5MI0B

A thermally stabilised version of plasmodium falciparum rh5
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
VKLVESGGGVVQPGGSRKLSCAASGFTFSDYGMAWVRQAPGKGPEWVTFISNMAYSIYYADTVTGRFTISRENAKNTLHLEMSSLRSEDTAMYYCTRAIFDYAGYWYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reticulocyte binding-like protein 5,Reticulocyte binding pro
publication title One-step design of a stable variant of the malaria invasion protein RH5 for use as a vaccine immunogen.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Immune system
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2016-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5mi0B01
5I19H 5JHDE 4NSKA 3LS5H 5HD8D 1A6AB 2V7HA 5TGBA 1BD2D 1EJ6A 1I9EA 1FQ9C 1S9XA 1GXEA 3LKRA 4JHAL 1YEHH 2RFXA 4K7PL 3O6ML 5D72L 5F88B 2AQ3A 4NZTL 2LU7A 4C54A 3JWDH 3WXVH 1KTLB 3UBXI 3U0WL 4NQED 2X42A 3QUYD 1JGVH 1FAIL 4AIOA 5H2BA 5I8EA 3OX8A 1FCCA 3LN5A 1JCKA 1TVBA 1KENH 4MAYB 4PLJD 2G5RA 1AGEA 3Q48A 3U0PA 3H3PH 5SWSA 1OWRM 4ELKA 3SE8L 5F93C 3GJFA 4OLZL 1I1YB 3MV7E 1N8ZA 3RVXC 2BVYA 4GAJH 5GSRB 1A1NB 2A6JB 4BFEA 5M94B 4LCWE 1FO0A 4KZDH 4Y7MA 4HMEA 1OP5H 1BLNA 1P4LB 1GZQB 1RMFL 1BJMA 2BNUA 2MMXA 3PP4L 3WLWD 1KACB 5I2IB 4YHZH 4XX1G 3ARBB 3K2MC 5CZVL 4MNQE 4WHTB 3CX5K 3VXQB 4N0YL 5DHXB 3HLAB 3PHQA 1U8LB 5DGRA 4PJDF 3MRCA 4R0LC 2WLZA 6FABH 4GKSA 4KDTC 5DS8B 4PJDE 1OARL 1ZSDA 1WBXA 3E2HB 3C08L 5DQJB 4XP1H 4YBQC 1A6VH 4JPIB 4XGZB 3VRIB 3VI3F 4R96A 5IMKB 4QTHB 2XICA 4RMVA 4IDJL 1AQKL 3ZTJH 4NPYB 4R7NB 4FQ2H 4EI5A 3NCJL 3VI3E 1Q9OB 3FQWA 1IGCL 4JDVA 2X41A 4HKZB 4HIJA 1IAIH 2DI8A 1SVZA 1KLUA 3RTQA 1XGPB 3TNMB 2CKBB 4XMKH 5HBBA 1T7YA 3EBAA 1E4WH 5J13B 2GJZA 4QHMA 2JIXD 2AK4A 3SE3C 1PKQA 4OLUL 2IWGA 4K3DL 1WC7B 3CVHL 1R3JA 4JRYB 3GSVA 3O6KL 4H26A 3Q3GA 3FFDB 3SDCC 3SGKA 4UOJA 1U3HA 1F6AA 2JELH 3V52L 3O8XC 3TLRA 4MD5B 4ZPVB 2VR4A 2APVA 4P3WA 3VMPA 3BQUD 3QXTA 2YD3A 4NKOA 3HI1B 3HC0B 3KLAB 3NACH 2HT2C 1KLFA 1DUYA 1S7UB 1TJHH 2X9XA 1YY8B 1WV7T 4YXKL 4CL7A 1RJLA 2DDQH 4H88H 1J8KA 3PWUB 4RAUA 5IR1B 3AM8C 4UDUA 3L7EA 5HYIA 4ODVL 2HFEA 4LSUL 1M71B 1BVKA 1MCOH 5I66A 4UILH 3R8QA 4QRSB 3T3PF 2WIIA 4GMTL 5I18L 5C0AD 2QQNL 5J1SC 3KXFA 3QEHA 4TYUA 4HC1L 3D39B 3MRFB 4Z6AT 4JN2A 1NLDH 4FFYL 4LVHC 1RULH 3RNKA 2GK2A 3KYKH 3HNVL 1BFTA 3L3OB 4DKFH 2H41A 3UC0L 3EO9L 1X5GA 4H1LH 5D4QA 5FGBA 3FB6B 2A83B 3TPUA 3SOBH 5FGCE 2GW5A 3TT3H 2XZCL 1S8DB 1VGEH 2ZJSH 3A67L 4FQXC 3LZFH 1IAMA 2AXJA 5E94B 2X05A 3U46A 1BAFL 3DYMA 3S36X 4TNWK 1FPTH 1IT9L 1FNEB 4KKBC 5F88A 1W72H 3C6LB 4P23A 1WSST 2BNQD 4KK5D 3MC0A 4N9OB 2DBJA 1UWXH 4YFDB 2OJZH 2YD4A 3PQYE 1J12A 5GGRY 4CN1A 1S78C 5CJXC 1YEIL 1RUQH 5D1ZA 4ZUVB 2B4CC 4TUJA 4E41A 2R56H 3T04D 2VABB 1MFAL 1CLOL 4K23H 3DJ9A 5T5NF 2ZPKL 2GT9A 1I1YA 3VXRB 4DCQA 3WL9B 5GSRA 1C08A 1J1PH 2OLDA 1WFOA 4GMSH 1A1NA 1KB5B 3F62A 3SGJA 5GS0D 5DVLA 3I6LE 2L7UA 1A5FH 1MCKA 4WW2A 4X99B 2DLFH 3JV4B 4IIQB 3DV4B 2YKLH 1HK6A 1B0GB 2IAMC 5HHOD 3D39E 2HFFB 1FAKT 4LRIC 3RPIB 3HNSH 4YHIA 5LKNA 4EXKA 3HE7C 4KI5D 1FH5L 1M4KA 3BWAB 5TE7L 5EIIA 2IFFH 4XAWH 1ETZB 4OGXL 4M6ML 3LPFA 1F02I 5FYKL 4MDJB 1L9NA 4O9HH 5DD5L 5HYQB 5DQJA 2WUBL 3PWJB 4JO3H 3NFNA 4JPIA 1SYVA 3VRIA 3O0RL 4NZUH 4Y1AA 4IJ3B 5AYUH 4CBPA 1GC1H 5IMKA 1DQML 3ZE1F 4UQ2A 4WFGD 4R7NA 1F13A 2UV3A 2XZAL 1ZLWH 1MHHA 1IEBB 4HKZA 3ZE1E 1DBAL 1YJDL 3NH7L 3QHZL 1GGCL 2FX8H 2Q7YB 3D48R 3X13A 3IXTB 3T0ED 3MRGB 5CKAA 1ZLUH 4N5UA 5J8OA 5IB3A 1IGYB 1L6ZA 4P2RB 5CINH 1UWGL 2R4SL 5K9JH 4WEUD 1I1AB 3EKCA 1AI1L 1GSMA 4Q2ZB 4OFVA 4XMLH 4TSBH 1QQDB 2DICA 4XP6L 3W11D 4YZFF 5IB2B 2A38A 2R23A 1A3QA 4HDIA 4HG4J 5DT1L 1DL7H 4NO0B 3HI1A 3KLAA 2W9EH 1D5ZB 3NAAL 3V6OE 2VIRB 5IR1A 3ZSSA 4MAYC 5FO8B 4OIBA 2DWEB 3BKCL 3X11A 3PXJA 2DLHA 5DDHB 1D5XB 4W4OA 3VWKA 5ALBL 4JPWH 4FP8L 4KY1H 3N85H 2BVQB 5JA8B 3L1OL 4EKXA 1SVCP 4PRHE 4XBGB 5E6IB 5AD0B 4NNPL 4ZOCA 3L3OA 5CWSB 5D96B 5J3HC 3P73B 1OD9A 1FNAA 1F58H 3HMXH 2HN7A 1R3IL 4MQ7B 3EOTH 3ULUF 2JCCE 3I02B 5CIPH 1JZ8A 5FYLH 3SJVD 4JM2C 4XAKD 4EBQL 5FYJE 3WKMH 3TJEL 2XTJD 5C0BB 4HPYH 2Q86B 3ULUE 4F33B 4U1MA 3RIFF 5D7LA 3SKOB 5GRWA 1R3HB 5E94A 2B2XL 4R26H 3RVWC 1ZVSB 2FL5B 4XXDA 3PF2A 4PJ9D 1FNEA 4AENB 3T4YB 3THMH 2AXFB 4KAQL 4N68A 2IPKB 4I18B 4HS3A 2ZOKA 4ORZC 2MTPA 2DB8A 3DMMB 3E8UH 2R9HC 5GIRA 2J5LB 2VLKB 4OZIB 5DVNA 1IC7L 2A6KB 2BVOB 3EHBD 4GO6B 3UJJH 4ZUVA 3GDBA 4JCMA 4MJ6A 4GH7B 3HFMH 1KCVL 2BK8A 4WUUA 1LO4H 3MLVH 3VFPB 5J13C 3QUML 3WFDL 1HN1A 1RUPH 5A3IC 3MCG1 2DQDH 1MCPH 2XOTA 1MRFL 1OCWH 4FRWA 4HK0B 5JA9A 5JR1H 2GHWB 3VXRA 5L7XL 3UCRA 4L3EE 4P9HL 3K46A 3GB7B 4EI6A 5IM7B 4IRJD 3BEWA 1TMCB 1MNUH 4ALAH 3MREB 4X99A 2Z8WC 4LAJH 4G42A 3WNLA 5DUPL 3LS4H 5IBLD 1ORQB 4LNVA 4HWEL 2NW3B 4J3TA 4LFHG 2OL3L 4ZQKA 1ZMYA 2D7TL 4WTZA 3FQUA 5EA0H 2B0SL 4K94H 5IEHB 3O2VL 4FQIH 3RPIA 3R4DA 4XRCB 5IF0A 4LLMB 1OP3H 1CQYA 4PGEA 1BF2A 4KKCC 2AV1A 2ICWJ 3IAQA 3PWJA 3LKNB 4Z7WA 1S3KH 3GBNH 3DX8A 2AV7A 3I84A 5I76B 1TNMA 5AZEH 1W0WB 2VQUA 5IHUH 1BFOB 2VDMH 4Z78B 4GFTB 4U1NA 4S1SH 1WZLA 4CMMA 2Q7YA 1CD1A 5FO7A 4OZIF 2OK0H 5GISH 4M93B 4PRDB 3MRGA 3WD5H 3R0MA 5DK2A 1OM3L 1R3KB 2NY2D 2FECI 