5P8WA

Crystal structure of comt in complex with [5-(2,4-dimethyl-1,3-thiazol-5-yl)-1h-pyrazol-3-yl]methanamine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
215
Chain Sequence
GDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEINPDCAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of COMT complex
rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Catechol O-methyltransferase
total genus 69
structure length 215
sequence length 215
chains with identical sequence B, C
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2016-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5p8wA01
1M6EX 2V74B 1X1DA 5MHTA 3LL7A 4GOLD 1FBNA 4P58A 1D2HA 2VDUE 4POOA 1UIRA 1L3CA 3TRKA 3QV2A 2JG3A 1VQ1A 2EX4A 4QDKA 4C06A 2PBFA 2UYOA 3GRRA 3BUSA 2BR5A 5FA8A 4BLVA 2OXTA 2AOTB 1QAOA 3FPHA 2YXEA 3SSOA 3UJ7A 1QANA 1VE3A 3KPJA 2QM3A 2HV9A 3MB5A 3PFGA 4HSGA 5DPMA 4E33A 2YXLA 2VP3A 4LWOA 5K0GA 1M6YA 5FADA 1MHTA 2BM8A 3E7PA 3FYCA 5FULA 1KPIA 3AXTA 4QVKA 2YX1A 1MJFA 3KPWA 2CL5A 3DLIA 3DULA 4X41A 1RI4A 5E2AA 5FQOA 2PV0A 4ER7A 5DLYA 1DL5A 3A7DA 1JSZA 3BT7A 4CTJA 5CCXA 5T64A 2ZZKA 2P35A 2PWYA 1RI5A 3GO4A 5E9WA 3GCZA 1NW3A 1XJ5A 3OE4A 5EMMA 3PTAA 4MTLA 1EG2A 4BP1A 1AQIA 2QE6A 4RTKA 5LQAA 4MQ4A 4EKGA 3GIWA 3P9KA 2IBTA 3KPYA 2PX2A 4R05A 3K6RA 3NW9A 2P7HA 3GRZA 4YUZA 4RTNA 5C0OE 1FJXA 4XUEA 4K6MA 3HVIA 3UJ9A 1WS6A 4PGGA 3SSNA 3ER9A 3UFBA 1N2XA 2C7RA 3CJTA 1NV8A 2K4MA 1H1DA 3G8AA 3TPZA 3MTEA 4E2XA 3LHDA 3E05A 2FPOA 5D1NA 2JHAA 3KPUA 2HMYB 3EMBA 3M33A 5CM2Z 9MHTA 3I53A 3C3PA 3HCBA 5DTQA 3SSMA 3DMGA 3B3FA 3OU2A 5EMJA 3C0KA 1G6Q1 1P39A 2XVAA 5K0NA 4G56A 4R6XA 1KPGA 2BR3A 4V0QA 5E1MA 4Y2HA 3HEMA 3ELUA 5DM2A 3PLAE 5CD1A 4AUKA 3CJQA 5DXAA 1R8XA 3G5LA 5EQJB 3MGGA 1NBHA 4OQEA 1PJZA 3RW9A 2B25A 3EGIA 5ICGA 3K0BA 2PJDA 3GDHA 5EHIA 2VZ9A 3DR5A 4KW7A 4HG2A 3NVMB 5FWAA 4UOEA 3OFKA 5HEKA 5ICCA 4DQ0A 1XXLA 2NNWB 1EAMA 2ZWVA 3G7UA 1D2GA 2H00A 5CIYA 2IH5A 3FPGA 5EMLA 1M0EA 2R3SA 1B42A 1XCJA 1RJEA 2PX8A 3THSA 3LSTA 2G1PA 