA 5CJQL 1ZXQA 5DUPH 3HI6H 1L4IA 5E2TL 2AJYL 4TSAL 3PF2A 3MJ9H 2V2XA 2R8SL 2DS4A 4C57C 1K8IB 2GY5A 1RZJH 3UCRA 3LPGA 3DSFL 3RWEA 3J8F7 3MRRB 3REWB 5IHBA 1N0LA 4KV5E 4KTEH 1KBGH 2AJUL 3RNKA 1OF2B 3HAEG 2VQTA 2EDHA 1K3IA 2DWEB 4NHCL 3WDIA 3WFDL 1DLFH 3P9LA 1XGRA 3QZWA 4AY0A 5AG9A 5EZJA 2D9CA 4K3DH 4UIKH 1X9QA 4JDZB 2HJKA 1ZANH 3WIIH 4O2EB 3HR5B 4MD0B 3B5TA 3RL1A 1OAQL 4OLXH 3TN0A 3VXUA 2I26N 4JN2A 3ZHLA 3WLBA 1F3DJ 1RD6A 3EGSB 1F8TH 1U8NB 2GSGB 3KPLA 3ZTJH 3OJVC 2HVJB 5IQ9A 1XCQB 4Q9QL 4WW1A 5EBGA 1P6FA 4U1IB 4U1HA 4U1JB 3QUMB 4OFKA 1KN2H 1AXSB 1INDH 2X4RB 1IL1B 1FAIL 3T65B 4R4BA 4HX1B 4EN3C 1ZA6B 3WFBL 2XKNA 1RK0B 1QLFA 3T65A 2IBGA 1OW0C 3LDBC 1UKSA 1BZ9A 4M00A 2E7MA 3MLZH 2YZ1A 1AJ7L 3DHMA 5BRZD 4YNYB 3K74B 3U4EB 1AR1C 2GSGA 2FO4B 3OB8A 4UDTA 1T1XB 2E5EA 1S7RA 2IADA 1FZJA 4FFZH 4FTVA 3SE9H 2W07A 3QEQD 2C4XA 1DCLA 1G1CA 3GMOB 1V7NL 3QWRA 1YQ2A 5GXBB 1I1AD 5EBMA 4YDIH 3QCVH 4TULL 5ISZD 1U8LA 5FKPB 2A38A 5TH2B 2YBRA 3G6JB 3QO1B 4U1HB 1OSZA 5ICYB 5L8KB 3KJ4C 4PJHE 5FCSH 3QQ3A 4GMTH 3T1WA 4P3DA 5JR1L 2LTQB 2NY5L 4JY5L 3S35H 4XCNB 3CSPA 4OQTL 4UILH 4QRRE 1QFWH 3BRDA 5I19H 3QEQA 4YHIB 4C56A 3LVEA 5I1KL 5CEZD 5HI4C 3L9RB 1A7OH 2D7TL 4F7EA 1DBBL 4GW5B 4KV5F 4RFOL 5J13B 3DTXA 3ARFA 1T7VA 5KG9B 5I1CH 1CU4L 1D5IH 5DZLA 1K4CA 3FB8B 4U0RB 1WWBX 3MRRA 4P4RB 4OTXH 5C8JB 4U0RC 1CVRA 4UV7H 1QSFE 3VFRB 4NRYB 3SDXB 3V0WL 4JHWH 2BNRA 4P23C 1AKJB 1UXSB 4MZ3A 2ZUTA 1ZHLA 2MNUA 4LVHC 3U0PB 5ESAB 5CMAB 4TYUA 4LSRH 3VXMD 1A5FH 5DDHB 2W60A 2EO1A 2VABB 2X7LA 4B0MM 3KS0H 3IT8D 1BX2A 1I7ZA 4LMQI 4M1CD 3VD5A 1DE4A 3IDGA 4ERSH 2FIKA 5I8EA 3VFTB 1DDHB 4Z7NF 2VISA 3ULSA 1P4BL 2YD6A 1ZT1A 4P2RA 1AD0A 3QBTB 1FFPB 4P46C 3HRPA 3BW9B 4R0LB 3DVNA 2QTEA 3RUGF 2CDEA 2ILLA 5MP6L 5L2KA 3BX7C 3LPFA 3OX8A 2MQ3A 3CPLA 2I5YH 1C16B 1T0MA 5DFTA 1S7WB 3LS5L 1RUML 4PG2A 3UO1L 1WT5A 5IVXF 1Q9OA 3B9KC 1YEDA 5J6GA 1HH9B 3U1SL 4Y4KB 1X5HA 1O7VA 4JPIB 4G8IA 3HCVA 1MNUL 4G7VH 3S37X 3GEWB 3ARDA 1FYTB 3GDBA 3V5KB 2IAMD 1NBYB 1I75A 2V7NA 3SDAD 1QQDB 3DWTA 4OSUL 4DJMA 3IU4L 1TMCB 3FO9A 4H26A 3LRHA 3PWLA 3BIKA 4GG6B 4D2NA 3PGFH 4ZXBC 2O61A 4GAGL 4KKCC 4QF1A 5T5NG 2OXGA 2FZ3B 2NMSA 5F6IC 1LD9A 1FNLA 3P0VH 4RFNC 2AW2A 5CBEB 1FG9C 1YQVH 4OCNC 2FEDC 4KXZH 1WT5C 2XPGB 3SDAA 5JW4N 2XWBB 4PJFA 4NCC2 2F53A 3SE4A 2Z31A 1CI5A 2OSLA 4FOMA 2IG2H 4MS8C 2GJZB 2N1KA 3G08A 1DUYA 3BQUD 1Z2KA 4YHZL 3QCTL 1SEQL 1M71B 1JF5A 2VR5A 4QRRD 5MEOB 4ZS6C 4OLYL 3L3IA 5GS0L 2BSTA 1S9XB 5F6HJ 4G43A 2VAAA 1RHHB 3V6ZB 4HMDA 4YHML 4BZ2L 3KPQA 1JRHI 5ABDE 2DI7A 1YECH 4MB4A 5TFSH 1H8SA 3D1MC 2W91A 1IAOA 2Z92B 4Q0XH 5I1DB 4Q2ZA 3BVNB 4G8GD 3ZL4H 1FC1A 5SWZB 2BY0A 2XYCA 4LLAA 1FV1A 4KKCD 2EE2A 3MLRH 4BFBD 1R5IA 1RQ5A 3E6HA 1JMXA 1KXQE 1IAIH 2W9DH 3UTZB 3I9GH 2NXYB 1IAKA 1NGZB 5CS7A 4ZPTA 1DQLH 3LS4H 1K6QH 1OTUD 4NZJA 4AQ1B 1N6QL 1DP0A 3H3KA 2APTA 3DX8B 3V4VL 1ZS8A 3H9SD 3MLYH 1MHEB 1LE5B 3QT2A 1JRHL 4NNPH 1LVEA 4F7CB 4NKDA 5TDOB 4KUZL 4R2GB 4JFZH 3AY4A 5KAQF 3WSQH 5D7SH 1F4WH 1HSBB 3IAQA 4IS6B 4U1MB 4P5TC 4WIQA 1I9RH 3VFWB 5JQ6H 15C8H 1DZBA 1Q94A 3L1OH 1Q9KB 2IAMB 5TE6L 3HA0A 4X6DA 5D6DC 2IJ0C 1JPST 3TPUB 5GRVL 2IAMC 2PTTA 1U93B 4M3JA 4EIGB 1MJUH 1XF5A 1IEHA 2VWEC 3OGCB 4N0YH 4ZPVA 4C55A 2J88H 1UJTA 4A6YL 3LB6C 3DRTB 3ZT6A 2F58H 3BIBX 1DQTA 3KDMB 3EJJX 4MXQD 4BQCA 2C3WA 4YPGB 4Z7VF 5DQ9A 2VAJA 3GI9L 5CJ8A 4Z7UF 4XNMA 3GSUB 2OL3A 4QXWA 3Q0HA 5FUZH 2F5BH 3DV6B 1FZKA 3KPSD 3LQAL 4U7SA 2A6DA 1FZOA 1C7SA 3IVKA 4AYFA 2R2HB 4M93B 4I9WD 5IB2B 3QHFL 3IDIB 2EDNA 1U58A 3QIUC 4WEBL 4OIIH 3GMLA 1UM4H 4P5TD 5I75B 4JFFE 3D5OF 3IDUA 4CW1B 1A2YB 4LCYB 1DEEB 3ALWA 4HWEL 3ZE0E 1LO3H 4NQCA 1CZ8L 1MUJB 3BKCH 5D5MB 3O2DL 2QQNL 3OJDA 2W0LA 3W39A 5IESH 5I1JL 4Z6AT 2EH7L 2WNGA 2X9WA 4RA3A 5I1HH 5IF0A 1M4KA 4LHUG 4YK4B 4HG4K 3FQRA 2P8MB 