5MI0B

A thermally stabilised version of plasmodium falciparum rh5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title One-step design of a stable variant of the malaria invasion protein RH5 for use as a vaccine immunogen.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
molecule keywords Reticulocyte binding-like protein 5,Reticulocyte binding pro
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B01
4UT6L 2YUZA 3PL6C 4JJ5B 4DGVH 1JPTH 4N0FB 2UVFA 1MJ7L 4PV9B 4N0UE 2FO4A 2VR4A 1I1FB 5L8KB 2VDRL 4V2CB 2FJFB 1X6NA 4L9LB 4PJIA 4Z78B 2HJFA 3PDDA 3L95A 1DQQB 3MUGB 3MRPA 4X4MA 1GH7A 3MJ9L 2V2TA 5T1DL 3RDTD 2FIKA 3UYPA 1TNMA 5ANMA 4J7RA 2FYYA 5EIIB 2VDLL 3TH3T 1CGVA 5JW5A 1BM3H 4PD4J 35C8L 4M7KH 2W65B 2W0PA 4FZEH 3SE4A 1DBAL 4KMLB 1NGWA 1AKJA 4YO0B 1DBKH 4Y4KC 5E5MA 3PHOB 3I75A 1X5FA 3B3IB 1DBJL 4U1LB 3N1MC 3OGCB 4Q0XH 3RTQD 3WS6A 3HN3A 4FFYH 5D72H 2BNRB 4EUPG 2XIDA 5L8LB 3NFNB 5FYLL 2C26A 3OKNB 3ZKNC 5SV4A 4HXAH 5JUEL 3EBAA 3LPWA 5TQ2H 1DEDA 1S3KL 2GHWB 1N2RA 5DUBB 1OT2A 3L5HA 5CGYD 4PB9H 1BIIA 3CSYB 3T2OA 1F8TH 1JGDB 4PGEA 1N3NB 5JR1L 2IAMA 4NDMB 1A4JA 1UXWA 2ESVB 3B6SB 1Z6JT 5SX4I 5FM4A 2CRZA 3SGDH 1BBDL 5EU3B 4L4VE 3B9KA 4P2QE 3TJEL 3F62A 4ZUWB 1JWSA 3DV4A 4WRLA 2D7OA 3HR5B 4KJPD 4UNUA 4APQC 2YK1H 3MGTB 5DQJB 3GSVB 2ZG3A 4NT6A 3MO1A 3D3VA 5F97E 3HMXH 1CR9H 2PCPB 4JQVA 1A7OL 3GMPA 1FYTA 4A6YA 1JNNH 1EMTL 4LSQH 4LKCA 1WT5C 4M7LT 3HZVB 3GM8A 3MJ8B 4EVNA 3LV3A 4MJ6A 5I1EL 5JW3L 4ORGA 2VLRA 1I1FA 1RSFA 1DP0A 2DYPD 3KG5A 3HG1B 4TPRL 1FG9C 3C5ZB 1IL1A 1UA6L 5E00B 2OSLA 4MNGA 5CHNA 3L3IA 4RAVA 2EXWC 1X5LA 1HHGB 2AI0L 1NSNL 4G9FA 4OB5L 1SJHB 5EU4A 1FO0A 4ZOAA 1ZT1A 2FIRT 2RJMA 1P5UA 4FXLA 1IAII 3HA0A 3OJDA 1QNZL 1IEHA 3ZTJH 4FFWD 3HC4L 4PTUA 5IF0B 4RNRB 1LK2B 4K3DL 1WFNA 2I25N 1JVKA 2EECA 3G6AB 4V1DD 5JNYB 4CW1B 1AKJB 4YO0A 5E5MB 4XNYL 4JKPL 5D7LE 2EXWD 2BRRL 3V0VA 2DLTA 3LPGA 4KWUA 3ARDB 4F7TA 3VH8G 3V79C 4PB0H 4NNPH 2H32H 4G8GD 3ZE1F 4GSDL 3OKMB 2OZ4L 3DX7A 5J4MA 3HPLA 5KG9A 5EIQA 2YWYA 3MRKA 2HVJA 4QXTA 1UEMA 3SQOL 5E2VL 1EXUB 3OKDA 4KK6D 3WDHA 3NZHL 2ED7A 2B5IC 1P2CA 4TSCL 4RFNB 3NH7L 3BP6A 5MI0C 3GO1L 1CVSC 3GB7B 5GS2H 5FGRA 1BFVL 3FN0H 2QSQA 4I77H 4X9IA 1TMCB 1AD0A 1CD1A 2EDOA 4UI2A 1YEGL 4CN6A 4L8SC 4R6UA 2SEBA 4ODTH 4ODSL 4F15C 4F9LA 5TDNA 5CBAA 5BRZD 2XWBA 4H8WC 1R5VA 1TVBB 3C60C 4R26L 2Z31B 3KPQB 4GXUM 3TIEB 1AXTH 3DVGB 2GQHA 3M8OL 1NDGB 1FBIH 4A6YB 2I60L 1O0VA 1JP5A 3EO0A 3OHXB 5F96L 4Y8AA 1B4JL 3T77A 1UJTA 3INUH 4BZYA 2DM2A 4NKDA 1OARL 4RA3A 1KEML 2A77L 3EO9H 2VMFA 3RWDB 4J3VA 3IDGA 1IL1B 5E00A 2XNAB 5BS0E 4N0UB 3RDTB 5AUMB 3HHRB 4L4VD 2QR0A 5H94B 3FAWA 1HILA 3U7AA 5I8CA 3L3JA 1IFHH 5C0BA 2V6HA 4G6FD 4YXLH 1FO0B 4JG1L 4LEXL 1F4YH 4JFED 5D93B 5FYJD 1Q9WB 5C2BL 2I26N 2HRPL 4EIZC 2VC2L 1JYNA 3CCHB 4BH8A 3VXSD 2YC1B 4I3RL 1X9QA 5FK9A 5K59F 1S9XA 5ACMA 4MQ7B 5B3JE 4LRIC 3V0VB 2FZ3B 1KN4H 3TA3D 4PRIA 3WHXA 2NW2B 4LVNB 4AEFA 5EU6A 3VWKD 1T1XB 3CFDA 5FEBA 1OOAA 3KJ4C 2PR4H 3BKYL 1A6VH 4ZS6C 3AAZB 3SHSA 5MEPA 1KB5B 4P5KA 4ODWA 3IFNH 2HVJB 3B43A 2HRPH 3CFKB 3U1SL 5KVMC 3L5WB 3UDWA 1AGFB 1OPGL 2Q3AA 4PJGB 3RY5A 4JAMB 5CD5C 1U8KB 4PRPB 1C12B 3RVTC 5TDPA 4EJ1C 5E7BA 5SWQA 4YGVB 1L6ZA 5IVXB 1KGCD 5E8PB 3PWJA 4LGPB 3G6DL 3V7AG 3MLUL 1BJ1J 3EDEA 4PJ9D 5C0AE 3STLA 4P2CG 3C9NA 12E8H 3IJSA 3UX9B 3KR3H 1U36A 4YDIL 3MZGB 1K4CA 2OJZH 3INUL 2Q6WB 4M48L 3T3PF 1DFBH 4PJGF 5F9DC 1U8MB 1A14H 5IVXF 2PUQT 4JO1H 3T3PE 3GIZL 5K33A 2FBJL 4O02H 2IBZY 5JIIA 2GK0B 5HGAB 4XMLL 2EE9A 1FIGH 1NDGA 4EUPH 5DZLA 1KSRA 5BXFA 3MRNA 3TC9A 4LSPH 2P5WA 5IV2A 5KSVB 1F90L 2XN9B 3FO9A 1HHHB 4LRNH 5GRVK 3BMWA 1MCDA 3RJQB 1FFNA 3BYTA 3PL6A 4P2OB 2ZNXA 3I9GL 4NUJB 4RMQA 3VFTB 2J8UA 4MD5B 2W0FB 2A6KB 2Z0BA 4JHWH 4BZ1H 3MA7A 4PJ5A 4OZIE 3WFCH 5BO1H 1KEGH 4JY5H 1AR1D 1DSFL 4ELKB 5JXEC 1KN2L 3TBSA 1DR9A 3LKNA 3DX9A 1EZVY 1A3RH 1TQBC 5E2VH 2J88H 3ZO0A 2B1AL 5DMIL 5IFHH 1FORL 4F9PA 4Q2ZB 3FQTA 3BZFA 3TBWB 4MWFB 5ERWB 5IESL 4PLJD 3JZ7A 4NNPL 5EOTA 3Q3GA 2FNBA 5E8DL 2NX5B 3K4ZA 1HHJB 5FECB 5F71A 3VXMB 1G7LB 3CFDB 4LVEA 3HRPA 3FB6A 1BJMA 4H26B 3CX2A 4JG0L 2YPKA 3WKMH 5IG7A 5JOFB 4WI7A 2WP3O 1LO0H 4OFPA 4XT1C 1R3LA 3EOTL 5TJWK 3Q2CA 4OZFG 5IJVB 1CVRA 1J0JA 4JB9H 4WV1B 4PLJC 5DJ2A 4OLZL 4FQCH 5IBUB 2ICWA 1ZSDA 4RFEB 2DTSA 2YPLD 2FCBA 2EDQA 3TVMD 3P0YH 1J87A 3DBXB 1G7QA 5DEFA 3PWJB 2DI9A 1JNHB 5TE4H 1JGEB 1LNUB 4HC1H 4ERSL 3A6BH 1IM9A 1REIA 1YEKH 3WO4C 1DEEA 3GMOB 5ESAB 4OLUH 4ZFGL 3PHSA 3BEWA 4NHUB 3TT3H 4OT1L 1FZKA 2B1AH 4M6OH 3WEXB 2Q76A 1EMTH 4X9BA 3HC3H 1CXIA 4P2QA 4WI4A 3HFML 4TYUA 1A6PA 2A6JA 4DUVA 2AGJL 4TQEH 4OZHE 4X6CA 4Y7MA 1PZ5A 5E9DD 1Q0YL 1CN4A 1BVLA 4WJ5B 3V5DA 4P2YA 3W9DB 5MENE 4ODHH 4UUJB 1J05A 2XN9A 1RUKL 2Z35A 3L5XH 4NQDE 5C08B 4ZUVA 3RQ3A 2VDOL 5EBLA 1A4KB 5D7IA 3IFLH 3BH9A 3SJVD 4PRAA 3JV4A 2CLZB 3GIZH 4MNGE 1LEKA 5J3HC 3ZTNL 4FQHB 2X41A 1A7NH 5I71B 5D7LB 5E1HB 4LPXA 4Z6AT 3NTCH 3ARUA 2R2BB 3D48R 3N85H 3S5LB 4OV5A 5KOMC 1JIBA 3P30L 3D9AH 3O3EB 2PYEA 2CR3A 3H9HA 1KC5H 1NAML 2MMXA 4AH2A 3S88H 3EFFA 4HK3J 3OX8B 1T4KA 3FTGB 1G7LA 5K9KB 1WFUA 