4P7KA 3EVBA 4KDCA 2F8LA 4LECA 4CXMA 3ER8A 4LWPA 4RVDA 4JXJA 2CMHA 3CBGA 3Q87B 4V0RA 1XDZA 3LECA 1FP1D 4RSRA 3HNRA 2ZULA 1RJFA 3IHTA 4EVIA 2WA2A 3BGIA 4PYJA 2IIPA 3NWEA 3PB3A 3IV6A 3HA5A 4BLWA 5E2BA 3UJBA 3V8VA 3LKDA 1VLMA 1JG3A 2Z6UA 3KQPA 3E23A 3A7EA 4HTFA 2ZWAA 1NW5A 3AJDA 3EVZA 1WXWA 4GC9A 4PIPA 5ERGB 1NV9A 3EGVA 3SGLA 5K0BA 2FCAA 3OU7A 3NJRA 4P7GA 5CVJA 5LQUA 1L3BA 2V7EA 2OKCA 4ER6A 4DKJA 3X0DA 4FSDA 5GIOE 4B17A 3P8ZA 4XUDA 2Q41A 2G72A 1EIZA 2JJQA 3T7SA 4EQZA 3M6VA 2FK8A 4P7FA 4RTQA 2FHPA 4BY9E 2AZTA 5GP1A 4RV9A 3SR4A 1L9KA 3HCEA 5K03A 3F4KA 2IH2A 2YXDA 2GPYA 1G38A 3NMUF 2Y1WA 5U4XA 2ZBRA 3G2QA 5HZMA 4BP3A 1JG1A 3FTEA 2O07A 2QYOA 2HTEA 2ERCA 2P8JA 3C6KA 3GRVA 4HTFB 4RVGA 4DA4A 1YFJA 3OZSA 5K0LA 3QOWA 3DP7A 4M38A 5E9QA 4GOMD 4YV1A 2UYQA 1XDUA 5CCBA 1JQEA 2IGTA 5EGSA 1L1EA 2EJUA 3TM5A 5BXYA 3FUXA 2OB1A 2GS9A 2XYRA 2ZIFA 4HH4A 4IV8A 3VC1A 1JTFA 3M70A 3MERA 4M37A 1EQAA 1SUIA 1WZNA 2I6GA 3BWYA 3LDUA 2H1RA 4PCLA 5EIFA 5FQNA 3EVGA 3TLJA 2WK1A 4C04A 2P7IA 4Y30A 2Z6AA 4E2YA 1IY9A 3KQQA 3KR1A 4ER5A 2EG5A 5LQNA 5DRYA 4KDRA 5EIWA 1T43A 5K09A 1I4WA 4KIFA 3GNLA 3UBTA 1BHJA 3BKWA 3CGGA 1R8YA 3P9IA 3Q7EA 1O9HA 2G8NA 3BWMA 3HTXA 2FYTA 2YUIA 2O06A 2GLUA 5H02A 4AZSA 1KR5A 3P97A 2OB2A 2I7CA 1NW6A 4RTOA 5EC8A 5K0JA 5KQRA 2PWPA 4OA8A 3UJ8A 1IM8A 4A6DA 1NKVA 4CKEA 5E8RA 1TPYA 2P3LA 3EEOA 1L3IA 3UA4A 4RX1A 4HRAA 4CWAA 5DX8A 4HGZA 1SKMA 3TFWA 3BWCA 3C6MA 4CTKA 1VP3A 3LDGA 1DCTA 5IKMA 1QYRA 1ORHA 3HVHA 4PYIA 1YFLA 3IYLW 1AF7A 2GH1A 2ONYA 3G89A 1UFKA 3I5UA 3KQSA 2ZVJA 4ISCA 4C4AA 2B78A 1KPHA 2OPBA 1JR4A 5EMKA 4DCGA 4AZVA 1HMYA 2CMGA 2IPXA 4YMHA 3I58A 1G55A 5LQCA 1F3LA 2BR4A 4O29A 3REOA 4YV2A 4PNEA 3T7TA 2PXCA 1KYZA 3CC8A 3UWPA 3HA3A 3G2MA 1XDSA 3MAGA 2P1DA 2XYVA 5DSXA 4U7PB 1R74A 1D2CA 3PFHA 3ELWA 4M7RA 4DF3A 3LPMA 3ID6C 3MCTA 5EG5A 2XYQA 4FZVA 4OX9Y 3KU1A 1U2ZA 4QPNA 1IXKA 2JHCA 3GWZA 1AV6A 1JG4A 3EPPA 5GM2A 4DCMA 3G2OA 2ESRA 4C07A 2C7QA 5T6BA 3DXZA 3FTDA 1KXZA 1SQGA 3R3HA 1P1BA 3DMFA 3P9CA 1SVUA 3SMQA 