2W9EH 1JF6A 4FTVD 4S11A 3BFOA 5FDWA 5IR1A 3MRFB 5DR5L 2H3NB 3OBAA 3U9UA 3QJHA 4XAWH 1LGVA 1PD6A 2R56L 4WHYH 5KVGL 3JV4B 4KMQA 4H0GA 2AJUH 3QH3A 5J7CC 3H9YA 2BJMH 3RTQB 5HHQA 3A6OA 1JPFB 1NAKL 4Q9RL 1QOKA 1CXLA 1YPZB 2XWJB 4F15C 3DECA 4P9ML 2BX5A 1BFOB 4JREC 4K3DL 2HWZH 1ZANL 3O9WA 4L8CB 5EUOB 3T77B 4OLXL 3LN4B 1AY1L 1S7UA 3FCTB 1QFWM 4APQB 1Z0MA 3G5ZB 1EX0A 3E1F1 4R96A 3QNYB 4LCWA 4HMCA 4XHJD 2ATPA 5SV4A 3O6KL 4D9LL 2BNQB 5F7UA 1U6AH 1KGCD 5IW6A 4MMXC 4NQSA 1KELL 4K2UL 3UTQA 1W0WB 4NUGL 4KDTA 3H9SA 3MRIA 5C3TA 5GGTL 1W72H 5IMLA 2VDLL 3RGVC 3KYKL 5FGCE 1IRAY 32C2B 4RX4D 1ZLUH 5IJKC 1H5BB 3P30H 1OQXA 5K9OA 3S7GA 3TA3D 3MV7E 4OCYL 4OF3A 4UT9H 4Y16C 4NJ9H 4QRRA 3WO4B 3ZTNL 4Z77A 5HSFA 4PJXE 4J8RA 1S7SB 3T08A 3O3BB 2AJ3A 3MLZL 3GMMB 4JO3H 4Z7VE 3LDBB 4YQXL 3UDWA 1AJ7H 4NOFA 1YMMB 3A6CH 3BP4A 5TDPA 5GQBA 3MRDA 2X05A 1ZLVH 2YK1L 4RCAA 4NM8L 4R97C 1I1AB 3T0EB 1YEEL 5HYFA 4U1KA 1AXIB 2FX9L 2PETA 3U7AA 1EEUA 5KJRL 2YN3A 1S9YA 2Z4QB 3OG6B 4PY7A 4F15B 2ZUVA 1SBSL 1P4LB 1V7NH 4EBQL 2P43B 5EUKB 5IJVA 4M02A 5IEHA 4TTDD 4JFDD 4MQTB 5T1KD 1UENA 5ERWB 4HIJA 2ICES 3ISWA 1XEDA 2HT2D 3AY4C 4XHJC 4PJHA 1A4JB 3BIAX 4UDUB 4X7EC 3MBED 3CLEL 4H88H 4OT1L 4YHPA 1A7PL 4RMRA 1NLDL 2VLJB 1AKJD 1D5ZB 1SY6H 2YPKB 1GC1H 2OLDA 2ORBH 3KJ6L 3HZYA 3TJHC 1IZJA 4O2FB 2DTMH 1QZ1A 1OP3H 4MLIA 5JR1H 4Y16D 5E00A 1J8HE 2XXCB 3MYJA 3E8UH 3B8YA 3O0RH 4TUOB 2DQGH 3ARBB 4PJBF 1YN7A 3BEVB 4ENED 3F5WB 5C0DB 4TUOA 3O3AB 1OD9A 4MA1C 3WN5B 5I1GH 3WHXB 2YPLA 2AEQH 3FFCE 3VD9A 5I1KH 4N8VG 4WU7B 4HSQA 5AZEL 5DJCB 5FHBH 2AJSH 3PNWB 4MVBC 1DBBH 3T4YA 4JQVA 4ONHB 4R0LC 1KTLB 1O7SA 4NFDA 1KCLA 4LRIC 3ESUF 5IK3B 1FH5L 4Y5XA 3LOWA 5ITBL 3MV7B 1EO8L 1EV2E 3TLRA 2YPLB 2HRPL 1L7IH 4LHJB 2OL3H 3BZ4A 2FEEI 3K3QA 5C0DA 1MSPA 2OZ4L 25C8L 4WVRA 2V7HB 3QUZA 5SX4I 2X4UA 4LAQL 4X8JA 2Z8SA 4YBLC 3OAUH 5FUOL 4MQ7A 4LSRL 5EBLB 5JIPA 4L4TE 1H9VA 1PZ5A 1EHXA 4KFZC 5EZOL 1EXUA 1A6UL 2WAHA 2A83B 4V1DB 5FV2A 4XCFH 1C5CL 2E6JA 1O0VA 1S7QB 4PG9A 5DD1L 1E4XL 1S7SA 3VW3H 3HPJB 2HAZA 3SO3B 4IRSC 2KZ1B 1WEJL 2FGZA 5E6ZA 4AK1A 1IGMH 3TCXA 2GFBB 4N0UA 5IJVB 4TNVK 3LN5B 3R8QA 2LFGA 4PJ7A 3DHJA 1SY6A 4U1KB 3CH1A 4GKZB 5J8OA 2COQA 1T7XA 4IIQB 5EU4B 5JHDE 1A7NL 4NQSB 3TNNA 3QNZA 1S5IL 2CIIB 4HWBH 4JPVH 5IVXE 5KN5B 1EEYA 5J6HA 3SCMB 1U8JA 4UQ2A 1KEMH 5I15H 5EOCL 1C5DB 1W0YT 1OGAB 2W59A 4HIHA 1U3YA 2H26A 1KLUB 2EKSB 4XTRD 5CEYA 3VFOB 5JORA 2CUIA 1NFDB 1SJEA 5F1KC 3MGOA 3DI2B 1F8TL 5EU6B 4LLMB 1CWVA 4WTZA 3HUJA 4U49A 3WO3B 5K9OB 3JWOH 4Z7WA 1G84A 1G9NC 1RZKC 3QI9D 2YMXH 4HS6B 2V5MA 5C0CE 3ZKMC 3S96B 1LK2A 2P49B 3ABZA 4GW4B 4NM4L 1MIEL 5CIPB 4OD3H 1WFTA 3W5NA 1GZPB 3P9MB 3SE8H 4MDIB 4L3EE 3QJHB 1YY8B 2EYRA 4KK9C 1MY5A 5I18L 3NCYP 4XVUD 3D25B 2QADC 1NGQH 5DK3A 1YY8A 2EC9U 4RDQF 5E1HB 1R5WA 1J5OH 4DCQA 4HJ0D 5D5ME 5I75C 3K2MC 3OKNB 1NSNL 3MRJA 4EKXA 4ZFGL 2W65A 4C59B 4JFQA 1BECA 1R5VB 5EIIB 4HKJB 5JO5B 3ARBD 4JG1H 5SWSD 2VDNL 4ZO9A 1OTUC 2OTWA 4PRBB 4XBEH 1NFDA 2V5RA 3PWNB 1MFNA 3S35X 1TZGL 4PJGB 3W11C 4XVJL 4LHUB 4MNQB 3U9UB 5MERB 4YR6B 4JEGB 1QVOB 4RMWA 4GT7A 5L2KE 1YEKH 1FGNH 4RFEA 2BOBB 4WTWA 4KROB 4TOYH 3MLRL 4X0KA 4EVNB 1NCCH 1CXEA 2VR4A 5CGMA 3HC0A 2J8UF 3FTGB 5L6YL 2JELH 5DFVD 3I9GL 4Y8AA 4Q7DA 1CBVL 5E24E 1K4DB 2VN4A 1ZWIA 5SV3A 3SKOB 4M1DH 5HHXH 2CLVA 2VB5A 2VTFA 1K9TA 3D18B 5ALBH 2CPCA 2GFBA 4N0UB 1OTTC 1Q38A 4HQQH 4OFYD 2ICWA 4L8SA 3U4BL 1B2WL 1NEZA 1BVZA 4LCUB 5EN2B 2E27L 3WSQL 4O2CA 4NCDA 3PXJA 2EIBA 5FK9B 1A7OL 5DC9B 5I9QB 2FJFA 3WXVL 4Y2DA 1CCZA 3GKWH 1XGTA 4GKNB 4PRHE 3QEUA 3IDXL 3ROOA 2WUBL 3JWDC 5HYJE 5HDLA 2JJTA 1MFCH 5TE6H 3GSUA 2FX8H 4LKXB 4FMFA 4NPYA 2Q6WA 2FEDD 3RWFB 4X4XA 5DZNA 3CDFA 5FYJU 4X6BB 4AEHL 2VH5H 5DWUL 1NDGA 3WL9A 3MCKA 5EZLA 2FATL 1A3LL 1WWAX 1BPVA 2KKQA 2Y9RT 1Q0YL 