1IGYA 5J9PA 4NJAL 3BPLC 4GQPH 2J6EA 2AP2A 2EC8A 1EZVX 2XZQH 4UV7L 2F5AH 3HR6A 4QXWA 3KPMB 3C6LC 5KJRL 3GRWA 2IQ9H 4JB9H 5EUOB 4Q2ZA 2HT3C 3B9AA 1JHLH 4Z0BH 3O2DH 2FIKB 1VCAA 3OJDA 4N0UA 2PYEA 3GO1H 5E9DD 4D9QE 4M7JH 3QDJD 4XZUA 2HTKC 1WZ1H 4Z7UF 2IALA 4OZHA 1Z3GH 1XCQB 4APQB 2VIRA 1EUUA 1JYVA 5L8KB 5IT2H 4HPOL 4Z7UE 4ZNEA 5FO8A 3CDFA 1BOGB 4HXBH 1GIGL 2NW2B 1MHCB 3WIFA 4J2XA 1DCLA 1XT5A 4U3HA 4Z7NE 4Y19B 3H3BC 1VPOH 1QBAA 2D0HA 3GMMB 3DBXA 3BZDA 3V6OC 2V5MA 3KPSA 5E6IA 1EEUA 4J6RH 1AGBA 1S5HB 3KYMB 3DTXA 2EYTB 4O2EA 2NX5B 4F3FB 3VWJB 5ACZA 5EBWB 3P73A 4LEXL 4BSJA 1U91A 3F7VA 2M8XA 2FEEI 4IIQC 2DKUA 2DYPB 1IQDA 4HIHB 4XCYA 1AXIB 1IQWL 3D0LB 4MNGB 4XNXH 1L6XA 2YD5A 1ZLSH 1QSEE 3HHRB 3FONB 4ODWA 15C8L 2J4WH 2OP4L 4BZ2H 1ZVSA 2AJUH 5JW4R 3QWRA 3BYYA 5DHVH 3MCKB 4AENA 4X80L 2AXFA 2C3WA 1EV2E 4PJCA 5D70H 4JG0L 1FZOA 3OKDB 1JWUA 2Z91B 3ULUC 3VXSD 4OCWH 1EHAA 5DF0A 3P4OB 3OR6B 3BD4A 5TDPB 5C0GB 4IJ3C 1OSZB 2VLKA 1JYWA 4HG4K 2AKRB 4XCNA 5EUOF 3VXOB 4IRSD 1OTTC 4YQXH 2I27N 3RNQB 1G7LB 2YPVL 3QO1B 2AS5M 4FN0A 5IB5B 5T3ZL 3EGSB 4Y88A 5T3XE 3IDJB 4PJHB 5AZ2H 3BXNB 3AREA 2PO6B 3LN4A 2OZ4H 5KSAD 4D8PB 1QLEL 3GB7A 4JFDB 1I1AC 5CP3H 2YOCA 4DW2H 5IM7A 5HHXL 1MIML 5IK3B 1QR4A 3MREA 4PJBA 1X5KA 4PY7A 1UKTA 4CRPA 1ORQA 4HH9B 3VXUD 1UJ3B 3MV8B 4L9LC 4U7KA 2NW3A 1FP5A 2ED8A 4ZS7L 1KLGA 5TJWK 1NGQL 3ILQD 4RQQA 4MB5A 5F7EH 5JO5B 2HG5B 3O4LD 1DP0A 1MCQA 4RA3A 5IEHA 1A7PL 2NX5E 3WYRA 2FH6A 4XRCA 1HOCB 3MLYL 2C3XA 5DWUH 5ENWA 5HGGS 1YMMA 3D5OF 4Y5YC 4XX1E 4WI6A 1N6QL 4JAMB 3S5LB 3I85A 2JKXA 2WMPA 1K5NB 3ULVF 5ICZA 4QRRA 1E6JL 2BDNH 3VCLB 3UAJC 4JRWA 5FEBA 5LVEA 4UT9H 1CZ8H 5DK0A 5DQ9A 2P44B 3BAEH 4ONFL 5I76A 1BM3L 3ULVE 4Z7VF 4YK4B 1BFOA 1IGFH 1OAUL 5KVGL 2GTWA 4PRIA 4UBDD 4Z7VE 4HCRH 4P2QB 1XIWC 3P0VL 4U0RB 5HI4D 5KW9L 2ZSWB 4M7KH 2EEDA 4E42B 3DX7A 4S1DC 4KROB 3NPSC 3IFLH 1HQ4B 3V0AC 1B3JA 4I4WB 3EW3B 2BSRB 2WSKA 3DETC 4KXZI 4XPTL 3KPMA 2FATL 1SHMA 4NDMA 4I18C 3GNMH 4OFIA 4P5MB 1B0RB 4KKLC 1JNHA 1WQVT 2R4RL 1Q72H 2QSCL 3DMMC 5SWZB 4JG1H 4EN3B 2PTTB 3JUYA 5BV7H 2X44D 2VH5L 3BP4A 2PETA 1KEMH 4V2CB 1T7WA 1JK8A 5J57B 1XCQA 2JB5L 3BUYA 3V7MA 5JLZB 4APQA 1T2QL 4KMLB 1RK0A 4OM0L 4NRZB 2C4FT 2P5ED 2NW2A 4N8PA 1C7TA 4TQEL 4Y19A 2E5EA 4IRZL 3QR2A 4I3GA 4LF3A 5E99L 5INCB 3MBED 3SGDH 4G7YH 3R8BB 1PY4A 1SBSH 5GGTH 1AHWA 1S5HA 3FB8B 4D0BA 4IMKC 4XNUL 1T5XB 1DSFL 4I0PD 1GZPB 4H25B 5EBWA 5T33H 5FUZH 3MJ9A 5DJZB 4Q0XH 5ESQA 3RWJA 5D1XD 2DYPA 4M3KB 3D0LA 2F5BH 4MNGA 1MWAL 2ZCHL 2UWEE 1N5YL 4LP5A 5JUEH 2O5ZL 3JZ7A 4RGND 2HT4D 3X3FH 3A0OA 4JKPL 2M1KA 4RZCA 3EZ8A 2CH8A 1S7RB 1Z6JT 4OFKA 2BNRD 4GBXC 1YC7A 3ROLA 4NQTA 2WLYA 1RZKL 3HB3D 4JFFE 2RR3A 4TTDD 4P2QE 4M61B 3OR6A 1FG2A 5TDPA 3SE9H 3RQ3A 1VKXA 2OR9L 1FNSH 2NTSP 3K0WA 2AKRA 4Y5XB 4HUWA 5J89A 35C8H 2YPLA 3RNQA 4MWFB 1G7LA 2Z0BA 4JE4B 4W70A 4BSWA 3ECBB 1A7RH 5FF6A 3M07A 4A6YL 5J6GA 3NABL 2WBJB 2X4QA 3OXRB 1U58A 2VUOA 4PJHA 2PKDA 4FA8A 3BXNA 1I9IH 3C5JB 1X5YA 3O2WH 1ZEAH 2I60L 2VLMD 4AG4L 1PBYA 1TLKA 1BVLB 4JFDA 1QBBA 4UU9B 2V2TB 4D94A 1YEKH 4PB9L 2YRPA 1MJ8H 1R5IB 3BJLA 1JGEB 5ESAB 5DMIL 2XY2A 4YXHH 1CDBA 3PGCA 1BQHA 1YZZA 2W59A 4BQCA 2XKSA 3QXUA 3QXAA 1NL0H 3WS3B 2MWCA 4AEIH 2VXSL 4BQ9A 5B21A 1GAFL 1HILB 1TNNA 5IVOA 4FABH 1UKQA 3VRJB 1UENA 3A6CL 4LSTL 2V9QA 5CD5C 4WTZG 2MPAL 3VFNB 1KN4H 5EZLB 5C86A 5CBAA 4L1DA 3RHWF 5IW1A 4JAMA 3S5LA 4ZFZB 2NR6C 4YHPB 2EIZB 4X0KB 1QFUL 4ZD3L 3LQAL 1CD0A 1KEGL 4NM4H 2RAMA 4OCYL 4YHML 3OPZH 4HULB 5LGHL 4XH2A 3PDGA 4PJ5B 2JB6B 4YPJA 4I0KA 2ZSWA 3N9GH 4L8DB 4E42A 3MLWH 4M00A 2FHFA 5HPOA 4MHHG 3ULVC 1JGLH 4WFHD 1ZV5A 5SWSD 4XVSH 3KPQB 2XNAB 4HS6B 3D85D 4WIQA 4CN4A 3FO1B 3PWLB 2IH1B 2RGSA 4V2BA 4M6OL 3CK0H 3L6FA 3MRJB 1HINL 3BH8A 3FN0H 5IROA 5DRWB 1CYGA 1EO8H 1CGVA 4PJGB 5IESH 5SWZA 3W0WB 2PYFB 1XGUA 4EN3A 2PTTA 2C9AA 2XN9B 3H42H 4NO3B 4P2OA 4RGNE 4PJ7A 2IMNA 2HKFL 3GIZL 1UVQA 5JLZA 1SY6A 1I1RA 4XPGH 3B5GA 4HJGB 1VGKB 4QXUL 4JDTL 5DFWH 4MHHI 3UROR 3BD3A 5ACMA 4CADA 5B39B 2XQYG 3UTTB 2VDQH 4JM4H 3AB0B 1G0DA 3GEWB 5INCA 5E5RB 4LOUD 3EYVB 4OGAC 3FB8A 3LKPB 1GZPA 3QHTC 5K9KB 1U8QA 5EBLA 1AY1L 1BECA 4IDLA 3WFEL 2MNUA 4YUEH 4NRXA 4M1DH 4UINL 3QI9B 1UJ3C 2JJWA 4G6KL 1S7XA 1FZJB 2WW8A 3IDXL 5E2TL 2C3VB 3RZCA 2AEPL 3CFIC 2WQRA 2YWZA 5GGVY 3FB7B 2F74B 1OTUC 4ZUWA 2Z31C 1RZ8B 4AEHH 2Y36L 5I1GH 1U8KB 1YEFH 2AK4D 4NKDB 4F8QA 2AABL 2D31B 1J11A 5IMOB 4J8RB 4QXGL 1I85C 4RSVA 3WFCH 4ELME 2EZ0D 3QIUC 1BZQK 2Z8SA 2O5XL 1U3HD 1UACH 4M03A 3LV3B 4R7DA 1SM3L 4DJMA 4J12A 1DBKH 3T1WA 2YRLA 1HKFA 1HHIA 3TEUA 4DAGH 1QOKA 2CSPA 4UTBL 3ECBA 4HLJA 4YEEA 2ITCB 4HF5H 1T1WA 2Y7QA 3QUZB 3V5HB 3WXVL 4RX4A 4Y2OA 5L9DH 2B5IC 4KDVA 1MSPA 2G75A 5DI8B 3C5JA 4ZMAT 5GS0H 3TYGH 3OBAA 4UDTA 2XT1B 4I48A 1AE6H 1F6LL 5GRJH 4DKEL 5EIVA 2EYSB 4HGWA 1N7MH 4DEPC 3C5ZC 3FOMB 3KXFD 5L2KD 1JGEA 1CQKA 4FXLA 3VJ6B 5CJOH 5DYOA 2GITA 1RI8A 4OZ4B 2FJHA 4JFOB 4JVWA 3S37X 7FABH 2XWJA 2X4UA 1RUAH 1J8HB 3BGAA 4MYWB 3GMOA 3OKKA 1C16B 3VFNA 1AO7B 2VXVL 2XQBL 4NQXB 1J0HA 1A0QH 4LLDB 3VU2A 3ES6A 4HHAB 4WUKH 3FN9A 2FCBA 5C08A 4BH8A 3GK8L 5FOJA 4X0KA 3QXDB 1EA9C 4NN7C 