3PJSB 4OCRH 3WXWL 4ZXBA 1QHPA 3JWOL 3BPOC 2F19H 3VJ6B 3MXVH 1J88A 1KB9J 4L8BB 4N1CA 1TETH 1KCVH 1LK3L 5IVNA 1DVFB 1G84A 5DJ0B 2WLZA 5I1LB 4P23C 2DQIL 2DKUA 4ZOEA 4KI5E 1N6UA 2R0WH 3L5IA 1JPFA 5LVEA 3QUXC 1LNUA 1ZMYA 2V2WA 4U6XB 4LLMA 2FSEA 1H5BA 1K8IB 4UBDD 4MXVE 5E7FA 1T7WA 3ULVD 3GUTB 4HIIB 2EIDA 2R69L 5HPMB 1NC4B 2P24A 2A73A 1ZA6A 1P1ZB 3L3DB 4NPYB 2D0GA 4HUWB 4YXLL 1FL3B 1AQKL 4JPIA 1XCQB 2BVQB 4K94C 3V6FB 5DMKB 5JA8B 1BVKB 3SKOB 4BQBA 1UQSA 1RIVL 3D9AL 3DRQA 3MRHB 1OQXA 4U6TA 1DE4A 4BELD 2L0DA 2ZCHL 4H0GA 4X7DC 4YFLI 4TULL 1MWAH 4XCCH 3SGDI 5F96H 3VFPB 4YHZH 3CSPA 5JDSA 1V3LA 1IVLA 1KCRH 5CSGA 5CWSB 5D7JD 1KXTB 4RRPA 1AO7B 4UV4H 1NCWL 1TTGA 5ENWA 1I1AA 4HV8A 2AK4A 5HGGS 4ODTL 2VZTA 1T3FA 5IQ7H 4NZRL 4LPTA 1XAUA 2R2BA 4M3JA 3T0AA 5DRWA 4H25B 4OCWH 1A7PL 1NFIB 2ZCKL 4NQSA 4AMKH 2DQTL 3QXVA 1J8HB 1ERNA 4RDQF 3DGGA 2BVPB 5DK0A 5ABDE 3RHWF 2F8VA 1YA5A 5MHSE 3I2CL 5EBMA 1JFQH 2OXHA 2MKLC 4N0FA 4PFEA 1Y0LA 4DZBA 3IJHA 1IKNA 2CMRL 3SPVA 1RV6X 3EJZD 3BDBA 4X4ZA 1YY8A 1FDLH 5FO9B 3UTZA 3O11A 4JKPH 5KZCD 3HCVA 4YPGB 3QIUD 4Z5RB 1DQQA 5DUMH 4MCZA 1I7ZB 2FSEB 1IM3B 4HGKC 1HNGA 3EOTH 2ZUSA 3I3DA 4HKJB 4KKLC 1WBYA 2R39A 5DDHB 4J3OC 3LVEA 1K2DB 4R4FL 5HHOE 3BPOB 4KJQC 2P24B 1H3GA 3AY4A 4CDGC 5E2WH 4FOMA 4XMKL 5DSCB 4XBGB 3VWKB 2APWA 4OD2B 5I18L 1NSNH 2AI0H 4OB5H 4CNIA 4JM4H 3SQBA 4P5TA 3ZYZA 1P4BL 3DROB 1XZ0A 5EPMB 3R8QA 3O6FC 1F11A 1YPZF 1BZQK 1UA6H 2IWGA 1JRHI 2JCCB 2B4CL 1IGJA 1CT8B 4ZUTA 5BRZE 1WITA 3OAYH 3BDYL 4OGAD 3OAZH 4XNMB 1JF1B 4EUPB 3UC0H 3V8OA 3GDBA 1A7OH 3O81A 3HI1A 2H45A 5F8QC 5CWSA 3KYKL 5DJXA 2UZXB 2B20A 4YDKH 2R1YA 4K7FB 4HV8B 5LGHL 2VZ3A 3U9PL 1MHCA 5L88L 3U9UB 5HI5C 1TJHL 4QGTA 4CVUA 3VFSA 4D2NA 5FOBB 2K9UA 4LNVA 2VZOA 2Y5TA 4LCCB 3NABL 4Q58C 5AYUH 3V5HA 4JFZH 2ESVA 1RHFA 2PYFA 3IKKA 3NA9L 3G5YB 2ZUQB 5B8CB 3VMOA 2FBJH 3WNKA 3T1FB 3MUZ1 4I1NB 1UWGH 1FZMB 1AI1H 1R5IA 1QFPA 3BAEH 1J1OL 2EH8L 4X7CC 2OTUA 5HVHB 1CLYL 1CTOA 1T1YA 1ZHBB 3D69A 2IPTH 3GMPB 5EH1A 4IRJA 1ZA3A 2C1OB 1AHWC 4K9EL 3DI2B 3SDDA 3AGVA 1YY9C 3EUUA 2VLRB 5DMYA 4MQTB 4Q0XL 1YEIL 2BHZA 2A74B 3L3GA 2P8MB 4PP2B 2CXKA 2XRAH 1A3LH 4M6MH 4PJ9C 4HMDA 5JW4M 1RUAH 4P57A 1TENA 2NY2D 4MZ2A 3WJLC 2LU3A 4XPAL 5FIEA 2BCKA 4XHQA 2D2OA 3EOBA 3FONB 3IDJB 2AJVL 3N1QC 1DUZA 4WW1A 2GK2A 1NAKL 5E2TH 1GHFL 1QSVA 5F1IA 3VFWB 5HI4C 2PR4L 4HWUA 5GSVB 4ZG1A 3HNSH 5M94B 2DLEA 2Z9TA 3RVVD 5I66A 3VXMD 5MP6L 4XC1H 2X4RB 4PJAF 3VXPB 4NWTH 4NO0A 5F9OL 3C6SB 1NGYA 2E6QA 2FLRT 1KULA 1J18A 5I15H 4P4KB 2ZSVB 1WBZA 4M6AA 4CJ0A 5F21B 3T2QA 1T80A 2CIKA 2JCCA 3ZKMD 5JHDE 1Z5LB 4I3RH 4PJHA 2YXMA 5I76A 5DURB 1VFBB 5A2KH 2EC9U 1NMCB 4UOW1 4FXKB 5IM7A 4U05A 4M02A 3U0WH 4NP4H 3WJLA 4HHAA 3TFKD 1FN4A 4JFFD 4JGJA 4XPGH 1CL7H 2I07A 5AZ2L 1RJZB 3D25B 1YN6A 3DXAD 1UJ3B 1UXSA 1LE5A 2VLKE 3X14A 3B5GA 5KSBA 3I02A 3BKML 3E6HA 5FDWA 3ZKMC 2X70A 3I50H 4M7ZB 4OM0H 1OAZH 2CLVB 4HS8H 2NCMA 5FFLA 1IAIM 4PJHF 3S98A 3MV9A 1IAKA 4NZTH 1VCAA 2ARWA 3LRSA 5GS0H 3TVMA 3EYSL 3B9KD 2ORBH 1BJ8A 3C60A 5INDB 3WDJA 3HUJE 3IVKB 1N3NA 2PYFB 4OZFA 1MFEH 5J89A 4Q9BA 1IEBA 3ARRA 2XPGA 4O5LH 5TF1H 4Z7UA 4CKVX 3UJIH 3K4DA 1RI8A 4FXGA 1BLNA 4JLRA 4MNQE 1CU4L 1U91B 4L9LC 4LDEB 4IDJL 3DO7A 4AYFA 1FYTD 5KS9B 4JO3L 3REVB 3PDOA 2WBJB 4IRJB 4ZQKB 4YHNB 3DI3B 1UWXK 3FZUC 4S1SL 4XWOC 3T0VA 4HCRL 4G9FD 1K3IA 2DQHH 4JFXA 3P4LA 3R8BB 4HULB 3RKPA 3X3FH 4ONFL 1KJVB 3WO3B 4YDVA 4R7DA 3T3MF 3QEQA 3HB3D 5C0BB 3SDCB 2OZ4H 4KUZH 5C7XL 1GGTA 4P9HL 4M7LL 4HEPG 1CQYA 4P59H 4QGYA 4LU5H 2WWMC 2JB5H 2AXJA 1C1EL 5D6CA 4WY7H 1II4E 3R06A 3RWHB 4KRPB 2IANA 2FJHB 4EN3B 4CW1A 1F58L 5JW5B 3OJ2C 5GSRB 5F1KC 4L8DA 2D9QB 4HIEA 3MGOA 4IDLA 2ZG1A 3IDMA 5B4MD 4OUOA 3TPKA 2H8PB 1DVFD 1CCZA 3A6CH 1P69B 2MHAB 3MA9L 9CGTA 3RHWK 5I0DA 5F7UA 3CDGB 1Q1JH 1YN6B 5C0ND 1MJ8H 1D5ZA 2VYRE 3DECA 2FGZA 4BFBD 1AGCA 2DBLL 4QXTB 3TN0A 1OM3H 5HY9A 1E6JL 2YA0A 3WHE1 2DD8L 1S7XB 3IXAB 3OKLA 3HRZB 3BGAA 5TF0A 5DZOA 4W4NA 4RGOL 3X13A 1S7TA 1KTRL 1RZJC 3D0LB 1YNKL 4H20L 2XA3A 3HB3C 1WC7B 5IHBA 2AW2A 2UY7A 5DQDL 1AGBA 5E2JA 4WHTA 1ETZB 5D71H 2YK1L 2OBGA 3C8HA 3FT2B 4NN7B 5IMMA 3ARTA 5TDNB 1CFVL 1I9RH 5TH2B 1CG9B 1C5DA 4JM2C 4LP4A 1RJYB 3V7AE 4JFDB 2MQ3A 1IARB 2X40A 5DJ8A 3KPQA 4QTHB 4MX7A 4MD0A 3QDJA 1F8TL 5F88A 2NXYB 3LOWA 1M71B 1J0HA 3PL6B 5GQBA 4WEBL 1MHHA 3MNWA 4HF5H 1I9IH 1NCDH 4UT7H 3TNNA 3S3SA 5FB8A 1ZWIB 5LBSH 1XF5B 1DN0A 1MJ8L 2V7NA 2Q7YA 1TIUA 3VW3H 3BUYA 3TBSB 5KVGH 4N0CC 2DLFL 2VLRD 1MIEH 2J1KA 4N1EA 5DLMH 1G1CA 2V9TA 3WUWG 3O2WL 2AK4D 1INDH 2QKIA 1CFTB 4XXDA 4ALAH 4BSVB 1QG3A 1GZQA 3R06B 1W0WB 3K1DA 3HG1E 2OP4H 4AT6B 5DLML 1KT2B 3L95B 1MIEL 1ZGLB 3DMMC 4M7KL 3G6AA 4FQXD 2W60A 4WY7L 2EXYD 4UT9L 4NQEB 4AG4H 2NTFB 3FB6B 3P2TA 4H26A 1XGTA 3S4SA 4CU6A 1AC6A 4HH8A 1VHPA 4R97C 4UDTA 5HVFB 2DLIA 5T1DH 4YC2B 1FNSH 1KPVA 4JRXD 1KCUH 4P2RB 2R0ZH 1P7KB 3QPQC 3X11B 4JDTH 4F58L 2EIZB 1CIDA 2BK8A 3MRJA 2VDRH 3T0BA 2APVA 3QIWD 3IXTA 2CGRL 3C5SA 1CLOH 2YUVA 4LDLB 1I3GH 4GMTH 3B9DA 4IOFC 5HVHC 3QH3A 3U6RA 1H3PL 1KFAL 3B9KC 4MA3B 1FNGB 4H0IA 4ONGL 5AD0B 1V3MA 1BAFL 5DUBA 4RMSA 4DW2H 