4XNQA 2J88L 1CGSH 1FFNB 4RQQB 5B4MC 5C6TH 3SE3A 1LE5A 4KRLB 3FOLB 3B5GA 4MJ5B 1NGWB 1KTLA 2B8OT 2BZDA 1INQA 43CAB 1ZGLM 1R3LA 4OM0H 4BH7B 2PYFA 1N59A 3HLAA 5IBUB 5E8DH 4ZPTB 1WZKA 2AKRB 5IB3A 2ZNXA 3WN5A 3O3AA 3IJSA 5INCB 4MQXC 5CGYC 1FV1B 4E0RA 3NIDE 4K55A 5DJYA 4H1LA 1KB9J 5E7BA 1UWXK 1AO7D 2R1WA 4L3ED 4YDLC 4R90H 5KSVB 3DURA 3DX6A 3MJ7A 5C07E 3UO1H 4KRNA 3RKDC 3MLSL 1S7TB 2VSDA 4JZOA 3DX8A 3BKCL 4NO3B 1HCVA 4EDXB 2ZUQC 1ZT4B 4KJQD 3LCYA 1RHHA 1Q1JH 5I1JH 5E8NB 1Y6NR 2ADFL 2Q76B 3L3IB 3ES6A 3S34L 4D9QD 3K4DA 4WDIA 5DJ8A 4HK3N 4YGVB 3U0WL 2NY7H 3NCJL 4PUBL 3X3FL 5DT1L 4JFOB 2ADGB 3F58H 1C8PA 3VD7A 3SDCA 3WIHL 3CIQA 3OMZA 2IQAB 1CGTA 2C1OB 5I1DA 2ZNWA 1IAOB 4OQTA 2DAVA 2GJJA 2OX5A 4FQ1H 1CR9H 1PY9A 4Q6IA 4LRIA 5JOPE 1K2DB 5BZDA 2WBJA 4TSCH 5J1AB 2FZ3A 6FABH 4J8RB 2MCPL 4ZUTA 4GG6A 3BIKB 3MRCB 4RMQA 1QQDA 1WWCA 4PFEA 5INDB 5LQBL 4MNHA 3BP7A 1CTOA 4JAMB 5FO8A 1U8MA 1JGUH 4FP8H 2BCKA 3MCG1 5J11B 3ARDB 5GS0H 4AENB 3IETB 4MWFA 3DYPA 2ZP0T 2Z31B 3FB7B 2F53B 1KB5L 1T21B 3PP4L 5DSCA 2ZZUT 1VEMA 4MSWB 4UIMB 4YX2L 1QSEB 1IEAB 4RWHA 4ESKA 3SKJH 5LXGH 1W72A 3O8XB 3I2CL 4PGZA 1FJ1A 5L2KB 2X42A 3L6FB 3T77A 2WWKT 4M62H 1RULH 3STLB 3WFCL 3TYGL 3HRZB 4OM1L 4PV9B 1JGLL 5D2NC 3BHBA 5IMKB 3GSXB 3UPRB 3KYNB 1C5BH 1PZUB 4Y19B 3SOBH 2OXHA 1JK8B 3F8UB 2L4OA 3QH3B 4PJHF 1ZTXL 2VYRE 1K6QL 4ZYKB 3L5WA 5BVJA 4N9OB 4Y4KA 5EB9A 4G9DB 4XNYL 4ZSOA 3AREA 3MLYL 5E2WL 2DBLH 1P6AB 3V0VB 4OIAA 3FQTB 2F15A 2LQRA 3MRFA 3BMWA 4ODBD 3GSNA 4HS3B 1T83C 4JFZL 2CDEB 5GHWL 1CLYL 2CMRL 5C0JA 1YYMH 5JPMB 5D70H 3MLWL 3TH2T 3TJHD 3VFRA 5ID1A 1MRDH 3RVUD 4F3FB 4I2XB 2PTVA 4RAHA 4PLOB 4MJIA 2RIKA 4F9LC 15C8L 8CGTA 3CLEH 1F6FB 2X2YA 1UH3A 3EYVB 2CKBH 3P77A 4KI5C 4GKSB 4MAYB 4PRPD 1BX2B 2R1YB 3FAWA 2VABA 2X7LB 1N4XH 2V2TB 3NZHL 3ROLA 4Y5VB 3WYRA 1IAII 1QEWA 5I73C 1TQBB 4N0YL 1NL0H 4X9HA 2FL5B 4JFDA 1R24A 1EGJL 2FIRT 3BPLC 3GSQA 4L8DB 4MDJA 5IROA 4HKXB 4AH2A 4F2MB 4KK8C 2P45B 4R4ND 3UAJC 4JN1H 2VDOL 3GSRB 5CLWA 3S98A 1KIRB 1FIEA 5CZXC 1BJ1H 1CS6A 5ICYA 3OHXA 3VXMB 2AK4B 2L7UA 2VZOA 3KDMA 4P59H 5DEGB 1C1EL 5C0AD 1HHGA 4UQ3B 1GIGL 2FSEA 3MJGX 1EO8H 5FHAL 3KPRD 4L4JA 4MA3A 5GRZA 5A2LH 3FRPA 25C8H 4HWEH 2CUMA 1FZJB 4PJEF 3V6OE 4OZGA 4X6DB 1CZ8H 3IF1A 1CFTA 1T1XA 5EZIH 5HXMA 2VC2L 3MXWL 1MFBH 3ARZA 4TSBH 4PJXA 1RIUL 4PLNC 3GSOB 4DAGL 4HF5L 2Y07L 4AQOA 5F70A 3QDGB 1BZ9B 1E4XH 5IROC 1KCUL 5DR5H 5ADOH 4RRPA 4IRSA 2B2XH 4R4BB 4Y4FC 3OKEA 4F7PB 3S3PA 5D2LA 3L3JB 1JPGB 5CJXC 2J8UA 3BWAB 1CQKA 2EYTB 4UU9A 4LEXL 2P1YA 3R1GH 1JHKH 4U1JA 2IH1B 5IHUH 2CR6A 2FO4A 4UDTB 4LVOB 4I5BB 4MJ6A 3MFFB 2FECL 3I02A 2NTFB 4H20L 4YNYA 3U4EA 3QXDA 3LEVL 1BAFL 5KVEH 3MRQB 3F6LA 2VXVH 2EC8A 5D8JH 4PJIB 1EEQA 4S1QH 1JYNA 1ES0A 5EFIB 1NBZB 2H1PL 5C3LD 3AVEA 4ZUUA 4BM7A 4MJ4A 5D2LB 3UTSA 2JB6A 3B9KB 4S1SL 4QRPA 4ZTOL 2CLRA 1UWEL 1RURL 3RZCC 3IXTB 4HJ0C 3BP6A 4FQ2H 1W0VB 3PQYE 3OR7A 3H9HA 1EBPA 3N9GH 4PRNB 3VXME 1XF1A 1X5FA 2B39A 2VDKL 3QXVA 1BFVH 1NGYB 4WY7H 3F7RA 3O2VH 2CRZA 4NHUA 3G9AB 4QXUH 4DTGH 1AO7E 4FQIL 5I18H 4LP5A 1A14H 4R4NC 3WLBB 3CVIL 4X6CE 1YMMD 5I17B 3LPWA 4MA3B 3DIFB 3IKKA 3FB6A 1GGYA 4PRDA 2CGRH 3P9LB 4F8TA 2YK1H 4KI5F 3RNQA 3LQZA 3VXRB 2GK0A 4CU8A 2ICEB 1PX4A 3C6LD 3M17A 1EFXA 2A73B 4I18C 4YDJB 1BVKB 4KGJA 4L29B 2R9HD 1SBSH 5ADPH 3HI1A 4XVJH 4GW1B 1K8IA 4QGTA 1RVFH 4EUPB 1AGCA 3D9AH 3P11H 1SVZA 4KU1A 4QHNA 5B38B 1HYSC 5C86A 2W0FB 1FGNL 3RPIB 3E6FA 4OCXH 1R24B 1AXTL 4O58H 4Z76A 4HK0B 3W5MA 2EDKA 3OL2A 2MJWA 4WI8A 3T1FA 5E99L 4KTYA 2EH8L 5C0RL 4U6YA 5ETUB 2VXSL 2Q8BH 4PJAA 3DXAE 4L9DA 1FZMA 3LHPH 3KGRA 3ZDZF 5E0QA 1ULVA 3WUWA 3T0DA 4PJ5A 2YUWA 3VXSA 4DVRL 5ALBL 2X4SB 4NQDA 4XZUA 6CGTA 2ESVD 4W81A 5IB1B 3PWJA 2H2PD 2EE9A 1XT5A 4G5ZL 3ULSB 2E27H 4ALAL 2FIKB 3HMXA 2J1KA 3QEGL 5I71B 5IT2H 