5GINE 3LGAA 3FRIA 3DUWA 2AVNA 5ICEA 3DOUA 5EHGA 1TW3A 2LD4A 1RJDA 4QDJA 3P2IA 1XTPA 2GAFA 4YUVA 4IWNA 1KYWA 1Q0TA 2CWWA 3DLCA 3G88A 1NBIA 4E70A 3EVAA 3KKZA 2BH2A 3A26A 3P2EA 1QAMA 2UYCA 5BW4A 2IBSA 3LBYA 5FHRA 5FCDA 2C7OA 3DXYA 4WXHA 3GGDA 3FTFA 4PCAA 2ZZMA 1WXXA 1EJ0A 3HVJA 4FP9A 1WY7A 5EVJA 5T67A 3TM4A 3FYDA 5E1OA 4RTJA 4RWZA 3SM3A 2AOWA 2PX5A 4ATNA 3E8SA 4RVHA 5EZSA 1WG8A 1JQ3A 3EEYA 3HM2A 5DT2A 3UJAA 3T0IA 4F86A 3VSEA 5F2NA 3TR6A 2B3TA 1XVAA 4NECA 3GRYA 3FUUA 3S68A 1DUSA 4X63A 1R6AA 2XVMA 3ORHA 3R6TA 4ZTBA 1VP9A 4GOND 3DTNA 3GRUA 1G8AA 3BKXA 3NDIA 1X1AA 4KWCA 5EKXA 3R9XB 2NP7A 1P1CA 2PGXA 3OU6A 3EVDA 3OZRA 4EK9A 2IDJA 2QRVB 1F38A 2A14A 3M6WA 5CVUA 2GB4A 2HR1A 4X1OA 5FHQA 4L7VA 3BGDA 3HCFA 2ZLBA 3OZTA 4HC4A 5DTRA 5KS2A 1YZ3A 3B3GA 4R6WA 2P40A 2P3OA 4FS8A 4E31A 4HGYA 3NWBA 3P2KA 4FGZA 2IDKA 2NXCA 4DZRA 4EMSA 5JR3A 2OO3A 4PGHA 2OBFA 1XCLA 2DPMA 4GOOD 2Z6QA 1G60A 3OPNA 1P91A 5HIMA 3KQOA 3KQMA 3R0QA 2C7PA 3NVKI 4M36A 2O0LA 4GUAA 2CKDA 3A25A 3G5TA 4PYKA 4ER3A 3SXJA 3ME5A 3DMHA 3LKZA 3PVCA 5CVEA 5K01A 4KRGA 2AOUA 1TW2A 2OY0A 3B89A 1JG2A 2B2CA 2EJTA 1ZGJA 3EVFA 1I9GA 2R6ZA 4X60A 4A6EA 1AQJA 3KQTA 4FT2A 1BOOA 5HIKA 2ZCJA 5HOQA 2ZW9A 3G2PA 4MIKA 5EKUA 4GF5A 1KP9A 1NW8A 4QPPA 1NT2A 4R8SA 3BWBA 3I9FA 5C9ZA 8MHTA 4PINA 3TOSA 5K8VA 3DH0A 4WVLA 4QTUB 4RTSA 5GOZA 5C1IA 2O57A 3BXOA 1KIAA 3D2LA 5K0CA 2FRXA 1EJ6A 2OZVA 3BZBA 1BC5A 2IP2A 5P8WA 3LCUA 3I64A 3TMAA 5HILA 5B1SA 4OBXA 3KPVA 1ZHFA 1QZZA 1NW7A 3PS9A 4PYOA 3T7RA 1QAQA 4GQBA 4PYNA 3VYWA 3KHKA 3ELYA 2E5WA 3HCDA 10MHA 3ANXA 5F2OA 5EEGA 2QRVA 3PX2A 3CJRA 4YUYA 3EGEA 3M6XA 5CUQA 4EKIA 5LQRA 4YV0A 2AN3A 2ZZNA 4IV0A 3LCCA 5FTWA 4KIGA 3THRA 4RTLA 4RTMA 3GXOA 1X19A 3MCZA 1PRYA 5CVVA 5HIIA 3R24A 4OA5A 1ZGAA 5E8JA 5DM1A 3FUVA 2YR0A 4DM3A 1ORIA 3O7WA 3V97A 2BM9A 5E1BA 3KR0A 2KW5A 1JQDA 3GU3A 3O4FA 4PYLA 1RJGA 2QY6A 1V39A 1ZG3A 1INLA 1G8SA 2NYUA 4PYQA 5DXJA 3VC2A 2AN4A 4H0NA 2IFTA 2G70A 1X1CA 4YUXA 1I1NA 2VDVE 3JWJA 4P7JA 3FUTA 1VPTA 5GWXA 4C05A 3WSTA 