5NULA

Clostridium beijerinckii flavodoxin mutant: g57t semiquinone (150k)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
b'MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNIDELLNEDILILGCSAMTDEVLEESEFEPFIEEISTKISGKKVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNEPDEAEQDCIEFGKKIANI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVODOXIN
publication title Control of oxidation-reduction potentials in flavodoxin from Clostridium beijerinckii: the role of conformation changes.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Electron transport
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1996-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5nulA00
2M6RA 1FUEA 2A5LA 5EA2A 2HPVA 4GI5A 4DY4A 5LJIA 1V4BA 3QFRA 1RTTA 4CF6A 2FLVA 4Y7CA 1J9GA 5LVAA 2FCRA 3TE7A 3UXEA 1SQSA 1J8QA 5B3LA 4LAFA 2OHHA 1AHNA 1TLLA 2FVXA 4ZVMA 1XT6A 3U7IA 3G5MA 2M6SA 3B6JA 4QOEA 2Z9CA 2BPOA 3N3BC 3NHUA 1AMOA 1QRDA 1D04A 1CZNA 2QMZA 1JA1A 4F8YA 2Z98A 1X77A 1BVYF 4C0XA 4BMPB 4C14A 3F90A 4M0CA 5FX2A 4C76A 5LMCA 4YAUA 2OHIA 4FGLA 4U7GA 1D4AA 5JROA 3KEGA 5NULA 5ULLA 1DXOA 1YRHA 3ESXA 3NHJA 3N3AC 1GG5A 1FVXA 3RPEA 3TEMA 4ZVKA 1OBOA 3EYWA 1H69A 1XYVA 4OXXA 2R97A 2XODA 4PU0A 4GR9A 1H66A 1JA0A 1CZHA 2QX9A 1OFVA 3K20A 1QR2A 3FNIA 4LTDA 1T5BA 1FLNA 3TZBA 3B6MA 3JSXA 3UXHA 2BN4A 1RLIA 3U7RA 3ES9A 3KLBA 3OX3A 4QOIA 2FX2A 2V5UA 1CZLA 1YOBA 5B3KA 1QBGA 1TIKA 3N39C 1D03A 1ZX1A 3NHFA 3F6SA 3OX2A 5EMNA 1AG9A 3S2YA 1J9EA 1WSBA 1FLDA 1E5DA 3NHPA 5BUCA 4C0WA 1KBOA 1FLAA 3O73A 2FDXA 2QWXA 2F1OA 4ICIA 2D5IA 3HLYA 1FTGA 3OVMA 4YAOA 2HNAA 3R6WA 3GFRA 3NHWA 3EDOA 2N1MA 3F6RA 1WSWA 4HS4A 5F51A 2Q9UA 3LCMA 4YAFA 2RG1A 4U7HA 3FX2A 4XDHA 3FVWA 3GFQA 4GQIA 2BZSA 5TGZA 3ESZA 1AKWA 4D02A 2X2OA 4YAWA 3KAQA 2MTBA 3OJWA 3L9WA 4LTNA 2V9CA 2MT9A 3W77A 5LBTA 4BMOB 3FW1A 2XOEA 1YCGA 4N9QA 2QMYA 3NHYA 1AKUA 4R81A 4ZVLA 5FUQA 1XYYA 1CZRA 2ARKA 3NHLA 1VMEA 3OWXA 2HNBA 1SG0A 4ZVNA 4H2DA 2QX8A 4N82A 5LJLA 2ZKIA 2WC1A 2QX6A 2GSWA 2FOXA 1BU5A 5F12A 1QHEA 2B3DA 1AZLA 1FLVA 2AMJA 3GFSA 2BMVA 4QOJA 1YKGA 4J8PA 1C7FA 2FZVA 4CETA 3KAPA 4HEQA 3OJXA 1YCHA 3W7AA 1AKVA 2OYSA 4LA4A 4NULA 2KLBA 4Y9UA 5LLDA 1CZUA 1CZKA 1ZWKA 2BF4A 3QFCA 4QOHA 1RCFA 5A4KA 4FGJA 2R96A 5FA6A 2X2PA 1XI2A 2MWMA 3NHRA 1NNI1 4QOGA 4DIKA 3FJOA 3ESYA 4PTYA 4PTZA 4Y9RA 2FAXA 3HA2A 3K1YA 1DX9A 1I1OA 4FX2A 4ESEA 3W79A 2MOKA 3SVLA 1OBVA 3P0RA 2V5VA 4NLLA 2OHJA 3NLLA 4S24A 1DXQA 2QX4A 2KQUA 4U7FA 3NFRA 1ZWLA 3QE2A 2QR2A 1YCFA 4XDGA 1CZOA 4LTMA 2FZ5A 4YALA 1J9ZA 5NLLA 3W78A 1RLJA 1AKTA 3ZHOA 1C7EA 1AKRA 4QODA 4DILA 3LT5A 4FGKA 3B6IA 3F2VA 4YQEA 5EAIA 3O2NA 2Q62A 2Z9DA 3NHSA 3NHKA 3D7NA 5LBUA 3OX1A 3GAMA 3HR4A 1F4PA 1YDGA 3B6KA 1T0IA 1KBQA 4QOFA 1FX1A 3OWHA 2Z9BA 6NULA 4N65A 1B1CA 5F4BA 3L9XA 2W5UA 4H6PA 1AKQA
chains in the Genus database with same CATH superfamily
4RPHA 3RQSA 4O5OA 1JDUA 1QJ4A 3G0HA 2P9BA 5F5LA 5AKLA 3GFTA 1TMOA 2P5SA 2XMZA 3MGAA 5TV2A 5KWVA 4YRTA 2BVNA 2C3UA 3FZNA 2G1UA 2PRJA 4MA4A 4M2LA 4NECA 1RAGA 5CB4F 1RYYA 2AF4C 2I3ZA 2AFRA 3QLTA 3QGMA 4QEKA 1KZ7B 1TNDA 1VDMA 3SX2A 4LRYA 2CHEA 1L7XA 4MWOA 4TXJA 4CM9D 5KVAA 2WF6A 1MOSA 3B89A 3DQZA 3DZIA 3LKBA 1IBRA 5GOTA 3MJ4A 3CINA 3LIPA 1V9LA 2OENG 2GX6A 1P81A 1B41A 1PJSA 5CG2A 3CX4A 2HRQA 1KJZA 3NOVA 1YE5A 2PFGA 3VYTB 3TE7A 5IT0A 4M88A 1WUTA 5ITSA 3VTZA 3OCUA 1YJ5A 2QW0X 4B9EA 3QYJA 4QDJA 4ERXA 4K9MA 4F5EA 2O14A 4U0JA 4P0QB 4QSHA 3DBIA 1W2HA 2BGRA 2OUIA 5LMUB 2VOEA 1NSYA 3HXMA 2Q2VA 2LWIA 5DF1A 4TS9A 2FFJA 4KR2A 5HMLA 1BDJA 1E6EA 1R6TA 1WY5A 1XK6A 2ATCA 2JKYA 1O96A 2Q3EA 1AK9A 3KWLA 3N0TA 5CIQA 4PIVA 4D8YA 4URZR 5LBIA 5CBPB 1A8HA 3E15A 4A6EA 4C7OA 2N1BA 4TT8A 3PCRB 3ZWCA 1VE9A 1HDZA 2Q45A 3HHPA 2WMNB 1GPJA 1UMDA 4J0IA 2QNBA 5HKLA 2XXAA 4KXMA 3EBLA 3JQFC 3QOXA 3GLUA 3C1AA 3E7FA 3O94A 1W30A 3M6LA 4G85A 4LWOA 4X54A 6YASA 1ONPA 4YFYA 3VI3B 3IUJA 3KEMA 1KHTA 2ZR7A 2FTKE 3M6FA 5K3FA 1X0XA 4GC9A 1AMOA 3CFYA 2JJMA 2FLKA 4OHXA 2YJNA 5IJ9B 5CGQB 4ZHQF 3PLAE 1VTKA 1ZINA 2B9EA 3ROPA 3ETHA 3LBIA 5J1SB 4RJLA 1SUEA 1ZD8A 5EHGA 3SG0A 4F6RA 1G59A 1UPAA 1EVIA 2EL7A 2G5PA 2WJGA 1G0NA 3JRNA 3PJRA 3E2PA 5IMSA 1URPA 2WWHA 3F46A 3I64A 2DETA 4Q39A 4EVRA 3C7AA 4C14A 2PIAA 1U7DA 3E6AA 3T5TA 4EY7A 3H8VA 4G41A 2EP5A 3JQPA 2IQIA 1KZ4A 2WWFA 3TIFA 3WL7A 1JDNA 1KDPA 2DWOA 2WIFA 3DAOA 3JQQA 4QDXA 4AULA 3OKAA 4C76A 1KU0A 2DPLA 3ZY2A 5KOYA 3HVHA 3OOEA 3P2KA 4MXDA 4BIMA 5C3MA 1RC8A 4AN4A 2GNPA 2DPXA 1SKYE 4UHCA 5FPSA 3WI7A 1GPDG 3SHWA 4E70A 2QMUA 2RHHA 3VR5A 3ONEA 3AEUB 2Q21A 4O5AA 3UHOA 4NY1A 4CHTA 2YZMA 2GJ8A 3GZTB 4MRVA 2AFVA 3BH0A 2D5LA 1NIJA 1KQNA 2O4CA 2BR5A 3HXPA 2E18A 4OPMA 2FX3A 3TUIC 3VR6H 1HK7A 2Z5VA 4O2RA 3RTDA 4YLYA 1OH8A 2JW5A 4HATA 1V3TA 1W25A 3G49A 4QATA 1GPKA 3L7NA 1NYRA 1D8AA 2PWYA 3L3BA 4UBKA 4YP7A 5L95A 4HB0A 1F3LA 2VF7A 2MSDB 3VR3D 2KI5A 3GJ0A 3U7JA 3ZWMA 4ZCPA 3KS9A 1BH2A 1LBSA 2Y4OA 2VF4X 3R23A 4G9BA 2CMKA 1IMOA 1G16A 3EAQA 4LRUA 5ARBA 3PR1A 2VNHA 4XYMA 1EVQA 1FX0B 1Y8RB 3EFHA 4GPTA 4IGEA 4ND8B 1EFTA 2N46A 1DAIA 1M1XB 1P6UA 3UA4A 4E2YA 2VHXA 2QQEA 4JWKA 1E63A 3KVOA 3ZK8A 1RDFA 5FV4A 4DL9A 