3MBEA 1DE4B 3GKWL 1FBIL 1B6UA 5KSBB 2HN7B 4LSTL 3M1BA 5KVFH 3DETD 3IFLL 3UTPE 2FX8L 3DRQB 3P73A 5JXAL 1FLRH 3RKPA 5ITBH 2DQTL 4KTDL 4JKKA 2VUOA 4ZYKA 3R4DA 1CK0L 1CYGA 1F6AA 4XWGH 5F1NB 5JNYB 3FQXB 4NBXB 1A9EA 4QHKI 1HXYA 4MA7H 1CFSB 4XX1G 4YK4C 5DA0B 1Z5LA 5BO1H 1FFQA 3WHE1 3PV7A 3SCMD 3G5VB 4LNRA 2AV7B 3DTXB 5SWQA 1M05A 1X4XA 1TPXC 4XXCC 2NY0C 5DJZB 5HD8D 4Y4HB 2EEAA 4GW5A 3VFGH 1P84K 3KPOB 4N0CC 2H41A 1A3RL 3KPSA 5FO9A 3VFSA 3E2HB 3O8XA 3OKDA 5DMJB 5ENWA 1CXKA 5HPMB 2XV6B 3T4AA 3C5ZB 1NCBH 2VLKA 3I6LD 4W4OC 5GZNC 1YMHB 1JF1B 1S5HA 1LO2L 2E9IA 3H2WA 4R97B 1NH6A 5F9OH 4HIXL 3QQ3B 4P46D 5I8KH 4FHBD 4DVBA 2O5ZH 1L6XA 3MLUH 1A7NH 4ZAKA 4O9HH 1J0HA 3C6LC 4HCRL 1HH6B 4HWBL 4JPVL 3LKQB 4JFFB 1OVZA 2VLKD 2Z31C 3KNBB 3BP6B 2MHAB 3IXTA 2J7LA 4NUJA 2CK0L 1UJ3B 1AP2B 1LK3H 3VA2C 3MGTB 3UTSB 4YHLL 5HYSA 3O8XD 1R0AH 2BK8A 5KS9E 5I66B 3PDOB 4ORGA 1FAKT 2CJUL 5HGHA 1D7FA 5D1QC 1QKZH 4HG4J 1IC5L 5FF6B 4MYWB 4P4KC 5FYLL 4Z18A 4HPOL 4G6JL 4TPRL 1UM6H 2RQ8A 3BN9D 5BS0D 3RGVB 1V3KA 2UUDH 4HGWB 4JFXB 1J12A 1GHFH 2ZSVB 4TSCL 3V4PH 4MD4B 4JKPL 1E4XI 2JJUA 4WUKH 4NO3A 4JZOB 2APWA 2ZOLB 2D3VA 1MHHB 2Y36L 3AMKA 3JWOC 2FYYA 1JNNH 4U6HA 4LCIH 2WBWB 2P7TA 4PRAA 2DM2A 4I9WE 1MREH 1LNUA 2IANE 1T89A 1E6JL 5CD5D 4BSWA 4E9LA 1JZ7A 1NGPH 5HDOA 3Q48A 3DUUB 3EOTL 3KPLB 4PJ7E 5HVGB 5CJOL 1L7TH 4K7FB 2IGFH 1VADB 5I6XB 4PGDA 1T0PB 3VXQB 4UMGA 4NQEE 3DMMB 3ULUH 4M6OH 2OJEB 5KSAB 3GI8L 4OZ4B 1MCOH 4OGXH 5TGBB 3O3UN 2C9AA 1SMAA 2FO1A 5GGRA 1N2RB 4ZDHB 1WC7B 3L3KB 3SGKC 4AT6A 1JGLH 3RJDA 1JHLL 1IGFL 4LCCC 1RAMA 5IFJB 3TZVD 4X5WA 1IBGL 5DEGA 4E41D 4KKBC 4GRWH 2AK4A 4X83A 3VFMB 1RIVL 4QNPF 5J56B 5F9JA 4NWUL 3FKUS 1AFVL 3LKNB 3LEYH 3DSFH 4D0DB 3WNMA 1NFIA 5HHXL 1HYRC 1ZHBB 2ED8A 4WUUB 4KTEL 1QLEL 4XPFH 3DUHA 3O4LA 1T2QL 4X80H 2VITB 3I75A 4DOHE 3WLWC 5HHPA 3MLWH 4PPTA 4WTZG 3BYYA 4OKVB 1OW0A 3MACL 2P5EE 4JO2L 5DUMH 4PJCF 1NEZB 1S9WB 1Y18B 5HHNA 5J9PA 4LDEB 3NPSC 1J05A 4PJIF 4GH7B 3X12B 3PL6C 2IBBA 2HH0L 2X44D 4L8SC 3SKOA 4EIZC 3ULVE 1ZWIB 1N8ZB 2R4RH 2R0WL 4HFWA 5I1EH 1K4DA 1XFPA 1MCPL 3B4NA 4J3UA 3IXAB 5EORL 1E0OB 2VE6B 1EFXD 3ILQD 5SX4H 1J8HA 2VXQL 1QRND 3PHQA 4DN3H 1EGJH 2J5LC 1W8NA 2DIBA 3JTTA 4B7IA 1AQKH 1DUZA 5B39B 3N0PB 5D1ZA 1UQSB 4PJCB 5TPWH 4CUCA 1N3NB 4M6NL 1Z3GH 1MCNA 4Y1AB 3VXTA 2B1HH 4GRWB 2GEEA 3NFPB 1IGTA 3K2UH 5DXWA 5B8CC 3HHRB 4MB5A 3C2AL 3PGCA 1MEXH 3TYFB 4QYOB 2PO6C 3FOMB 2Q86A 1A47A 3OPZH 2FEEL 1L6ZA 4GRLA 5DJAA 4YZFE 1EUUA 3LV3B 3DLQR 5IHZB 4JR9H 4M1GH 4IIQC 5I30L 1P4IL 1RJYB 5FCUL 4FQXD 2SEBB 5GRVK 1SJHB 5HDQL 4GSDH 2R29H 3TH4T 5JW4Q 1RIUH 3RZCB 1A6AA 5DRWA 1TZIA 2EE3A 2GI7A 2PR4H 4J4PD 1YYLL 2BVUA 3IETA 3S96A 4ZO7A 4X5XB 3O6LL 4Z8FH 3X14B 3QUKA 4JY4A 2UVFA 4QXGH 1DVFD 1XCTA 5CINL 5C2UB 1SHMA 5F9AC 1CFBA 1ORSB 2ZCLH 2F54A 5DT1H 4XPGL 5D7IF 1D9KC 3QQ4A 5GSVB 4X4MA 4LLMA 2I9TB 5JORB 2AJZA 3PHSA 3EBAA 1GGIH 3QZWG 1JWSB 5EH1A 3VG0L 3VFVB 4QHKJ 5I19L 1VGKB 5L88L 3NFNA 3WJJC 2UWEA 1I3RA 3GSWA 4HDIB 5MEND 2P5WB 1LEKA 4OQTH 4YAQB 4JFOA 3C60C 3W82A 4XBGA 5I1CL 1FNSL 2IF7A 1I3GL 4PJCE 4GBXB 4J1UA 1RURH 2Q76A 1H0DA 4H8WH 5E8NA 1W2KT 3NCYS 3MUZ1 4XPAH 1OAKH 2C1PB 1J1OH 1I7UA 4L5FL 1G7QB 2IPUG 4FXKA 3V0WH 3ZO0A 2PCPB 1ORQB 4IOIA 4PJFF 1XZ0A 4WI2A 3TYGH 3QQ9C 1U8IA 2AS5M 3HNTL 3EYOB 3U7WH 1JZ6A 3QG7L 3TO4A 4H1LG 4Z9KB 4X8JB 4ERSL 3GJFK 2AEWA 3MLXH 3CZFB 5BRZE 5INCA 5HI3C 4JJ5A 35C8H 3EOYG 4F7MB 5DO2D 1NDMA 5FGCB 3HE7A 3NA9H 1E6OH 3NFSL 5AUMA 3HLAB 5I1IL 5EO9B 2BNQE 4RX4A 3VMPA 4RGMC 1G6VK 4KI5E 3I6LE 2I5YL 4NO5A 4APQC 1QO3B 5GS3A 3SQOL 4AZ8A 1KPUA 3QDJD 3B43A 5FYJE 4O5LH 4KWUA 2P4AB 4HT1L 3ULUF 1D3CA 3REVB 5FUCC 1YPZE 3LS5H 4EJ1C 2A6IA 3VWJB 4RAUB 1E4WL 1G9NL 2Q6WB 5LJYH 3CUPB 5I76A 4MA8H 5GRJH 1WQVT 3VWJC 5E08L 1P9MC 5DRZB 1RUQH 4GAGH 2YPKA 1YNTA 