4TVPD 4YHZL 4YEFA 3QRGH 1WTGT 1H5BB 1UC6A 4LCYB 4RFNC 3N1GC 4PJ5A 3H0TB 2GJ6A 2ZZUT 4ERSL 4YBHA 5D1ZD 4JO1H 4E41D 3DUHA 3JVGA 2FX7L 1IARB 2EDTA 4QKXB 5TQ0L 4F7CB 4I5BB 4XP1L 5E4IA 43CAB 5F1OB 3MCLH 3WIIH 2WINA 3FO1A 3P30H 3P4NA 2YBRB 4FQ2L 2HAZA 1CDYA 5BVJB 4MB3A 4X98B 5DRWA 1A7OH 3B5HA 4MA8H 4HIEB 3BO8B 4PJGA 1IAIL 2VZUA 3W0WA 3LAFA 1AXTH 5E8OB 3WFBH 4NO3A 3WKNA 1E4WL 2QR0A 3K2UH 3MRDB 4Y5XC 4S11A 3C8DA 4JGUA 4G6JH 5MENE 2W9LA 2CDFB 5SX4H 3ARBD 3HE6B 1KB9J 4CJ0A 1NAMH 3C9NA 1U3YA 2VKWA 4FNLH 5E7FA 5C8JB 4X7TB 1DBML 1EK3A 1MCEA 5DMGC 2WM0A 2JELL 2QKIB 1OGAB 4PUBL 3T0XA 3UTTA 2PXYA 5EZIL 1XGRA 3WUWB 4OGYH 4FFVC 1T66C 4ORGA 1VEOA 3EYVA 1CVRA 1IILE 3CFCL 3TC9A 1TJHL 4JANB 2E9IA 2DDQL 4H88L 1ZTXH 2P5WA 4JFEA 2FYYA 4LU5H 4LQFH 2DBLL 4PGDB 4WI7A 3VD4A 1IMHC 4Y1AD 5E4EB 3RGVB 5ICYB 3MTRA 2SEBA 2P47B 3L5WB 4LPXA 4KHTH 5DD0H 4YWGL 1QO3B 5D7JA 2VNCA 5H35A 1FFPB 2CDEA 5CMAB 4R97C 2R69H 4NQSB 1U8KA 4Q7DA 5HHPB 2VQ1A 5AUMB 3WUZA 1TJIL 4FQLH 5I6XB 3OWEA 4NGHH 3FFCA 4J8RA 4JRYD 2G5BB 3T0AA 5I1CL 2O61A 1OAYH 3ARUA 1VACB 3NZHH 4FZEH 3LV3A 3FCTB 2Z92A 3CVHB 5F89B 3ZHDA 4XNMB 2EH8L 1INEH 1TETH 1VGEL 3MLSH 5GHWL 2YXMA 1A02N 3PABA 5IHLB 1WFNA 5K33A 4GRWF 3M8OH 3VXNA 4LARL 1NMCB 3SQOL 4UV4H 1MVUA 2FR4B 4QRPE 1LNUA 2ITCA 4Y16B 4JN1H 3HNTL 5JOPE 1W72L 4GRWE 2DWDB 1S7QB 5KS9B 1E4JA 5DI8A 2IF7A 3B9KC 3T0VA 4HMDA 4JLRA 3RA7H 3WSQH 1MEXH 3DSFH 3VWKD 5I1AB 1I1CA 3BMVA 4JQIL 2VR9A 4G8FA 4WHDA 1DZBA 1XMWA 4DVBA 1KELL 1ZANH 3RWIB 4R8WL 3MACL 4QWWD 3MLTA 4N1HB 5DEGA 4BFGA 4O5LL 4Y4HB 3C09B 1CXLA 4E41E 2HP4A 5BVPL 3DRQB 1Q1JL 1NC4A 1EEZA 4BM7A 4GW1A 2R2EA 5C2UB 2VDLH 4YHOH 1YEGH 1Q94B 2YD2A 4PJEB 4G8GB 1BQHG 4ODBD 1J8HA 1TZHA 1J1PL 1F4YH 4GMSL 5C70A 5B8CA 3V5DB 1WGOA 1C16A 5D7LD 1N6VA 1C12B 4NWUL 4CU8A 1U8IB 3L95A 5J12C 3OHXB 4EUPA 4D9RE 4HHAA 3V79C 5FYKU 4OBSA 4U1LB 2E27L 3BD5A 3VFMB 3QXDA 5FB8B 3AU1B 1V8HA 3MRNA 4L8BB 4HT1L 2NYYC 2DLGA 3ZSTA 3IDGA 1FYTA 1C5BL 4FZ8H 1D7FA 3S5LG 1UXWA 5E1HB 1H5BA 1LO2H 1N59B 4LCYA 1G9NL 5E00B 5EZOH 3BPNB 3OF6A 1VADB 5JDSB 4XP5H 3MR9B 4XAWL 1EAPA 1EHLL 2DIAA 4NN6C 1TJGH 4WUUD 4F7CA 2VQTA 3ZKQD 1N64H 1DN2A 2BSTA 4O9HL 3H9ZA 1FSKB 2R2BB 1ZS8B 3IETA 1P5VA 2W65B 4JO3L 4W6XB 1NAKH 1JPGA 5F8QC 3GHEL 4NZUL 4R4FH 3LEVH 12E8L 4GSDH 4LMQE 2AEQH 4Y0GA 3VXRD 4Y1AE 4O02H 5KS9F 3TESA 5F6HJ 2ESVB 4OGZA 4XVJH 5BVJA 3BO8A 1U8OB 3ETBF 2C7UA 1CDUA 3JWOH 5E8OA 1LP9A 5I73B 2OTPA 2Y4SA 1HHGA 2KUTA 5DC0A 2IANA 4DGVL 4WW1B 5CINL 5ITBH 3HE6A 5I75C 2DLEA 1DLHB 3DGCR 1SJHB 3MLRL 3U30C 4EI5C 2Z35A 3FAXA 5MEOB 1K4DB 1NBQA 3NVQA 3KPRE 1C1EL 4X7TA 3QUZC 3GSRB 5IBTL 1NFKA 1J0KA 4K8RL 1K3ZA 4QYOA 3RTQC 1OGAA 3U9PH 5TDNB 4PJEF 5LWYL 1HI6B 5HGDB 3WUWA 3GGWA 1OPGH 5JHLH 4LEOB 1TVDA 1NGXB 3Q2CA 4YGAB 3STLA 4K7FB 1CT8B 3SGKC 5C6WH 4PGDA 5HJ3B 1GVIA 1XF5A 3GSXA 2MQ3A 1BJ8A 5CEZE 3RGVA 5ICYA 4HFWB 3L5WA 4HKXB 2XXMB 4JPWL 1MF2H 3WS6A 1QO3A 4KY1L 1R0AL 5F71A 4NC0B 1FFPA 1MQKL 3BGFB 3G04A 3T2OA 4LRNH 4OF6A 1U93A 4JO4H 2HVJB 4UQ3B 1D5BA 1D5IH 4P2RD 2WUCH 5HHQB 1F58L 2G5BA 3QYCA 1JTTA 1RUKH 2EE3A 5FYLL 3FCTA 5T1KB 3CVHA 4XNMA 2YC1B 2HJFB 4C56E 4PREA 1TIUA 2PYED 4KVCH 3QFDB 3VDBA 4JZNB 5F3HA 3RIFK 2WNGA 5D7LE 1YEDB 4BKLB 1B9ZA 5I71B 3OL2A 5D2NB 2H32B 1KB9K 5HYSB 4LSDA 2OTUB 4XCCL 3L5IA 2EDRA 2J2ZA 1S7QA 5KS9A 3MOBL 1A14H 3HMWH 4FTVB 3AS3A 3RVTC 4WHYG 1OW0A 3WE6B 5I1AA 5TE4L 4HUXB 3QCVL 1U8PA 1CTNA 3KNBA 5IW6A 3OR7B 2LAGB 4EZMA 4ZG1A 1NCNA 3RUGA 3KPSD 4YPGA 1R5WB 5E6ID 3S88H 1X6NA 2H8PB 4P23C 4Y4HA 3HFML 4RGOH 4Z77B 2R1YB 1LO4L 4UUJB 1OAZH 3DRQA 3SGEI 1RUPL 5L6YH 4HKJB 1RD6A 2DQEH 1MCPL 3HZMB 4LCUB 1OCWL 2Q8BH 4G8GA 3PG2A 5SX5H 4FQPA 2Q76B 4JJ5B 1EJOH 5C0BD 5GZOC 2DAVA 4JZOA 3S97C 1G7PA 1FNFA 4PJAB 1FC2D 4D0CB 1JV5B 2FGWL 1JGDA 1UYWL 1M6OA 4F9LA 3UDWA 1JN6A 3VD3A 5HYJA 1MNUL 4LPUA 4XPFH 1HSBA 1NMBL 2MSPA 4L4VA 2QQKL 4NO2A 4P5TB 4U1LA 4K9EH 1ZT7A 3VFMA 5FB8A 3AU1A 3Q6GH 2VZ1A 2XZZA 4L8BA 2LAAA 1PG7H 5I1EL 4PJIB 2EO1A 5ADPH 3C8KA 1WCBB 3OJ2C 1JMXA 3SCMC 1ZKAA 5EA0L 4JY4B 2VLKD 2LV4A 4H5SA 3UO1L 4JFPA 4NQUA 2UZIH 1UZ6E 4G9DA 5CEXA 1TVHB 1EERB 3BIKB 4BFBD 5A16B 2X89A 5JXEA 2ARJB 2VLRB 3PV6B 3IKKA 2R2BA 4KGJA 4OLEA 2W65A 1EVTC 2P8PB 4OV5A 3GBNL 4Z7WE 3TA3B 5GZNC 1U3ZA 1QYGL 5HPMB 4IOIB 3RWCB 3ARED 3SDXB 5F7LB 3QUMB 2V2XB 2NZ9D 2OQJB 1YN6B 2ESVA 3TVMC 4I9WE 4UAOB 3RAJL 1MCWM 5FKPB 1FL3B 1KPRB 3MA7B 1QBLH 4RDQG 2IADA 1G7QB 3MJGX 1UQSB 5FK9B 3EJYD 3WD5L 1DVFB 1A1OA 4WWKB 1U8MA 2H2SC 1NMCC 2R0KH 4U1JA 1SJHA 2XZQL 1IGIH 1CDGA 2V2WA 4Y16C 3V0VA 4RISL 4P5KB 3QHFH 3RDTB 4A2LA 4JB9L 3G9AB 2OL3B 5TDNA 3Q6FB 2I9TB 3GO1L 2PYEE 4PJAF 5CZXD 1AXSB 4LEOA 3HMXA 1V7NL 4OZHE 5EOQL 3I9GL 2P24B 1DEEB 3C09C 4DUWA 5J4MA 3WLBA 5T1LB 3WFHB 3TYFB 4GW4A 4DKDC 1ZVHA 5BXFA 2FX9L 4HKXA 4XI5D 1UCBL 1DQQA 1PDKA 4NN5C 3QDGB 4PJIF 1PZ5B 4PV8A 3ROOB 1ZHKB 5ANMB 1F3JA 4TNVF 2AGJH 1AJ7H 1MCJA 3MGTB 2W9DH 2IBBA 3KPSE 4J6RL 4G9FB 4YHNA 4LVEA 1YNTA 3UTSB 1HH6B 1S5IH 5GS1B 4HUMB 3UJIL 4HW6A 3C60B 3FOLA 4JHWH 5C9JB 4TRPL 4RMSA 4XNXL 2YC1A 4TTGA 1HHHB 5TF0A 3QFDA 4JZNA 3FAWA 2J4WL 2MCG1 2FJFA 3LEYH 3L3IB 2WWMD 2H32A 4APQD 5M95B 2L7JA 