4Q16A 3A37A 2J0UB 4IEFB 4BE7B 4Q3NA 4TT3A 1B8OA 2QV7A 4PQRA 4X45A 4IG9A 1NW3A 3FWYA 3TRDA 3UK6A 3VYWA 4J07A 3WAKA 4Q93A 2IOYA 5ALHA 3TQIA 4TRJA 5E4FA 1GUAA 4UBLA 2Q3LA 1LPOA 4YXWA 4GLFA 2VSYA 1GPYA 1NPTO 4DDWA 1T1GA 2V4MA 3F73A 1KEEB 3RSZA 2V6GA 3GFOA 3BWXA 3R76A 4ZI7F 1VJ5A 1RYFA 1G1AA 1W2WB 1SHTX 3GRZA 5EJ9A 1RI4A 2XCQA 3EQ8A 3MCTA 3CF6R 4KSYA 4IXMA 3K0CA 4YPVA 5B4TA 5KTSA 3IAAA 1DCFA 1XIVA 1XR3A 3TR0A 4Z4IA 4NOJA 3B6MA 4RCZA 3IB6A 1HNNA 2OAQ1 1U1DA 3BMQA 4I6JA 4MMZB 3JU3A 4LY9A 1P61B 1DTWA 1IZ9A 5B7QA 1N8NA 1KYYA 1ESMA 1ZMXA 3G9XA 3QVGA 4YMVA 5GTDA 2IKSA 1AN9A 3LPMA 4TTRA 4HWGA 5FLEX 3QLVC 2YCLA 3OOWA 5KDOA 3WGNA 1P0QA 1NQVA 3B8HA 1PI3A 4OK5A 1G8JA 2RCYA 4GX5A 3F7NA 2GESA 2QJRA 5IRCD 1IATA 4OQDA 2O8EA 2BHSA 3CVOA 4KE6A 4KIFA 1MQ9A 4J0QA 4KB5A 4LVCA 4RESA 5K0ZA 1XPUA 1DO0A 1GKIA 2CMHA 3HYLA 4JQYA 3NKLA 3TLZA 4AXXA 4ZYVA 5HUHA 1JEOA 3OOYA 1SUWA 3KJGA 4QLAA 3B9BA 5BPFA 2FFRA 2VDLB 1VSBA 1XJWA 2RBEA 4IFIA 3PXUA 4L22A 1VE7A 1NVAA 1FPQA 2QAGC 2ZRHA 4UUQA 3RSOA 5BUQA 2O2EA 2IDKA 1ZPDA 4TXMA 4KE7A 4K88A 5LOVB 1Q77A 2HWKA 1Z15A 5GIPE 3IHLA 4TRMA 3RE1A 2PZEA 3NTXA 3UMVA 1TQDA 1M75A 1Z2PX 3MT7A 1OI2A 3D4NA 5AOVA 5G40A 4CEJB 1BYIA 4YMWA 3DZGA 2XEXA 3S2YA 4UM5A 5DN9A 4BOYA 1QQ7A 1RYDA 3H2HA 1M66A 1R0RE 2HA6A 2Z5FA 2PA0A 3NHPA 4NOMA 4NZPA 1P72A 3QPCA 1UKVY 2K2QB 4OA8A 4PQGA 2HMTA 3DG9A 3NBZC 2OFWA 1YBFA 4PSVA 4C89A 3EEIA 3A4YA 2NOAA 1JDPA 4B5KA 4GX0A 3G8CA 3T4EA 3TBHA 2N3ZA 2QEQA 1EWTA 5T67A 4MUMA 1DLIA 1ZKDA 5EXTA 1IHYA 2QRMA 4CLXA 1MW9X 3EG5A 1SCAA 3G68A 4KN9S 3LUDA 3KB2A 4Q1VA 3UCFA 1OKKA 2AMFA 1D0IA 1UXKA 3DHEA 1KAOA 3UHJA 5EQTA 2CWWA 1R9GA 3KUKA 1QE5A 1E94E 4CT4B 3SZ3A 1G9XA 1JP7A 1AE1A 2BUBA 5FEMA 1DHRA 4DGSA 5CG1A 3HJCA 3FX2A 1VP3A 3B1VA 4U7HA 3DFUA 3AOEA 3TZKA 3OPVA 5EJ4A 2GFIA 2PGNA 1H05A 2VWGA 3ORRA 1L2TA 2A30A 1AT1A 2FSUA 2VEOA 2YFHA 3RFFA 3HCCA 4K2AA 1N33B 1WMAA 3NV9A 3IO3A 2GZ2A 3G2KA 1JHVA 3PQ8A 3IKMB 4IIGA 1R4NB 1C0LA 4N3NA 3R3WA 2F90A 1E2PA 4KH0A 2VQFB 3AB3A 4S05A 1MX1A 1F2TA 3DDZX 3O4GA 3QQPA 3EUWA 4UUAA 3FPEA 2IT1A 3S2EA 2V7TA 3ESDA 2GZHA 4DR5B 1CY2A 1PFWA 1ZN7A 3PNYA 5DBEX 1PR6A 3O9MA 5CIYA 2NLOA 4A3SA 3DXFA 3EHDA 1EWRA 4LW8A 2P6PA 1XRJA 3FUWA 2J3DA 2QW1A 3D4IA 1C9EA 3QTLA 3UMBA 1AIPA 2K7FA 5ECYA 3UAGA 2AVDA 2AXPA 1QG0A 1SB9A 1ZJ5A 3AFHA 3TRFA 4EY5A 1K08A 3JAKA 1TX4B 4H7IA 4UFNA 1PKXA 2F17A 3SCZA 3T06B 5ES4B 1RYEA 4L4RA 4MV4A 3SZGA 2RDMA 2PGXA 1J33A 3SR0A 2EFDB 1H2WA 1H0SA 5IKXA 1YRAA 2G9VA 1OY1A 1PV1A 4N9QA 1EB9A 2VPIA 3EFBA 1J90A 4CG3A 5LDHA 4E5VA 1X15A 5E7QA 4YYZA 1V25A 5L4LA 2FE4A 3O31A 2XVYA 4B6SA 1NMYA 5IKPA 2J0QA 4TWIA 1VE3A 4XUCA 3ORHA 4O0LA 1KJWA 3UAWA 1X7ZA 5HPYB 1SK8A 1JPUA 1IZ7A 1AMNA 5DCYA 4CKCB 3UYKA 1WCWA 1IXRC 3J7TA 4J0DA 2HHHB 4D79A 1FF9A 3BIWA 1JL3A 3B60A 3LVRE 1KHHA 2D0OB 5KTPA 4WQMA 3U4QA 2CXQA 1MW8X 4ZZ3A 2BJHA 1N2EA 3IAFA 5BORA 2PUJA 3H9QA 2ZKIA 4BIIA 1SZJG 1M2WA 2FETA 1G5PA 1H3FA 3G1UA 1WDWB 3E1SA 5G4KA 3V2GA 4DQLA 1L4GA 1NT2A 1UPFA 3A6PC 1X2BA 2FSFA 2HY7A 4YMIA 4LEIA 3SMVA 3F3MA 2GBIA 4WA8A 2JAQA 3TMYA 4WECA 3TW6A 5JQGA 3OZRA 3G7SA 5DX0A 4R01A 4JOCA 1KIMA 1YKGA 3T1QA 1SA0A 2ASEA 4GE0A 4EW1A 5ANRB 2FJ0A 2JIMA 2P4SA 2V0NA 5F1KA 1N5DA 1C8LA 4ZAGA 5IEJA 3CUVA 1VJTA 3MYRA 4J0FA 1BVUA 4GFDA 1UK9A 2C04A 2H65A 1DUVG 4I50A 4JBYA 4KR7A 4PO1A 4WZAE 4ESVA 3Q3GE 3H42B 1Q7GA 3ZTYA 1PZXA 3AR7A 3OPQA 5DKFA 2OQVA 3S0JA 4CMAA 1C80A 3E1KA 4W8HA 5C32A 4TZ6A 1COZA 2PPLA 3JRWA 3RRJA 2R79A 3KT0A 4HEA6 3RASA 3DQPA 3IRVA 4Q05A 4QTUB 3U81A 3WL4A 2YWRA 3QMMA 4NDZA 4CIDA 5B7PA 2V96A 4II3A 3O91A 1NBWB 1JE0A 1NUUA 4IO0A 4RMIA 1YDFA 4F72A 1J2TA 1FFXB 4BGEA 4G63A 1SBHA 4RKYA 3RRNA 3RVMA 3PHGA 1NASA 3CE6A 3Q0EA 5DISB 3GOQA 5CCDA 1M0EA 4X20B 1L3CA 2C42A 2PGAA 3C8UA 5JNUA 2I3AA 2G63A 4Z9AA 1Z0UA 4GR4A 3V80A 2W4IA 3GVHA 3EBOA 5L4SA 1UMBB 3DMGA 3RV3A 1OTYA 1GRRA 2F9FA 1Z4MA 1I1OA 4B8ZA 1RFLA 1XXHB 4OXNA 2ZQ5A 4FX2A 5D3ZA 4CR7A 3RYCB 5JS7A 3WK8A 2JDIA 1G19A 1QGDA 2PS1A 5DIFA 3W79A 4TXHA 4FLMA 2Q9AA 3WSTA 5AUQA 2ORYA 3IDQA 4B5LA 4L8WB 3ETJA 3IR7A 4EQ6B 4C6SA 5JW6A 1CBUA 1P1KA 2GS9A 1OGYA 2XTJA 1KEUA 4AJKA 4YY3B 3QI7A 4BMNA 1QM5A 1SHKA 2GLUA 2NO5A 3C8MA 4KBFA 4Q9JA 4BTEA 4IILA 4E31A 3RC8A 1PO7A 1XELA 3TKAA 3C4QA 3VR6D 2CVOA 3KR1A 5SYAA 4H0CA 3QM1A 1I2AA 5DIZA 1GNLA 3LNTA 4S24A 3SOPA 1MNAA 3SZMA 2QX4A 3GPDG 3VKWA 1ZWLA 4OB7A 2AJCA 4PFKA 4KQFA 4KEAA 1NF9A 4RQUA 2VWHA 3UWPA 2VK8A 2JGLA 3CNOA 5IANA 4R1QA 2UAGA 1N0WA 5I9SA 2B2NA 4A10A 2NO1A 5EOVA 1P17A 1U8YA 1OYOA 1PVDA 1Z37A 2Z8ZA 1KYZA 1E61A 2DT5A 3TQSA 1RC0A 3ECAA 3PDIB 5GWXA 5T4BA 5CXQA 1XDSA 5C4GB 3WNZA 4O02B 4AJOA 2UZ1A 1U9IC 3KZCA 1R0KA 5FOSA 5NLLA 4WMLA 2CC2A 1J0EA 1ISFA 3ROKA 3CNBA 4OATA 3GDGA 1U2PA 2IVFA 4KW7A 4MNTA 4QYIB 5AMXA 4E6EA 2GVNA 1EH5A 2Z1MA 3BXZA 1OX5A 4UVEA 1ZCFA 1RM5A 2HDNB 4C4OA 2EW2A 3HCDA 3TIVA 1ZC3A 1EFAA 3W5CA 2AN4A 2CHFA 5FRDA 5ICMA 5JYBA 2J9FA 4ARIA 3JZMA 2PAAA 4KDCA 1YVPA 4C0BA 1QP4A 1IPEA 4IJMA 3IIEA 5EAIA 2AJLI 2XWQA 4IL5A 2QKYA 1DMSA 2R8PA 1ZK1A 3S2GA 3DE4X 1GZ5A 5BN1A 4LNUA 2QGZA 4M1SA 2W2NA 2D1QA 4B34A 1F0YA 1GHTA 1YMVA 2XMCA 3H87A 2XQKA 1GZ3A 4EECA 5FWXA 4EW3A 2FW9A 4WOCA 