3N50A 4GUPB 4E5XA 5TFSL 2I9TA 2Y36H 3RWFB 1D9KA 2WIIB 1KELH 1HSAB 1DJSA 2AERT 3B9KB 2FL5A 4YZFE 4HQQH 5C0EA 1IEAB 3RWGB 3H0TA 4FQIH 4G3YL 1WFOA 2Z31A 4P3CL 5HXMA 5I16B 4K8RL 4NZTL 1NUGA 4HZAA 2BSRA 1JZ7A 3PWLA 4O9HL 3IKCB 2VXQH 3HE6A 3MXWH 3HR5A 1A4KA 5D7IB 1JYWA 5HGDB 5AAMA 1LMKA 4PJAE 4NQDB 2QTEA 4PD4K 1NL0L 2BC4B 3GGWB 2DQDL 2W0FA 3WFDH 3GSWB 3UZEA 3OZ9L 3CFJB 2X89A 3RWEB 3QG6B 2ZCLL 1EEYA 3UEZA 1NANH 4YIQB 2OSLB 4MNGB 1CD0A 3S4SG 3QULB 5LKNA 5F9JA 3VXSB 1A21A 2JIXA 4OF5A 1HHGA 3UTTE 4PV9A 4WFGD 4G6KH 4JFEA 5B39A 1JJUA 2DQEL 1Q9WA 1A1MB 4F33B 2AJYH 2ZUUA 4I0CC 1JRHL 3L3IB 3UTSA 4R2GC 5EU5A 3GSNA 3MJ7A 2H32A 3O8XD 2W60B 1G1YA 3KPPA 4RMVA 1A1OA 4NWTL 1OP9A 5IHUL 4XP1L 2AP2A 4D94A 3S4SB 1EAJA 4PJHE 4U6YB 1NMAL 3MRDA 3EKCA 4POZD 5EU6B 4ONFH 5IF0A 4Z7VA 3HI6L 4KUCF 1F42A 4NBYB 1T0PB 3J8F7 3UAJD 2NY4B 5CLTA 3H7BB 3ARZA 4Z7WE 3IF1B 1AE6L 4HLJA 3HNVL 1OTTC 1T0NB 3H9SB 3PGCB 2X4OA 3HUJB 2YPLE 3LD8C 3ZHLA 2XRAL 4B7LA 2OX5A 3B3IA 1I7RB 4NQCD 2VITA 3V4VL 2Q86A 4L3AA 4V1DA 3UP1A 2R8SL 2P5EA 3ES6A 5E8PA 2IPTL 1WZKA 3O41B 3MACL 1DEEB 3GMOA 4O2EB 2VXQL 4U0RC 2R29H 1EFXA 1CICD 4NPYA 3CPLA 1LO5B 4PRHE 3W11D 1I1AD 3HLAB 3VXQB 4XNQA 4JJHA 2FL5B 1N59B 3L7EA 2Z91B 1VA9A 4JFHD 1T0MB 5EN2B 1Q38A 3KPOA 4I4WA 5ETUA 3RL1A 2BSTB 5BV7L 4JFZL 2JJUA 2FO1A 1T1ZA 3NABH 1VGEL 4H8WH 6FABH 1N6QH 1J05B 4HKXB 4KHTL 1QLFA 4N8VG 2WLYA 1CL7L 3MLYH 4QYOA 3LEXB 3TZVB 3U9PH 1B0RB 4BSWB 5GRYA 2QSVA 3FO9B 4GOSA 5F93C 2AEQH 5C6PB 3GZKA 1FFPB 4YXKL 3NIDF 5IMKA 3JV4B 3W9EA 5DR5L 5HYJA 1EEYB 5EUOB 3QEQE 5E9DA 3SKNB 3BT2L 1RFDH 4TRPH 2J6EH 2XKSA 1HQ4B 1P7QB 5LXGL 2R0ZL 5I1JH 2JIXB 4RQQA 3DX9B 4XTRD 1X4ZA 4PJ7E 1P4IL 5I1IH 2J5LC 3GSNB 3T2NL 4WUUE 1GHFH 3C8KB 1A1OB 1J8HA 2X1WL 2FB4H 3MRCB 1S7QB 4JR9H 4M1GH 1RD6A 3RVUD 5EU4B 3TF7C 4LNRA 4XPAH 1YZZA 5FK9B 5CKGA 3REWA 1WQVT 3BPLB 4GLRI 1J1PH 4Y0GA 2W9DH 3LKSB 3RWCA 4ZXBB 3C5JB 1PX3A 3BD3A 4ALAL 3O2WH 2VR5A 2YR3A 5F7FA 3MV7A 4NZUL 3NAAL 3ULSB 3SE8L 3L9RA 2BNQD 3NIFF 1I7RA 5DVOA 1DBMH 5SWSB 2IGFL 1T83C 3MRRA 4RFEA 5FUZL 1Q9OA 1KPRB 4KKCD 2VN7A 4HXBH 4PJCF 4OLVL 4NJ9H 5GS1B 3OKMA 4Y4HA 4HBQA 3GJEB 4Y4FB 4Z77B 4LRIA 4LF3A 4MVBD 5IB2A 4OD2A 4YWGL 4KZEL 4JHBA 4NKMB 5KTEL 3DHJA 5GRXG 1F3RB 1B9ZA 3NOIA 3N1PC 3L7EB 2AQ1A 5AWNH 2COQA 1UM5L 1OP3H 5CGMA 2VL5A 4JO4H 2MJWA 1ZLSH 2HJKB 3MYJB 3GRWH 1IT9H 4YDKL 4XNUL 4AEIL 4LFHG 3IFOA 4XVTH 3S5LG 2Q20A 3GI8H 2CKBB 3MRNB 4AL8L 4QHUA 1EO7A 1WUNT 2IFFL 3PHQB 5FYKL 5FYJE 4Y5VC 1K8DB 1SYVB 2Y72A 3GMLA 1FG2B 1NGPH 4PGDB 2DD8H 3ULVH 5DQJA 3VFTA 4G7VH 5D1QB 1JGVH 2AV1B 3T0EA 1P7QA 4OLWL 1T03L 3MRIB 2GEEA 4JE4B 3WNOA 4M93C 5F7DA 1Q1JL 5J12C 5T1LD 5A2IH 4M5ZL 2HFGH 4E41D 1PFCA 4NQUA 5B8CA 5C9KA 4IEFB 1F6FB 2FEDC 1KCKA 4Z76A 1UENA 1XIWC 5AUMA 4B50A 3FRPG 3O3EA 4LCIH 1EPFA 3GKWH 3FQTB 1F45A 5FGCB 1QFOA 4Y16C 4WWKD 3FQXA 2W9LA 4OBRA 5MERB 1YECL 3VXMA 5BW7A 3JV6A 1N0LA 5IEHB 2FZ3A 4PG2C 4PRIB 1CDGA 3VWJC 2BCKB 5T33H 4YNYB 3GKZA 4UB0L 4F7TB 2UWEF 1DUZB 1JCKA 5KSAB 5MEPB 3QT2A 5FV1L 2DQTH 4G6ML 2ZOLB 4MXWL 1CDUA 1JNHA 5CD3B 2QADD 3NFPA 1V8HA 3BW9B 3EYUH 2MCPL 2ZUWA 5FHBH 5DEFB 2A73B 4Y1AA 3H3KA 3L3DA 4S11A 4EI6B 1KENL 1I1AC 1ZTXL 1I1YB 5HGHA 3U2SB 1H3WM 1HNFA 1NFDA 2VL5B 1Z9LA 5IHLB 2E7CA 3ILPA 1TQBB 1BFSA 3LS4L 4WTZA 2Z93A 2RGSA 1ZK9A 4YDJA 3BX7C 2KKQA 3F8UB 5MEQA 5KJRL 3MV01 2AAVA 2VWEC 3ROOB 5D7JB 5IR1A 1AO7D 2Q8BH 3EYSH 2F54E 4PJIF 2F53A 3NCBB 5JDSB 5C0JB 5JQHC 3STBA 3ZDXF 3T65A 5J8OA 2ZCHH 1TXKA 2GK0A 1QR4A 3I50L 2I5YH 4OM0L 2AABL 3T8XB 5F9AC 4Z95L 2D03L 4TSBH 4WDIA 2AK4E 2CDFA 3E2HB 4OZIF 3AU1A 1UG9A 5F7DB 3AB0B 4TNWK 4OV6F 4JDZA 2OK0L 1RUMH 4L8CA 4MXVF 3P40A 2XV6B 3O6KH 3C6LB 2J8HA 2X2YA 1B0WA 3ARWA 1D5BB 1NFIA 1MQ8A 4PUBH 3GBNH 3PP3K 2QR0B 4KQ3H 5H94A 3W82A 1JNLH 3G04A 3H9SE 4I2XE 5I15L 5DD5H 5T1KD 3O9WB 3O4OC 3SEPA 3DGGB 4FA8A 3ABZA 4ZTPH 3AREC 5TE6L 1U3ZA 5KS9E 2AV7A 4OKVB 4R90L 1BQHA 3F7QA 5TE4L 2B2XL 2AKRA 3VXTA 3BZ4B 4K8RC 4M61A 3WE6B 2FGWH 3I3EA 6CGTA 1HCVA 3QXDA 3DV6A 1NLDH 5F7NC 4MQ7A 1I8MA 5DHYB 1JHLH 3D39B 1RUAL 1FPTL 2HT2C 1MF2L 5FO9A 5GJSH 4L4JA 4XAKD 1WF5A 3SO5A 1LO0L 1FCCA 4L9LA 4YPGA 8FABA 2A6DB 5FO7B 1KJ3H 5J1TC 1KPUA 2FBOJ 3RA7H 4ZO9A 4J4PC 3MRPB 5L9DL 4X6DE 1K8IA 4BFIB 2V2TB 5GZND 1LD9B 1TCMA 2FJHA 3RWJB 5ANMB 5DSCA 1U3HD 4JAMA 1I7UA 4P4KA 4NHCL 3C6LC 1U8NA 2CO7B 5EBWA 2V9QA 5DD1L 1MRCH 1U92B 3VD9A 3AXLB 2MHAA 5DJYB 4KXZI 4R96B 5DMKA 5IBTH 3NA9H 4ZAKA 3CDGA 1KN2H 1T2JA 4HW6A 3TM6A 3WEXA 4OCLC 4OF7A 3KAAA 4ZPTB 2VDQH 5LJYH 1IC4L 3ET9F 2EYTB 1UM6H 1MWAB 4OI7A 3BEVB 4I3SH 4JFPB 2LV4A 4U7MA 2VLJE 1MFNA 5DRZA 3MRHA 3X14B 1UADC 1KLFA 5C0GA 1HI6B 1ZT7B 2OI9C 4J23A 2X70B 5I8KL 2R1WB 1F90H 1QFWH 1RZ7L 2EDKA 3S96B 2UY6A 3CFEB 4NGHL 4NQCA 4RDQG 3A67L 1DCLA 3C60B 5INDA 4XMLH 3UPAA 1MFBH 5CCKH 3V5HB 1JGDA 1KB9K 3VXRE 4IHOA 4FNLH 1ETZA 4LGRB 4OIBA 5FKPA 2E7MA 3IU3B 3LH2L 1CE6A 2VO5A 1QEWA 3O3UN 2BNUA 2H26A 4JKWA 5DMGC 4Z8FL 5IVXE 1RAMA 1UWXH 2G2RA 3FO0L 4K9EC 4ZUWA 2GFBA 2IQ9H 1W72H 4HFUL 3PWPE 4QTHA 5FYKE 3K8LA 1YNLL 1JHKL 5DI8A 5SWSE 4ELME 5IGXL 5CGTA 5IFAH 4IRZH 4R4FH 3BZ4A 4FMFA 