3LDFA 3FPJA 1R18A 1SG9A 2AOXA 4AX8A 3H2BA 4MWZA 2AOUB 2P3QA 3FPEA 4FT4A 5LQKA 2VS1A 2ZBQA 1N7IA 3NDJA 4RVFA 2B9EA 5DX1A 2ZSUA 2ORED 3OCJA 3HVKA 3CVOA 3DXXA 1N7JA 3JWHA 4YUWA 1YF3A 5DTMA 1O54A 2PKWA 3RODA 3FZGA 3RIEA 2HWKA 5JUWA 1ZQ9A 3LBFA 1BKYA 3SVZA 3QOXA 2GA9A 5GIPE 4FSXA 3HCCA 4QTTB 5LSAA 3O31A 1FPQA 1X1BA 7MHTA 1VBFA 3LX6A 3PX3A 5EOVA 2NXJA 2AN5A 4Z2YA 1FP2A 3FPFA 5EEHA 4MHTA 2I62A 5FUBA 5LR6A 2G71A 2ZIEA 3EVCA 2PXXA 3KQVA 3MTIA 5E1DA 2NP6A 5E9JA 3CCFA 1UWVA 5DM4A 4GBED 5D1HA 3UA3A 4PYMA 2IH4A 4LG1A 4YMGA 3AWIA 2JHPA 3KR9A 1RI1A 2PXAA 2ZIGA 3P9NA 2OYRA 1YZHA 1R00A 3G8BA 3JWIA 5K0FA 2PLWA 1HNNA 2AOVA 4C03A 3MHTA 3ERCA 3UJDA 1JTEA 1VIDA 2AR0A 2WA1A 4QVGA 3JWGA 3BGVA 4RTRA 2NXEA 2YTZA 3TKAA 5EZQA 3LCVB 3SX0A 5FWDA 1JSXA 4OBWA 2PT9A 4AZTA 4CKBA 3MQ2A 3P71T 2JH9A 2PVCA 3ELDA 4RYLA 2H11A 4R8RA 2P41A 5GM1A 5BP7A 5M5BA 1ZKDA 3EMDA 1NE2A 3M4XA 3NTVA 2NXNA 4QQNA 4XCXA 5BW5A 3HP7A 5LQJA 3AY0A 3B5IA 4GEKA 3M6UA 2ZTHA 5K05A 3UJ6A 3UZUA 2Y1XA 3B7PA 4GC5A 2O05A 2N47A 4XUCA 5DWQA 1O9GA 5G02A 2PX4A 1VL5A 2PT6A 5HIJA 1RI3A 1SUSA 2ONZA 2YVLA 4PWYA 5DM0A 1OR8A 3L8DA 5KYGA 2I9KA 2XBMA 1Y8CA 1RI2A 1YB2A 3HA7A 3FTCA 3FRHA 4C08A 1Q0SA 4PIMA 4OQDA 3AXSA 4E30A 5ICFA 4FR0A 1YUBA 4IKPA 5DSTA 5IH3A 3CKKA 4F84A 5DRTA 5CVDA 3KQYA 3OE5A 2PY6A 3A4TA 3HCAA 4KVZA 5KVAA 3GJYA 4U7TB 3A27A 3U81A 4RTPA 4E2WA 4CKCA 2HNKA 2UZ4A 2BZGA 2ZFUA 5EPEA 2AOTA 3EVEA 2UYHA 2JH8A 5DX0A 3C3YA 4DMGA 3B3JA 3KR2A 3TQSA 2PSSA 4F85A 2DULA 5F2KA 4PONA 2AS0A 3OFJA 4AZWA 2VDWA 2ADMA 2FK7A 2ZBPA 5HFJA 4ER0A 1SQFA 5K0EA 5KQSA 3UJCA 1Z3CA 4BLUA 4E2ZA 3PT9A 3TKYA 2AVDA 2YQZA 3FUWA 4QQKA 4X61A 5FA5A 1KHHA 2EFJA 3IEIA 4E32A 3KQWA
chains in the Genus database with same CATH superfamily