1RHRA 4K0RA 4X7RA 1ZC4A 5B36A 2YNMC 3K0BA 3AEUA 5I3ZA 3TUZC 3UPUA 2C2GA 3UWDA 3WRYA 3LO8A 2HMAA 3K92A 4LJLA 3CUTA 2FJPA 3GGCA 3N8NA 3K30A 5CNMA 5B4UA 5KAPA 7ABPA 4ED9A 3DLPX 5DTEA 3UGQA 2BFCB 3E9QA 4PAGA 2PUDA 4CE6A 2X0KA 1B00A 2W2PA 2PQMA 2ZT8A 3RYFA 1VB3A 4LZLA 1SKAA 4MX8A 1GQOA 5KWIA 4ZC1A 3UOGA 2O5EA 3N86A 4HBGA 3MWKA 3RVJA 3QVWA 3U4IA 4MMXB 4BFUA 1WX1A 2Q50A 3HCWA 3W90A 2IY8A 3MJFA 1Y8RA 3BG5A 1JHQA 1JJVA 721PA 4ND8A 3TDNA 2REBA 3WWDA 1PJLA 4EMBA 1KMIY 1R0LA 2OP0A 3EXHB 3RG2A 3EZXA 4LMPA 1NDHA 1ZH6A 2J0UA 2JAWA 2EF0A 2Q99A 2B6HA 3DPUA 4L4SA 2CLCX 1XCLA 5ALJA 3DAHA 2FRXA 3CZ5A 3GN2A 3QWFA 1QWOA 3EY4A 3V8QA 3LW7A 4J2HA 1H8ED 2G88A 5CUQA 4Q3CA 4HGYA 5SZJA 1BO6A 1N2SA 1E2NA 4G5OA 1LBQA 3OZIA 5HE8A 5GM1A 3BD9A 1Y42X 1U3TA 2WWRA 3QNWA 5JCOC 1PEKE 3NBMA 3AVUA 3AF4A 3AM3A 2FVYA 3CLVA 2RB4A 3R0IA 5IVPA 5CXUA 2WE7A 3CLKA 3BXEA 3GA7A 2C7PA 4R9UC 5BW8A 3DDSA 1MJHA 2EGUA 3WLQA 5IZCA 3BZUA 1X6VA 3WNVA 1Z22A 3PT9A 5HFAA 3ZCSA 1OAOC 2WIGA 3IT3A 3K0AB 1ZD2P 3UV7A 5HQJA 4U6SA 1UZMA 2HIGA 1AUPA 3OE5A 1I36A 1NUQA 1DZ3A 1QVAA 3M89A 4HBZA 4YP9A 4DWJA 4LF8B 1JXQA 5SY6A 1XTPA 1JEEA 2IDMA 2Z9CA 2J4FA 1IXZA 2WF5A 1CUFA 4EX6A 5HM6A 3N7TA 3HWX1 2ID9A 3BD8A 5LNK6 2GOYA 3NAZA 2AZDA 3VR0A 3DKIA 2H92A 1F8UA 1UZAA 1ZSNA 2P7HA 3K5IA 3WOVA 3K94A 3WKBA 5EN4A 4B6GA 3B6ZA 2WM9B 2X9LA 4DNOA 5B4VA 5EZSA 2Z6QA 1UPBA 5CHEA 2F8TA 4ZQFA 1WB6A 1M7BA 3CIFA 3GDWA 1DOZA 3SQLA 3WK5A 2C31A 5HK9A 2A0WA 1QRRA 2VKQA 4HVLA 5FV7A 5CXXA 2XF2A 4ZYZA 2QRVB 4DLXA 4B7XA 4B82A 3DWEX 1NUSA 2ZS7A 3LK6A 4FR5A 3VNRA 3L6UA 4NFSA 1JEDA 2P67A 2IEYA 1PT9A 4MUKA 4X8OA 2V1UA 3LPAA 4PAWA 2W2TA 2YMQA 4OCZA 1JR2A 1MQSA 1QFYA 1T8SA 1XTSA 2RJ3A 1XVIA 4ZV4A 5I8WA 4CEJA 2I6GA 4PLTA 1L5OA 1T8YA 1Z75A 1I3NA 1E9DA 1NSTA 3GVIA 4KZKA 4K9NA 1VPEA 1U04A 4F60A 3VU3A 1NQ5A 5TB5A 3GT3A 5KTRA 5LZ5A 5DGTA 1B14A 4NMLA 4M6WB 3DMHA 1SU7A 4DSNA 5I4CA 4MUNA 2JIDA 1J1IA 3F97A 4GICA 3ZWQA 5BSKA 1M83A 2AK2A 2YWDA 3QX8A 4GU5A 4HO1X 5B1DA 5NULA 1PVOA 4AG6A 1OWOA 4AJ1A 1I94B 2RK3A 1HUQA 1Z4NA 4TMZA 3GFBA 2HXYA 1S2GA 3TOSA 5IU6A 1Z6GA 2WJYA 2Q5LA 3A9UA 1ODFA 4E09A 5KSZA 3GZJA 5ARDA 4D4MA 5DTMA 3TQCA 5AD1A 1GZHB 4Y2XA 2QNIA 3W8RA 3H2KA 2RHMA 1W46A 4K9DA 4KQMA 1XD8A 1I1QB 3E48A 3QIAA 3V7UA 3V42A 1U0GA 2C03A 4X93A 1O0SA 5EHIA 1U7PA 5CVDA 3PQ4A 2PVCA 4PFSA 1ULTA 4WNCA 3PCXA 4FX5A 1T9BA 2ACKA 1DKMA 5IBQA 4O33A 3O1LA 3V4OA 5K01A 3TG8A 4OEHA 3BSWA 4ZOEA 1GZDA 4N3AA 3KOOA 4PHFA 2QVGA 2NVOA 3NDIA 3E9CA 2CDNA 3AHJA 3JQAB 5EKUA 1R4NA 1XTUA 2BM1A 2O0LA 3K9GA 5FTNA 3JYNA 1Y34E 4KQWA 1JLLB 4QPCA 2YHBA 4UXHA 4B3FX 3GLFB 2KYRA 4TTAA 4UPEA 2ZM6B 4BC0A 4HQ6A 3BCSA 1OF1A 2QAJA 2L2QA 4I5DA 1KJNA 5L53A 1T4BA 3K09A 6ABPA 1L5FA 1GQFA 1OIVA 1QYWA 2WVAA 3NBUA 5ALDA 3WGGA 4FFBB 4DQXA 3ED1A 1VLQA 2N9UA 2P0EA 4J43A 1KKMA 4JUIA 2X0IA 5B7NA 1J2UA 2ATXA 1E2KA 3RH0A 4M36A 2GKOA 3UCXA 5DRTA 2XJ9A 2A33A 4FZJA 1L1FA 2PQ2A 4GBGA 4YMHA 2QL7A 5FTMA 3VUFA 2FR0A 4I9FA 3QUTA 4NFHA 1NN1A 1JYEA 5ALRA 4I1PA 3N5KA 3EDMA 3WBJA 4NKRA 2ECFA 3AUXA 5D84A 5AW7A 4ABTA 2E6KA 3MMSA 4JCCA 3AIMA 4GDMA 1TDJA 2PGLA 5FA5A 5FWDA 1L7VC 1W4CA 4UPDA 4LWPA 3W2GA 2QRNA 5C1DA 3MS4A 4HRAA 5A7FA 1A9XB 2F3TA 3U7RA 4DABA 2QPOA 4MB6A 1ENPA 2M32A 2FW7A 5BP7A 3HXTA 2VBIA 3T6KA 4JU9A 4HXEB 4C3UA 4RJJA 4KWIA 1YZTA 1NMQA 3WLRA 2WAMA 3HXLA 1OQAA 4QX6A 3NB0A 2PH3A 2QTBA 2ZCJA 3ZU6A 4P6VF 1N2HA 4IZ6A 3O4VA 3SF8B 5SZHB 4BU1A 5DP1A 1QBGA 3F2IA 4BV9A 2JI6A 3MOIA 3QFFA 4M1WA 3RBAA 1AH2A 2V0GA 4DRZA 3P0JA 5HIAA 2HBYA 4CMEC 5BQPA 2CXUA 4RC9A 1T6ZA 4NH0A 4Q4LA 4WXEA 5B58C 5K7SA 5ILOA 1K4KA 3DXXA 4WTOA 4XX0A 3I0MA 1U28C 2QW8A 1GA1A 3X1ZA 4B4DA 1OLXB 3T7RA 2IHVA 3I2JA 1A98A 1IDOA 3JD2A 4NFYA 3CBGA 2JGMA 1M2VB 2XMPA 2ZJ5A 3DR3A 3FYCA 4LX0A 4MLPA 1IYZA 4I9UA 2Z56A 3X2EA 4G0OA 4Q1AA 4K1LA 4Q0MA 2JJ2A 1ADYA 1RKBA 4EFKA 1Y7IA 5GVRA 3QBTA 2WV7A 1AQJA 3KXDA 1WNTA 5AKYA 3U7GA 4D9FA 2HIMA 5KHAA 4V3BA 4EGCB 3SQXA 3PZRA 4P82A 1JT2A 4QJ5A 1BCSB 4TTVA 4AC9A 5AFSA 3EGWA 1D1QA 1BNCA 3BMOB 3I37X 1CF9A 4FDMA 3RVRA 1GKKA 1RXUA 2A4MA 2WNIA 3HEMA 2B4RO 5AVSA 4JJ8A 2ZZMA 2OAGA 2AOWA 2FP3A 2Q6OA 4MI1A 3UMFA 2TECE 1D8TA 4M1MA 3W8FA 1EESA 4X84A 2GZ3A 3BTVA 1B7GO 4D8XA 5BSVA 5JVDF 2AE1A 2VT3A 4LXIA 1RJFA 1ZESA 2WYHA 3C3AA 3HVIA 1HC7A 3IMEA 4M21A 4OH7A 4OHPA 4TV8B 5D3KA 5HJ2A 4DVJA 1USVA 4YCNA 4JB2A 4DCJA 4IDNA 5C8YF 1QIEA 2I6UA 2G9NA 3UJ7A 2HZ7A 1HO3A 1FFXA 3U0BA 1P5HA 2HWUA 1M1YB 1M8KA 1TM4E 1VJRA 1Z18A 2RGDA 1NJ6A 3TLBA 4X20A 1ST3A 1WZEA 2ZDGA 4IOJA 4EMSA 2X2OA 2GNAA 4M8KA 2O7NA 4YAWA 1J1ZA 2QMQA 5FOWA 2H1SA 5BSTA 2A0UA 2VA9A 3V1YA 4Y6GB 4DVGA 1T6YA 1ONBA 3TK1A 1XBTA 4CCSA 5CT9A 5IK2A 1OVMA 4JQCA 5KU1A 4JXXA 2E49A 3ZUPA 1XXHA 3EMVA 5ENDA 4NPHA 3GJRA 2ZJ3A 3LYAA 3RJTA 5F9FA 2X23A 1E5TA 1KYXA 1SG6A 3DBVO 3ZLVA 4EAAA 3QTTA 2H4WA 4LXUA 4QE3A 1HQYE 3L4KA 3SQOA 2JGFA 2LD4A 3KR2A 4HZUB 3G5UA 1FQWA 1QH9A 2VK2A 4EQ6A 2MU1A 4JC0A 1QH1A 3FW1A 2J5BA 5JUWA 4B6OA 1ZUNB 1RZUA 2FEXA 2R2AA 3C16C 4I7EA 4R7TA 4DMCA 1W9HA 3KSAC 5G2OA 1HTTA 2H3HA 2R3SA 2WJHA 3IE2A 4L2IB 1Z4JA 3PFBA 3PDCA 3RS4A 3UMGA 3F5DA 4OMUA 3AR6A 2EJVA 2PCJA 3BSYA 1MJGM 3HFJA 1V2HE 2WHRA 3C3XA 1Q0UA 4JFRA 