1NL0L 4LHQB 1G7QA 2GCYB 1MELA 4OB5L 1VERA 5C08B 2LV4A 5EOQH 2Y5TB 4RIRA 2XRAL 3BZDA 5A40E 4ZQKB 5DO2C 3RWGA 4G5ZH 1AGDB 3MV8E 2VDOH 1TLKA 2AXFB 1UZ6F 3P0VL 3NIDF 3W2DL 3NAAH 4WWKB 3CX5J 3BE1L 3LEXB 3QFJB 2WK2A 5IBLC 1NMCC 5HD8C 3DNKA 1RZFH 1FLRL 2FJHA 4NRXA 1INEH 1BM3H 3QUXA 4RGNB 4XP5H 5DD5L 5MEPB 1QVOA 4JFPB 1YECL 3DO7A 1E4KA 4OLYH 4Z77B 4U6XA 2CH8A 3WDJA 5I16A 4KQ4L 2AXGA 2H6PB 2OTWB 1MFAH 4YHMH 1VFAB 1WAAE 4YDIL 4F37K 4JFHE 5FOJA 1BBDH 4IRJD 2FCBA 4X9IA 3KYOB 2R1XA 2BOCA 1IAIL 2W9DL 4JFYB 1BOGA 1GSMA 3ARSA 2OR9H 1HEZB 2XN9D 3N85L 1A1NA 1SJHA 3OKMA 3QNYA 4UUJB 4XWOD 3G5ZA 4I3GA 5ANME 3TT3H 3UTOA 4HULB 1JRHH 1DFBL 1WZ1L 3GK8L 2E6QA 3LS4L 2HTLD 1QFWL 1NUGA 1XR8B 5DJAB 5T3ZH 2DLFL 4GW4A 5J3HD 3DBXA 3EO1A 5D7SL 2Q86B 4WWKC 1CDGA 2X4OB 1NUFA 4P4KD 4NNPL 5AAWA 3U9PH 2CDGA 1RMFH 3HUJB 4OZIB 1RK1B 1VFUA 1TTGA 3B9KD 1VHPA 4LEOB 1QSFD 4KK9D 4UV7L 2ENSA 2YN5A 3TV3H 4U4BA 3MNVB 4X4YA 5FDWB 1EEYB 5J6HB 1TQBC 43C9A 4NYLA 4ISVA 3L1OL 2J6EH 1OARH 5GGQH 5F96H 1EGJA 3QUXC 4YXHL 3UP1A 4HPOH 5IG7A 1HEZA 1A5FL 1PGRB 3QFJA 4C4KT 1I8KA 1IARB 5CD5C 5IOPA 3TZVB 3GI9H 2ADJA 5IQ7L 5CBAA 4OLVL 5F7DA 1IGYA 4G6AC 3G6JF 3ZDYE 5ILTH 4KI1A 4LGSB 1GGTA 5ESQB 3DMMD 2Y5TA 4U6XB 3GMLB 5JW5B 1M1SA 1S7QA 3TWCL 2EEBA 5MEPA 1FQ9C 2D4FA 4OZHA 4M8QB 3U7YL 1FYHB 1FL6B 1Z9LA 1IGJA 3CX5K 4FQPA 3HE6C 1N0XL 5IB4A 1T03L 4U33A 4MQ7B 3RDTB 1DLHB 2X1WL 5I76B 3NGBB 4PJ7F 2QLVB 2R0LL 3EDEA 5HJ3A 3ULUL 4XNMB 3O2DH 4JZNA 3VWJA 5C2BH 5IVNA 3KLAA 4OGXL 4UT7H 1G7PB 3D9AL 3P11L 3PGDB 1Z6JT 4GS7C 3BZ4B 1T5WA 5HGAB 5CWSB 4NC1E 4P49A 4NSKA 5EC1A 4EI6A 2MSPA 1LP9B 4LSVL 3O41A 5D2LF 4CRPA 1EHAA 5JPNA 5JA9A 1AFVH 2B1AL 5I73B 5MENA 5DHYA 3PNWA 3SKUD 3ILPB 1QACA 1U8KA 2QSCH 1RIHH 4F7TA 5BV7C 2VJXA 5HYJB 5IHLB 3VXQA 3CFEA 3UJTL 4QHMB 4RGND 4UINH 4G6AD 4CVZA 4F7MA 4FFYL 4HUMB 2BJML 4JJ5B 5B8CB 3L5HA 3EDFA 5GZND 1HDMA 5TQ0H 3QXTA 4HAFA 4X80L 4IM8A 4OZFB 3CFJB 1KJVA 1VGEL 1IM3A 5CP3A 3W0WD 3QWOA 5E00B 5KVGH 1GOHA 2PCPA 2DDQH 2ITCB 4IOIB 2FHCA 1TCRB 3T2PA 4PJDB 4W6XB 4FXKB 2VLJA 3QP3A 1T0NB 5B38G 4WI6A 4GAJH 3MLVH 4OZHE 1ZS8B 4ODXB 9CGTA 1CDCA 1RUKL 1I7UB 4OLZH 4PJIE 3V52H 3O6KH 4UB0L 3JV6A 4G3YH 3RBSA 2VDRL 3DVFA 4KY1H 4HGWA 4GBXA 1QPXA 2H32B 3PV6A 1MRCL 4MHHI 1NFKA 4ELMA 2VXQH 1YJDL 4WHTA 3BEWB 4ONFL 5TE7H 2ID5A 4KK6C 2DQHL 5HYJD 2PO6D 5M94B 5HGHB 5KBNC 2IEPA 2GSIB 1NC4B 2DLEA 4K2UH 3U46B 5CIPH 4R26H 3NFNB 1GH7A 2Q8AH 2XT1B 4NGHL 3ULVD 2UWEF 2YRPA 4X5LA 5IM7A 1EK3A 4U7MA 1HINH 5F6IB 4Q74A 4LSQH 4WV1B 4JFFA 3V6ZA 4P2YA 1IQDA 3A0OA 3NABL 4JJHA 5LCVL 2WWMD 4J1UB 5F1IA 1HIML 3EYQC 3QUYA 4N8VB 5C0GA 1MPAL 4HKZA 5DS8A 5DD6A 2O5ZL 4KPHL 4TVPH 1ZMYA 2R2CA 4QRPE 1P4IH 3UEZA 3EW3B 3WJJA 5D7JD 3PWVB 1KTKE 1LEKB 1MVFA 2P5WA 4OJFL 4XB7A 2JTDA 5HGDB 4CMHC 2YUVA 2FJGA 3O3EA 1I9RL 3SGKA 5AYQA 4GFTB 4RMTA 2Z0BA 3WKML 1B0GB 3O6LH 2D4DA 5DJDB 3FO0L 1B88A 4QXTB 2NY2C 1KN4H 2H32H 3EYUH 3VXOB 5SWQB 3LKPA 4K8RD 3MRKB 1U95B 3FO9B 3OJ2C 4H26B 4LPVA 2XWJA 2A9ML 1QLRB 3FOMA 3QUYC 2ZG2A 1A7PH 4RNRB 4OI7A 3V6BR 3EJYC 3ZE2F 1I9EA 4W4OA 5FYLD 3UBXG 1WK0A 2DTML 1HOCB 4MXQC 1QHPA 5F7HA 4XI5D 4EN3D 1LQSR 5DRWB 5ESVA 1HH9A 2DQGL 2EICA 1UFUA 3ARYA 3D87B 5K9QI 1T0MB 2F5BL 5TQ2H 3OXSA 1UQSA 2R23A 3UC0L 5KSBA 3NVQA 1JTPA 1CLOL 4ODHL 2AJSL 5C0BE 2W0PA 2VE6A 3IFNH 3V6OA 4IJ3B 3MPCA 1NGPL 1AD0B 1RUPH 2FDBP 2HRPH 1BJMA 2JLLA 3MUGA 3TBTB 3B3IA 3PWJB 2VISB 4MNGE 1N8ZA 3PGCB 2XQBL 1HHHA 1J05B 2M2DA 2EXWD 1U8OB 4QHUA 3U82B 4GXUN 4LCYA 5HHNB 3MRBB 4KMTL 3RWDA 1FPTL 1NCUA 1CFVL 3FMGH 5EZOH 1MQKH 5FA4B 3WS3B 4YIQB 4LSSL 2F8XC 4YBQD 3TFKC 1WWWX 2PXYB 2LU7A 3EJYD 4YXKH 1F2XK 3D0LB 1ADQH 1XIWB 35C8L 3RWHB 3EKCA 5JUEH 2R69L 4S0SD 4EUPA 1E6OL 1FC2D 3IXAA 3L7EA 5I0DA 4GUPA 4P4RA 2DQDL 4XCFL 1MCBA 2D03H 1HXMB 1DBJL 3F7YB 3FB8A 2C3VB 