4JB9L 4LVHC 2P44B 1VERA 1HDMA 4UOW0 5EO0B 1MQKL 1ONQB 3WV0A 1U42A 2IG2L 4WFHD 4YLQT 3QIBA 5IKCA 4K7PY 3ULUD 1I85A 4CJ1A 2VAAB 3QCTL 3I6LD 4EQ2A 5DMJB 2NX5D 3ZYIA 4IBLT 1U8HB 3PABB 3VXUD 2HWZH 5HHOB 4NBZB 1TPXB 3X17A 5D8JL 5DJ0A 4LSSH 4D9RE 2X4NB 4QRRA 2W59A 2HRLA 1BOGB 1OSZB 4DKEH 4OIIL 1ZOXA 4EN3A 3FFCE 1G7QB 4P49A 1SMOA 2NY0D 3SY0A 4QNPF 4CNIB 1DSFH 3L3OA 3T0XA 2DKSA 1RIUL 4G7YH 4MDJB 4X4ME 3TBVA 1XGTB 2JCCE 5DJCB 5ILTL 1F4YL 3ARGD 4NQEE 3BZEA 1HK6A 3JWDH 3BWAA 5A3IC 1F2QA 4ZD3L 5I76B 1CFBA 2WAHA 5JHDD 2P47B 1DQTA 4MB4A 2R2EB 3M1BA 4LVOB 7FABL 2EIZA 3VGFA 4IRSD 4KFZC 4Z95H 1FZJA 4NN7C 1A9EA 2EYSB 1OLLA 2WBWB 5GS2D 1AR1C 2CXGA 2EEDA 4O02L 2FEDD 5J0BA 5C07D 2VLKD 3QNZA 4XPFH 4OZGA 1A14L 1OB1A 3X13B 3FJTA 2Z35B 4HSQA 4XPFL 1LP9B 3VDBA 4WUUD 3AUVA 2OJZL 2OR9H 3VFOA 3KHQA 4ODSH 3OXRB 4KQ4L 1IEBB 4WNQA 4Y2DA 3O2DA 2F5AH 4HPYL 2OXGA 5HYQA 1KENH 1YEGH 4XI5D 3VFMA 4MAYD 5JPNB 4JM2F 3ZLQC 1S7RA 5FHBL 4XP9H 5HDLA 5D7LA 2R0KH 2IH3A 3GO1H 2Q1EA 1OPGH 2MPAH 1T6WA 4N5EC 4GAGL 1ZHKA 3PWUB 2VXTL 3IFNL 4JKKA 2N7BA 1M6OA 1ZHBA 2XQYK 5E2UH 5C86A 1NBYB 2EH7H 4OIIH 4U2YA 4HIJB 4JY6B 3OHXA 15C8L 2V2XB 4KKAC 2CUIA 5C3LD 3CUPA 2DQIH 3QG6A 1M7DB 4AZ8A 5IHZA 4GSDH 2DQJL 3BN9D 4FZ8H 4XAWH 4MVBC 3UXFA 5MEND 4L3EE 5EUOF 1KCVL 1K6QH 1HILB 3TO2A 3GSRB 3CNKA 1O5DT 4LPWA 4F3FB 2BVTA 4DUXA 3I84A 3JTTA 1W0VB 1NBQA 2WBKA 4PRHB 3P11H 4NC0B 2VQ1B 2QSCL 4G43B 5GZNC 2FJFA 1Q0XH 2I27N 4LCIL 4JM2B 4JPWH 5IIEB 5FV2A 1YYLH 4QRUA 1EO5A 4ZPVB 2HT3C 3VFWA 1U8IB 5C0CD 3GFUA 1NAMH 1KC5L 1X3DA 2GSGB 4X7FC 4Y8DC 5L6YL 4XZUA 3MTRA 5DD0H 3VG9C 3P3YA 4HIEB 1X5IA 4G42B 4KQ4H 3P30H 3Q6GL 4OZGF 3EJZC 5H8DA 1OARH 4F2MB 4PJHB 4FTVB 3IF1A 5IBLD 1B4JH 3T4YA 1WBZB 5IMOB 2RB8A 1XZ0B 5HGBB 5FUOH 1BEYL 4NN6C 1ZEAL 4ODWB 5I2IB 1QA9B 2CUHA 4L5FL 1OGTA 2Q86B 3KYMA 3P73A 5F89A 5DGRA 5E8EA 4EUPA 1JYXA 3S35X 3ULUF 4X0KA 4GMSL 3VWJB 3HMXL 3WIIL 3EYQD 4KRLB 4WO4D 3WD5L 2G5RA 3LRSB 1WTGT 2ZP0T 1EHXA 5F7EL 2EYRB 1QOKA 4XNZB 4XNQB 1DDHB 4ZFZB 4DGYL 2C5DC 2Y5EA 4W6XB 1B0GA 4TSCH 4GRMA 3DXAE 2X4SA 4ZO7A 5CEXA 4JRYD 3D1MC 4YWGH 4KZEH 4PIRF 4PGEB 3SQOH 4AM0A 3IDXL 5KS9A 4ZAKC 1VSCA 5EC1B 3QDJE 4Z7UB 2CKBL 2OI9B 1HEZA 3F7VB 4Y4HC 5HGDA 1CGYA 3QAZB 1IAMA 5IUSA 1IKFH 2IF7A 4K7PL 4N1HB 4RWYL 3VXUB 5TE7L 5L9DH 4NUJA 1QR1B 3D3VB 1U8LA 2D7MA 2A6KA 4FQCL 4PJDF 1ZANL 3EYVA 3J7HA 4YDVB 5E94B 1PD6A 4JFXB 5T3XH 4HIXL 1WAAA 1ACYH 4M6NL 2NY0B 1VADB 4LIQL 5D7KE 1OTSD 3BVNB 5INCB 4RX4D 2WANA 3QQ3B 35C8H 3MJ7B 1TZIB 1QTYT 4AT6A 4UTBL 3FFCB 3Q3GB 1U41A 3V0WH 5I1IL 5GSVA 3FQWB 2FHBA 2HTLC 2XZZA 3NIGF 4TUKH 1UB5B 3C5JA 3HE7C 2IMNA 2BMKB 3LZFH 4LLWB 2VKXA 5JOFA 3M07A 4KQ3L 5C0CA 5IW6A 2KUTA 4P5TB 3RUGB 4IIQB 4WVRA 1BWMA 4UINL 4I2XA 1SQ2N 4QHMB 1CR9L 1IE5A 5KVFL 1QA9A 5HI4D 3QNXA 2VXUH 1D5XA 3VXRB 4GQ9H 2M1KA 1RUML 3MLPA 4PREB 2R4RL 3OBAA 5K9JH 3DBXA 3V6BR 1U8JB 1CGWA 5ISZA 4TSBL 1AD9A 1UXSB 5BV7H 1X5HA 1FNGA 1PQZB 1HE7A 2OL3H 3L3KA 5IB5B 3TO4A 2WUBL 1CDHA 1FZKB 3ZSTA 1S9YA 3TFKC 5DD1H 4P2QB 4MLSA 1BOYA 1Q94B 5C0AA 4GG8A 4FQJH 3ZTJG 3WLBB 1AGBB 1PBYA 1E4JA 5IJKA 3QUMH 1U6AH 3W5MA 1HEZB 4BH7B 1QPPA 5KN5B 1MUJB 2YN5A 3MLUH 1RULH 2A83A 3DLQR 1CG9A 1EVUA 3L3HB 4S1RL 5HD8C 3NCCB 4LSVL 4XCYB 1NBZB 4JHAL 1F2XK 4LMQI 4X99A 3REVA 3HE6D 5FB8B 1DBKL 1IQDA 5EUOA 4D0DB 1DN0B 4FFZH 2P5WE 4KPHL 1MCRA 1I9JH 2NY0C 2FGWL 4FQHA 3HI6H 1DBBL 1LDSA 4M62H 1A6VL 3W0WB 2NY2C 3RVWD 4K23L 4DQOH 2A74A 4NZJA 1J1XL 2J8UE 5GGTH 1CFTA 5SWZD 2GAZA 5MENB 3DMMB 3C8KA 2VTFA 1FGNL 1K9TA 4I18C 4K7PX 4M3KB 3LQMA 4L4TD 2PYEB 5CHNB 3L3JB 3S35H 5FO8A 1WCBB 4CVXB 5E95B 3K81A 3WKNA 4KTEL 4CBPA 5ECJE 4LHUB 2E9IA 3ZL4L 4BM7A 3QFJA 5IW1B 1R3IH 3LKSA 4PY7A 1MCPL 2BNQA 3EJYC 4Z7VB 5IQ9A 3VXPA 1S78C 4HUKB 4FQLL 2NTFA 3ALPA 2CD0A 1R3JA 1MI5B 2CH8A 4L8BA 1AY1L 2XTJD 4OTXH 2YRPA 3BPNB 4KK6C 1XGYL 2J12B 4QOKD 4QRTA 4BZ2H 4G8FB 5TQ0L 3EZ8A 3FT4A 1RU9H 3ARDA 3IU4L 2P5EE 2R2CA 4TVPH 4U6XA 4MXQC 1FN4B 4G7VL 1D5ZB 4UAOB 4ODVH 1FBIL 1NC2A 3PGDB 4HH9B 1N64H 3S37L 3RJDA 5BV7C 5CJOL 4X4XA 4PRPA 5DFWH 2PF6A 2CLVA 3V0AC 1Z0NA 2APFA 2G60H 2V5MA 2Y36L 5DUPH 1FQ9C 1IGTB 2A9NH 4LCUB 4LCYB 3VH8A 1BAFH 1YYMH 5J12B 1XCQA 2BVQA 5CIPH 1CS6A 2WK2A 4DGIH 2VLLB 3SDCC 3IVKA 3C9NB 1KFAH 3RFZC 3DRQB 3GB7A 4TTGA 2VIRB 4HWBA 4X6FB 3NCMA 3BHBB 3ZDZF 4JFYB 1VACB 1XR9A 3PHQA 4KDVA 2RR3A 2X4TB 3OAUL 1QFWI 1K8DA 1SYVA 5KTEH 3T08A 2PXYD 1EGJA 4TVPD 5HI3C 5T33L 1IQDB 3IAGC 1CZ8H 4KDTA 4JRYA 4XRCB 3T0EB 2YRZA 3S3JA 2JJSC 5IT2H 1KCUL 3BJ91 1RY7B 3BPLC 3SCMA 3KPLA 5F7WC 5HDQL 4EOWL 1IAOB 3K2UL 4CADA 3FN3A 1U95B 3KXFA 2R56H 4S2SA 1QUNA 4PP1D 3FFCD 4N0RA 5ANME 3D3VD 1U8PB 4WUUA 4NNXA 4H25A 3NAAH 1WV7T 3BIBX 1CD9B 4GRLC 5KVDL 4B5EA 3VXSA 3HPJB 3KLDA 3V6ZB 2AXGB 1G0XA 4K3DH 1C5CL 5I6XC 2CRIA 3VRIA 3DOSA 2DQCL 5A1AA 3GBMH 5IQ9B 1FL5A 1UM4L 3KPPB 3QRGH 5C09D 3RIAF 1ZS8B 3VW3L 1E4XI 3LD8B 1QBAA 2B4CC 5LQBH 5CEZH 1GGCH 3MUJA 1FNHA 2NYYC 5GSRA 1L7TH 3Q48A 2H1PH 3QZWA 1YEFL 5I1AA 4TPRH 1Y18B 2XWTA 1MFAH 3K3QA 4MYWB 2YPKB 1Q9OB 3VI4F 4KUCD 3O11B 3QEGH 2JJSA 2L7JA 4JREC 3C09C 4L1HA 1CTNA 1LO2L 1WBXB 4XVTL 5FA4B 