1TAUA 2V4ZA 5UKDA 3K1AB 5DP2A 2H2IA 4YDQA 2AV6A 2HI0A 1UAYA 4H4EA 3D8RA 1GPNA 3TINA 1RQGA 3PDIA 4I4CA 4ZA2A 3QUSA 3W2IA 1KZ1A 1UJ6A 3AKCA 3JRXA 3L06A 3N28A 5J4HA 3EFEA 3INNA 3DMNA 2DRIA 3ADPA 3HI4A 4GMGA 4LDRA 3W5HA 4A2PA 4QYIA 5I7SA 1SHZA 1M8JA 2Y0CA 3ZW8A 3CRZA 1NR1A 3FMPB 3DTVB 2F2TA 4LSWA 4B76A 1KDRA 1T8WA 3C3DA 4Q4DA 4P93A 3ZIUA 4EEZA 2R1TA 2GLXA 4I19A 3R7WB 4MS1B 3RS9A 3VNVA 3CR7A 1O08A 2W71A 3OZEA 1Z17A 3N70A 5D5HA 2NZJA 3ROZA 4MV8A 1QFMA 1O95C 4YIHA 1NVGA 1QG2A 4CDNA 2OQIA 1F8FA 4B3IA 3K53A 5IEBA 3V8NA 3KXIA 4CJXA 1TQ2A 4TMFA 4ODIA 4BJ3A 2HXSA 5HQTA 1BD3A 3I8OA 4XDYA 3OJXA 3RUHA 4WBNB 1YCHA 1L7OA 4MJ7A 4ZO4A 5LNK1 4D0GA 4NU0A 1XRPA 2OTCA 3SYNA 5F2NA 2GK6A 1P9NA 2XDAA 3Q10A 2DKFA 1T2AA 2FKAA 4WHMA 4BO1A 1XVVA 2OXEA 4ARZA 3NIWA 3UPTA 2BFCA 3QA3E 3BULA 4KUHA 3F6CA 1PJQA 1V8DA 3TFQA 5HQ3B 3B1ZA 4FBGA 1FXSA 3BIOA 5LYJB 1P7CA 4F3RA 2WD7A 3IJ5A 3TD6A 4X5OA 5FFNA 2FG7C 4WBXC 3PL1A 4FGJA 5JRZA 4UU0A 2X2PA 5HTKA 4O4JF 1DQZA 2JZNA 1YOVB 1T3LA 2ZJAA 5HIKA 2F55A 4QOGA 2QTAA 1SVMA 2JAXA 3W3ZB 3ZWAA 5JMWA 4LY6A 5DRYA 1O77A 2D5BA 3H7AA 1FVHA 2O8FB 1F6BA 2QV0A 4GG1A 4MEJA 5H02A 4JB3A 4C4AA 3RRYA 3IILA 1MG5A 2QTNA 3G2PA 4UNIA 3X3HA 1FVOA 2FAXA 2XMDA 1KEWA 2QRJA 4I8XA 5JCJD 4ZK2A 5BWNA 5KQRA 3T7CA 2JBWA 2XCIA 2R6HA 3TCXB 1TUEA 1FMLA 2ZUUA 3DDNA 4YH1A 5AKIA 4ZXFA 1XMOB 1ZW6A 3CNLA 3SZOA 4BAZA 1EINA 1Z8HA 3BSSA 5AK6A 1Q0RA 1MU0A 3RC2A 5KNDH 3E5RA 1CERA 1VG1A 2IYNA 4FIDA 5AHWA 1J09A 3ICOA 1MO5A 3WYGA 4BO0A 3BL6A 1MABA 1E5QA 5BSHA 5ALWA 2JJ1A 2BAGA 2VSFA 2Q3CA 3K0HA 4C0HA 1GV0A 4E2FA 2WP8J 2GXSA 3QHPA 4IJ5A 4L9WA 5A6SB 4IIFA 2C4NA 1JEQB 1T6NA 2HK7A 4Z1MA 2B0JA 2P65A 1P3Y1 2HQSA 3BGOS 3K0AA 3KLPX 4X97A 1M0WA 2B36A 1K88A 1YZNA 2SKEA 1T5OA 3SNHA 4DLSA 1QOPB 1VLZA 4EBFA 3NUZA 5JXGA 1N5IA 4CV3A 1LS1A 1DXQA 1XWIA 5BYJA 2F43B 1PJAA 5B3JA 1Y9EA 1IEQA 1J25A 2D3TA 2ZYWX 5CFPA 1W88A 2JFUA 3JD1A 4OL0A 1JQKA 1RXIA 4Q9NA 4ZT6A 2ORIA 4H08A 1IRXA 3FVQA 5MHTA 1XZLA 3IUYA 3KOUA 1DWUA 2ZUBA 4QHYA 5B1EA 3WC4A 2CNBA 2QG6A 5I7EA 5TLSA 4ZVTA 4G56A 2MJLA 4CQMA 3ADKA 3WJAA 3E3OA 3M4ZA 4H0NA 3ROEA 3UN1A 1JZTA 3DDCA 1GRNA 3AG5A 3VZCA 5LA6B 3WGJA 4XVRA 1GU0A 3WXBA 4INJA 4UHKA 4F1KA 3PXBA 4MDHA 5EUCA 4D9BA 1O94D 2QRVA 2XD9A 4J3NA 4GD3Q 2XB6A 1PNQA 3LF2A 3B6IA 4QUEA 1MF7A 4EI8A 5BN3B 1BWQA 1UANA 2XOXA 3DZKA 4HNAA 3W8DA 4TS1A 2Y0EA 3O3CA 1UC8A 1NVFA 1R5OA 1YHZA 2H1CA 1U2QA 2ID4A 1ULZA 3CX7A 3LDGA 3O2NA 3DTNA 2BEUB 4NSNA 3H5AA 3H2BA 4Q1EA 4M54A 2Z08A 1YQDA 3FCSB 3SF0A 3DHYA 3ZXSA 1FZQA 3L7DA 1RVDA 3KWMA 3TLXA 3KQHA 3GEBA 4OYHA 1MZPA 3FVTA 4KO8A 4ZCRA 5GGXA 2JLSA 3QW2A 1ORHA 3AHCA 3OHSX 5EQDA 4ER7A 5BV2P 1HYQA 2J3IA 1YS6A 1HETA 3TECE 4J1NA 4GZMA 4M6WA 4AG3A 1DRVA 2WFLB 4TYQA 4X9XA 5FBRB 3B2EA 1WS6A 1X1DA 2PKYX 4OFZA 2ON6A 2XWSA 2ZU6A 1TFUA 3GRKA 5A0FA 4RVCA 4TYPA 2G0NA 4D9EA 3LIIA 4BRWA 3U3ZA 3HDVA 4FEYA 2QLBA 5DBOA 4HLNA 2PYDA 1ZUHA 4G4SO 2QYOA 4XJSA 5E3HA 1ZJZA 1HWYA 1X7XB 1V16B 1T0HB 1SIUA 5F4BA 1Z56C 3FBGA 4IUYA 1YDMA 3LY8A 4LHVA 1NHWA 2QYSA 3CW2A 1IXYA 4ZYXA 4U5QA 3Q6NA 4QXQA 3ICEA 2EHJA 1OA0A 1OROA 1TJ4A 1EFDN 4PC3A 5HOEA 1CQIB 2WABA 1ZXXA 1WRBA 4AAYA 1XKTA 2PSHA 5E7IA 5JH7B 1Y6FA 4ND7A 5JMTA 2NU7B 2OO3A 1B4DA 2R1VB 3K2IA 5DYNA 3HEAA 4P35A 3JQAA 4BCDA 3BXHA 2A9PA 1N0HA 3GLFA 1JLLA 1QPZA 2ZEJA 2QD5A 2Q8QA 3H99A 3H86A 4TX1A 2FPSA 4BE4A 2WW8A 4K8OA 2I66A 4WAUA 3UMCA 4GMHA 1P0FA 3HA5A 4ZIRB 2J7PA 3SLKA 2W83A 3WWPA 2CGEA 1J2EA 2DKOA 3L6RA 1AHPA 1J22A 1EDZA 4F5ZA 3TDMA 3WA6A 4Q47A 4N18A 4U8GA 4LPSA 3CCCA 4R2MA 3U9TA 5FI3A 3E23A 4B40A 4CKEB 3A11A 1VG9B 4OYLA 5T8KC 1QO0A 2HJSA 4KK4A 3GH3A 1WQ3A 2GF9A 4RSRA 4IWXA 4RVUA 1ZNYA 4AUNA 4GBJA 3G9QA 3OQ6A 4EVQA 1YWGO 1JQ5A 2GLTA 1HFEL 4FFPA 2XOKD 4NYJR 2IYQA 4IO1A 1A9XA 4QPPA 5DCLA 3J80A 1ZCZA 3Q8KA 2CHVA 5MN6A 1R74A 4TWAA 3EDYA 1ETHA 3RUDA 2WTXA 2UXBB 2BRUA 3HMKA 2G07A 1RCTE 1UFOA 3H5LA 4D3XA 4JGIA 1JSCA 2RIRA 3IP9A 4M7OA 1E58A 2H4ZA 1WLYA 2FRDA 2JGJA 2YN4A 4MYRA 3IQWA 1QOQB 3T15A 4QICA 4DT1B 2VYND 2VXOA 4C87A 2YRWA 1MXHA 3RUFA 2EG5A 3TQTA 4CN9A 5ITVA 2EZTA 1F7UA 3SF8A 3TSAA 3O90A 3OOJA 4F4JA 2FSHA 2NSHA 5JFGA 2XY4A 4UFOA 2FPKA 1AX9A 2ZRMA 1NHGA 3GU3A 4F2GA 2CEAA 3KD2A 3FRIA 1KK3A 3DOFA 4B2PA 2JI9A 1U0BB 2VF5X 4EGSA 5DNUA 2YXPX 3U44B 1EFLA 1Q15A 2BFNA 3EUAA 3SEAA 1SH7A 3EFOB 3QA9A 2B0CA 4YRSA 1F17A 4G09A 5A3RA 5JJ5A 3UB2A 3WL8A 5JXJA 1P0MA 3WLAA 4B6FA 1M2JA 1PS9A 4XJTA 3I1JA 4HGNA 5G02A 1V11B 221PA 2GCOB 2V6JA 3ETLA 3QQ5A 5D2CA 3RIHA 3PDUA 3DZBA 5JI2E 3IAM6 4JR2A 1JJBA 1G6HA 1D4AA 1SO8A 1JVBA 1UJCA 3ND7A 3WYNA 3A6ZA 1YRHA 2HGZA 3HGTA 3QF4B 3OJEA 3E3AA 4LX8A 4CIYA 3DFZA 1BCSA 5CU7A 1PVVA 3L4BC 4HMPA 4A8HA 2IYAA 3BMOA 1WKCA 1KVUA 4Y18A 2A67A 3AB8A 4OGGA 4ZRDA 4FFMA 3WGTA 5FB3A 3ZG6A 4EJ2A 3DBRB 1AK2A 5EE0A 5DE3A 4POOA 3OFKA 3QEMA 2RHTA 3D9QX 2OCBA 3MM4A 5FYDA 1R27A 4NE7A 2BLNA 4JI1B 1VL8A 1LPMA 4MYCA 5H59A 3SR4A 1LKZA 5BWCA 3THSA 2RKWA 3EEYA 2NZ2A 2W6JA 2R97A 1FXWA 1OLSA 1X3SA 4WV3A 1NYQA 3RF6A 4UUOA 1ISPA 3E5MA 1BX1A 1PHRA 3HKEA 5DTJA 2RMKA 4L0QA 3U3KA 4FYPA 4RO0A 1GZVA 3ENQA 3NATA 1V96A 2QX9A 4GNRA 1U9YA 1UL1X 3FSGA 4BAGA 2C3PA 2E0IA 3PIRA 5IDXA 4OFWA 