4LSUH 5BXFA 4GLRI 4QHLB 5CSZA 2EEDA 4XP6L 3FT2A 1BGXL 5ICXA 4JM2A 4P5KA 3HNVH 3DRTA 2VXUL 2CO6B 1S5IH 3RNQB 1S9WA 1Y18A 5F71A 3PIQA 3C5SA 2AEIT 3SBWA 3VU2A 4WW2B 3TO4D 5A2FA 4P2QE 4B41A 3RU8L 2EXYC 1HZHH 4MMZC 2F53E 5CCKL 3IKCB 1G9NH 3DMMA 1FIGL 3UAJD 2Y7QA 1A7BA 4YEEA 1HYSD 4C4KO 4Y5YB 3KR3L 1ZOXA 1F4YL 4GQ9H 3DX9B 1FNEB 4WEUD 1MCWM 4FN0A 4IOSD 4O00A 1X5JA 2F19L 4X6CA 3GJEB 1DVFC 2YBRB 3G6JA 4PRNA 3MA9H 4YDKH 2QHLA 4P2OC 2XRAH 4MAUL 3HC3H 1MCWW 2WBKA 4NKDB 3SE8L 3QDHA 4OCYH 2HLFC 4M6NH 3N1GC 2B1HL 1FG2B 1TNNA 2APFA 5HHME 4QLRA 5TGBA 1ES0B 5EFIA 3ZE2E 4D3CH 4OGYH 4FTVB 4PJIA 3B9DA 2Y06H 3HB3C 3IRZA 4JFXA 3FQUA 1OP9A 3RWCB 5I2IA 1ZVSA 4OAWB 5JDSB 4W6WB 2DJUA 2NY6D 4I5BA 2L7JA 4LLQB 2OMBA 3KPRB 1I7RB 3EFFA 1K8DB 4K23H 2EYTA 4Q97A 1ZA3A 5J89A 5I66A 3O2DA 4W68A 5CD3B 3MOAH 3EDDA 4NJAH 4XVTL 2YA2A 4Y4FD 1PYWB 1ED3A 4JQXC 1NC2D 4GSDL 3MXVL 1AP2A 5CEZH 3N50A 2EDRA 1BBDL 1P1ZA 5FO7A 2X70A 3RIFK 4JQXA 5EC2B 1WFOA 4CADA 2BSTB 4JVUA 2DRUA 5L6YH 4WRLA 2HVJA 5IQ9B 2NY0D 3GSOA 2CRIA 4RGOL 3CVHH 1T5XA 2APVA 2ZCKL 1QRKA 2GJZA 3JWNC 3EGSA 3E8UL 2ZG1A 4M1DL 4E5XA 1HE7A 2HVKA 5I8CB 3BUYA 5T3ZE 2NXZB 4PJFB 3S5LB 4JFED 1XGUB 5I1GL 2QKIA 2DLFH 3HZVA 3BKMH 3FQNB 4HZAA 4TN9A 3S4SA 5FHBL 3EUUA 4MJID 1BD2A 1I1AC 5SWSB 4M7LH 2O61B 2Y72A 4ZAKC 5GRWA 3V7AG 1JWUA 3VXNA 2AI0L 1UWGH 3QXAB 3WUWG 4XXCA 1MFCL 3H0TB 3ZKXB 1ZEAL 4HC1H 1KT2A 1SYSA 4JY6B 3RWEB 2CO7B 3GSRA 2VH5L 1F6AB 4IMKA 5GGSB 2V2XB 4PJ9D 3HCVB 4G8IB 1UB6B 2WBJD 4IHOB 2A1WL 4HKXA 1Q0YH 4AH2B 4MDJB 5CKGA 5F96L 4F2MA 5DVOA 3QUML 3MJ8B 4AEHH 1RFDL 1FO0A 1U8PA 3D3VA 1DQMH 2BSSB 4OM0L 1CGSL 3N06B 4PTTA 2P8PA 2YRLA 4AMKH 1KACB 2QV2A 3FRPG 5HVHB 4WFHE 5A16B 3ECBA 4NC1C 4MJIB 5IB1A 3RX5A 4MX7A 1UVQB 5C0CA 3H7BA 5IBTL 1KV3A 3LAFA 3ARVA 2AJVL 1OLZA 1IFHH 2BVQB 5F9WB 5JTWA 4XC1H 2XQYK 1H8OA 4P46B 4LLVB 1OD7A 1RZJC 3WS6C 1VPOH 2VQ1A 3QIWD 3W0WB 2AXHA 5FECA 5HVWA 5ESAA 3HTLX 2VQ1B 3LN9A 2Z8RA 4J3WA 3MV9D 2ESVE 1ACYL 1HQ4B 2BY3A 4G9DA 3JUYA 3MO1B 1N64L 3H3BC 3O4LE 4WI5A 2ADFH 3LMJH 3VXRE 3S34H 5IB5A 3HI1B 5EU5A 2YEZA 5LAXA 3UPRA 1JP5A 3GSXA 3U0WH 1BVKA 4W6YB 4XTRC 1G6RB 3NCJH 3CU7A 1I3UA 5K9JH 3F7VA 1A1OA 1AE6L 3ARUA 3UTPD 3M17B 4PJ5B 4XX1E 5JZ7C 4I18A 5D2LE 1FZMB 3CLFL 3D3VB 4Q9QH 4IOFD 3FQNA 4CMMA 4LU5L 4GOSA 1KN2L 4NM4H 2YWZA 2LU4A 4HK0A 3FB6B 3DIFA 4UOJA 4KZEL 1MFDH 1T21A 3MA7A 1AC6A 4EI5C 5FKAA 4QHNB 4Z0XB 1IZKA 1RU9H 5EO1B 2GY7B 1J8KA 1AD9B 3JV0A 4P3DB 1NQBA 1GAFL 1KCVL 3FFCD 4XPBL 2NCMA 4MNHB 1SJXA 3MV7D 5F89B 2A2QT 2BNUA 1RUKH 3QFDA 1D6VL 3EIFA 3OR7B 3VXRA 2Y5EA 1BM3L 5DD5H 2RCSH 4OLWL 1T4KA 4WO4B 3V79C 2GHWB 2EDYA 3HZVB 4WI3A 1TZHB 3NIGF 2E7LC 4ZUUB 3UJIH 1KLFA 2WBJC 1UYWL 5JHDB 1JUFB 4P5MA 2WWMC 4M62L 1JZ8A 3D0VB 2HTLC 1OP5K 5C0IB 2K7QA 3MRQA 3ORJA 3KPRA 1S7RB 4P4KA 5J3HC 2KQNA 2V5SA 3I02B 1NGXB 1NCCL 3MFFA 4OAWA 1JZ2A 5BZWB 1QFHA 5I2IB 2YPVL 2IH1A 5JW4M 4JM2F 4AIZA 4QKXB 1ONQA 2QHRL 3LY6A 3O2WH 4YHNA 3CVHB 1U3HB 2NX5D 2AJXH 3BWAA 4RSVA 4HHAA 5BCAA 5BOPA 1P1ZB 2IALB 4U3HA 3MRLB 4G42A 3GJFH 4IRSB 4EI5D 3MODL 4PJBE 4ODUB 3S37L 2E7LA 1IL1A 3HI6L 5E2TH 5KSVA 4XP4H 1QD0A 5HGBA 3QI9A 1U3HA 3EO0B 1WUNT 1YYML 2A74A 3AB0C 2HKFH 1BWWA 2HFEB 4FABL 2OI9B 3U83A 3DPBA 5BZWA 4HWNA 4OF8A 1OAXL 1CQYA 2WUBH 1U8NA 1FDLH 3OKLA 3S97C 3MROA 3IF1B 4NHCH 4BH7A 2EIZA 3QEHA 5CHNB 3GUTB 4UIKL 2J8UB 5F3HB 1JNLL 4QGYA 3QZWB 5HYIA 2J6EL 2NY3C 5EOTB 5B4MD 4GAYA 5JIKA 4N5ED 4RQQA 3ALXA 1Z9MA 3RGVD 4FQHB 2OQJA 1WBXB 4P2RE 5GGVY 1X5YA 2G2RB 2OYPA 1NDGB 3OHXB 4X6BA 3F7YA 5E6IC 3GRWH 3ARFD 3RWHA 2Y7QB 3UC0H 1P7KA 4NKMA 5I1AB 3EHBC 3GSQB 3D39D 2XY2A 3OAZK 1ZLWH 4L3AA 1UZ8A 4OCSL 2XZAH 4X4ME 2IPKA 4XGZA 1ACZA 4L9LC 2DB8A 3I6GA 1BQLL 3PP3H 5IMOA 4MXWH 3ZDXF 1MCFA 3CFBB 4MB3A 4P59L 4YFLF 5FIEA 1RUMH 1HNFA 4PRIA 1LHZA 1GVIA 