3OKEB 4QY8B 1RZIB 5HYSA 4G8IA 4WI9A 5F7DA 5DEFB 3ULSB 4WDIA 5MHSD 1Q0YH 4PJCE 1WVZA 1P5UA 4ZAKB 5GGQH 3WE6A 3WXWH 4Y19D 3QWOB 1QRNA 1G7IA 4U1GC 3ME0A 3OR7A 1R6VA 3SDAC 1T6VN 3BP7A 1R5WA 4LQ1A 2EDQA 4KH2A 4YQXL 1RVFH 3HC4L 5GRXG 3VWJD 5IOPA 4DN3L 3PWPB 4AIXA 4UUJA 4WO4C 3ZTNL 1T03H 3DHMA 1CK0L 1QUNA 5MERB 4WTWA 3JV6B 5AZ2L 4MJIB 3HZMA 4GW5B 2DYPD 4P57B 1P7QA 5JW3H 4JJ5A 2X1OA 3V8CA 5C09B 2VUYA 3DPBA 2R2HB 2B4CL 1KFAL 4TULL 1KCUH 1MLBA 3J7HA 3TIEB 43C9A 2ZNXA 3QDGE 3T77B 1KC5L 4EUPG 4LHUA 3H8NA 4DGYL 1WZKA 5F1IB 1WCBA 3EOBB 1A2YA 2OMNA 1JGUL 1FGVL 5C71A 4JY4A 1T1ZA 1WITA 3OKNA 4LCIL 3UTSE 3TBYB 1JMZA 1NGZB 2YPLD 5DWUL 3T65B 4JFQB 4YIQB 4AK1A 1OLZA 3BIKA 1S7SA 3G6JB 4J4PC 5JXAH 1YMME 3GJFH 5IVZA 4NCC1 1GYAA 1A3LH 4Y4FB 4ZUUA 2VLRA 3PV6A 2RHEA 2P42B 4Z9KB 4QRRE 3TM6A 5I17B 3LKSB 4UT9L 2HJLB 1CZ8L 1IAKA 3SKUD 4LKCB 4K71B 3SDXA 1FO0H 2PO6D 4QOKB 3O2DA 2V2XA 1YN6A 4JFDD 3QIWB 1CDCA 2F58L 1KPRA 1S9VB 4U1KA 4J3WA 1INDL 4PRIE 4WI2A 1KUMA 4M7KL 1DVFA 4X4XB 1T22B 3MV8D 3BT2L 3RFZC 3IFLL 3KPLB 3WJJA 5F3BA 1WEJH 1JZ6A 3S35X 3U82B 1K8DA 1FZMB 3RVUC 1G7MA 5I71C 3M17B 1B4JH 4OLYH 2FHBA 4U1HA 4GRLA 4LL9A 3Q1SH 2A6IB 3GI8L 4P5KA 3RDTA 1CE6A 2RBLA 4ZFFA 2OL3A 1NEZA 1V3JA 3OSKA 3Q6FA 1IGJB 4KJQC 4X9HA 4FQJL 2CLVA 3O9WA 1Q72L 1ZHBB 2E6PA 1CIUA 1KG0A 1D9KA 1EFXA 4ZO8A 4GAYA 5BZDB 3S34H 4DN4H 4XMPH 1AIFA 2HH0L 5BS0A 1GGBH 2P24A 1MCSA 1N2RB 1R24B 3AROA 4ODTH 2OYPA 5K9QG 5T1LA 3GBLA 2FEDD 4YR6B 1K8IA 1PZ5A 2IMMA 4JCLA 3ROOA 3BP6A 1MAMH 3I2CH 2P8LA 2BOBA 5C6TL 5DHVA 4G7YL 3IKCA 5CHNA 5GJSL 3MA9H 3AAZB 4KROD 1SBSL 1XF4A 4MXVF 4G9FA 4GG6A 3P77A 1HH6A 4BQBA 3GMLB 3PDOA 3HUJA 4ETQB 2OXGA 5FUZL 4MXVE 4JJHA 1GJIA 1H3UA 4AT6B 4LDEB 2QADB 5C9JA 1N0XL 2X1PA 4ONHB 5K9QI 2FO4B 4LSRL 1HHHA 5DZNA 5SWZD 4EN3D 4LCCA 4DFHA 3ARFB 3KG5A 3EO1A 4PJFA 2OI9B 5DVKA 3X3FL 4P2OD 3WNOA 1RIVH 1TPXB 4QOKE 3CLFL 1A3RL 4QY8A 1NC2A 2KZWA 1OAKH 4RFEB 2VDOH 1VEPA 2NTFB 4Q58C 2OZ4A 3U7WH 4EDWH 3ARRA 1MREL 5CP3A 2YXFA 3L3KA 5DVMA 2X4PB 5IHBA 4MXQC 3H9HB 2H45A 4ISVB 5D9SA 1P7KA 1FNSL 3B2UC 3DX9B 3QULB 1PD6A 3DROB 4CNIA 4ODUB 4HKBB 2YPLE 5I1LA 3K3QA 4Y2DA 1DQLH 2GY7B 1A7RL 2NY6B 3KPPB 4XPAH 5GRVK 3UTQB 4P9HC 3MRLB 5EUKA 3BPCB 5MERA 1YEJH 3K4ZA 1DQDL 1PZUB 1HSAA 3F8UB 4WWKC 4JFXB 3B8YA 3DUUB 4HZLB 1ZEAL 1AGDA 3RZCD 4OD2A 1TITA 2VN7A 3EYSH 2EIBA 3FT3B 4X6BB 5C09A 1YQVH 5ITFB 4KQ3H 1YEKL 3SDYH 2MQCA 1MWAB 4O51A 1A6WH 1KGCE 4FXKA 4G8EB 4TVPH 3W5NA 4POZD 3GSNL 4KJYB 4LSQH 2GTZB 3PWNA 1BGXL 4TN9A 4WV1B 5HVWA 3VXPB 25C8L 2VDRL 2FGZA 3GMRB 1A6PA 5C0IB 3BPOB 1I8LC 2BSSB 2NY0C 1U8HB 3TWCL 1FHGA 3BRFA 3QIBC 4GS7B 4AJ0A 2EH7L 4PV9A 5BZWA 2CLRA 4FABL 4E0RB 4HCRA 5AAMA 4WY7H 2D2OA 3TBYA 1CL7L 3O81A 4XXCC 4IS6A 2NXYD 1T20A 4JFQA 1FVEB 4HLZG 1WAAA 3G6JA 5DSCB 1QLFB 4OCXL 2EXWC 5DJDA 3PP3H 4Y4FA 2WBJD 3VGGA 1ADQH 5E24E 3RHWK 2LVCA 3KPNA 1PY9A 3O6LH 4YDJB 4RX4D 3IXAB 2YN5A 3LKSA 4MCYB 3VG9B 1U42A 5C0CE 3U2SB 3QG7L 4A6YB 4NM4L 2ATKB 5GS1C 5I1KL 8FABA 5IWLC 1IAOB 3H7LA 3C60C 5MEQA 2JF1A 3MV9A 2IGFH 1S9VA 3HCVA 5BRZA 5LQBL 3N9GL 3ZDXF 3MLWL 1T22A 2QBWA 4KXZH 3HI5H 1JGLL 4B0MM 2AJYH 3CSYB 2ERJC 3M17A 4XHJD 2IBZY 1KN2H 4EVNA 2A6IA 1K6QH 2MFNA 4GQ9L 2E7CA 3AY4A 1GGUA 1OB1B 3CK0L 4XTRD 4HUUB 1IGJA 3N06B 4OQTA 2HJKA 2FD6L 5H8DA 5IESL 3QH3B 2E7LC 1WUNT 2BERA 4P46A 1MFBH 1S7VB 4TUOA 4D2NA 3GM0A 1AR1D 5C08D 4U1IB 3FB5A 1R24A 5DD3H 1F00I 1K9TA 2CKBH 2XRAH 1ZT4A 4YR6A 4PRNA 4ACPA 4PJ5D 1DDHB 4P3CL 2GJ6D 4JM4L 1IZJA 1PQZB 2GCYA 3QUYA 2PR4L 1EEQA 3S3PA 2UVEA 5F1NB 4PBVC 1RFDH 3I75A 1T89A 3DVGB 2HKHL 1RUMH 2WANA 4YUEL 1FFOB 4MJ5B 2F8OA 4HWNA 3E6FA 5KG9B 3U0TA 2YSSB 5E7BA 4D3CH 2Q6WA 1QSZA 1MIEH 1II4E 4ONHA 5JOEA 2EDLA 2A9MH 3W0WD 4X6CB 5F7NC 4KVNL 2XN9D 3LMJL 3KWWB 2QHRH 2YA1A 1CIDA 1CICA 1P4BH 5D6DA 2YHGA 4HK3N 3RWGA 2X10A 3SKJH 3NFPA 4FFZL 2NTFA 3WFCL 3D9AL 4LLWA 1SEQH 5FKAA 1UACL 4NNXB 4CW1B 5IFHH 4UTAH 3UTTD 1AD9A 4POUB 1DBKL 4G3YL 3DNKA 1ONQB 3CMOL 5C0FB 3DROA 4ODUA 4HKBA 4LIQE 1BZ9B 4XNYH 5FYJL 3CX2A 4MDIA 4LHJB 3UTQA 3MRLA 1T0PB 5JIHA 3ULUL 2P5WD 3BPCA 4JFED 1EHXA 4LASL 5L9DL 3QI9D 3BN9D 5IQ9B 5CCKL 4HZLA 1AE6L 1Z5LA 3GUTA 5JDJA 3FT3A 4X6BA 5LBSH 5E2WL 5ITFA 4F7PB 5D7JD 4EOWH 1N7ML 3CD4A 5C3LD 1KIQB 4YDVB 2ZCLL 4HJ0C 1SQ2N 1EGJH 2ZUTA 3ZE2F 2E7BA 1HEZB 4WV1A 5IB4B 3OKYA 5ERWA 3GMRA 4LLQB 2BSSA 3CFKB 5EU3A 3KYOB 4P9MH 3FFCD 4L8CB 1FN4A 3OAUH 1OGTB 1MFDH 1Y6MR 1XAUA 4X6EB 4N1EA 1JWMB 2G9HB 5HDQL 4PTTB 4YDIH 4E0RA 4WFED 1KJMB 4DGIH 4LHUG 5DJ8B 1GOFA 1AFVH 1Z9OA 4MCZB 4DZBB 1QG3A 4WEBH 4AMKL 3CVIH 5B22A 3RY6A 1VDGA 1A0QL 2H6PA 5INDB 3GMPB 2CIIA 2R0WH 1FNLA 1ZHNB 4PLOB 5C08E 4P49A 4YDLB 3OKOB 4MCYA 3QCUL 3U2SA 3WMSA 1O0VA 5L88L 32C2B 2ATKA 3U6RB 4CUCA 4XP9L 3PWVA 5ALCH 1RIUH 2P7TA 2QADC 4W81A 4LBEB 3TO4B 5E6ZA 1VENA 3EYQC 4M7LT 5AYQA 3ARFC 2DM7A 2YZ8A 3M1BB 2OI9C 4GXVH 4HIIB 3CSYA 1TPXC 4RDQF 1F4XH 1IC4L 4L4TB 3G6AA 3JSSA 4PP1D 3X3GH 4N1CA 2XA8H 3F12A 3BE1L 3P30L 1KULA 4NWTH 1J8HD 4XWGL 4HUUA 3GHBH 4RMWA 1AO7D 1T21B 5DJYA 5JPMB 3ARDB 2XG4A 1AXTL 1FBIH 2W0KA 5C92A 5HHNA 5J06A 5DMKA 1NEZG 3K2UL 4M8QA 4RAHA 3MPCA 2HWZL 2H2PC 5M7QA 3MMEB 