2R5NA 1IBCA 3IBYA 1KVSA 3LBYA 3AVWA 4UOEA 4TQ9A 1GEGA 2O48X 5B3AA 5I9TA 1ZNQO 3L7MA 2RBGA 4JIGA 1T9GR 2YCBA 2QN9A 2QIPA 1V95A 3OJLA 1BGXT 3H0EA 3QPVA 1TGYA 2ZROA 4BLWA 5JJLA 5FTKA 2QUJA 4JQOA 4D3YA 5LZ9A 1OC4A 3UK0A 1I2CA 4IM7A 3AR3A 3IUMA 3TRKA 4XUDA 4LHEA 1SXIA 4J9UE 4DXAA 2E4VA 5CPFA 4LFAB 3LZDA 2JGAA 4BFVA 1H1LB 3CW9A 3ZU2A 3MGBA 4HI0E 4J2TA 3ECCA 3MERA 2O2IA 2COKA 2E4YA 4XDZA 2EVWX 1G4AE 5CVTA 4UBMA 1NW9B 7REQA 4ER5A 4AECA 2Y6VA 1ZUNA 4OB6A 3EZFA 4PX5A 3FOCA 2WSSA 2A5FA 2DWCA 4A23A 4CCAA 3A28A 5KWJA 1WMDA 4HWPA 4L2IA 4AL4A 2X22A 3EZ9A 1SCJA 1U8ZA 3PUJA 4UCQA 1AGYA 1FVFA 1LK5A 2QUHA 3CV3A 2I03A 4M1YA 4DSOA 2JLVA 4R54A 1PZGA 5L7YA 3BKWA 3U7EB 3GCGA 3D0KA 4NPAA 3K1AA 2ZUWA 2XKKA 4GRIA 4GS5A 1JNYA 1U5CA 2R86A 4GI7A 3UJ8A 3WLJA 4FI3C 3TGLA 4XVCA 3GMIA 1NWHA 1KXZA 2B94A 3YASA 3MTIA 4LYYA 4DDTA 2OZVA 5E0OA 1UWKA 4A7PA 1LDNA 2P2ZA 3C6BA 1GN9A 3GBSA 121PA 4KREA 3H6HA 2QI9C 2HLDA 4RXMA 1IOZA 2MSKA 1E7WA 1VI6A 4DRXB 2GYUA 2YRFA 3HDYA 4E21A 1APBA 3DTVA 3M6XA 4QGFA 2V65A 2XSZA 3BGIA 4MPTA 5KNDD 5EPEA 2Z6VA 2GRUA 3MJTA 4D7AA 2R62A 4KX5A 3GLHB 5J63A 1G3RA 2ZXUA 2F3QA 2B8TA 9GPBA 4V2UA 4UVGA 2G4CA 4MS1A 3WGKA 1VJ0A 2AUTA 3HVKA 1L5QA 1R7RA 2I62A 4CMKA 4MDFA 1F7VA 1BW9B 2MINB 2G36A 4FUTA 4M8IA 5ICSA 3HWWA 2F1OA 2YH2A 2JLUA 3Q9LA 1QJCA 2HO4A 3FDJA 1JTVA 3EPLA 4PR3A 3L1JA 2JL1A 1KYQA 3DMTC 3PQFA 1R66A 1CP2A 3OVMA 2CFOA 3KFLA 3BMNB 3OPNA 4GP6A 1S96A 2N0SA 2YL2A 3LXRA 1VSVA 4KXQA 2GO1A 3L6EA 5TQVA 1OASA 3U37A 1JJ7A 2C88A 4JI7B 3HV2A 3F6RA 2MIIA 1FUUA 1QAOA 4NIMA 3H2ZA 2HDHA 3L2OB 4QL3A 1ULHA 4I1IA 2P2SA 1EZ1A 5LYJA 3ZKWA 3VA7A 4ARCA 1YTLA 3ZDDA 1FQOA 3D2CA 4Q3BA 5LP1A 2RGNA 4RV4A 3RW9A 3RSSA 3PFFA 3GJQA 2FQXA 2GJAA 1F0PA 5EYPB 2O8CB 4OP2A 3PNVA 4KAFA 2JFGA 3V2IA 4ZDIA 5E8JA 2VZ8A 1PG0A 5MN4A 3EVNA 3NZEA 4ZJZA 1LRJA 3M6IA 3VJLA 4HPXB 4R1TA 1BFUA 2HCBA 3ORFA 5CURA 2GGSA 5KJFA 3MAGA 1Z73A 3FPGA 2E5LB 2O8FA 4QOSA 2CLOB 2W6OA 1GN8A 3LXXA 4MVYA 4MI6A 5CJJA 1UM8A 2VNKA 2VH2A 3QUAA 4BNDB 3AVXA 1ULSA 2MTBA 2O07A 1P77A 1YDEA 3OJWA 4QFMA 3L9WA 5REQA 2PQ6A 5IKOA 3FHOA 4MHTA 4FQ8A 1OD6A 3KQPA 2MT9A 4PRLA 3W77A 4MVJG 1CV2A 5AR1A 4DLKA 1NZFA 3QY9A 4GPBA 3ZHUA 3LA8A 3D6MA 3CJRA 1TO1E 3ANSA 4N03A 4QTZA 3OQNA 1ZQ9A 1HMYA 1C7ZA 3LCCA 4PVCA 4C4YA 5LOVF 4WLVA 1CQWA 1JHAA 4D9HA 4PXAA 3CW8X 1BHJA 4GSKA 3CVUA 2R47A 3JQCA 5A6SA 2XTMA 4QXAA 1JEQA 4OKSA 4BMOB 4U63A 5ESXA 1D9XA 1XVTA 4IHJA 4U00A 5CM8B 5KYUA 3V1KA 2JLZA 1YHYA 1YZ3A 1RWNA 4DDHA 1LQTA 1YRBA 3NANA 4G0VA 4LOIA 1W0KD 1MC1A 2I1WA 2IP1A 1HYEA 5JSQA 3QUQA 1AKUA 2SNIE 5ALZA 1PS8A 1YIDA 2F43A 3BCUA 4NPCA 1RKQA 3GJ7A 1K75A 1I6LA 4RK7A 1H23A 4KOEC 3RSFA 3K0EA 4A8JB 3HJUA 1TZ2A 2ZVPX 1R0YA 2R8OA 1EVZA 4Z7JA 3LLCA 1E1CB 4XRRA 2VJKA 2WF7A 1L7BA 4IVRA 4XSGA 5THXA 2HA2A 3VX4A 2BH9A 3OEED 3I1IA 3UJHA 5KWEA 3E3LA 4PAQA 4S2EA 3LD9A 4HNUA 4HNRA 4BVBA 2ODNA 1Y4AE 2O2GA 4FZ5A 3AR4A 1JHUA 3FYSA 4PIPA 2VP6A 3GBVA 3MXTA 4PRKA 5LA6A 3OQ1A 5KJ1A 3HBJA 3INTA 4IJWA 2VDOB 2DR0A 1IWPB 2PRSA 4TVKA 3NRBA 4Z2YA 1H6AA 4W7HA 3T4UA 1EXWA 1MJFA 1XKQA 3LC2O 4ITRC 3F6BX 2XA9A 4GBMA 1GZ4A 1RACA 2ZSHA 4XYEA 4I36A 2ZZNA 2GAFA 2BEUA 3E70C 5EIOA 8MHTA 4E51A 1AZLA 2BUAA 2CL0X 3R3JA 1IIBA 4WLEA 1ZMOA 5CT8A 3GLTA 1J6UA 3EN0A 2ZTUA 3ADCA 3KTAB 2A0FA 2H57A 2PFKA 2ZR8A 5DVZA 1DRUA 3DNFA 3FYHA 5KTNA 1WY7A 2O8DB 4HAUA 3IQDB 2WFLA 3WZLA 1DWQA 4E46A 6ADHA 5EMHA 2C9ZA 1PJZA 1ECBA 1EWVA 3ZHSA 3K9NA 2KHZA 4M8LA 1UQUA 2CDCA 5ECGC 5JCZA 1JWBB 2HCRA 1GNTA 2IVZA 3BB3A 2PV0A 3AZOA 2OQ2A 2RHOA 3EB9A 2X7HA 4X95A 1QB7A 5T41A 2XJ4A 4NULA 4D43A 4I5FA 3RB8A 3Q9UA 3SQNA 4FYXA 2FPXA 2ACWA 3AI1A 2XR1A 3UY4A 3AVQA 4MUHA 3NVAA 4E22A 3DPIA 2RHRA 3DE5X 3EF1A 2E1PA 3LDUA 2CNWA 5AVJA 2WE8A 2Y1FA 2GJ9A 2PX3A 5FJJA 2DPHA 4DADA 2R96A 3W6NA 5CLLA 3SSMA 2A5JA 2R68A 4YJ3A 2EWWA 1T0UA 5WRFA 2OD9A 1W4LA 3EDQA 3H2IA 3IOCA 4QBKA 4DIKA 3EQ9A 4QWWA 2P9JA 2W6ID 3CIOA 1ID1A 1CQIA 5JH7A 2X9NA 3LT0A 4LOAA 5TC4A 2B1IA 3R9KA 4ZANA 4B7UA 4DQUA 1WBDA 3I01A 2DE0X 4K3UA 4FYIA 5G3YA 2PL9A 3NT4A 4UEQA 1USGA 2IYLD 2HH9A 3VM6A 2YIDA 2O8VA 3DKVA 1DKLA 1GTRA 1N6IA 3HNOA 4E88A 1DX9A 1AD2A 1IXKA 3GPIA 3RRMA 2DPYA 2BV3A 2PTHA 1U0RA 4WOPA 3SLRA 1UPTA 3GLGB 1NG9A 4H77A 2CSXA 4HUQB 2P9CA 1TLFA 1AURA 1N5KA 4WESB 3S40A 2G04A 3ESRA 3IAM1 5KYNA 3KT6A 5KQMA 5TEVA 3AP3A 1GQQA 3GGPA 3JVEA 4V39A 1VKRA 3P0RA 4DDMA 1QVZA 1Q6YA 2RARA 1LW6E 2A1TR 1XTZA 3WADA 2MSWA 3LX4A 1XZ8A 3DLIA 1D4FA 4FR0A 3VAZA 1PGOA 2KB0A 4DCPA 1A97A 2EYQA 1AOXA 3T7DA 4DWVA 2P68A 3UKDA 1DO8A 2BDTA 1ICIA 4QREA 4H3SA 2XUGA 3HY3A 1KAEA 3ETEA 4GRDA 4QT0A 5AIAA 5BNFA 4M49A 3VVCA 1DIAA 1P4AA 5A06A 1OHHD 2CNNA 3D6UA 1OV4A 1X1TA 1IJBA 1QK5A 2II6A 3D3JA 4QBGB 3U1VA 4YWHA 2QX7A 3AF5A 1Y3CE 4LOKA 4FONA 3WG9A 5K4GA 1Y9ZA 4BQSA 3QJYA 5JC8A 3G82C 5JZBA 3HI6A 2B4YA 4JBWA 4WUVA 1FS4A 1T2NA 5DCWA 1VPLA 1VHQA 3WLEA 3PGLA 2GK4A 2YV5A 5EE1A 3Q0IA 2O2ZA 4DLNA 4DT1A 1VZ3A 1YBMA 3NU1A 4KGVA 3LTNC 3BS4A 3RFXA 1QKIA 5J5VA 4DUGD 5MF6A 5H8WA 3ACBA 4BP1A 1E7QA 2LCIA 4KAXA 3VKVA 1S4MA 3EQ6A 3CX6A 3B7GA 1ZGGA 1BQ4A 5EFOA 4B3SB 2L42A 5C4MA 5JSFA 1W76A 2ZYIA 3T3EA 1KZGB 5G0WA 3EFOA 3WP1B 5CT5A 1YZYA 5KJEA 1KSGA 