1T22A 1KIQA 1WIUA 3D3VD 3VFNB 4QHLA 3F7VB 3RAJH 2VOTA 4MQSB 3QPQD 5GGRY 3TBTA 1F00I 2NLJB 1XGYL 2YEZB 1Y0LB 4DK3A 3C87A 3S4SG 3SDDD 4F3FA 3NIGE 1W8OA 1KFAL 1T3FA 4NQDE 3ELAT 2XXMB 4YHKH 4HZLB 4OI9A 4X0KB 1RI8A 4LIQE 3TO4C 4NQEB 1UEYA 5FM4A 4CKVX 3FFCA 3OXSB 4XRCB 5IVZA 3F58L 3RY5A 4NN7B 4YIQA 4YUEH 3W0WA 2QSCL 3AREB 1MCHA 3ROLB 2J8OA 2F74A 1U8OA 4QHUB 3Q3GA 1QHOA 5HYQB 3TIEA 1P5UA 1PG7W 4U1SB 3F7PC 2A6KA 4AIXA 3OAYK 4WFED 1VGEH 1QLRA 2YD3A 3TIDA 3EHBD 4FRWA 1E28B 3C9NA 5FYJD 1T6WA 3MRKA 1K5NB 2LAAA 2CLZB 2X5PA 4GXUM 3T2QA 4NQCE 4ZODA 1TTFA 3TT1L 5KSAC 1FIGH 1FO0B 5CZVH 1KTRL 1QSZA 1VB9A 3V0VA 4E42A 4OLZL 3V52L 4RFOH 2WQRA 2YPLD 3N1FC 5DURD 2VLRB 4G3YL 5M7QA 2ZUYA 1RZGB 2VSCA 4XI5C 1GGCH 1FNFA 2CUHA 1FN4B 2M1KA 4LDLB 4NCC1 3C2SA 2ZPKL 5D2NA 3CC5B 4K8RC 4JY6A 3HC3L 4Z7WB 4N8VA 3SJVD 4X98B 3DVGB 4OM1H 4Z7VA 4PLJD 1ITBB 3VXNB 4ZUTB 3RVUC 4HW6A 5SWSA 5ANMA 1HHKA 4QXTA 1FJ1B 2Y06L 3S4SB 2D31A 1U8HA 2EDDA 2X89A 1F42A 3Q6GL 3L3GB 2CGRL 4FQIH 2JCCF 3V4VH 3PABA 5HGDA 1WISA 5DSCB 3UTTA 1B0RA 2X4TA 2X4QB 4IIQA 3FB7A 1E27A 4DKDC 1WZLA 4X6DE 5GHWH 5D7IB 3C6LB 5JDJA 4OJFH 4Y1AE 4JRXB 2D0HA 5CSGA 3JV6B 4LOUD 3KLSA 5E8OA 1ZT4A 1UA6H 2C26A 3WBDA 3MOBH 4ODVH 3GIVB 5J1AA 1RUAH 4PRPE 4ETYA 3GMQA 5H35A 1K2DA 1DQQA 2AK4E 4UV4L 4QOKB 1EXUB 4ZO8A 4KVNH 1PZ5B 2E9JA 1A6TB 2IQAA 2XZCH 4Y2DD 5F21B 3CSGA 5F93C 2GSIA 5D72H 4NWTH 4TRPL 2ADGA 4X7FC 1K85A 1PKQA 4LLQA 1RJLB 5E2UL 1U2CA 2CIKA 4R7NB 4YGVA 5HVHC 5DEFB 5E8EB 2R4SH 2ARJQ 3TVMA 3WO4C 2H32A 3PV6B 4C58B 3CFEB 3FO1A 3RWCA 1A64A 1JPSL 3ES6B 4LCWD 4F7TB 1N59B 4DVRH 1IGIL 1AH1A 3GBNH 3GMPA 4FQXA 5DMIL 5MEQB 5C0AE 1UWGL 2NR6D 2VDMH 5DK2A 4K9EH 1CLOH 4ODHH 5KSUA 4EI6B 1CL7L 2BNQD 2EXYD 1FYTD 2DQTH 1QR4A 2V6HA 2IG2L 4WU7A 3SE3C 3G9VA 3QUZC 1A6ZA 4GG6F 1T5WB 3RWIB 1DR9A 2DMCA 1SEQH 1RHFA 3QAZC 4XWGL 2A1WH 2X1QA 1YN7B 5HHOB 1GPOL 3T3MF 4JREB 4LSPL 1NAMA 3LH2L 3RDTA 2VLMD 5IB4B 3AXLB 1RFDH 1IILE 4P9HL 3UZEA 1TVBA 3QEUB 4GS7B 3ILPA 3IKCA 3NMEA 2P5WD 2BVEA 3JVGA 4MAYC 5I1HL 2AQ1A 1U92A 4G80B 1T1WA 1A21A 1MLBA 1TQCB 3LKOB 1S8DB 1SBBA 1UM5H 1LDPL 1CICD 1LP9A 4G6MH 3DUSB 4XNQB 1DANT 1TVHB 1IGYB 2DQDH 1LO2H 5CP7B 2V17H 1IKFH 4M7ZC 3WNKA 2WINA 4YO0B 5F9OL 2YC1A 4HIXH 3EYFA 5A43C 4LEXH 1I8KB 5IOPB 4D0CA 3SKMA 3KYAA 3QHZL 3MLTB 4LKXA 2O5YH 2UZXB 4PJ8A 1MAJA 2NY6C 1U2HA 4H20H 5TDPB 1MJ8H 2XG5A 3AAZA 3D0LA 5C0EA 4FQCH 1CF8L 1T89C 1U0QA 4XP1H 4AM0A 4X9BA 2PXYA 5I8KL 2AJ3B 4RMUA 1BJ8A 3JV5A 5CCKH 4BSVA 3AU1A 4MXVF 4PD4K 4M3KB 2LVCA 4LOUC 1A0QL 2ICWB 4L8SB 4WCYL 2FLRT 4F9PC 1QKZL 5IKCB 1BVLA 3CXHJ 4FQ2L 1KELH 4KUCF 1XAUA 3P4OB 2VMFA 3FN3A 4E41E 4N0UE 4DQOL 3QUXD 4LDOB 1UM6L 4JGJA 3CFDB 2EDTA 2BDNH 3UTQB 2LVEA 2UWEE 3FTGA 1MJUL 3WHE0 2NW2A 4DZ8B 4LCWB 4MJ2A 2R23B 3TH3T 1RU9L 1EAPB 1R3HA 2VRAA 3EOAB 4J23A 4MDIA 5E2VH 4N1CA 4P48A 1RZKH 2J4WL 5EU6E 5FOBB 1UCTA 5CIPA 4PRBA 1EPFA 4IRZH 5C0AB 1J11A 2AABL 4HKJA 2HFGH 3BGAA 4KKNA 2X4OA 2W0KA 3ULUC 5KZCB 3EOTH 2VZSA 2RCSL 4OLWH 1IVLA 4B53A 3DBXB 3EO1B 3QI9C 5KJRH 2VZ1A 3NPZB 4DKEH 2BVPB 1SJEB 4M6ML 4PGCA 2DYPA 3GI8H 1MRFH 1R5WB 4GG6E 5D96C 1NANI 1CLZL 1CICB 1B0GA 2V9QA 1QA9A 4A2LA 4WTXA 1U8JB 4NRXB 1HILB 2PYEA 4OT1H 2FJGB 3O3EB 5EA0H 3T3ME 4EUPG 1AXTH 2QQLL 1S9VA 1WV7T 4WGVB 4ZAKD 2QQNH 4M5YH 4ZNEA 2WUCH 3V7MA 4K3EL 3VXPA 4KK6D 3QNXA 1RIVH 2EH7H 5FV1L 2FX7H 1EDQA 3MRHA 3FT4A 1EZVX 3T3PF 3QUYB 5C0GB 2VLME 2VNCA 2WV3A 1MLCA 4NQCB 1QR1A 4LQFL 2VL4A 1A2YA 1J1PL 5DMYA 2FR4B 4ZQKA 5T33H 3RVTD 3IFPA 2Z9TA 4NWUH 5L2JA 4ALAH 4BH8B 2FD6L 3DO7B 4KZDL 3QRFM 3QEGH 1B4JH 4AM0B 4UQ2B 3MACH 2R56H 1QYGL 4NNYA 1I4FA 5HHMB 5BS0B 2DKMA 1A3QA 3IAGC 1T2QH 1NAKH 4Q9RH 1I8LA 4JRXE 5IJKA 5LBSL 3CH1B 2H9GA 2NNAB 4P9MH 5IMMB 4JO2H 5DUML 3RI5K 4PS4L 2HWZL 3LN5A 4I3SL 4IBLT 3U36A 2VLJE 1PBYA 5LWYL 