4M03A 1UGNA 2VITB 1ZHLA 5IEKA 4L3EA 4N8VA 3LEVL 5HGHB 4YXHH 5D71L 5E08H 4O2FB 3UYOD 3VXQA 4HWBH 3NN8B 3O2DL 3MSPA 4MA3A 3S34H 1F11B 4LQFL 4PRBB 2WINA 2XQBH 4LSTH 1G7HB 4ZFFA 1EEUA 4RGOH 3GJFA 1G0YR 3OKYA 2P45B 1XF4A 1HH9A 1O7VA 1L0YA 3QWRA 3T1WA 1QLFB 1U8MA 4F37F 3CX5K 2E8YA 5F7LB 1YEFH 1QO3B 3DX6A 3EHBD 1VKXA 1JE6A 1N4XH 2VLRE 5KSAC 1T1ZB 3CH1B 5CBEB 4HK0B 1ZLVK 3RL2A 4GAFB 3O9WC 4OGYL 1YMME 3QO0B 1RMFL 5C0AD 4GLRH 4HUMB 2ZKHL 2EKSA 2AV1A 2EIBA 3VCLA 4Y16A 4RISH 1BGXL 5ALCL 5HHXL 5D72L 4ZUVB 2BY3A 2Y5TB 1MHHB 2DQCH 1CGUA 1PKQE 1BZ9A 1UCBL 5DXWA 2HTLD 4NNYA 3GSWA 1NJ9B 2EDFA 3U82B 3QEUA 4N0YH 2BHUA 1F58H 2DQGL 4GW4B 1QRNE 5I30H 5IVZB 1T5WA 2FH6A 4NKQB 4U0RB 4Q9CA 1NCBL 1QZ1A 4J8RA 4QT5B 3RIFF 4Z7NE 4X5XB 2NX5E 3T2NH 5E8NA 4M7LH 2AV7B 3NVQA 5I19H 3UTSB 2Y07H 1HKLH 2CUMA 4QRPB 4QOKB 4IM8A 1SMAA 1J12A 2BVYA 1JRHH 3GM0A 3QRFM 3KLHD 1HWHB 2NY1C 2WZPD 3FQRB 3QCUH 1NGZB 3AMKA 3ROLA 1I75A 3F6LA 4LSRL 5DEGB 3OAUH 5DJAB 4D3CH 5L2KB 2FH8A 1YPZB 3BIAX 1WBXA 2X4OB 3QIWC 3X11A 1X4YA 2GY5A 3KGRA 1I85C 2ZJSH 4PLKC 1NL0H 5C8JB 2ICWB 4PLNC 2GJ6A 2IMMA 4LLAA 1LE9B 3Q6FA 5E0QA 1GXEA 4X6EA 5I1CH 3WXVH 1JV5B 3CVHA 3ES6B 5F6IC 4KMTL 5D96B 1HHIB 2BRQA 3S37H 1U92A 4U1MA 2J2ZA 1ND0B 3MC0A 4HGWB 1G7HA 5AD0A 2YMXL 4KKCC 3LEYH 4XWOD 4HX1B 2GITA 4K2UH 4FXKA 5IM7B 1RHHB 4CDHA 4GKZB 1D9KB 1OSPL 4MAYA 3LMJH 3O4LE 5C08E 3QISA 4I4WB 5ETUB 3RL1B 4GKNB 1SJXA 2CDEB 1ED3B 5F3HB 3B2UD 1XT5A 1DANT 4AEEA 1WEJL 4ZOBA 4HJGA 5TPWH 5AEAA 1P4LA 2XFXA 2E27L 3GMMB 5T3ZE 2XYCA 3RZWA 5BMFH 1A6WL 4P2RE 3QQ9C 5DTFB 2IAMD 5IB4B 4D3CL 3MRIA 3LAFA 4PGDA 5EBLB 2ICCA 2F74A 3FQNA 1ZE3C 4Y2OA 2KZ1B 1A1NB 3WYRA 4OLXL 1N5AA 1B3JA 2H26B 1FRGL 3FQUB 3CFJA 1HYRC 4YIQA 2I9LA 3FAXA 4FXGB 4JLRB 3W81A 5GGTL 2ED9A 1BQUA 1XR8A 2BHYA 4M62L 5EO1B 1A1MA 5MERA 4ZS7H 4HFWB 1KG0A 5CP7A 2HFTA 5EU5B 1MRFL 4M8QA 3WS3A 2NY5H 4I13B 1EHLL 2C4FT 3BGFC 3RKDC 2OP4L 2P8PA 3PG2A 4H1LA 4KROB 4KVNL 3O2VL 2VISB 4OI9A 3FTGA 3W0WD 1GC1L 3PIQA 2BNRD 2CJUH 4OGZA 3GIVB 4RMTA 3F58L 1G9NH 4K9EH 2CDGB 5ACZA 5J13C 4OFKA 4RISL 1DQDH 1MCWW 2YPVL 3CDFA 4WEUD 1XH3B 4Y19E 2AVGA 3L9RB 3OR6A 2ZOLA 4W6YB 3OG4B 1CDYA 3QHZL 4PLOB 5LBSL 4K8RH 4DVBA 1CXLA 1AI1L 3DUUA 1NCDL 4TUJB 3OF6A 1LD9A 1RK1B 1HWGB 2BXYA 3BXNA 4V1DB 3H9SD 4HQQL 1CICC 1NBVL 4F2MA 3LRGA 3V5KB 4APQD 1JI1A 1OWRM 3QI9D 5C07A 3IRZA 1WIUA 3TN0D 5KS9F 4XX1E 4YDJB 4D8PB 4ZAKB 1NC4A 3UPCA 1CF8L 4U49A 4P46A 1H3PH 2EZ0C 3RIAK 5AZEL 1G9EA 5EPMA 1CF8H 4HG4J 5DQDH 1RZJH 1I3GL 3CAFA 4GMTL 2VXUL 1HSBB 1X7QA 1BVKA 2OTWA 2C1PB 3QXTA 5DD6A 3ESVF 2J7LA 2X44D 2XFXB 3QO1B 1P9MC 5FDYA 4PTTA 4Z7WB 3BDYH 3LEXA 3TZVA 3TBYA 4OI8A 3P77A 2GIYA 4NIKB 2VLJB 3O4LD 1AR2A 1X5YA 1UACH 1L7TL 1JGUH 3RU8H 4U1SA 1QLEH 1QHOA 4HEME 3CFIC 4MLIA 2X7LB 4UQ2B 1DQML 2VWEE 3UTSD 4UV7L 4P9HC 3T0WA 1HQRB 1SM3H 3LKPA 4XMKH 3IDUA 5CJQH 3SKMA 1PG7H 1UFUA 5TH2A 4YGAB 2PXYB 4M6NH 1S7WB 2ATPA 1X6LA 3LIZH 5T3ZD 4Z7UE 3MMEB 3D18A 3ZT5A 3MLXL 3C5ZC 3BFOA 2HN7B 3O6LL 5HYSG 1NAMA 5KVDH 1FNEA 43CAA 5B38A 4F37K 4XP4L 4G8GB 4ELMB 4E0RB 4KJYA 3MBEC 3WN5C 1T20A 3VXUE 1IKNC 3RWCB 3MJ6A 3BYYA 1JHTB 2H3NB 2PW1B 4Y5XA 4NOFA 5CILL 1IQWH 3IDXH 1OCWH 3U7WL 1A22B 2ID5A 3U4EB 2AJXH 4PGZA 1Y0LB 4EI5D 5J56B 1U8QB 4H88H 2B7DT 2X4NA 1D5MA 2NMSA 3EFDH 5EFIB 3HKFA 5LWYL 4HCRA 2A6DA 1A7RL 4JZNA 1KPUB 2VDKH 3ZKXC 1RZKH 1JPGA 2EC8A 2XZCL 4GBXD 3WO4B 5CD3A 2GJZB 5C9JA 4MDJA 3TBVB 3KXFE 5F1IB 1F6LL 4MHHI 5SWSD 2C4XA 2BOCA 3TBTA 3RVWC 3AMLA 3MRBA 2HLFC 4OFYA 4G6FB 3O45B 4R2GB 5I6XB 1AH1A 2ITDA 1I1YA 2ARJA 1OSPH 1YNTB 5EULV 3VD5A 2WUCL 5D7IE 5DJYA 3HAEH 3LEYL 3QI9A 4PJFA 3MFGB 4J1UB 5FUOL 3NMEA 1HI6A 1ZT7A 4PJ9A 1LO3L 3VMPA 4HWEL 4IMKC 1JF1A 4TVSa 2VDNH 1SBSH 1OTUC 1S7SA 3MLSH 2O93L 5IB5A 3MA9H 3A6CL 1L4IA 3D2UD 2R1YB 2ZJSL 4MB3A 3FMGL 1U9KA 5C0FB 2PYEE 1AQKH 2AJZB 1QRNA 2ATKA 1G9NC 4O2CA 4E42B 1IAKB 5JPNA 2EO9A 2KQNA 3GSXB 3BP4A 2HKHL 4DFHA 2PTVA 4JANA 4LSRH 1GGIH 1C1EH 3LCYA 1CE6B 1NANI 4OF8A 5SWZA 4YHYC 1DQLL 1KGCE 2YKLH 3VGDA 3R4DA 3BQUA 3TGXA 3EW3B 2O5YL 4PJCA 2VDPL 5ITFA 3BP5B 5DS8B 3VGGA 5DHVA 4I5BB 1T89A 2C7UB 4AJ0A 5DI8B 3DO7B 2C4FU 2DN7A 3QUXA 5I19L 4KJYB 2HG5B 3T2PA 2JB6A 4OSUH 1IGFH 3GGWA 4ETYA 1NAKH 4EDXA 1I9JL 3EYVB 4Q74A 1RZGB 3NGBB 4U1JA 4YX2H 1TPXC 2F15A 5I30L 2NR6D 4GAGH 5F9JB 4S1SH 3GHBL 1HCFX 3D87B 2GAZB 3HZMA 2P8MA 4PP2A 4JVWA 1D5MB 3AC0A 2PW2A 3NCYS 4K3EH 4NM4L 5BQ7A 2GJ6E 1TZIA 4C56D 3CLEL 3DPBA 4OFDA 5GHWL 1RULL 1EDQA 4KHXL 2F5AL 4DN3L 1JNJA 4QRUB 3TYFB 1AFVH 1FNAA 4WW1B 2FX8L 1PKQA 4HS6A 1BOGA 1OSZA 4OGXL 2ADFL 1WFTA 5KSAD 1A7NL 3PV6A 3WFHA 3QIBD 3U0PB 4U1HA 4Y1AB 1I4FA 4OLYH 3ARBD 1MIMH 2C3WA 4D0CB 1CLCA 1NDMB 4QHMA 3UO1L 1ZVSB 4APQB 1R3KB 1D5XB 2EDEA 2Z93B 3IDMB 4WV1C 2XQBL 3D0VB 3O8XA 1T2QL 1I3RA 1BD2B 4UIKL 5EO9A 4Q6IA 4ZNEA 3UPRB 3SBWA 1CDCA 2AXHA 3HNTL 4BUHA 5E08L 1TJHH 2NZ9D 4Q6YA 5I1HH 1JBJA 3GHEH 5A2JH 4PJEA 1H3XA 1XIWD 1XGUA 3DTXB 1ZLVH 2DTMH 3D25A 2NY7L 2B0SH 1MRDH 2AS5M 4JFEE 1UH2A 1F4WH 4JCMA 4DK6A 1JUFA 1A9BA 2ITCB 2J8OA 2LQRA 4YHLH 4AY0A 3DXAA 1NFKA 5T1KA 5HJ3A 1EO8H 1IC5H 3EJJX 4M6OL 3PL6D 2W92A 