5CDHA 1XVUA 1LPBB 3D7NA 3DGFC 3Q1LA 3PWTA 5K4HA 1E2HA 5AWFC 4P7GA 2RK4A 1LX6A 1IHPA 3PPXA 3ZE9A 2R8XA 1DMRA 1V11A 2GCOA 4BMCA 1DAEA 1W4AA 2GR9A 2VL7A 3PE6A 4TWBA 4E03A 1ATIA 1R0SA 3EAFA 4FZ3A 1OBHA 5LMNB 5H7XA 4NAVA 3IDFA 2C20A 2CYBA 4B3BA 2PL1A 3KIPA 3QF4A 1B26A 1HSZA 4K6OA 1V1RB 4CLRB 4DSUA 1N78A 2VUHB 1XWWA 1A5BB 1EE2A 3CX3A 5M7EA 3KJEA 3HRKA 5IH7A 4IV5A 1KPGA 2R4TA 3EQZA 4O1MA 1YUMA 4TLBA 3D3KA 3EQ7A 3IDAA 3MPUA 4L74A 2F1RA 3WQSB 3VO1A 1ZK3A 5CNKA 2E4ZA 3ZXIA 4N5LA 4YJFA 2WSIA 1R5BA 4S12A 1ID8A 3G13A 3QF7A 3A3PA 1JU3A 1TTQB 1LY1A 3BQ9A 2EGGA 4FJ1A 4MVCA 5EA2A 3KQQA 1OFGA 1MO3A 5IJZA 1CG6A 3FGZA 4DR4B 2BMDA 2W2LD 1SUAA 3T9FA 1D7AA 2WPDD 1A9RA 1KTIA 4H0FA 4MQFB 5LJIA 3DZJA 2G9UA 2PK3A 3O8OB 1Y6QA 3LUGA 2WT8A 4ZCQA 4BVKA 3ZQ4A 1BC5A 2TMGA 1TMKA 2ZRDA 5F7OA 2JC3A 4OXQA 4GXQA 2G70A 3FH0A 4G0YA 3PC4A 3BZWA 2P2YA 2OYCA 1BAPA 2BP7A 4OU4A 5FOTA 3GEEA 5FP0A 5J2UB 3SS9X 1KP3A 2CXNA 2VDVE 3BGSA 3PHBE 2J5QA 4H1TA 1G8SA 4JLNA 1R15A 1G3IA 1LPPA 4BNWA 2YDXA 2E4AA 4E3WA 4ISCA 4LXTA 1EFCA 1RYZA 3U0VA 1KI8A 1XTBA 3I3OA 5TEWA 3PE4A 2HK8A 1A0OA 1YJQA 1DEOA 2W4QA 3CLRC 3OQBA 3Q1KA 4CUKA 4DBLE 4GE3A 5L3VA 2G0TA 3PHCA 5GZ3A 2X1MA 1XD9A 3L7YA 1Z6QA 1DKOA 3Q41A 2HU2A 2FZCA 3SYKA 1Y80A 2WUFA 1XT6A 3KOMA 2ONCA 4IQ8A 2ZATA 3VR2D 4UCWA 2OFPA 2I4RA 4ILKA 4YPFA 4UEOA 4ALLA 3D6TB 4RTJA 2ZJ7A 3HO8A 3H05A 2NMVA 1UFKA 4BKOA 4IINA 3TAHA 2A59A 2B8NA 4WOJA 3ZE6A 2P91A 2H29A 1F9EA 3K2EA 3IT1A 2OHGA 4J16C 1NLYA 1RM3A 3QNUA 3JVIA 5E0KB 3EAGA 1YA4A 5BMVB 1E6LA 3FCAA 4M9ZA 1RQXA 2C97A 2JIPA 2NUPB 3NUQA 3AM4A 3LXMA 3ER6A 5A9SA 1YR8A 1NY6A 4I1OA 1E3WB 3T3IA 1CUSA 3OT1B 2EC5A 5JASA 5K0LA 4B44A 4JT4A 3PHIA 3RNOA 4BQIA 1SIWA 1IFXA 4QTYA 1KFKB 4K9RA 2CMFA 1BXKA 1T0BA 3FZYA 4IX1A 4F8EA 1E8NA 1TM7E 1SURA 1NFFA 3R3XA 4WIAA 2G5CA 3W05A 4RHXA 5TMPA 4GIBA 4HGOA 1YONA 2AG6A 3X1KA 3T5BA 4DIMA 4DN6A 3AEYA 1FEZA 3KEFA 1TM3E 1I5RA 1WD5A 3LCRA 3K8OE 4H18A 5F21A 4M0CA 1RRVA 3JQ9A 5LXTF 2TSYB 1BS1A 1W2GA 1XLUA 2GN1A 2PT7A 4LC0A 4MUBA 3TZLA 3ZZMA 1P2SA 5LMCA 4QGSA 1RAFA 1FP1D 3L8CA 2FN4A 1BW9A 3EGEA 4W5NA 3OECA 4B48A 4QFBA 4YTEA 3L4JA 1V1JA 1TA4A 2A0YA 2GJSA 2ZYVX 4NABA 1CYEA 2IXAA 3U3OA 1DTSA 2DUWA 2IQ5A 1J0DA 5M2QA 1PL0A 3KX2A 3C45A 5ELLA 5HRCA 3O9VA 2M9MA 1PWXA 5DM70 1A9OA 1MCZA 1W1UA 1M2KA 2ZT6A 3D6FA 3BMNA 3FMVA 4PZCA 2OMKA 3ZLJA 3NP7A 2DR2A 2OBMA 1B73A 1I01A 4EGAA 1KE2A 2WWIA 4FEAA 4JOQA 4A91A 4EATA 1US8A 3JVVA 4KR6A 2AI1A 1NUAA 1XMPA 1TECE 4N7MA 3R8XA 4UNRA 4U5XA 1N4DA 1T2DA 2GARA 3BRWD 2WTBA 1OIXA 1YS2X 4G0MA 4AMVA 5EYPA 2WA2A 2O8CA 2PUAA 1WVMA 3D6AA 4MW6A 2AOTB 4OX9B 4GR9A 1BXRB 2OV6A 3PPVA 4M0LA 1ZMRA 1POWA 5G1NA 1IVYA 5AH0A 3UJAA 1NI3A 4E94A 2C0QA 2QDXA 3TF5A 1O97C 1H4TA 4GMFA 2QBYB 3D3NA 1R00A 1Y6ZA 4UM9D 3R9WA 2HUPA 2RGBA 5L7TA 2VDQB 3TOCA 3K8QA 3CLHA 3H5RA 4IPTA 2M6KA 4Q19A 4MIEA 3CUYA 1HE3A 1JIXA 1DBQA 1XPRA 3LC0A 3GJYA 4X65B 3C1OA 3P7MA 4C1NA 3OJOA 1WIWA 1VBFA 2Y6UA 4IZHA 4Q15A 4KHPB 4CV0A 2Y9PB 2HWWA 1D0SA 2VUIB 2JLQA 1WVIA 2XGMA 3JR7A 3LP8A 4JLUA 4NS4A 3X1WA 4YJ2F 1GXSA 2YJZA 2EARA 2ZI7A 2YNMD 2RJNA 2GILA 3H04A 4X66B 1YMUA 1V8BA 4IIJB 4LYFA 4BRSA 2FWMX 4RWZA 3ZU4A 4CGZA 1CUUA 1LTKA 2BFEB 3D0QA 3REQB 3UXHA 4OJNA 1QFZA 4TVOA 3X1MA 3H1FA 3BHIA 3UW3A 1K3FA 3I72A 1JR3A 1PP4A 2R2GA 5G0SA 3K70D 5AOBA 4HDRB 4YRJA 4A8JA 4EZEA 3L1HA 2IYZA 5BSWA 3QNMA 2F4VB 4V0NA 3ZWPA 1H22A 1E1CA 5AW1A 2LUOA 1ES9A 4OUKX 4YCCA 1F6WA 1UK6A 1C3OA 3RUIA 3TR6A 4NCHA 5CM9C 2EGHA 1RQ2A 4D26A 5DK6A 1SU8A 2QLTA 3OQHA 4NU6A 5F76A 2V98A 3T54A 3KK0A 3MJEA 4X44A 3GAZA 4D4KA 4EITA 4Y2VA 4ZN6A 4AZSA 1RTKA 3B85A 1V7PC 1LDYA 2EBUA 2X86A 4AKEA 4E14A 1Z13A 1V4VA 4TVSA 3OFNA 3I52A 5TT0A 3BD7A 1QUFA 3WBBA 3PK0A 3EEFA 4F6CA 3FROA 5IHXA 1JWLA 3MUEA 4F8JA 1QNLA 1JSRA 1FMJA 4FOPA 1L5LA 4RMNA 4YA6A 3BIXA 4G8JA 4BHTA 1IVNA 5JZOA 1KMNA 3ND8A 1J9EA 2OY0A 4JJEA 3T95A 1ZJWA 1V26A 2Q8NA 1PJCA 1Y1PA 1FLDA 2NTJA 2ZJYA 3BIJA 3H5NA 4ZAZA 3TRHA 3ZBQA 3DKKA 4B47A 4I1VA 5JAZA 4UMDA 4MHSA 3JWGA 2NWQA 5K8TA 2Q1WA 3DEAA 3KTAA 4LISA 5B1SA 5C1IA 2L69A 3A70A 3MRXA 3I2HA 3CVVA 1THGA 2O8DA 1OOEA 4BPBA 1AXRA 3GXOA 5CEFA 4OJTA 3GGSA 3NORA 5DO9A 1Z6ZA 4C01A 1JKXA 2X8BA 1Y1TA 1E9FA 3PE3A 5ALXA 3FD8A 2PH1A 4O63O 4PYOA 4UUMA 4DMRA 5HUQA 1J39A 4V0RA 3U7QB 2KBEA 2JGNA 5BR7A 1HX7A 1Q92A 4WY2A 2EKDA 4EW6A 1XSEA 3QV1A 1SEPA 4M86A 3IHWA 3M5CA 2ZZKA 1TVCA 2G76A 4KSCA 5F51A 2JB9A 3FGPA 4L3VA 2FJUA 2QR5A 1RXWA 1BFDA 2ZE7A 4A27A 2O59A 3LLSA 3SHVA 1P8AA 1II8B 1I6WA 1SUFA 1GL7A 2H2AA 5CK4A 4TL7A 4I5GA 2PKEA 1V8FA 3BWCA 5G3ZA 3MJDA 4EYEA 2ZR0A 4UZFA 3H1AA 4Y30A 1TEZA 1BCRA 2GCEA 4IWNA 4BQQA 3B48A 3VPFA 3OZTA 5DGIA 2YWEA 2IYFA 4DCNA 2ODEA 4X41A 3WIVA 3VTAA 3PGKA 1R37A 4Z86A 1YKFA 2C29D 4P5PA 3WLOA 4OSPA 3RROA 4DZZA 1CCWA 2FU5C 4P36A 4BKUA 2V9ZA 3GLGA 5ALQA 3ITEA 2ESRA 3NC0C 4HUQA 5JTTA 1XVAA 2OCPA 3ZCUA 3DM9B 2FSVA 3F6PA 4KMOA 3CSDA 3LOPA 1XP5A 5SZKB 1G55A 1OXSC 2IYSA 4GWGA 2J85A 2I4LA 4WINA 1LC0A 4IJQA 3V8VA 3FWPA 1QGZA 2XNDD 4G0NA 4X6UA 1CLEA 2L82A 4CMIB 4OBWA 1O4VA 1A9YA 3H2SA 4NJEB 4A16A 1FS5A 3ADOA 4QEZA 3KSBC 1GUFA 1TCCA 1P1JA 1WPQA 4YJGB 2NNLD 2VTDA 4HAOA 5JZ9A 1T43A 3PUVA 