4ZD3L 4L4TD 4BKLB 3QDJB 3T2OA 3TA3A 4WENB 4LAQH 1BQUA 1NKRA 3GB7B 3SCMC 4BQ9A 2ZJSL 4WO4C 1AQKL 5DLMH 4PJGE 3QUYD 1U92B 4G80A 2EDFA 1JCKA 3L95A 1YNTB 3VFGL 2DN7A 4JE4B 5FUCE 1A3RH 1TVBB 3VJ6B 3AXLA 4KHTH 1Q9KA 2IAMA 3NN8A 4Z7UE 4PTUA 3HE7B 5F1SA 1NDMB 3BESR 2G9HA 5TPWL 4FZ8H 4Y89A 1IGML 4RAUA 1HDMB 3RTQC 2OR7A 4HEPG 1CE1L 1DL7L 5F7EH 1TCMA 4J6RL 1JFQH 5HYJA 5DYOB 4OD2B 1AGBA 1Y6MR 5DMKB 3EDJA 2VIRA 3S3JA 1KPUB 1PLGL 3ARWA 4BK4A 3A6CL 5I30H 4EZMA 3VE0A 4YDLB 4XBPA 3OKYA 5HDQH 4ONHA 4JPWL 4ZOCA 3OF6A 3T4YB 4HIJB 1N64H 2DJSA 5JLZA 3DV4B 4KMLB 1KNOA 1KULA 5DJ0B 3UTZA 3FO1B 2XWTB 5DQDH 3JXAA 3RFZC 3OKOB 3S88H 3MRNA 4PBXA 3CD4A 1OAUL 1HQRB 3V8OA 3MYZA 1WFUA 3OXRB 1A6TA 1FNHA 2VZ3A 4NZTH 5CINH 2D7NA 4H5SA 1VGKA 5E1AA 1WLHA 2CD0A 4OZHB 1F45A 1OAZL 3GMMA 4JKMA 4X7DC 5GJSH 1H3TA 2NY1B 3ZDYF 2J8HA 3O0RL 3ARXA 4QRRB 5D7KE 3VI4F 5IEHB 5I74B 3HMWH 4LF3B 1QR1B 3BQUB 1NCWL 1GAFH 3QDJE 1AGFA 1DUYB 2PYED 3ET9F 4PY7B 3TT1H 1NMCB 1J10A 3TZVA 4NKQB 4N9GA 4XBGB 3QHTC 4N5EC 1WTLA 1VEPA 3FRUB 1D5XA 2MQCA 1I1AA 1S9VB 1UWXH 3K0WA 3U79A 4TQEL 4RMVA 7FABH 1GGCL 4P2RD 4XBEL 3JTSA 4BFEA 1BD2D 3THMH 5CBEA 1ZLWK 4K3JH 1S3KH 3O3BA 1S7UB 2HMIC 5F44A 4L3EA 3MV11 1HI6A 2BVPA 1I7TB 1QFUL 4ODSH 2VLJD 1YN6B 2OZ4H 1KJ2B 1J1OL 3QDMD 4Z7VB 4GG8A 4OZIA 4TNVF 3DVGA 2BFVH 3PXHA 2V7NB 1P7HL 1PG7L 2F54B 1ORSA 5D2NB 1C12B 1JHTA 3RTQA 5D71L 1FYTA 5IMLB 3TZVC 3SGDH 3QCUL 5DK0A 4N0RA 1CBVH 2QHRH 3IFOA 4KKBD 3HNTH 3U7WL 1X5AA 3FQWB 1RZGA 1MHCA 5I1IH 4K8RL 3VRJA 1R3HB 3LD8C 4XVSH 1MIML 1Z9SA 3QXWA 4UUJA 4DUWA 4APQA 3FCTA 1KCSH 1NC2A 3HI5H 4RBPH 3NFSH 2NZ9C 2QSTA 3HZKB 1M6OB 3T09A 4X9GA 2HKFL 4UNUA 4OZGF 3MZGB 4ZOAA 3VGAB 1PG7X 3HE6B 2HLAB 2JIXD 3MR9B 1BEYL 3TVMC 3MV8D 2DLGA 3TYFA 2DL9A 1KEGH 1FDLL 1QFOA 5C0BA 1MUJA 4AL8H 5GS2D 4JKWA 4J3SA 5JOEA 3Q3GB 2X41A 3GBLA 4JANB 4GRMA 1J87A 2F74B 4TVSa 5EOCH 2C4FU 3R8BB 5J1TC 1A3LH 2J5LB 4Y0GA 4OKVA 4LVNB 2A9NL 5C0FA 3BUTA 3G6AB 5JXED 1OGTB 5HY9A 2Z91B 3QDME 4J3XA 4WUUA 3H7LA 1OCWL 1Q72L 2HLFD 2ERJB 1QBLH 4FFVC 3KG5A 4OB5H 4OD1H 3UTTE 4D0DA 3EYFB 4WWKA 1N6VA 3OJDB 5SWZE 1IGIH 3IU3B 4X6EA 5F9WC 5ICZB 1OP5H 3ARFB 4XNZC 1T22B 1BF2A 3WNPA 1BZQK 1IT9L 1SYVB 1XH3B 2ZUUA 5C70A 3L9RA 4DK6A 5ACMA 3BYTA 4CMHB 4ZPVB 4DGVL 2G75B 1Y6KR 1RZ7L 1U58B 3RVVC 3B2VH 1CICC 4NKIH 4ODTL 3VDBA 3IDIA 3LKSA 3O6ML 2YZ8A 2KUTA 4QRUB 3R0NA 4DW2H 5T1MA 5D7KD 3DV6A 4YHYC 4ZFGH 5J4MA 4RA0C 5EBWB 1T20A 1NFIB 4K9EC 4DGIH 5SWSE 2ZCHH 3ARDC 5T5NF 4K94C 2VDNH 2JJWA 1VKXB 3I3BA 1MFAL 2YD4A 1FORH 3QSKB 2XIDA 2ZCLL 5TDOA 4JDVB 4N5UA 1HN1A 4I3RL 1EHLH 2JJSA 5DK2B 3OGCA 2X1OA 3BJ91 4NO5B 2UY7A 2E9BA 3GMOA 3SJVB 1EVTC 4PR5B 3TT3L 1AQDB 4OZ4A 1DFBH 4P5TA 4XXDA 1IAKB 1NGZA 5F8RC 7CGTA 2MPAL 3ETBF 3E6HB 1RV6X 1WIPA 3MUHL 4IS6A 3SQBA 4QRQB 1MJ8L 3PHOB 3V6OC 3V6FA 2GYSA 4I77L 4HQQL 1JGUL 4FP8L 2QQKH 2EO9A 3DJ9A 2J3SA 1V7MH 5L7XH 3PDOA 3ZE1E 3PQYA 3QI9B 4WEMB 1TXKA 1QLFB 3BZEB 2XKSA 1KSRA 3S36X 3QDAA 3MCLL 4NUJB 4ETQA 4ACPA 5IIEA 2X4RA 3OZ9L 4OCRH 2V2WA 2VXTL 2YD7A 3IJYB 4P3CH 3KWWA 1F13A 4YXHH 3I2CH 4MD4A 1SJVA 5KVDL 3MBEC 3V5HA 1XCQA 4MVBD 3C6LA 2VQUA 5D1QA 2G5BB 5L2KD 3G08B 4WNQA 1KGCE 1BQHA 3IDMA 4OLVH 2FWOB 5SWZA 4XH2A 3VFPB 1MI5D 3RI5F 2CR3A 5C0BD 3TN0B 1KJMA 3C5ZA 5ECJE 3HR5A 1JUFA 2XPGA 2Z92A 1RZKL 3MJ9L 5BMFH 4I4WB 4A2MA 3QDMA 1RZJL 2FRGP 2Z8VC 2AABH 1LE9A 4JHAL 5E8DL 3VDAA 1DBKL 5HHMD 3UMTA 4QF1B 3H8NA 5D7LB 1RZ8B 2DBLL 1BJ1J 2LAGB 5CJBA 1MCKA 4WI7A 1S9XA 1VACB 1J0KA 1KG0B 2A6JB 4QY8A 3L7FA 1NBYA 1MRFL 1YA5A 1AD9A 4XNXH 4JHBA 4KDVA 2QBWA 3V9FA 5GISL 1QRNA 2ZUXA 1DANU 1S5HB 5FKAB 1DVFB 1N0XH 1OAQH 3HAEH 3ZE0F 1TTUA 3VMOA 3C09B 1S78D 3SY0A 2BSED 1Q9OB 4UV4H 2XG4A 5HPMA 1FRGL 4FQJL 4G8GB 3CPLB 3RZWA 3VFSB 5FO9B 2RJMA 2DIAA 5DGRA 1RSFA 2FX7L 3DVNB 3MBEB 2WIMA 2CLZA