3QBTB 4JDZB 2YPLB 1CI5A 4GG8B 3QXAB 4QHNB 4QWWD 1BF8A 1HH6A 4XPBH 1A6AA 1T0MA 5EN2A 3HC0A 1S9KC 1T1WB 2X4PA 4IHOB 4Y2DB 4M5YL 2IH3B 3FFDB 4EBQH 3CD4A 1VGKB 1JWSB 1KIRA 1DLFL 1KIPB 1H8SA 1S7RB 2A83B 4HKXA 3P0YL 3QUYC 1CICA 4NSKB 1JTPA 2V17L 3TCLB 1EHNA 1GAFH 3G04B 4ONHA 5DFVD 1MFDL 4HIJA 3LB6D 1M1SA 3HS0B 3P9LB 1HXYA 4KU1A 4NUGH 4H1LG 4CN4A 1MCKA 1QBML 2IJ0C 5T3XL 2X9WA 4OF6A 2C9AA 2XTLA 4FQQB 4V1DE 3MJ8A 2XACC 5E9DB 1IC1A 4HT1L 4ORGB 2VABA 3HZKB 2QQNH 3VI3E 1YNLH 3VGAB 4HFUH 3QUYD 1M7DA 4K7PH 4HLZG 4RWYH 3WJJC 4HJ0D 1FL6B 2BERA 4PRHA 4P3DA 4RAVB 2C3HA 3BSZL 1TNNA 3TYFA 2CIIB 4QTIL 4GO6B 5DJ6A 4UDUB 3SDAD 3SE3A 3VRIB 4FNLL 1UKSA 4BUGA 3OJDB 4PJDE 3CIQA 1D9KC 4KROD 3REWB 1Q9LA 3ULVC 4D9QD 2Y25A 3MRMA 4MNHA 1KJ2A 4EZMA 4U1GC 5BO1L 2WP3T 1KEGL 1MJUL 1QSEA 2WSKA 2DJSA 3UYRH 2VZVA 5I1AB 2W9EH 1E28A 1LILA 3I9GH 1J5OH 3I75B 3QR2A 4NWUH 3WUWA 1OAXL 4ZMAT 5FYLE 5E03A 1NC2D 1YYML 4JZJB 4EXKA 3C87A 4YDLC 3V4PH 3KYKH 4KROC 5HDBF 1EV2E 3RAJL 4KJPC 3LQZA 2BNRA 1TVHB 4CUCA 4JY4A 5D70L 1NCWH 5C3TA 1C08A 2EYSA 1Z9SA 4PJ7A 1N64L 4N8VB 5HHVL 1RQ5A 3L3KB 1QSFB 4TNVK 3Q1SH 3F6IA 3QNZB 4O2FA 2A0LC 1DFBL 1J8HE 4Y16D 1XCTB 3TPUB 4XCCL 1LP9A 2R23A 4Y19A 2EDXA 2H2SC 4EDWH 1RU9L 5CAYB 5I18H 4WFFD 3VG0H 1E4XL 2O5ZL 3B6SA 1I1RA 4KV5F 1MEXH 3G6DH 5HYQB 1J86A 4J4PA 4XPHH 1U8OB 4YHPB 3ZE0F 1TJIH 4GXVL 4YHOL 3WSQL 1PW3A 5EORH 3ZT7A 1Q0XL 2DKMA 3TIDA 4AM0B 3L6FB 2X09A 3MLVL 3OKKA 5E6ZA 1A7QL 4LOUD 1QRND 1RJYA 1R3IL 5I75C 1FG2A 1OLZA 2AQ2A 2V17H 1T7VA 3KYOA 2E9BA 3PWUA 1JPSH 3VXUA 2HT4C 5A43C 2C3XA 4FQQA 1CXHA 1U8LB 5HHMD 5BJTA 3C08H 4UILL 4OZHA 4X6CE 4ZTPL 2MOVA 3U46B 2DL2A 3MNWB 4JDVB 4G8EB 1EJOH 1UZ6E 1U8PA 5ID1B 1ZWIA 2N4IA 2E6JA 1TETL 2PO6A 4U3HA 3QJFB 1ZVHA 4PUBL 2P49B 1R5WA 1H9VA 5F6IB 5T3ZL 5FO8B 5DVLA 3KHOA 3VFGL 5BVPL 1HYSD 5C2BH 3DYOA 3QQ9D 4KKAD 3MRFA 4OCWL 4JG1H 4LEXH 1T22B 1G7JA 3BGMA 1BZ7A 3MOAL 4PTUB 2Q3ZA 4P5TC 5IIEA 1F6AB 4Z7WF 2OMNA 1E4KC 4LLWA 4XCFL 3V7MA 2DWDB 5JMOC 1WAAF 2UUDH 3QUML 4XH2B 2DLHA 4RRPG 5KSBE 3S9DB 4QF1B 4WI9A 1EUTA 4G8IA 1G6RA 5DRNA 5FM5O 2CO6B 4C54A 4JY4B 2P46B 3HMWH 4YHYB 3HUJA 5EOQL 1AGFA 4LCWB 1A9EB 1OGAE 1BD2D 1OAQL 4RMRA 4UQ3B 3CZFB 1PAMA 1RIVH 1GPOH 3EDKA 2R9HC 3WMSA 5ISZB 3U36A 1DL7H 4CAGA 1JZ8A 3V52H 3SDXE 3L5JA 1M7IB 5GRUH 3CC5A 3GRWA 1K4CB 4TSAL 4BQ6A 2OMBA 5D7KD 1Q0YH 1FFOA 1K3ZA 4XI5C 2D0FA 5BVPH 5IFJA 1NUDA 4Z7UF 3R1GH 5C6TL 2I9TB 4WNQB 1XF4B 4A6YL 3BHBA 2WIIA 4JFOA 3MBEB 3WN5B 1RZIB 2Z91A 2NZIA 3WIHH 3WLBA 4P4RB 1T7YA 2X42A 4EN3C 2OM5A 4PJFF 4BFGA 4C59B 3H0TB 5FYLD 2P5WB 4UILH 4YK4B 3ZE0E 1MAMH 3A6BL 3FZUD 5JQ6L 4MMZC 4HZLB 5GRVL 1FYTE 1URLA 3IDIB 2J8UB 1WTLA 2F19L 2BRRH 3ZYJA 1FFPA 3RWDA 3W0WA 3FOMB 4NFBA 3P4OA 4QO1A 4OLZH 3C6LA 5F1SA 5D5MF 4TNVF 5HYJB 4J3UA 3ZKXB 1I8IA 1A7BA 5CJ8A 5CEZD 1SY6H 3SKNA 1RVFH 1GCFA 3MR9A 4I48B 5L2JB 1NCCH 3PP3H 2GW5A 2G5BA 2Y4SA 3TO2B 1QNZH 3I6GA 5IGXH 4TUOA 5E8NB 2O5ZH 5CD5D 1ZT1B 4L8SB 3H3PL 3BZFB 4GFTB 5KSUA 3IDYC 3TBWA 1F6AA 3QUZA 4G43A 4EDWL 1V5JA 4R9HA 4IS6A 4PPTA 4OKVA 5J1AB 4CVXA 4Z8FH 3VFUA 1ZKAA 1ZS8A 3B9VA 2DMKA 4GJTB 2DWDA 5IK3A 5JLZA 3LH2H 3RNQB 4OF0A 1IRAY 4XH2A 4H1LH 4PRHD 4AIXA 3QFJB 5IW1A 3FQWA 5IROC 4P5MA 2C3GA 4M00A 4CU7A 5JW3H 3F7YA 4ELMF 2J88L 4GG6B 4FTVA 3AREB 2D4FA 4KVCL 4UMGA 4Y4KA 5D1XB 5HI5D 3S8WA 1MVFA 4KGLA 1UT9A 3L5XL 4P99A 8FABB 2BVOB 3O6MH 4DGYH 3RGVD 4NKIL 4QRTB 1MH5A 3GSQA 4IOIB 4U33A 4JN1L 4PREA 4NKIH 3OKOB 3P73B 4YFLF 1T66D 3N1FC 2AGJH 1IGCL 2UWEB 1BBDH 1S9VB 1EEQA 2LE9A 4OD1H 3V4UH 1RZKC 4X5WB 5J6HB 4OZ4B 3QWOB 4O2EA 1BHGA 3W5NA 2D7TH 2YSSA 2C3VB 5C09E 1KYOJ 2OR8A 1TVDA 5CS7A 3RTQA 3IT8D 1LO5A 5C0IA 4NHCH 4PJBA 3MFFA 1HH9B 2F54D 1QQDB 1SYSA 4I9WD 5C0AB 4C56E 2W0LA 4XHJD 3W39A 1FE8L 4JFPA 2ICEA 4NDMA 3DWTA 1UC6A 1JWMA 5BZWA 3LSOB 3MV9D 2OL3A 5BXFB 1VACA 1KJ3L 5DHXB 3DGCR 4HT1H 4LEOB 2NY3B 4M9PA 2F53E 2VH5H 3CFEA 3X3GL 3F7VA 3MGTA 1DTUA 4JFDD 1MF2H 4F7PA 2XA8L 3CGTA 4WWKB 4XNZC 3P4OB 3LKRA 2F74B 3WKML 3TH4T 4UV7H 1HQRA 4IMLA 4NO3A 1BQLL 4TVPE 3BKYH 1U95A 3KXFB 4LARH 3OR7A 1MAML 2PXYA 5FUCE 5TE6H 5C2UB 3MYZA 4X5XA 1VADA 3VD4A 5HHPB 3TESA 2WWMD 4YQXL 4NRYA 4AENB 5E4IA 5DVNA 1E27A 4PJIB 4Z78A 5J6GB 4LVOC 1EK3A 2EH7L 4QRPA 1QPXA 5M95B 1NUNB 4U6VL 3R1GL 2VC2H 3MV11 1A6TA 3VGBA 5EOCL 4X6CF 1Q9KB 2B0SL 5HDOA 2BNQB 3GHEL 5KOVC 1RIHL 4ODXB 3BRDA 2GTZA 3NACL 1JGLH 4YHKL 4XP9L 2DQFA 1J7VR 5IKCB 3QQ4B 5EC2B 2JE8A 1WWWX 4HAGA 3MV7B 2WBJD 5I1LA 4P5KB 4IOIA 2G9HB 4K3JH 5C8JA 3VXRA 4G8FA 3QDGE 5ACLA 4D0BB 4QRRB 4MAYC 3ZKND 1BMGA 3BXNB 1ZHLB 4OLYL 5GIRB 5MEOB 2IPKB 3F5WB 4X5WA 4K3GA 2D0HA 4IRSA 3V5KA 1AD9B 1H3VA 1A64A 2X1PA 3MRBB 3B2UC 1A5FL 2G75A 2OR7A 4S1QL 1PQZA 2EEBA 5ITBL 4Y4HD 3VFVB 2QHRH 4GRLA 4F7EB 3VMNA 2R8SH 2R2EA 3M1BB 4XB8A 7FABH 3BP6B 4MXQD 5D2NC 3HTLX 3M17B 5GGRA 1FJ1A 3P4MB 3MOAH 3FL7A 1YQ2A 4KRPD 4LK4A 5BZWB 4CL7A 1ORSB 1FVEB 5DJZB 4EN3D 3JWDL 3OAZK 5EOCH 1XGQB 1R0AL 4HK0A 1MRFH 4J6RH 3CU1A 4LKXB 3DX6B 3QP3A 2XWBB 4X4YB 4F7PB 1NUFA 1HN1A 4UB0H 2VLJA 1J0IA 1IGFL 2E7LA 3F65A 5C0BD 1FFNB 4QNPE 3A0OA 4Y5VB 4MCYA 2P5WD 4O4YL 2D4DA 4HWZB 