5K0NA 3ED5A 5EHZA 1Z9BA 2YVKA 3BHMA 4A03A 1IJKA 4CM9A 2ARKA 1ISJA 1EK2A 2MSNA 3I9V1 5A5VA 2RGGA 3QI2A 4KR9A 3QJGA 2P9TA 1TKAA 4YUVA 3WISA 2GEVA 3R77A 4PZDA 2YR0A 4PYIA 2EKBA 3EGVA 4WEQA 5CX1A 3TMAA 4B1FA 3MHTA 1ZH2A 4DKXA 2NZUG 5BO5A 1NXVA 5L3SA 1BXGB 5F3RA 16PKA 2XXBA 3SY8A 3HABA 1AKMA 2P3OA 3V8RA 3N2YA 3W04A 4XA8A 3DFMA 3LM8A 3P96A 1WCYA 2ZRCA 4MZDA 4Z9FA 1L4EA 3HO6A 4XB1A 5K6AA 1SVKA 3NOOA 1NR5A 1SQGA 3TTUA 3FKSD 3TTSA 2VDRB 1WZCA 1SVUA 2EZ4A 1A4RA 1KY2A 3ILHA 3KEQA 3IP3A 4TV8F 4TKVA 4JHLA 3B53X 1PR5A 4RX1A 1DB3A 2JGIA 2WKRA 3OG9A 3AU8A 4BEBA 3M1YA 3K0CC 3D8NA 1EG7A 2IKQA 3IQFA 5EIAA 2AMJA 3IQEA 3MJHA 3IR6A 3OH8A 4INZA 3GFSA 4R0VA 5D00A 3VZPA 4XR4A 3QG5A 3WE7A 4E5NA 1P7VA 2FHPA 3BJIC 4MRNA 4NI5A 2DVMA 5P21A 3N2ZB 1R8SA 3FXAA 3L1KA 4AO8A 3W6OA 1N2ZA 4TSKA 2IBTA 1C7JA 2YMMA 1VBMA 1HR0B 5FTWA 3WOHA 4HTFB 1V1RA 2GEUA 2UUOA 1JRLA 2YASA 4UOQA 4DIDA 4CLRA 5KTOA 4OXKA 3BMCA 3CEAA 5DWQA 1NF8A 2ZIGA 2D74A 2PYIA 1Z3CA 4FK8A 5TIIA 1A76A 1VL6A 3V34A 5AVVA 5KYUB 5BRJA 2OXCA 4QO7A 2IIPA 3ICQB 4IF4A 4FU0A 3CRRA 2JATA 3CZ4A 2Y1LA 4JLOA 3STHA 3FPHA 3W5JA 4A1FA 4K6HA 1NGSA 1KGSA 1JU4A 3NWPA 5AK0A 5HRAA 1D6JA 2FEMA 4NBSA 3VNSA 3FPJA 4BLUA 1D09A 3IVAA 1Y1LA 1JECA 3COYA 3FJOA 5EI5A 4RA9B 2V7UA 4E1VA 1CB7A 4H7DA 3U13A 1D1PA 5G1OA 1W73A 2PMKA 2Z2IA 3OBIA 4MQFA 4X92A 1DUIA 5PGMA 4DDKA 4F11A 3O8OA 4XYLA 3U40A 2DXIA 3PJGA 3SX4A 3VJMA 2X7JA 3PRKE 1N34B 3IESA 5DYIA 2G8LA 2IIQA 2HN9A 3CHYA 4J0KA 4LQ4A 3ADDA 4N8SA 4EG4A 3N74A 4JODA 1LX7A 4ESEA 3VOAA 3DVSX 1J21A 1B76A 1HEIA 2OLJA 2PSDA 2VK1A 3P0FA 3AYXB 4Q03A 3E9NA 5CMLA 5ILQA 4DQVA 4MVJM 3L1IA 5H3CA 3E84A 5EINA 2DLNA 4C4XA 3VR3A 4ZARA 1RHKA 1OR8A 2YWJA 1CEQA 1J8FA 2Q46A 2ZXFA 3H6KA 4UAUA 3FR7A 2ZYUX 4WOBA 4KNWA 1E18A 4R83A 1T9GS 2PGDA 3MJRA 4MGHA 3EVCA 4ZTUB 2H18A 3DONA 1U3DA 1LF0A 1S2MA 3TD2A 3D3WA 1X13A 4G1BA 4RHTA 2OXFA 4BVAA 1SNYA 1EA7A 3AOEC 4OK3A 3GCWA 5AHRA 1Q0LA 1WXEA 4MW9A 1U8EA 3C8HA 3MC1A 3NO4A 5BW6B 1FFSA 4KFRA 2IK8A 2M6LA 1E7SA 3VV3A 3A1CA 1ICEA 2WTAA 4LTMA 4B6EA 4IX9A 4RHUA 2IWHA 4WBNF 5KO2A 5U4XA 3AILA 3LBNA 1QV7A 2HX1A 2ZRFA 3N8HA 2XRMA 2IYPA 3DF9A 2DCUA 2C2ZA 3Q3CA 4ID3A 2RHJA 4PYLA 3V7NA 1WPRA 4EPYA 1IM8A 3CPEA 4R98A 4BNGA 4AX8A 4QXPA 3OT1A 3OLXA 1NBAA 2IZ5A 3G0GA 1D07A 3PR2B 2VCHA 2PZJA 1S4QA 4DR1B 3WDLA 1TEXA 3PXXA 1S8NA 2ZAOA 3F5SA 4G8BA 1OH7A 4LBYA 4ZVUA 1NVWQ 1OW3B 1BWPA 5JRDS 3KVRA 3IL2A 2DPMA 3I23A 5JJCA 4HFRA 1YU6A 1DNPA 2I1VB 2Q1TA 4F3YA 3HC7A 3OAAA 4AMGA 5IT5A 4JDUA 5EXDA 3RSQA 1P5JA 3BDVA 3VX3A 3NHSA 3HVUA 3AVVA 3FSJX 3IUSA 5HKOA 3GBPA 2GAJA 3QFTA 1DFHA 4G2NA 3IS3A 4O08A 4YRRA 1L4LA 2PKXA 5LBUA 4KQJA 3RT7A 3F3KA 3CGWA 4UAVA 1RKVA 2RI1A 4IDDA 1QHGA 2ZSJA 1TJNA 5DCUA 3AMVA 5BSEA 3L7KA 1U1CA 3TG2A 3C97A 1OFTA 3OZVA 4W5HA 1X9GA 1M2FA 3AETB 3M81A 1TZBA 2W58A 6NULA 3PDWA 4BPRA 4QM7A 1GGVA 2WYVA 3I6QA 4ZQIA 4MSUA 2WFMA 5IAEA 2RC5A 1E9CA 5D3QA 1KI4A 1U1EA 1DAKA 1KORA 1RE1A 2VC2B 2WOJA 2GK7A 4HX5A 4KFUA 3J81A 2Z5LA 4OTZA 1GU1A 3VO8A 1UP4A 2OL4A 3DL2A 3WMWA 1LCIA 1RLOA 2W5UA 2Y1EA 4LE2A 4O59O 4QULA 4UTVA 3EVDA 1XCPA 5YASA 4B75A 5B6JA 1CNEA 1UBMS 4GHWA 4BUZA 5JE8A 1Y81A 3LGSA 1DQNA 2DZDA 2EERA 3V4ZA 1PJBA 4FVTA 2Q28A 4NDAA 2OAP1 1IY9A 2AOTA 1LI4A 2YV1A 3B9QA 1BXRA 5AXBA 4A0QA 5AYVA 3F78A 1Z2DA 3RTGA 4FTWA 1PR1A 1V4BA 2GT1A 3P9ZA 4BCCA 4CL2A 3QFRA 2BHTA 2OT3B 4R1SA 5J43A 4FOOA 4KBGA 3T52A 1OIWA 3ZCPA 1Q44A 1SRRA 3Q88A 521PA 3LS2A 5IG2A 4OOFA 2QBYA 4HUTA 2QJWA 3ICWA 1OPXA 2XI4A 4BFZA 1XN4A 4XAQA 2ZM5A 4CMCA 1QWSA 3QWBA 1TZCA 5IJXA 1WPXA 3P32A 4BQNA 2FPPB 2P30A 2G40A 2WU8A 4K03A 3LKDA 5LPNA 1FDWA 4RTPA 4GKKB 3GDHA 3KJIA 4XGQA 2RHWA 3MMXA 3KPVA 4ARSA 4LI3X 4N3GA 2FUNB 6REQB 2FPGB 3F3YA 1REQB 4KQXA 3I62A 3NJ8A 2FWRA 2R8BA 3BXFA 1E7MA 4YCBA 3OF5A 2Z2YA 4R2LA 2YJTD 4Y2UA 3TD9A 4AY3A 4AQ7A 3GEMA 3GRYA 3HSSA 1ST2A 1QHHA 3D1JA 3KZ1E 4RXTA 2NXJA 4IIJA 4L5CA 4C2AA 3KFXA 5HWSA 4MV5A 1FFDA 4I3FA 2VZEA 5DLEA 3ZD9A 2Z4TA 2BFEA 2ZQZA 3OLVA 3B6JA 2AZMA 4M98A 4HY3A 3REQA 1J23A 2CY0A 4RD4A 1Z74A 2VH5R 1EFHA 2HV8A 4FB5A 1TM5E 3U80A 2GFQA 2WU0A 2CK3D 4TUYF 4CDMA 3I12A 4PZ0A 1QS0A 1ESCA 4RK5A 3ZH2A 1M6VA 4TMWA 4JI5B 3WTCA 1NFRA 1TKBA 4OJKA 2O2YA 4ZDWA 1TKRA 1R8QA 4HDKB 3STWA 4C2UA 4EHKA 3K5WA 5AVTA 2HWXA 3EVBA 3QJ5A 3UH0A 5BSFA 4EHBA 1ZH0A 3AKDA 4HVAA 5HK8A 1S1MA 4XFDA 2WWWA 4K46A 4QXOA 2F00A 4CKCA 2YIVX 5KQPA 2BGIA 2V59A 3WGIA 1FOEB 4B84A 3VH3A 5ERGB 1T8RA 3LRPA 3PNBA 1VGQA 4GMXA 1ONOA 1MVOA 1P2VA 2FFQA 1TOAA 1KI9A 1DCTA 3QE4A 3PV0A 3VPSA 3R0QA 1DARA 1JQBA 2YVUA 3MGGA 4G23A 2QSYA 3M3PA 4HNGA 5JLAA 3TN7A 4Q1FA 4IS2A 4Z0PA 1M1ZA 3A1VA 3CUEF 2BEWB 1H85A 1HOXA 2VAXA 3TLJA 4E07A 1KSHA 3OSZA 1XNRB 1MT3A 1HZJA 1PR4A 2DJ5A 4CKWA 5I4IA 2H7YA 1NP7A 5ENZA 4DGQA 4R0MA 2Q0QA 5KCMA 1JFSA 1NQOA 1E2DA 2JBHA 5K0CA 1H2XA 2V97A 5B3JC 4B4VA 1O5TA 1PLLA 2PXHA 2CCJA 2ENWA 4UULA 5DNCA 2YINC 1B2LA 1V45E 2CT8A 5HF6A 2Q3BA 5ER6A 1UXJA 3ILXA 1ZM3A 2J6BA 2X15A 3DR5A 2R1ZA 4RFSA 5TQ0B 2J33A 5FPKA 5E2BA 1BMFD 1E1NA 1B6TA 1Z8FA 4L50A 1YRWA 5J4KA 4KTTE 3U7QA 4G1EB 1V5IA 3ROFA 1R0BA 3EYWA 1RE0A 4XARA 1A27A 1ZXBA 3NKVA 4QIHA 3WGHA 4OLBA 2AYYA 3CRVA 4NU8X 1PD0A 