3U48A 4RBPH 1MRCL 4BK4A 1FGNH 4WU7A 1FYTD 4FNLL 4M43H 1P84J 3OF6D 5IHZB 4BUHA 1DDHA 5E8PB 3VFGL 4JY5L 1PQZA 4HXAH 2HMIC 4QRUB 3ZHLA 4X7DC 2RQ8A 3SN6N 3GRWH 2X4OA 1TTUA 4YC2B 4KZEH 1FVCB 3EFFB 4EIGB 2K3TA 1JJUA 3P4MB 4LU5L 3SQBA 4JFEE 3LPWA 3I6GB 2WWKO 3BPOC 4GT7A 3HPLA 1JZ5A 2YSSA 4O2CA 1RZGB 3WIHH 2D4DA 3ARGA 4GS7C 1UB6B 3VD7A 3ILPB 2IPUG 1IC5H 4JFHD 1QFWM 4X6CA 2FLBT 1RZKC 1G7HB 1NBZB 4JPKL 5IJKA 2GYSA 1P9MA 2IAND 1J0IA 3QUXB 4F7EB 3PIQB 4FQLL 3HE6D 4PR5B 1NDMA 4GLRI 1HQRB 3QCTH 1UM5L 3VGDA 2X4SB 2LQRA 2K9UA 3FFCE 1T2XA 5GSVB 4MSWA 5FM4A 3KS0J 4X6FA 2I07A 2OMBA 3NZHL 1OGAD 1B88A 1IAIM 3VG9C 1WF5A 1TETL 3QQ9D 1A8JH 4WCYL 1ORSB 4Z7QF 5L0QC 2CLZB 3BEVB 2W0FB 5KAQF 3TIDB 1NH6A 1BZ9A 4XP4H 2CK0L 4Z7QE 1GHFL 2VISA 4UV4L 4BYHA 1KT2B 2GIYA 3BOVA 4EEEA 3HI6H 2XWBB 4EDXB 2X7LB 1YDPB 4E9LA 1INQA 4S10A 3VA6A 4H8WC 5CJ5A 3RGVD 5IKCB 1E6OH 5IQ9A 3BN3B 4U6XB 5EU5B 3RA7L 3S4SB 3RWHA 3DSFL 4XC1H 3MNZA 5EN2A 2VITB 5IJVB 1RURH 3RKDD 3DSNA 5ID1B 3QXWA 2EE2A 3F58H 1AGFB 5E8DL 5IB4A 5E5MA 2G2RB 5D2LA 5KVFH 3RL1B 4X5XB 4NKQB 1OGTA 2R0LL 4KKNA 3EDDA 2VDLL 3MRQA 3IJSA 2J8UA 4YHOL 3KYNB 3T0EA 1JWMA 3O3BA 2ZKHH 4P48A 4P4RA 1KJMA 1UCTA 2NY5H 3IT8D 4KU1A 2J88H 5T3XL 3GIVA 4KK6D 5E95B 4DZBA 3SE4A 5BJTB 3QNXB 4JRXB 1W0VA 3EFDL 2P1YA 3LQAC 3R0NA 1S7TB 5C07A 2GFBA 3EAKA 3QNYB 1JHKL 3CGTA 2VZTA 4R4NC 1NFIB 1ZHNA 5FDWA 1LO5A 1SJEA 4OD1L 2AJSL 1NMAH 1A4KA 4OF5A 3NN8A 3SY0A 1W72B 5B4MD 2C4XA 5ADOL 3BW9B 4IMLB 3IJYB 3NZ8B 5A43C 1NCWL 1NCBL 4LLYB 4NQDB 3I6KB 3TZVB 5A2JH 2ZUUA 2RB8A 2R1XA 2JK5B 4Q9QL 4Y4HD 1KTRL 3S96B 2HTLD 3M1BA 1YYMH 4NQCE 1N64L 1HH9A 1UM4H 1NAMA 5F9WB 3SPVB 3TFKD 3AXLB 4L4TA 3CH1A 3DV6B 1CXHA 5DD6A 5F7UA 1FE8L 3DO7B 2QJDA 4G8GD 3S6CA 1C5CH 3UZVB 3P0YL 3S98A 3LQZB 3GSUA 2X70A 4XVJL 3GKZA 3VFTB 2EICA 4L8SB 1DFBH 4JFHE 2EXYC 3U9UA 5HYJD 4QO1A 4NYLB 4N0CD 3MODL 1Q9LB 1ZHLB 2VJXA 3KJ6L 3ZL4H 5C0ND 3KPOA 5DFVD 3FT4B 1K4CB 2UYLB 4LAQL 2GKIA 1JF6A 1QNZL 1X5IA 4PJ9A 4LPYA 1OSPH 1MFEL 3K8MA 2GY5A 3FQNB 1JZ7A 5IHZA 4MZ3A 4I77L 1JUFB 1DUZA 1Y18B 5C0RH 5KSBB 1J86A 2GSGB 1MI5A 1YPZA 2A73A 2FWOB 4K3EH 5I74C 5JXED 5E8EB 1FVCA 1NSNH 1WBZB 3CUPB 1BREA 3P4MA 2AQ2A 1QSFB 3NBNA 1UADC 4KRPC 3ZE0F 1NFDB 2PXYC 3JTTB 2ESVD 3ILPA 1QBMH 5B38B 2XTLA 2I5YH 2ZSVA 1RIHH 3FO9B 4OQ1A 4I2XA 3QNZA 3CFJB 1MJ7H 1G7HA 1MVFA 1MJJB 2Y06L 4K7PX 1G6RL 3QUXA 3PIQA 2V5TA 3ARQA 2EE6A 4PR5A 3GSOA 4KMTH 4M9OA 5D7KD 2X4SA 1HXMA 2V17H 4F2MA 4YDLC 4O58L 5FV1L 4PJ8C 1MCHA 1FORL 2CLZA 3JWDC 3MLXH 3W9EB 3MJ9H 4PTUB 2B7DT 1L0XA 2JJUA 4OSUH 3VA2C 5EOCH 4OZFB 2V5RA 4Z0XA 1D6EB 1I1FB 5FYKD 3HMWL 4J3SA 3OQ3B 3S4SA 3CLEH 4WU5B 3LSOB 1JF1A 5IJVA 2Y23A 2JE8A 1G9MH 1A9BB 3A6BH 4HEPG 1RZ7H 3S88L 3RUGE 4WNQB 3IFOA 1JPTH 4XB7A 1T1XB 5J1AB 1FRGH 2F15A 4V1DB 5KSBF 2HA1A 1SYSB 4RGOL 5IQ7H 3RL1A 1K3IA 1OAZL 4Y5VC 3DI2B 5I30H 3SKMA 5IB1A 3WHXA 5ISZB 2MHAA 2DQEL 3C8HA 1MCRA 3HG1E 2UUDH 1PYWB 1XF3B 1CGTA 1W2KT 1KJVB 2OJEB 1EJOL 1X3DA 1NFDF 5CIPB 3ZKSD 1L7TH 4ODSL 1B90A 3LVEA 3WDIA 2ICWB 5GRVL 3QNXA 5GGRA 1IBGH 1E27B 3P3YA 2IBZX 4B50A 3KLHC 4G80B 4L4VE 4K3JL 3T08A 1AP2B 1NFIA 4FTVD 3NCYP 1KCSH 1N3NB 5IFAH 4YC2C 5D7SL 2Z8RA 4J1UB 4KUCF 4XVUD 1CFSA 1QRND 4IMLA 3IJYA 5KN5A 1ZAGA 4XBPA 2NY4B 3TZVA 4G6AD 4PG9A 5D93B 4CVWA 4UZGA 2UZIL 5ICXB 4AL8L 4LGPB 4TSAH 3SO5A 4FHBD 1RHHA 1IKFH 4ZFOA 3B2VH 3D25B 5IMMB 2KL6A 3IB4A 1EBPA 1B6UA 2GSIB 3SPVA 3L9RA 3DO3A 3AXLA 3GMNA 4OUUB 3RVVD 1NLBH 1YY9C 3DV6A 1I4FB 1P7QD 2GUOB 3DO7A 3VW3L 2YN3A 5KVMC 4G7VH 3QUKB 1F90H 2FB4L 1CGSH 3HRPA 2VXTH 2CUMA 3VGAC 3G6DH 5DGQA 4DQOH 2C5DC 1QBLL 3TT1L 4M1GL 1ZHLA 4P0DA 1JPFB 1F8TH 2A74A 4ZODA 5DJ2B 4P5TD 3BH9B 5DMYA 3MFGB 4LHUD 3OKMB 2R1WB 5DRXA 4X5WA 1IGIL 3KHQA 1CR9L 3V4VH 5TDOB 4BZ1H 4V1DE 4OIIL 4PBXA 4BQ8A 1Y18A 2EDNA 4BELD 1A21A 4YJZL 3D2UA 1KYOJ 4Q9RH 3T8XB 1XGYL 2ZCKH 1NQBA 4PB0L 1JNNL 1XZ0B 4N0RA 3LKOB 3U83A 2DRUA 3OB0K 2VLRD 3ZT5A 4FQCH 4DZ8A 3TA3D 5FYLE 1ZLVK 4JZJC 2AJZB 3OKLB 4FQQB 1WBYB 2CDGB 3JTTA 4YFLI 1SY6H 3IFNL 3QDME 5LCVH 5HGAB 3MXVL 1FJ1B 3HAEB 2AGJL 4N8CH 1J5OH 1NGWB 4R0LB 5KSAA 1DVFD 5I9QC 2IH3B 2XWTA 5IMLA 3CFDA 1A7QH 3QPXL 1QA9B 4TPRH 2YA0A 3FO0H 5F44A 2R0ZH 5FIEA 1UFUA 4GRLD 5EPMB 5FM5O 3RDTD 3WS6C 5GGSB 3UJTL 2VMFA 1DBBH 3O9WD 2LABA 2Y07H 3NIFE 5LG1A 1PAMA 4X9IA 3W9EA 1EFXD 1EUTA 4PTUA 3O45B 3MRHA 3D3VB 3LEYL 3MJ8B 3P2TA 1CWVA 1U2CA 4PY8I 5HI3D 5ESVB 2BRRL 1I1FA 1Q0YL 1T0NB 3DXAA 5T1LD 1MELA 1ND0B 5F9WC 2LTQB 2KQMA 1I3GH 1HDMA 3R1GH 4R2GD 4WU5A 3PGFL 2C1OB 3SDCB 3K80A 4BK5A 3WXWL 1A9EA 1FZKB 2J1KA 5GJTL 3MRPB 3W2DH 3HZYA 1A9BA 5DLMH 3U7YH 1RVFL 4OT1L 4N8VB 1MLCA 4G9FD 3MO1B 5F8RC 2KH2B 3ZKMC 3PNWB 3VD9A 2Z4QB 3OAZK 3GJEB 3OAYH 3SGEH 1E4XL 1NCAH 2NY1D 5ISZA 1F4WH 4AM0B 5JNYB 3W9DA 1PYWA 1UJTA 1CE1H 3MRKA 1CLZL 3FZUC 4WHYH 4NBYB 5JIPA 1OAQL 3ZDZF 4MMZC 3BGMA 5DRNA 1WWCA 2EDYA 4I3SH 3D87B 1G0XA 4U6VL 1KCUL 1BIIA 1E27A 4CDHA 3SHSA 2VC2H 4NHUA 1NC2D 2VTFA 4G43B 1P1ZA 4LLAA 4YLQT 5FUOL 2PW2B 1A4JA 1HWGB 1N3NA 1QVOB 2VLJB 4NUGH 4ZAKD 1TENA 3O3EB 3BX7C 2DQCL 5EU6B 3BIAX 1NCUA 3RU8H 1NGYA 2D7NA 2MCPH 2B1HH 3U7AA 4LSVL 2P8MA 5EFIA 2FBJH 4J3VA 5CSZA 