4E42A 3AU1B 2MFNA 1FRGH 2CPCA 3OR7B 1T5WB 2XKUA 3HE7D 5C6WH 2X9XA 1CGTA 3I3BA 4F8TA 2FECL 5FGCE 4D9LL 3PF2A 5L8JB 2VLKA 1V3KA 4WU5A 3KS0J 2MWCA 1CFQA 2CR6A 3IDNA 2BOBB 3DMMA 1MQKH 3BP5A 3WSQH 3SGKA 4ZSOA 1LP9E 2VH5L 3X3GH 5EOTB 4QOKA 4O58L 5D1XD 2AEPL 2YD9A 3OKEB 4ZO8A 1Q9KA 4IRZL 5DA0B 2VISA 4EQ3A 2R4SL 2F5BH 2E9WA 2E8ZA 1G7PA 4R0LA 1H0DA 4JKLA 1YQVH 4HWEH 4DVRH 3FO0H 3OQ3B 4X9FA 3SDXB 4MNQA 3QFJD 2YWZA 1FVCB 3Q1SL 2JLLA 2Z8VC 5IEHA 2ZUVA 3JTTB 4OQ1A 1U58A 2D7TL 1ZSDB 1L6XA 5LAXB 3AAZA 1DQJA 4WGVB 4NO5B 2IFFH 4JZNB 5FYKH 4LLMB 5CLWA 4XC3H 4CN1A 5JXED 3P4NA 4ZPVA 3CZJA 3TA3A 1LDPH 2NY1D 4JVPA 3QEQD 3V4PL 4MA1C 5I17A 2ZPKH 1FH5L 5K9QG 4NWUL 4I77L 4X4XB 1JV5A 1RZKL 4ZFOL 1PY9A 4I3SL 2JKXA 1YNTA 1CLOL 1P2CB 4MAUL 4U1MB 3P4MA 2A6JB 3V9FA 3DARA 3AM8C 5DJZA 4KVCH 1YEHL 2Q6WA 2GY7B 1I3VA 5EO9B 4F58H 1UYWL 1P7HL 4JFQA 2C1PA 5DD6B 2DJUA 1IQWL 3JV0A 4MS8D 3ZYOA 2R1XB 3RX5A 4WJ5A 4BK4A 5E9DE 2IANE 2PXYC 5A16A 4DEPB 2VUOA 3H9YA 4X4YA 4JFYA 1NGXB 3BEVA 3PV7A 3O3DB 1XGUB 1QVOB 2F53B 4GRWB 5DRZB 1FFQA 2VDMH 3OPZH 1AO7A 1JUFB 3DVGA 2EYRA 4U1SB 3RA7L 2AJZA 2EKSB 1XGRA 4XNYH 1PLGH 3KVQA 2V5SA 4XXCC 1MJJA 3KPLB 3RDTC 3FQUA 4X7TA 4GXUN 3BKJL 3T77B 4CADB 1UCBH 3FQNB 1MREL 4NUGL 4NKDB 1JK8A 3HC4H 5E6IC 3DUSB 3G5ZB 3O9WD 3ZDZE 4WUUB 3HAEG 1NLDL 1K5NA 4DZ8B 4ENEC 3RX8A 4PJCB 2ZKHH 2ZZUT 1IZJA 2I9LB 3JWOC 3OTTA 3KXFD 3UJTL 3BIKA 2GFBB 2NY3C 43CAB 4NQDD 1N4XL 3DO3A 3D69B 4FMKA 4H1LB 1YJDC 3MJ9A 3CMOL 5I1JL 5HVWA 2O5XL 1NQBA 1FVDB 1RFDL 1S9WA 4D9QE 1JHTA 5A2LH 3RY6A 4LSTL 4KI5C 5JIPA 4HD9A 3U83A 2AXFB 3HZMB 1IM9D 4DEPC 4HBCL 3S34L 5D9SA 3GIVA 3ROLB 4TSAH 5AZEH 3DUUB 5J9PB 2V2WB 2HT4D 4ETQA 1KB5A 1BECA 4J2XA 3KS0H 5I0ZA 3GSNL 5I17B 5DO2C 4XVJH 1CK0L 5F72S 5FA4A 4EIGB 1OAQH 3MRQB 2BOCB 5BS0B 1L9NA 1FLTX 4BFIA 4OQTA 3WNNA 4FG6C 2FYYB 1QSEB 5EIIA 1QYGH 5ELIA 3WFEH 2ITDB 4NC1C 4BJLA 3QDME 2APXA 4L1DA 1GIGL 4JPIB 4U7KA 4C56A 4ORZC 2BY0A 1NGWB 4PJFE 4YR6B 2ZUTA 1UQSB 3GMQB 3NGBC 3O8XB 3UTPE 3BPCA 1DE4B 2ZUXA 3CK0L 2I07B 3QRGL 4EXPX 3S36H 4WTXA 4I3GA 3NIFE 3CLEH 1T04A 5JW4Q 1FAIH 2VLMD 1WLHA 4GRLD 3WIFB 5D5ME 1T5XB 2MCG1 5KW9H 5CBEA 4G80B 2Q7NA 1QLRA 1V7NL 3NCJL 3VFGH 4MXWH 1MFCL 2NY5L 1EHLH 3S96A 2E3VA 1S9YB 1YEDA 1EGJH 1IZKA 4LHUG 4ZS7L 5E56A 1OL0A 3SDYH 1IAIL 1WK0A 1BZ9B 3WNMA 43C9B 4HUVA 1LEKB 5DVMA 3CVIL 4GW4A 5DO2D 3QHTC 1CICB 2O5YH 5KN5A 4QRSA 1MCOL 3TEUA 2E6PA 3GEWB 2NPLX 3LS5H 4OV5B 4QY8B 3KYOB 5EA0H 1XR8B 2AJUH 1JL8A 4X99B 4HUUA 4C4KT 1A7QH 4HCRH 2HKHH 1WICA 4UT6H 3BE1H 5ICXA 1X44A 1ADQH 3OB0K 2E27H 3GKWL 4LLYA 4WWID 3OX8A 2BDNL 1P7QD 3E0GA 3G5XB 3HZVA 3ULUH 2GJ6D 5J13B 1IJ9A 1TJIL 4G8EA 1BFOB 5T1LA 3FMGH 1OAUH 2HFEB 2E5EA 1KTDA 3PIQB 2LVCA 2QQKH 4YHMH 2A9NL 2YZ1A 3VG0L 3FONA 1R5WB 2HFGL 3RUGF 3T0EC 5T5NF 2K7QA 4NC2B 1LQSR 3MXWL 3WUZA 5H2BB 3MRLA 4LLDA 3ECBA 1G7JB 1AGDA 4PJXB 4FQPA 1TZGH 5HHOA 1SY6A 2NY2B 1NGPL 4TUJA 4R7NB 5EU7E 2J4WL 1RZ8A 2RFXA 1ITCA 3MJGX 5C0RH 4OZIB 3IETA 3ZHDA 1J8KA 3ZE2E 1F3DH 2AEWA 4JRXA 5D70H 3WNPA 1PSKH 2NY1B 4AL8H 3ZDYE 3SKJL 5CKAA 4PV8A 3RZCB 5TFSH 2GT9B 5FYJL 4YJZL 3PDGA 1UZ8A 3UTTA 4NHUA 4EI5A 3BPCB 4OF3A 5BRZA 3ARFB 3DETC 4UIMB 3UTSE 1J5OL 4ZNEE 4HHAB 4QRPE 5BZDA 3JWNC 3ULUC 4XP5H 4PJEE 1LWRA 4NYLA 1I3UA 4OZHF 2M8XA 4URTB 3DTXA 4H88L 4YBQD 3GMRB 3QCUL 1YJDH 4JDTL 1KTLA 4XVUD 4Y2DD 3CMGA 3D0LA 4R4ND 4RBPK 3FHAA 5FOBA 4XC1L 4MQXC 4I0PC 2YPLA 3ILQD 2EDBA 1AXSA 4KMQA 3U4AA 4HUNB 4OCSH 3FFDA 2LABA 4N8CH 4Z9KB 4J12A 4LVNC 3O6LH 1UEYA 1TTFA 4P4RA 4YEEA 1GOGA 3BN9C 3C2SA 2BFVH 2DM7A 4ISVB 2YZ8A 2W9DL 4DTGH 3B9AA 5EO1A 5EC1A 1M71A 2XXCB 5ADOH 5D7LD 1MY5A 1SM3L 2PO6D 4Q9QH 3MLTA 3KPRE 1DQMH 2C7UA 3MOQA 5T1LB 1FYTB 3QIUA 4OBSA 1NBYA 1ACZA 4M4RA 3BJLA 2FWOA 4X6DA 4P23B 1J1OH 5ID1A 1KJVA 1GGUA 1I9IL 4UT7L 3UMTA 4POYA 5JXAH 2IFGA 1GIGH 4PRPE 2NLJA 5DF0A 4OJFL 4F57L 5E94A 4XXDB 1I7TB 3HPJA 2DDQH 3MLZH 4L8SA 4JFHE 1DVFA 1YY8B 4ACPA 4P46D 5AYUL 1MCIA 1CK0H 5JPMA 3CFBB 2VLME 1RK1A 1NLBL 1KB5L 3KNBA 3NCFB 5I1HL 1QSEE 4YXHL 4JM2A 4LBEA 5CGYC 5B3JF 4XP6L 1LK2A 1EBPA 4WFGE 2ZSVA 4MB5A 1NLBH 3HNTH 2UV3A 4D0CA 1UVQB 3L1OH 2FIKB 2BVUA 3ELAT 1FV1B 5F7KC 4PJDB 2FJGB 4UIKH 3GUTA 3WHXB 5ESVB 2NXZB 1CXFA 4WW2F 2GYSA 3QUKB 4G6JL 4Y4KB 1RK0B 5D1XA 5D6DC 1YNKH 1I4FB 3MREA 4PGCA 4JZJA 3VA6A 4ZSOE 5I74C 2FX9L 3H8NA 2P5ED 3QDMD 2O5XH 5IMOA 4OJFH 5FKAA 1MH5B 3GSQB 1AC0A 3ARVA 1WWCA 3PHOA 3QNXB 3TN0B 1KUMA 2YRLA 3ORJA 4U1LA 4RZCB 1FGVL 4KGJA 2XTJE 5D7IF 4Q9RH 3MACH 3QH3B 3UJTH 4JM4L 4HLZH 5FGBC 3VFNB 1YEJL 4Z7OF 5IVXA 1IGML 3HMXA 3MV9E 3O6FA 3TYGH 3NFNA 3CC5B 5KANI 4YEFA 3V4VH 1AXSB 5GGRY 4LIQH 1Z9OA 2ENYA 3EZJB 2WINB 1R24B 4HMCA 5DURD 4KVNH 4UZGA 5EBGA 2GTWB 5DUML 4YPJA 1ZANH 2BSED 2B1HL 5J1SC 4JFOB 5IMMB 4PS4H 1ZGLM 1FDLL 2XKNA 5DK3A 4N8CL 1Z3GH 3MCLL 3L6FA 4GAYB 3PWPB 1A4JB 1UXWB 4X7SL 2E7HA 4OSUL 1NMAH 3KPSA 4OAWB 2R56L 5SWZB 4P2OD 5EU3A 5F6HI 5E5RB 2Y23A 3BQUB 2OZ4A 4HKZB 4L4VA 3I2CH 3QO0A 1MUJA 2CKBH 2P43B 2YD8A 4YZFF 3D18B 2YA2A 5ITFB 4E41E 5IT2L 5GGQH 1JZ3A 4WWKA 5BJTB 4PLKD 4P23A 5BVJA 4QRQB 1YEHH 3LRHA 4RWHA 4QRRE 3FB7B 2HFFB 4WHYH 