1TQ4A 4EOGA 2YXDA 1II8A 3CA8A 2L17A 3OICA 1YA6A 2C5HA 4D1YA 4M46A 4AKHA 3ZCQA 8LDHA 1XL1A 3G7NA 4O2AA 3W9YA 4FYMA 2PZMA 1CZHA 2ZBRA 1GFIA 3VNQA 4BNZA 2G1KA 1I13A 4LK3A 5F78A 1P7ZA 3NTVA 2IZ6A 3EZNA 5LQSA 1DEHA 3MTGA 3SZLA 1UKEA 2TS1A 1PU2A 3EUEA 3VZSA 5ADWA 4CG0A 4AP5A 5CAEB 4J94A 4F92B 3FR8A 3UTDA 4YX9A 3R5JA 5AXAA 1FC0A 1NJSA 1DOHA 3ECSA 4BNJA 1P4JA 4DZRA 3KZKA 3CZAA 1MORA 3U4GA 4RCVA 1WEHA 4AZ0B 1S2NA 4J75A 4AY4A 1RBQA 5J23A 1XNQB 4JMLA 2YY6A 3C6QA 4IDGA 4M0EA 3WRYC 4EF5A 3BYZA 3PQEA 4TYYA 1KY3A 2C4TA 5IP5A 3FHTA 3ANYB 5BN4B 4C6TB 2VQ6A 1XQ9A 3FDFA 3TZBA 1RZVA 4CMIA 2AOXA 1KC1A 2V6IA 4U0KA 3ML1A 4PZLA 4EPRA 3FSEA 1TADA 2VQEB 4QELA 5ALUA 1B16A 1VJCA 3K9BA 2R4UA 2ZTLA 4RGVA 1EFPA 2ZE8A 3RFVA 1TPYA 2VI5A 2ZJZA 2CV0A 4QTXA 3ES9A 4JBLA 4MUFA 4OXIA 5I7HA 3NEYA 3NC1C 2DQZA 3ZDRA 4D8TA 2A1TS 2Y2UA 3K71B 3SWWA 2GN4A 4LWQA 2RD2A 2YC4C 3E53A 3HJGA 4RL4A 2AG1A 2C58A 3OY2A 3WGLA 3EEQA 2PBRA 3WZMA 1PLKA 4DG8A 5BVGA 3IQIX 4XH9B 4MCHA 4Y2RA 4RAOA 1WV0A 4XTRA 2JCBA 2WLTA 5JSHA 2XKAA 2D4AA 5H68A 5J59A 2RGUA 2VT2A 2G7ZA 3L0PA 4K86A 5D7BA 4DMFA 5K8VA 3HY6A 3G1WA 1O6CA 1XHEA 4HCJA 4E33A 1W36D 1ZEJA 4NJOA 4DIBA 3IT2A 1FUIA 5KTKA 4X8HA 2DWQA 4ZT3A 5TVGA 2FSPA 3ZBUA 3VR6A 1PDWA 2Y8EA 3NGXA 4MVJI 5IZCC 3G0BA 1OZHA 3CLUC 3CT4A 5FJIA 3WIEA 5HGXA 2VA8A 4KAAA 3FA2A 3OT5A 3GRVA 5F1YA 1MFZA 2F62A 4JWTA 4DM4A 1EUDA 1DAPA 3I9KA 4R2JA 5CFOA 1AO0A 1NX9A 3EWNA 1GDHA 2IYOA 3LX8A 1KE1A 1I5EA 3JWEA 1R8XA 3QVUA 1B23P 4HSEA 1P74A 4J9VA 4KO1S 2EXXA 2I8AA 2W2MA 3L43A 2I3DA 4P53A 3OLYA 2D1TA 5C1PA 4KRYA 1SXQA 3ZGYA 4ZOLB 2HW8A 2WKQA 4DCOA 4YAOA 4QUBA 4Y1FA 5CLFA 2J3QA 1M34E 1CUDA 1DWPA 3ASZA 4W82A 1S89A 3LQKA 4FC7A 1GQSA 4D3DA 4YAIA 2NQ2C 4UTXA 4YEDA 4DYDA 1MAAA 2D1RA 3CX8A 2IE0A 3L18A 4IGKA 1RMQA 4NQZA 4IJ6A 4YAFA 3I61A 4I1SA 3CVWA 2QE7D 1AKYA 3IGFA 4JOSA 4PZUA 4Q18A 3FGNA 4KNYA 4JZYA 2K6GA 4Q7KA 4MGYR 3KUXA 2HTFA 2XH8A 3K4QA 4A0HA 3GFQA 5K0BA 4ZT4A 3W8EA 3EQ2A 2NZYA 4RA9A 1BGVA 4IEIA 1CETA 4QUKA 4S04A 5AI0A 3H0CA 3TPZA 2PHZA 2H1WA 1G6OA 1OT5A 2HKIA 4OXYA 4ZAWA 2OFFA 5KU7A 4ACAA 3HR7A 3O2JA 4GSYA 1C0PA 4L4UA 4RNCA 3IJRA 2V9CA 1SKYB 3O75A 5CA0A 2XQGA 2IP2A 1C9KA 1G0OA 2QORA 5CD1A 4KXLA 5CGZA 2NVBA 4OFXA 2OM2A 1X86B 2KWIA 2H7XA 4KLCA 2LDXA 4JUAA 5D86A 2DBZA 3SIWA 2R6AA 3T3GA 3K35A 3X0DA 2AEFA 4C7MA 4CU5A 1QTQA 4MQMA 5JNLA 1SC9A 1Q6ZA 1RPJA 2QAIA 1YGPA 3KHKA 3NALA 4DPLA 3H1TA 1RPNA 3AUJB 1E69A 1QVWA 1W8DA 3RTEA 1Y3FE 2VN8A 3ZJ4A 4L6CA 5AHOA 4X91A 4MKIA 3G3EA 1RAEA 2WG0A 4F71A 3KVNA 5CFQA 4L57A 4LQDA 1TU3A 2WTNA 4ZT2A 3WB9A 2QMEA 3U17A 1YS1X 4PPQA 4QTTB 3DL0A 3GV0A 2JFNA 1RJWA 3A4VA 1Y5LA 3IOMA 4D9GA 1N5OX 4HXGA 1CZRA 1R0WA 1CEXA 2ZTHA 1R6DA 4K6MA 4IIUA 1AJEA 3PC7A 4O1HA 2RKOA 4CI9A 1ZKMA 1ZJYA 1ZHHA 1HPLA 4BMZA 4LVNA 1RYMA 1VMEA 2YHIB 3B12A 4WN9A 5IYZA 5EHQA 1SR8A 1UK7A 4KE8A 3ZWBA 1DV1A 1XNGA 2HU7A 2QM0A 1YT5A 2Z09A 2IP4A 2NUBA 3NX4A 1CR4A 2ZUVA 3EIOA 4GYKA 1L7DA 1V3UA 1AU9A 3ZI7A 3GFVA 1K68A 3K09C 5EKDA 3LFTA 1CUBA 1OWMA 3IUEA 3W5UA 3NWOA 1Y3HA 4G3XA 4L3WA 3SSAA 1WOYA 1BU5A 4M1EA 3RR2A 4C4ZA 2VJOA 1QHEA 4Y2YA 3CSSA 2R7KA 1QCZA 4LJ4A 4DMKA 4QQKA 1K2WA 3QVOA 2JASA 1U2DA 1KVQA 4EYGA 5IUKC 4NZ9A 4PXYA 2QLNA 1E92A 3SI7A 4TWRA 2G6BA 3ETDA 1L7MA 4KG7A 2FZVA 4IIVA 2QRZA 3E2IA 2XUPA 2KE5A 2ZBFA 3IFSA 4FDUA 1TPZA 4LDNA 4ZGBA 3L40A 3AETA 1TO6A 1KARA 2VHJA 2GHIA 1EVYA 3UJBA 3T35A 1T15A 1QX3A 1A4IA 5LLDA 2B92A 3AI3A 3STTA 4S3MA 4DAOA 1K8QA 2AWNA 3ZWXA 2IW3A 3V1LA 4DJTA 4KQ6A 2CFIA 4DIFA 4MO2A 1N6RA 2ZIUB 3WYDA 3MTBA 3FSRA 4X71A 1YRQA 2OECA 3FNHA 4Y1EA 4C0AC 5HKKD 3SC3A 2OV1A 3NHRA 4PG4A 4ON9A 2XNCA 1KYWA 1NKTA 3C70A 4W1PA 5DNVA 4JI0B 3PTZA 4B73A 2FW0A 2XUDA 1GSAA 1FBNA 2BKAA 1Z5ZA 1G6KA 1FJHA 2DCMA 1R8YA 3HVRA 1EP3B 5AKKA 3DGEC 3B3AA 1K8XB 1IONA 3LL7A 3OURA 4B3MB 2Q5EA 2ZTVA 2QYHA 2P78A 4LOHA 5COAA 2IWRA 3HA2A 4C4RA 1FFEA 4JP1A 4F04A 1Q84A 4CDGA 4EHLA 1QGUB 3MELA 3MLEA 2I5PO 4GEGA 3C7KA 5IUJC 5E2AA 2PBLA 4NE9A 1G21E 3IKJA 1Z16A 3OETA 1THMA 2PSFA 4F1JA 5L45A 1MJ5A 4JP2A 2FPPA 1SZCA 5AM0A 5A71A 1GNQA 1BOFA 4IICA 3LSTA 2XE6A 4LYJA 1ORTA 2RONA 4DZTA 6REQA 1Q20A 1JLHA 2NYAA 4LZJA 3B8EA 4NYMQ 4S1TA 4XQ9A 1XAHA 3VC3A 2AT1A 4MW7A 3PXAA 4I1UA 4KYIB 2AFIE 1DBRA 2PMBA 4LN1A 4P4NA 4DHEA 1TVEA 2AG0A 2ISSD 2O3RA 4BU0A 2XRZA 3HHEA 2PLAA 4BNMA 1BU8A 4OQXA 3NVKI 2YW2A 5TGDA 5E4YA 4A0SA 5FAXA 1HLFA 4U7FA 2H1VA 1VL5A 3A0RB 3WLLA 3PLRA 4F93B 2X3UA 2VJPA 2XE8A 5EE9A 3A6FA 4OBXA 5LQAA 5T6BA 2H07A 1CZOA 5EZ5A 2CHQA 4NNJA 1EXMA 2YICA 3RVLA 5EIEA 2VP2A 1ZIDA 4QEDA 2RH4A 1MO4A 1RI5A 2FK8A 4S1PA 4A4DA 1A1VA 1SVNA 3NW9A 4EVSA 1WW8A 2ZLBA 2JVJA 4GP7A 4HDKA 3VJRA 1TI7A 3E7PA 1VB5A 5IAAA 2NU8A 4L0DA 2VSXA 4GGOA 2IOFK 5ALTA 4OBBA 3U9LA 1XDUA 4LHSA 4PPGA 4V03A 3USES 5ALNA 5K0EA 1Z8DA 4XOUA 1DEAA 4MKHA 4CM8A 4ZK6A 5DI3B 3HCRA 5KNCH 4JIMA 4D4GA 1BEEA 5G4LA 1H5QA 3R5XA 1N2BA 2HXGA 2JJQA 5HG0A 2B30A 3EWSA 1S8OA 3KB6A 4KFSA 4U2DA 3VH1A 3TZHA 2P6UA 3KDPA 2VP4A 5JXHA 3OX1A 5HUJA 2BEWA 5CYFA 1N7IA 4QZVA 2FMFA 2AN3A 3GT7A 1BOOA 4P7JA 4YRLA 3ABZA 3OC6A 4U7DA 3IAXA 2GD1O 3F9RA 1WAMA 1U5AA 2CBZA 4Z4HA 1CIJA 4WKOA 2DFKB 4M9UA 4YNBA 2Y1XA 3F4BA 4PNHA