4HWZA 5ICXA 4QF1B 2VDNH 5E2VH 5A40E 4KTEL 4MA3B 5IMMA 4AIZA 3PWPD 4P4KB 2GSIA 1IRAY 2AJXH 3MBEA 3L3JB 2G60L 4MJID 4IM8A 2VDPL 5D6CB 2VR5A 4S1QL 2F54B 1FO0L 5JHDB 5C09D 1VFBB 2EEBA 5L8LB 2QHLA 4W6YB 1BZ7B 1MUJA 3L3GA 4BFIB 2PW1A 4JFZL 5FM8A 1WFUA 2BY1A 4QRQA 3DRTA 4GXUM 1KJ3L 3ZKXC 5BO1L 4X4YB 2LFGA 2Y6SD 4OJFL 5H37G 1CU4H 3BH9A 4TUKL 1HHKA 3FMGH 4ODXB 1B4JL 4OLYL 4PFEA 4G5ZH 2D03H 1MCBA 3Q1SL 4LSSL 3WDHA 4OCSH 1L0YA 4LSPH 3AC0A 1Z9SA 5A2LH 3NA9H 4DOHE 3BP5B 1HZHL 5AAWA 2N4IA 1BX2B 3IS0X 3EUUA 4QGTA 3LKOA 3O3DB 4Y4FD 5EWIH 3QFJA 1RZJH 2BVPB 3WEXA 5J11B 4XPHH 1KNOB 3OJMB 5F6IC 5BS0E 2ORBH 2P43B 3EOAA 5ELIA 3MV7B 5T3ZD 3T0WA 1I7UB 2AJZA 3OKLA 1WBYA 2CDGA 2IAMB 3JXAA 2V6HA 5CUSH 5J0BA 1NGPH 3QIWD 2AI0H 2Q8AH 2FRGP 4LCWB 5EC2A 4ZFGH 3MV9D 5HGAA 1UA6L 3HAEA 4P2YA 2DM3A 4YE4H 4KJPC 2HLFC 3IFPA 3MRBA 1KJ2L 2IH3A 5IVXA 4UB0H 4MAUL 2B39A 1HE7A 1QA9A 4MNQB 3QRFM 2FEEL 4GUPB 1RJZA 2H3NB 1PX3A 3HUJE 3L7FA 3UBXG 1RHFA 4OF0A 4X8JA 3VG0H 4L9DA 4PIRF 2HFGL 3QEQB 4N0FA 2OTWA 3WN5B 3LH2H 2NLJB 4UOW0 2VXQL 1UGNA 1FFRA 4MXWL 1YNKH 1RZFH 2IQAB 4PJDB 1CF8H 1Q38A 4PRPB 4QHLB 1S7WA 3O45A 5D7IA 1QFWI 4KGLA 3FTGB 2NY4C 4P46D 5HHME 3ZKNC 3D3VA 1JRHH 3G5YB 4AEFA 1RIVL 2F54E 4HK3J 3MJ8A 5D1QB 2BHUA 4PRBA 4NHCH 1J0ZA 2NXZC 5FGRA 4MX7B 4KJWC 5ILTL 3SE3A 4JDZB 1F97A 4KK8C 5C0EB 1LEKA 5ETUA 5F9JB 1ZGLP 5DO2C 2IG2L 1GOHA 3SDCA 1HIMH 1JHTA 4ZXBB 1T04A 3O6FC 2NCMA 3FQTA 2VZOA 3O8XA 4M6AA 1P6FA 3SBWC 4ZUTB 3S4SG 4NO5B 1LEGA 4TOYL 4N8VA 4XCEB 4OFDA 1X4YA 1DQLL 2Z4QA 3GJEA 4OCRL 4XPAL 3I50H 2I25N 5MEPA 3HR5A 3QO0B 4XT1C 4AM0A 1QACA 2X4NA 2Y5EA 3ZT7A 2WQ8A 4YHKH 4IHOA 2FDBP 4DVRL 2WBKA 4U6YA 1JBJA 3EYSL 3IF1B 3VMNA 1Q0XL 3WHE0 3VFWB 3SDYL 3TJHC 3D85A 2Q20A 3BIBX 1A6WL 1CICD 4YX2L 4HQQH 3D0VA 5AWNH 5E56A 4K94C 1AGCB 5EU4A 4HZAA 4YO0B 5CJQL 4Z7OF 4S1RH 1KCRL 4IOFC 5LGJB 2F8XC 2O5YL 4NQEB 5FCUL 3RWFB 2A77H 4JM2B 4Z7OE 3T2NH 4WY7L 1WK0A 1JYNA 1X6LA 1T1YB 4FQXA 2CMRH 4OB5L 4H20H 1A6ZB 1WAAE 2NY6D 3QEQE 4HX1B 2R15A 4X6DF 4QCIA 3H9SE 4QNPF 4KKAD 3MRMB 3O6LL 4M62H 1OL0A 5TH2A 2F19H 2QQLL 4PRAA 4PRPE 5FGCB 5F96H 3G5XA 4X6DE 1DBJL 1H0DB 4EUPH 4QNPE 5JHDA 1UB5B 1U92B 1T7XA 2GK0A 2BVEA 1SEBA 1BZ7A 4HAFA 3C6SA 2OM5A 2N7AA 2IGFL 4JHAH 4QXTB 5T5FL 5CJXA 5EO9B 1HKLL 5BRZE 1GOGA 4K7PH 2ZUYA 1YNLL 4X4YA 4NZTH 3VXME 3GSNB 3SKNA 4HWBA 1CXIA 1EO7A 4MNHB 3PQYB 4P2CG 2F53E 5TF1H 4UT6H 3RWDB 3HZKB 3KJ4B 2M26A 3CXHJ 3O11A 5T1MA 3JV0A 3QZWB 3IDMB 3BP5A 2LTQC 4PGBA 5IG7B 3DGGB 1RK1B 1BX2A 1GPOL 4TVSa 3V4PH 4NQVB 2XPGB 3NPZB 1KNOA 4M6NL 3SE8H 2CKNA 3MV7A 1KIUA 3QQ3A 1RAMA 5C7XH 5JMRA 1BD2E 2A0LC 1AKJB 2BP3A 1EXUB 3STZA 1LGVA 2DIBA 1D9KC 4LRIA 4JM2F 3HE7A 5I16B 3C2AL 5JZ7D 3CSPA 4NQEE 4KK9C 2FJGA 4U3CA 3PP4H 1AQDB 2JIXB 3VXTB 3H2WA 1W0YT 5CZVH 5L2KA 3ARPA 4N0YH 1RUML 1WWAX 1CS6A 4XC3L 1EHNA 3VRLF 4D3CL 4RGMC 2CGRL 2KKQA 2NLJA 1P7HL 1HWHB 4I0CC 3OTTA 3O3UN 1KPUB 3TO2B 1JIBA 4HJJH 4PJDA 4YH6A 3VRLE 3LB6D 3QEGL 5CEZL 3FTGA 1OARH 2E6QA 4BH7B 5BMFH 1UEMA 3G5YA 5HI5C 3C08H 5FYJU 5LAXB 3LHPL 1TDQA 1A6AA 2NY7L 4CVUA 1MH5B 4IDJH 4P4KC 1AQKH 3BPLB 3V6ZB 1XR8B 1H15B 4U7MA 5C2BH 5J7CC 1IGCH 1IGMH 5IFHL 1KTLA 4KDWA 5C0AB 3RJDA 4TSCL 3RKPA 2X09A 3UXFA 4ZUTA 4XCEA 4MZ2A 1ZA3B 4XNYL 3IJHB 4OLUH 4K3DH 2DLTA 3CVHH 4HBCL 3O6KH 3QO0A 1X5HA 3SDDC 4MAYA 3V52H 3ARGD 2NNAB 4YNYB 5JQ6L 3MLPA 4Y2DC 1WCQA 4I13B 1EEYB 5KSUB 1ADQA 1E4KC 3TN0C 4YXKH 2EDFA 1QFOA 4B53A 2J8HA 2A6JA 2BY3A 1WWBX 3MYJB 4LSUH 2E3VA 3E6HB 5GRZA 1P4LA 3RWFA 2DMKA 1GZQA 5J11C 5F1SA 3W39B 3LY6A 1N0LA 5I2IA 5I18H 1BJ1H 2QQNH 2LU3A 3ARBA 4R4BB 4PRHB 4WHTA 3VXQA 4U6HB 1ES0B 1XGTB 4WEBL 3CVIL 1A6ZA 4LPVA 3HNVH 5DJXB 3CNKA 3HLAA 1J05B 1U8LA 3O4OC 2R0WL 3VFOB 4HX1A 1T3FB 3BSZL 3EO9H 5F7MC 2JCCB 3H7BB 2P48B 5DS8A 1WLHA 5DR5L 3UTZB 5DA0B 1H0DA 1UXSB 3EJZC 2ICWI 2QSTA 3A67H 1LE5B 3BFOA 4XGZA 4RAVB 5EDXA 4PP2B 1WIUA 3WNNA 1FFNB 5ALCL 1RIUL 4QTHA 3WN5C 4NPYA 4Y4KC 4QXTA 4JY6B 5EO9A 2N1KA 4I3RL 1Q9OA 1N5AB 4GKNB 1V7ML 4HLZH 3TNMA 5FFLA 1XGPA 4GXVL 2CKBA 1KPVB 5F9DC 3GSNA 5C0AE 2VL5B 5D1QC 4FG6D 2FZ3B 3PQYA 5C0DB 5BV7C 2X4RB 2XA8L 5I1HL 4PJXB 3HZKA 1Z0NA 1BFSA 1WC7A 4OTXL 3IDMA 5IG7A 4JRYA 3VFSB 4MVBD 3FFDA 3PL6C 4Q6IC 4ZXBC 3CSGA 1I75A 5GRYA 5C07D 1YEEL 4PLKC 4QLRA 4MD5A 2XPGA 3CDCA 4ZPVA 5I15H 1MFAH 1CLOH 3V7AG 4KUZH 5CAYB 2ZPKH 5JORB 2ZWLT 1RJYB 3AY4C 4L9LB 3HC0A 4OZGB 5ID0B 4L3EB 4GOSA 1S7UA 1YY8A 4RIRB 4LVNC 3PWUA 3UYRL 1HYSD 2XXCB 4NRYB 1CLCA 1M71A 3TO4D 2BNQE 4NC2B 3QDAA 2J6EL 4QHKJ 2ZNWA 5HDLA 1GL4B 3G9VA 5HD8C 4QRSA 1AQDA 4Y5YB 4HS8L 3HAEG 3BKYL 4L4TD 3AMKA 3D39A 3MRFA 2A1WH 1S9YB 3MZTA 5JOFB 2JCCF 2QL1A 3UPRB 3X14B 3VH8B 4U6TA 1FH5H 3G08B 3QUYC 4J3XA 3QPQD 3G5VB 3ARDD 4M6MH 1GGIL 3FB6A 1SMOA 2A83A 2DD8L 5FYKH 1S8DA 1XIWB 5DD5H 4NNYB 3O0RH 3NPSB 5KANI 4FFWD 4PLJC 2CO7B 4NT6B 3QDHA 4YHLL 4XHQA 3CXHK 4M1CD 3OGOE 4E5XB 2XZAH 3C6LA 1DBAH 3NH7H 1YJDH 4NJ9L 1NJ9B 1M05B 1GGCH 1EGJA 4PJXF 3ET9F 2Y9RT 1X4XA 2Q87A 4CVXB 1MI5D 2JJSC 4KI5F 3G5ZB 5GS3A 5HHOE 2VN4A 5IBUB 1ZA3A 2AXGB 4PJXE 3B43A 1A6TB 4OM1L 2DF3A 4MA7H 4KI5E 1JI1A 5IIEB 1U8JB 1LK2B 4N8VG 3WLWC 5D5ME 5K9OB 2VABA 