1T20B 2CQVA 4XP5L 1QR1A 3NA4A 2DAVA 2ZCKH 1A6WH 5BMFL 4RGND 3QA3B 4EI5C 2XOTA 2XICA 4MSWA 5F7EH 1MI5D 5EOCJ 4J8RB 1FH5H 4QT5A 1AO7E 4P57B 3KYNA 3WD5H 3D5OF 2MQCA 2JJVA 5J6GA 3IDJA 4P4KC 1ITBB 5D7JC 5J1AA 2VDNL 3ARFD 1NCAL 1FO0H 1I7ZA 1L7IH 3N06B 3LMJL 2IEPA 4ZS6D 2X4UB 2RCSH 3EYOA 3RWIA 4UV4L 2GJZA 5C9JB 1KCLA 4R3SB 2EIEA 4KKBC 4P5MB 2X4RA 1HZHL 1TZGL 3MREB 4PGCB 4ODVL 3IS0X 3U0PA 4AK1A 4U0QB 5JNYA 5D1ZC 2DIJA 1FC1A 1FO0L 1NCAH 3QXWA 1DLHA 1F4HA 1SVZA 2HMID 1MCEA 4OCNC 1IGJB 1RJCA 5I1KL 5HY9B 4Z18A 4O58H 1U3JA 2H6PA 1R3HB 3OGCA 3ULUL 1X5KA 2UWEA 1QSED 1AHWB 2Z92A 4LHJB 4D9RD 3DJ9A 2WV3A 4UU9A 4XVUC 5FCSH 3DX7B 3BE1L 5IBLC 2JELH 2R69H 1S7SB 4ZFOB 2Z31D 3ZL4H 4ZOCA 3VFVA 1EXUA 3OKDB 4Y5XC 1SHMA 3RTQB 3RWFA 3TPUA 3AM8A 5T1KB 4JFFA 4C83B 4WHTB 1OP3K 1KLGA 4WW2B 2DQJH 1FJ1B 4FZ8L 4L29B 3KPOB 1U8OA 5DMGD 3QJHA 3B2VL 4OZFB 1FVEA 1ORSA 1J0KA 4HGMA 5C08D 3H3BC 3K4AA 4JQIL 5IBUG 5E2TL 3MXVL 4JQXC 3HE6B 3IKCA 1BLNB 1RUPH 4S1DC 3TV3L 1NFDE 1R0AH 1NEZA 3DRTB 3SE3C 2XZQH 1V7NH 3LIZL 3FOLB 4MCYB 1D7FA 4P48A 3O3BA 5C70A 5KW9L 2P4AB 4P2OA 4C55A 4ZQKA 4NFDA 3S88L 4JDVA 3QPXL 4XGZB 4ZYKA 1EEZA 2HVKA 4S1RH 4MD4B 4NO3B 3S36L 3SCMB 4PY8J 4RQQB 2HMIC 1LO4L 2QHRL 1A3QA 1YMMD 4PJAB 1H8NA 2DWEA 5D7SH 1B2WH 5F3BA 4Q9RL 3KYNB 1CFSA 1CFQB 1N5YL 3C2AH 4ONOA 3IAQA 4NRYB 4AENA 3HG1A 5J7CC 3QUZD 4NQVA 4DKFH 4OD3L 2IBZX 2CIIA 2EDDA 3OKEA 3RVVC 3VFUB 3CX5J 2X1XR 4AH2B 4R3SA 1DUYB 3MQIA 2DI7A 3HUJF 5JW4N 3QG7H 1G6VK 4U6YA 4RA0C 4RX4A 1RZFH 1EFQA 1U3HA 5EB9A 4RGNC 4LQFH 1HINL 4PY7B 4QF1A 3AREA 3ME0A 3QHFH 1YMHB 1CFVH 1I9RL 2BJML 5DWUL 4L8DB 3IYLW 3BOVA 5A40E 3D6GA 3NACH 5LGHH 1E28B 3G6JA 4FTVD 3QZWB 2E9JA 3N9GH 1OY3B 5KVFH 3D0VA 1D6EA 3PGFL 3BQUC 2EDYA 4YE4L 3HC3L 4UU9B 4DCQA 1AJ7L 1S9VA 1AGCB 1MCSA 4HS3A 1EFXB 2D7PA 4FABL 2UVEA 2HWZL 3OKNA 4HUXB 2YSSB 5EUKB 4TOYL 2C3VA 4JFFB 4HC1L 1U3HC 5EG6C 4ERSH 5SWQB 1BQLH 2XN9D 3DXAB 1QFHA 5FOJA 1OT1A 3BQUD 4Q9QL 2HLFD 2P48B 5C0EB 1S78D 4KXZH 1BIIB 3CSYA 1C7TA 4JO2L 3BISA 5C1MB 3O6FD 4Y88A 1MREH 1ACYL 4HIXH 3FT2A 1NGXA 2JK5A 2IBBA 4PP1C 3KDMB 3GSUA 3LB6C 2SEBB 1U91A 4G5ZH 5C08A 5JHDB 1JHKH 4JFDA 2VKWA 3OKKB 4MGXA 5DJ8B 1U93B 4Y5VA 2CMRH 3RVXC 1IKFL 4MX7B 1TVBA 5CEYA 1OAKL 1KXQE 2BC4A 2VDML 3KPNB 3OPZL 3I6KB 3QCVH 5IW3A 4JGUA 1JFQL 2A6IB 3K0WA 4DUWA 4KUZL 5C7XH 5CJXC 3LHPH 3LKPB 5IFHL 2F8XC 5FM5M 2VLKB 4M1CD 2VXVL 1A3RL 3KJ4B 4JFEB 5JTWA 4KI1A 1MHEB 2NNAB 3QEUB 4WEMB 4ZDHB 4NNXB 4NQXB 4ELKA 1EX0A 4ZSOB 5C0CE 2V9RA 4PG9B 3TT1H 2G5BB 1T89C 2AJSH 1A7PH 3U79A 2BXZA 1VB9A 1U0QA 3TJHD 3GSOA 2HH0L 1V7ML 5B38B 4LRNL 4DGIL 4IOSD 1RJLA 3HE7A 3FCTA 4J3WA 1S9WB 5T1MA 1PG7W 3K74B 2A9MH 4LIQE 3SKJH 5EC2A 3OMZA 5JMRA 1K4DB 2MQ0A 5CJOH 1U58B 2G9HA 3IS1X 1ZEAH 3BD4A 4L3CB 4NRZB 2ADJB 4PJGE 3TJHC 3M45A 1UWEH 3KLAA 3FO1B 4OFYD 3UTOA 4TTDC 4KMTH 1IM3A 4Y4HB 1MNUH 3VI4E 4PY8I 3O41A 1OW0C 1N0XL 2V5RA 3DURA 5DD3L 4HUXA 5AYQA 2VUYA 3U0TA 1XF1A 1QFUH 2Z31C 3ZT6A 4MNQD 4OLEA 5L6YH 4EI6A 4NKMA 5EU6D 2QQLL 4FN0A 1TITA 5AZ2H 4B7IA 1M7IA 5B22A 4OZ4A 3U0WL 3MNVB 1G6RL 4YHIA 5C07E 5A3ID 3QQNA 1B88A 2R1XA 1VFAB 3D2UA 1WGOA 3KDMA 4HX1A 3RZCC 1CD1B 1RHHA 5LGJB 2B2XH 4PJ9B 4LOUC 1IEAA 3I6LE 4E41A 1D6VL 1HXMA 3WIFA 1HKLL 3TIDB 4XWGL 1ED3A 1KN4L 5F3HA 4WDIB 1LK3H 15C8H 3U9UA 2ADGB 1VPOH 4HZLA 1I1AB 5E2UL 1MJJB 5EZJA 4NQDA 2DLGA 3NCJH 3U48A 2A1WH 1CDIA 4WW2C 1BP3B 2DQGH 2MPAL 5C0NC 1D5BA 1I9EA 5ICYB 3EDFA 5FYKD 2Q7YB 2EEAA 4JHAH 4KAQH 4KDWA 1I8IB 5GRUL 3MA7B 3THMH 1ZHNB 3RUGE 2EE3A 4DFIA 4I48A 5IJKC 1AP2B 4QOKE 4ZUSB 4HG4K 5BV7B 4H0HB 2EICA 2FD6H 3EO9L 5JORB 5ITBH 1JTTA 1F97A 3DMMD 1Z2KA 4WGWB 3IB4A 2PYED 4HFWA 4IS6B 5CP7B 1A47A 2Q8BL 1ZGLA 1UWGL 4X7EC 1BFOA 3M8OH 4KH2A 3MV7E 2IPUK 1T4KB 1A6TB 3VGHA 3BPNC 4R26H 4XBEH 2JIXD 2YS4A 3C09B 5D1QC 3P0GB 1EVTC 4ZUUB 3HZYA 5CEZE 1EFXD 1NKOA 4Y5YA 1IGYB 1HHKA 4XCFH 5KSAA 3EOBB 4N68A 5GJTH 2H41A 4AQ1B 1CBVH 5F6HJ 3O2DH 4PJ7F 4LLDB 5F9WC 4Y4FA 3EYUL 1WCQA 4IOFD 5C0DA 4YDLB 2ZOKA 3IXTB 1X5JA 1LGVA 3PV6B 1LE9A 3CZFA 5D2NB 4RGMC 4UINH 5FCUL 4YC2C 1QP1A 4DOHE 1OTTD 1SBBA 5CUSL 4QHLA 3QEGL 3ARFA 1SEQH 3O4LB 3T09A 5DJDA 2QJDA 3VXRD 5CJBA 5D8JH 1VFBA 2B4CH 4GBXB 2X4QA 3S36X 3ROOA 2EYTA 1N59A 2VL4A 3C08L 4W81A 1WZ1L 2YEZA 4LARL 5CEZL 3QCTH 2BY1A 1XFPA 3RWGA 4LKXA 3PWVA 1CWVA 4FFVC 3MLVH 2Q8AH 2XA8H 2CDFB 4F7CB 5MHSD 3VFPA 4QYOB 3JXAA 5D1QA 3BKJH 4NOBA 5J11C 4PTTB 1Z0MA 3AS3A 4HKBB 5K9OB 1B90A 5F1NB 5KSVA 3P77B 1F4XH 3QSKB 4WO4C 4L8CB 4LLQB 2A0LD 2MNUA 3W9EB 5TE7H 4LCWE 1W72L 1BD2E 1BWWA 2X4PB 3WFBH 1FE8H 3SGJA 4GAJL 2G2RB 3CFCH 1BF2A 1C16B 4IRJD 3IDNB 4EOWH 1B6DA 5L2JA 3ULVL 1UZ6F 1FORH 2FX7H 1WSST 4TUOB 5HYJD 1PDKA 5HHPA 2YA1A 5CCKL 1MFBL 3HS0A 1OP5H 5KSUB 2EXYC 3V4UL 4OD1L 4YHNA 3G5VB 4M61B 3CJJA 4S0TD 1S7QA 1FVDA 3JV6B 5SX5K 3QXDB 4M8QB 4LSUL 3WLWD 4AMKL 5GGVL 2QL1A 2D7NA 4U6HA 3MBXH 4ZUUA 2IH1B 4BYHA 5K59E 1CFNB 4JO4L 2NLJB 4WHYG 3LN5A 1S7UA 5AWNL 1CBVL 2AJ3B 5GGVH 1UM6L 4GS7B 3H7BA 4MNQB 2L7UA 4LSUH 1MJUH 4WU7B 1LDPL 4LLVA 2G60L 5H2BA 2NW3A 3U4BL 4XC3L 4BKLB 2YD1A 3IJHB 3CFBA 5J11B 3DVNB 1FSKC 4JO1L 4D0BA 4GS7C