4XP6H 2NNAA 4OZGF 3DECA 2COQA 2H32H 4JGMA 4YNYA 3U4EB 1OP5K 3UTOA 4AH2B 3KJ4C 1RURL 4U4BA 3AVEA 4YHYC 1EEYA 4OZGE 3WL9A 3NAAH 4WFGE 3GBMH 1KB5A 4Z7UB 3QUXD 5D2LE 3F7QA 5C3TA 2BY2A 3E6HA 3NGBB 1OQOA 3VMOA 3JV4A 5ALBH 4FP8H 2J8UE 3DV4A 4IIQA 3T0EE 3TV3L 3BDXA 2ITDB 2ZKHL 5DUBB 5HHVL 1MFCL 1B0GA 4KHXL 2J88L 4BSVB 5E08H 1JNLL 2HFFA 4NNPH 2BX5A 1QPXA 2C4FU 3BRGC 1TQCC 5FAAA 1R3LB 1T3FA 1ZWIB 4KRMB 3N1FC 5C07E 3BWAA 1WIOA 1ETZA 3PJSB 4ONGH 4GBXB 1NKRA 1NMAL 4EBQH 1PLGL 2CQVA 3UTZA 4JKWA 3TJEH 2V5SA 1UXSA 4MDJA 5HYQA 1QSEB 1LE5A 5KVDL 5F7HA 3WCYA 2DN7A 1RU9H 1WTLA 2B2XH 2EO9A 3TCXA 1CBVL 4L5FL 1URLA 4JO2L 1IEBA 3BQUC 4KAQH 5HVHB 1QTYT 1UM4L 4ZO9A 1T5WB 3IXTA 4K07A 5C0DA 1QRKA 2X4RA 2Z8VC 3VI4F 1C5CL 4P2RA 3P11H 4ZS6D 3VFSA 3PHOB 1I1AA 3F7RA 2PN5A 4JRXD 4M5YL 3VI4E 4OKVB 3SJVE 4NP4L 1KCVH 1T7VA 4XAKE 5B3JE 1QQDA 3RY4A 3QUMH 3WFDH 3FN3A 2XTJE 3ARTA 4JREB 5DC9B 5IB2A 4ENED 2FBOJ 5JORA 1MRFH 4NO0A 1ZGLB 3WIHA 4L9LA 5TE6H 5ID0A 5L7XH 1D5ZA 3TBWB 3ZYJA 1OSPL 4X9FA 4Z7NF 3MLZL 5GGSY 5DRZB 3TZVD 4NRYA 1OTSD 2AAVA 4NKMB 2DWEA 3KLDA 5KOMC 5C0RL 1ZGLM 1MJUH 5DDHA 1D5XA 4R3SB 3ARXA 5DUPH 1A22B 2BVQA 3TH4T 3CPLB 2OL3H 2V7NB 3TBVB 1PKOA 4XBGA 5AD0A 1WISA 4OAWB 4DK6A 2B0SH 3U36B 2ENYA 2BMKB 4KK5C 5CWSA 3ZT6A 3RX7A 2DI7A 1XF2B 1PJ9A 4MQ7A 2I5YL 3I02A 2X1XR 5E9DB 4I2XE 5AG8A 3QDJB 3DI3B 1MJ7L 3HRZB 2DQTH 5DTFB 1A7NH 1XIWA 5C0BA 5IUSA 2Q86A 1KCLA 4F33A 2VYRE 4JKMA 4GLRH 1UWXK 4XBEL 1D5MB 5HYEA 4FMFA 3SKOA 5KVEL 1R3HA 3LIZL 2L0DA 2FL5A 5DHYB 4PG2A 1NCCL 5GQBA 4HFUH 1BQLH 1ACYH 4XWOD 3T4YA 5HGBB 4GAGL 3T4AB 1P53A 2IPKA 4I18A 1M05A 4Z7VB 1ZXQA 4G6FD 3DMMA 3K8LA 3D2UD 3MLXL 3MJ9L 1OM3H 5GS0C 4OI8A 1WWWX 2AXGA 3UZQA 4OZIA 2DQUH 4NJAH 2A6KA 1TZGL 2BVOA 1HNGA 1A6TA 4UV7H 1Z9LA 2OR8A 1QKZL 1QSFD 3DVIA 5IIEA 5GGUB 5K9OA 3VFPA 1Q8MA 1P2CB 3I3EA 2AXHA 3U4EA 4AH2A 2A9NH 4HK0A 2B8OT 5KOVC 5HVFB 5CGMA 2FNBA 4KI5C 1FRGL 2CRZA 5EIQA 1NDGB 4Z7UA 1JZ2A 4HPOH 4IBLT 4IMKA 3D18B 5I30L 4N5ED 1GIGH 5D8JL 3VXSB 1G6RB 3OGCB 5FHAL 3DIFB 4MQXD 4OCLC 4QHNB 1U36A 3N50A 4ZSOE 4RFOL 5HVGB 1L0QA 2P49B 3T1FB 4IRSB 4BSVA 4K8RD 1IM3B 1IVLA 5DJ0B 2WWKT 2Z31B 4LLMA 5HYFA 3T0EC 1C7SA 3DLQR 3DXAD 4GBXA 2GAZB 5E9DE 1ZLWK 4UI2A 1IQWH 3QDJE 2UWEB 5EORH 3NFSL 1H3TA 5CGYD 1QSEA 1DE4B 3LKNA 3QIUB 1UH2A 1ZLUK 3CXDH 1W0WA 3W11C 5FOBB 4Z78A 3B2VL 4X80H 4JG0H 1H3PH 4JFFB 5I1JH 4H0IA 1NLBL 4X9GA 1EPFA 5ISZD 3FQRB 4PRDA 4MJ2A 2B5IB 1R3KA 3O4LB 2VDKH 4M4RA 3REVB 3MUGB 4UT7L 1CGSL 2R8SL 1QD0A 3BDYL 1FIEA 3ARWA 2YPVH 4DEPB 3C5ZB 4OKVA 5EUOA 5T3ZH 3ZYZA 3IAGC 4MS8D 2FIKA 2NY3D 3EYFB 3TCLB 1DEDA 4KMQA 2VSCA 3S36H 5LGKA 1LDPH 3NTCL 3GKWL 1QLEH 4R90H 1I8KB 3PV7A 1FIGL 5KTEL 5HHXH 2APBA 4NKMA 4XVTL 1BOGA 1MIMH 2P4AB 1MHCA 2XTJC 3IDNB 5T5NG 3ALPA 3VXSE 4Q9RL 3GMMA 5FA3B 3MNVB 5GPRA 2V7NA 4YDKL 3TBVA 4ZS7H 4PJ9C 4OQTH 1NGQH 3MLUL 3KYMA 4NN7B 2EYTA 2NX5A 4F3FA 3VWJA 2EDWA 1A7PH 3V5KB 1U9KA 3REWB 3NGBC 2JJTC 2UWEF 1I9JH 1R5VB 1SY6L 4DTGL 1CL7I 4RFNB 1LO3L 4HIHA 1J5OL 3HRZA 5DTFA 1N6QH 3EHBC 3JBG7 5IGXL 4O2FB 2VXUH 3VFVB 1I9RL 3LQMA 3FONA 1FL6B 1D5MA 1F3DH 3B3IB 1SMAA 2N56A 4TPRL 4MD4B 4OIAA 2P5EB 2R0ZL 3AUVA 3DURB 3OZ9L 4ONFH 5DHYA 1BM3H 1CFNB 2FLRT 1ROWA 3MCKA 3T4AA 4UNVA 3K8KA 3RVXD 3NCFB 3VXUE 3OKDA 4Z7VA 4CVZB 2Z91A 4F58H 1NBVL 3P0VH 4KTDH 5KW9H 3HC3L 1XF1A 3P4OA 1K2DB 5C0GA 5F9AC 1OSZA 3O4LE 4IRJC 4PD4J 3QFJD 3VXOA 4KC3B 4NUJB 1SJXA 1QEWB 4XPTH 4BJLA 1HCVA 2FATH 5IBLC 5HVHC 4C83B 3QO1A 4HIXL 2VAAB 5IB5A 1I3GL 3EGSA 3R1GL 1PSKL 2R4RH 1BF8A 1IFHH 1LO0L 3IDJA 3MZGB 4UIKL 2DQHL 4RGNB 1ZT1B 2PO6A 4OCNC 2JB5H 4UNTA 4D8PA 3PE9A 1T2QH 3MBXL 3QP3A 2XKNB 5DVOA 4OM0H 3IDIB 4H8WL 3D18A 5FA4B 1NCAL 5IK3A 4YBQD 1LEIB 2Y5TB 5DJAB 4JREC 4LIQL 2CK2A 4NZDA 1PVHA 4QHNA 4IRZH 4HH9A 1OP3K 3TGXA 1UJ3A 3MV8A 3UEZA 1I8IB 4M7LL 1CE1L 2BZDA 1X7QB 3F7YB 5JO5A 4I3SL 2HG5A 1NCDL 3D3VD 4XNUH 1DSFH 4CMHC 2Z31A 4MQSB 4R97B 2OCFD 1HOCA 1TZIB 1IZKA 2HVKB 3C5SB 3CCHB 3T2PA 1YECL 4DFIA 5E2JA 2YMXH 1EO5A 2NY2C 1ULVA 2EEAA 2ZCHH 1I85A 3SDCD 1N5YH 1K5NA 1DE4A 4GG8B 1X5LA 3VCLA 1AD0B 2ADGB 2O5ZH 3UTPD 1F3DJ 1KIPB 3HZVB 2B1HL 2MCPL 3O8XD 4ZUSB 2APTA 1BPVA 3M45A 4JKPH 4URTB 2P5EE 2VDNL 5FOBA 5F97E 3DUSB 2HT2D 4ELMB 4P2QA 2W07A 4F57H 3FQRA 5GS2D 3JWOC 4WFFD 4K55A 3B9KB 1HQ4A 2OR9H 4I4WA 4ZDHB 3MUGA 1GH7A 4NSKB 2BSRA 1C8PA 4OD3L 2V7HB 2BSED 5I8KL 5TGBB 1S9XB 3LKRB 4P5MA 1B0RA 2RFXB 3NABH 3UP1A 2E9BA 1VB9A 1CU4L 1V05A 3FMGL 3ARYA 2ZUSA 4GRMB 2I60H 2D03L 5EU6D 1I8KA 4LSPL 2D7PA 4NRZA 3E3QE 2BNRE 3QSKB 3LN5B 1TVBB 4FQXD 4ZO6A 3V4UH 5J12B 1AGEB 3U0PB 5E70A 5EWIL 3ZYOA 1RZJL 2VXSH 5SWSB 4KKBD 4XPHL 2EC9T 1GAFH 2ORBL 4QTIH 3GJFB 1WT5C 1N8ZB 1I7RB 1T5XA 1CDIA 1T4KB 4H25A 4O00A 3V5KA 5JHDD 3REWA 2ZUVA 1P4IL 2AI0L 5DJZA 2MPAH 3U1SL 3VGFA 1FO0B 1S78D 2DQJH 1BLNB 3ZDYF 3EYUH 4IRSC 2VLME 2BNUB 4L1HA 4NN6B 3BISA 4HV8B 5F7FA 5IVXE 1QFUH 2IPUK 2DQIL 3ZDYE 1KEGH 4OCYH 4YHMH 1CFNA 4ELMF 4F37K 1S7RA 3VG0L 5LGHH 1CFTB 3PHQB 1U6AL 3IS1X 3MRCB 3N0PB 4CVZA 4GKSB 1YNKL 1ZA6B 1RZFL 5KSAC 5DXWA 1FL5B 3BZEB 4M61A 1ZSDB 1JRHL 3MXWH 5I19L 4Y5XA 4JGJA 1WICA 3LS5L 4R96B 3MV7D 4MWFA 4DUXA 5I75B 2IAMD 4FXGB 3U30B 4EI5B 3MV11 1YEHL 4GXUN 2YWYA 2WBJA 3FQWB 4JDVB 2VRAA 3OXRA 4LCWD 3JWDL 3ILQC 4HIJB 3RTQB 1KLUB 3B4NA 3ARZA 3HE7D 4LGRB 2HKFH 1L7IH 3GIZH 1JGVL 1BVLA 4UU9A 4QHMB 5MENB 2V2TA 2AK4B 4MNQD 1R5IA 1MCIA 1R3JB 3BZFB 5ESAA 5DQDH 4H26B 4QXUH 5B3NA 1KJ2B 3Q3GB 1KENL 5DJAA 1F6AB 3F6LA 4BUGA 3ORJA 4YHKL 1I8IA 3P9MB 1LD9B 2H9GB 3H3PL 3WS3A 4WFHE 1T83C 5SWSE 1HILA 4K9EC 4NKOB 4KPHH 1DUYB 4GAJL 4UBDC 3VRJA 2KDGA 5EC1B 5HI4C 4EXPX 1AY1H 1TZIA 4RAUB 2HVKA 5A2IH 1F4AA 5EZLA 4UDUB 3L7EB 4UINH 2HFEB 4G6KH 1BVKB 1LQSR 4S1RL 3IDXH 4KZDL 4J23A 1OOAA 5I66B 4YBLC 4ZFZA 4ZOEA 1EZVY 4YHPA 4B5EA 2ADGA 2EIZA 3KR3H 2WIIB 2CR3A 3HZVA 3V9FA 3T2NL 3KXFB 3QEHB 3QJHB 1BMGA 2Y36H 4JN2B 2CMRL 5EBGA 2AABH 2CJUH 2JB6A 1NANI 1AR2A 6FABL 4QXGH 2A2QT 3V2AR 4L8DA 1Y0LB 4ZYKB 4MAYD 4PY8J 3DYOA 3B9KA 3TPUB 1SM3H 4YGVB 1XR9B 1RQ5A 4ZDHA 4RA0C 3MYZA 1A6VL 3KPQA 2XNAA 1DLFH 4HS6A 2X1QA 3N1MC 3PWLA 2IH1A 4UTBH 3U46B 4QRPB 3MRJA 4WVRA 4FS0A 1B0WA 2ENSA 3ZZ1A 3MBEC 4M3JA 4GRWB 3P4LA 1IKNA 3DARA 4P23B 5F6HI 2PYFA 3CAFA 5J3HD 2XN9A 4XMKL 4I0PC 5CS7A 4GRMA 4JVUA 1NBYB 5TF1L 4UT6L 4DKEH 4JM2D 1FLRH 5D1XC 2CRMA 2AK4E 1PKQE 4HJGA 1VGKA 2VL4A 4GJTB 1G0YR 5D1ZB 2E7HA 4TUJB 4E41B 3R06B 1TQBB 2DM4A 3V4PL 5B39A 3L5JA 4RGNC 1V5JA 2HT4C 3RVWD 1FCGA 2DJUA 5H37H 3E3QC 2GT9B 3NACL 3LKPA 4Z18A 2EECA 1I7RA 4DCQB 5C7XL 2DJ4A 1T4KA 3HB3C 5K9KA 4TTDC 1C08B 3SCMB 3DVFA 2R9HD 2VXVH 2XQBH 3QI9A 1XGQB 3RX5A 2D7QA 1FZJA 1X4ZA 4WW2B 1MCOL 2C3VA 4UILL 1AH1A 3GK8H 4HV8A 3FRPA 3FB7A 2F74A 3KXFE 1RZ8A 5L2KE 3PQYD 5A3ID 1NLDL 1RULL 3KYKL 1CFTA 3GI9H 4DKFL 4JQXC 4NKDA 1A6UH 2D31A 4YHIB 4JEGB 5IMOA 4RCAA 3TVMB 4ERSH 1QFWH 5EIIB 1ZA6A 2YR3A 1FL5A 2DLIA 4HJJL 4OCMC 1MY7A 3BZEA 2FX7H 5TQ0H 4JKKA 1V3MA 5BMFL 3SOBL 3TT3L 1UKSA 1NEUA 2ZJSL 2V9TA 1CD9B 3NFNB 1SYVB 3QQ4B 3LZFL 4Y1AB 3RY5A 4LPTA 4UQ2B 4FXGA 1AKJD 5MP6H 4NFBA 4LVOC 5C2BL 1FPTL 2XKUA 1MHHB 2UVFA 3I6LD 3QUZA 3V5HA 1IGML 4MQTB 3ARVA 4X4ZA 4TVPE 1XCTB 3X13B 1P6AB 2OJZL 4JVPA 4BQ6A 1ZOXA 4Z8FH 5MENA 2IPTH 4KKCD 2EYSA 5IB3B 2L4OA 1HYRC 3FOMA 3BZFA 3VJ6A 3D39D 3KPRB 1RUQL 1KJ2A 1DBMH 2R56L 5AG9A 4X5LA 4PUBH 4OZ4A 4JFOA 3P9MA 3JUZA 1LD9A 2H9GA 5EZIH 4K23L 4NN5B 2R23B 4HDIB 3CFCH 3B8SA 4WJ5B 4RMRA 5EC1A 4WW2F 2DBLH 2VSDA 1AO7A 4M8VA 4QGYA 4NQXA 1A5FL 4LLDA 3X11B 3OXSB 2DLFL 3VWKB 3C6LD 1QSVA 4YWGH 2YKLL 2GJJA 4C4KO 2HT3D 4HSQA 3QJHA 3T3PE 3E0GA 5DZLA 2HTKD 2LU4A 1QZ1A 1TJIH 1G1CA 3HNSL 3H0TA 3U79A 3IRPX 2HN7B 5I1CH 2IFFL 1Y0LA 4ZYKA 4WTXA 2EH8H 4YGVA 4C56B 1XR9A 4I5BA 4JHZA 5GHWH 4U1MB 43CAA 4MLSA 2ADIB 2XFXB 5D7LB 5AYUL 4U1GB 1GC1L 1J87A 4XNZC 4LARH 3SDAB 4QRPA 3SQOH 4XXDB 2YBRA 4POYA 4X98A 3HNTH 4HIEA 4LOUC 1BBDH 4HS3B 2ZOKB 2FX8L 4WO4B 5E0QA 3MRDA 1NBYA 4JQIH 5GIRB 1KOAA 2CDFA 1KELH 4ZTPH 4PRHD 3VDCA 4R8WH 3MACH 5K9JL 4Z95H 3KHOA 1Z2KA 4JRYE 3B9VA 3HTLX 3ZLQC 5C8JA 4O5LH 1BWWA 3R06A 4MJ6B 2QKIA 4XMLL 4WUUB 4TSBL 5BVPH 1Q1JH 5I15L 4KUZL 3KVQA 5FYJD 5AEAA 1DL7L 3RL2B 3DYPA 2W9EL 3ULUD 2DL2A 4JANA 4EI6B 3SCMA 2EZ0C 2W91A 1U3HC 4NWUH 3BEWB 1XGQA 2D9QB 4NZJA 3CU1A 4G42B 1OTTD 3N85L 2E27H 4WRLA 4I8DA 2DM2A 4HT1H 4ZQKB 4B7LA 5CMAA 4K2UH 2XY1A 1PGRB 1C5BH 3FQUB 2A1WL 5CD3B 4NQSA 2BXZA 5HHPA 5AUMA 2PUQT 2YS4A 1G9NH 1EIBA 3KDMB 5IF0B 2YUVA 3HMXL 3TVMA 1I1AD 1LK3H 3EOTL 3KAAA 1VACA 1EHLH 4PGEB 2APXA 2AV1B 5IV2B 3WKML 4RWYH 5F89A 3AMLA 4HPYL 3IRZA 3IU4H 1LE9B 4Z7WB 1TCMA 3QQ4A 4J7RA 4M7ZC 5TQ2H 3GHEH 12E8H 4NO0D 3DX8B 4R26L 2AV7B 3K4DA 4L3ED 1J88A 2FR4A 4Y16A 4U1NB 5DFTA 3THML 5FGBC 2DWDA 4WWID 4CMMB 2E6JA 4KQ4H 1CD1B 1UEYA 1XCTA 5FO7B 1A47A 2XG5A 3E8UL 5DK2B 4DGVH 5J9PB 3RWIA 3MLRH 4U0QB 3KPRA 4MA7L 3UJJL 3UAJD 4MD0B 1C1EH 1U95B 2HFTA 1QHPA 5IBTH 4K8RH 2ICCA 3MLVL 4F8TA 4HC1A 4WUUE 5LWYH 1CVSC 4OZFH 3OJDB 4N0UB 2PYEB 2DQDL 3UMTA 1Q94A 4PJEA 4XZUB 5JR1L 4WJ5A 2WZPD 2IALB 4OZHB 3VXRE 1XIWD 3U4BH 4YZFE 5D1ZC 3GBML 4S1DD 3V5DA 1TQBC 1B2WH 1C12A 1U8IA 4DWHA 1H8NA 3OHXA 5FV2A 3K1DA 3NA4A 4ALAL 3OXSA 1I7ZB 3ISWA 3WIFB 2WP3O 2MKWA 3DETD 3LS4L 1R0AH 5F9OH 4KKLD 3DBXB 1F3RB 1MQKH 3KPSB 3DMMD 5E08L 4N90D 4K94L 1AGBB 1UZ6F 3SGJC 4O2EB 3DTXB 4WI8A 2D0FA 1N59A 5ACZB 4FQIL 5E00A 1VADA 5JDSA 4WW2C 1U91B 3F7VB 3MR9A 4ONGL 1IQDB 4Z7WF 4XCYB 2UY7A 3ARBC 2EDXA 2DMBA 4OLVH 4C56A 1JZ4A 1ZS8A 5BCAA 4D9QD 2D9CA 2ADIA 1S3KL 2XFXA 4ODWB 4KWUA 3MUY1 5HDBF 1RU9L 1H8OA 3SDAA 5AZEL 1BBJB 1Y6KR 5IHUL 2VDML 3JTSB 5GXBB 4S1SL 1L9MA 4XCCH 5HDBE 1U8OA 4PJCB 3LRSB 1FZOB 3MOBH 3EDFA 2BRQA 2WBWB 3E2HC 1JWUB 4WO4A 2DQGH 4X7FC 2OK0L 2RJMA 5GISL 4R6UA 5TE4H 3QCVH 1XFPA 4NM8H 4WW1A 4UNUA 3P11L 1I8MB 1DLHA 4P2RE 4XCNB 2F5AL 5MEOA 1K4DA 2YZ1A 3P0GB 5I8CB 3CC5B 3GSRA 2IQ9L 1JHLL 4Z0BL 3O2DL 1HI6A 3CDYA 4OZHF 5HGDA 4GBXD 4N0UE 1E4XI 4M7JL 3RL2A 2NY0B 3K74B 3AREB 1WZ1L 5TE6L 5B39G 1Z3GL 3LN4B 3QIBB 2QLVB 5HSFA 1NGXA 1QSED 5K93A 4K7FA 4L29B 1CT8A 2FGWH 1UYWH 5HJ3A 3MOQA 5IT2L 2C1PB 4ZNEE 4LGSB 4WGWB 4HXBL 4HFWA 1J1XH 1MJUL 1NMBH 4PJBB 4PY7B 2ILLA 2QQKH 1VPOL 4J4PA 3WFZA 5I1EH 1KLGB 4RQQB 5CD3A 5IEKB 1BOYA 2HVJA 4H0HB 4UQ3A 2WIMA 3KPTA 4OFPA 3FRPG 5JIIA 3UO1H 5HHQA 3KDMA 4U7SA 3S37H 3VWKC 4W4OC 4M02A 5ENWB 1YMMB