4HDRA 4ZN6A 3K0AA 3NBAA 1S9DA 5BURA 4WBXC 1CJMA 4JR1A 1YB5A 5BSGA 1EK5A 3KYCA 5CAEA 4A3SA 1GPJA 5EJ7A 3HKEB 3S27A 2JGIA 2O2YA 4YRKA 2EQBA 5JLAA 2Z30A 4JGIA 1SRQA 2AOTB 4GWLA 2YXEA 1CUCA 1VMDA 4R0NA 3MWGA 5DTJA 3ZXUB 2L2QA 2YWEA 5L6LB 2QM3A 2ADOA 5DPMA 3FA2A 5HQJA 3NHZA 4P31A 2E6KA 3O6VA 3V80A 2E1RA 2QT0A 3NTRA 4LWOA 3DMRA 4YT5A 4TSFD 5AVKA 3F2VA 4PLFA 1YQXA 4X24A 4OH7A 4BRWA 4GWGA 1O6CA 2BN4A 4JJAA 1ZYUA 2F43A 1N2IA 4KSBA 5B6PA 1S6YA 1ECFA 1W0KD 1CB7A 1G6OA 2AX3A 1UP7A 3MAJA 4BN4A 1WSWA 5CB4A 5IT5A 1UK9A 2OZEA 1A7UA 4D98A 5LZ8A 5JXWA 4UUNA 1CF4A 2BDUA 2RI6A 1VG8A 1K66A 3G5AA 3SQXA 1WLYA 1CJCA 2R6CA 3W8FA 4S04A 1AKUA 3UXYA 4N1AA 4IF6A 3P94A 5G0UA 1RU3A 1FTQA 2AI1A 2O3TA 4DY4A 5KKCA 5J9FA 4E4YA 2VPIA 1P2GA 1S9HA 1QQ5A 2IPAB 3BGWA 3BIWA 3K9NA 3K9HA 3U3DA 4AG5A 2IC5A 1MA0A 3WP1B 4DM4A 3SZGA 5AESA 2DHQA 1U8CB 2OGSA 4AJLA 3ECAA 5KCZA 1JDSA 2H51A 1GZ6A 2J6CA 4KQHA 2HJRA 1PNQA 1WTAA 3GJ4A 5DW3A 5FI3A 5K3SA 5I47A 4OJTA 5CLIA 3B3FA 5FPTA 1UBHS 3ROFA 5E6SA 2G4LA 3HDTA 5JPDA 3DLAA 5NULA 3SKVA 1T9GR 1Y3CE 2OCPA 3HYSA 5GONF 1UJNA 3GZNB 2W0SA 1MAWA 4PTZA 1G20E 4NS4A 1E77A 3E8XA 5H81A 5EUMA 3DKPA 1YVDA 3B1WA 1WPQA 4RKFA 4E13A 4M1SA 5A7GA 2NQ2C 4D8YA 4KW7A 5B64A 1U0OC 3GPCA 2HA7A 4KH1A 3FTFA 1SCBA 4FCTA 4JI6B 4AJ4A 1LDGA 4FDVA 3I0NA 1A8HA 4Y7CA 2OAEA 3AJAA 3M5CA 2FEPA 4MW1A 1BXKA 1LH0A 3AVWA 3AG6A 3NR2A 1KDPA 3AM3A 3CZMA 3UPTA 1Y4ZA 2FWJA 2DH5A 3DOCA 4MEBA 4Z4GA 2XB2A 3BRWD 5KNBH 3E6AA 4FFDA 1YR1A 4DBVO 3PLRA 1WAMA 1OHHD 1PL7A 2R7MA 2YC2C 4I19A 4AM8A 5CCEA 2ZJ0A 3GFSA 1P1HA 3ZGYA 1DBPA 2BI7A 3OWOA 3KZOA 4MR8A 4OJQA 5ILGA 5M04A 4ZO4A 4A9AA 4S0XA 1J2RA 1II8B 2CFOA 1FYVA 4BL5A 4NYIR 1EXWA 3FHTA 4D8VA 1G2OA 4PIPA 1NNSA 1Q92A 4IOKA 3SGLA 4HAOA 4PAQA 5DBHX 3FROA 1BE8A 3WLQA 3FOFC 3BF8A 2IE8A 3NJRA 4MYDA 4ZVQA 1FW6A 3EIEA 3I0ZA 2OP1A 2ASVA 1IM2A 2VHYA 3W2TA 3B6EA 1VSQA 1R4MB 4AU1A 1A9SA 3QFCA 2G72A 1CUAA 1DFGA 1WXDA 4J0IA 1N2HA 2I8AA 1KI6A 3IVMA 4CYMA 1R10A 4R2WA 2PL5A 1F6DA 2OFXA 4LCBA 4TUYA 4ZVPA 5REQB 1Z7GA 5JNSA 3HP4A 3PE4A 4BMSA 4URYR 4B3TB 1FMTA 1P5HA 2QN2A 1ZJ4A 3GDOA 1A5SB 3AUYA 2C5BA 3RC2A 1FS4A 3AL2A 3NBZC 1JHDA 3ZWPA 1D2MA 1QRUA 1KAMA 4HYEA 3FTEA 1XTVA 5TMBA 3STWA 4DA4A 1ZWKA 1TKCA 2JGNA 3DZ8A 4CMKA 2F9FA 4J7UA 3WYAA 4CIYA 2UYQA 1OLUB 3RUEA 1ID8A 3Q3IA 2GBGA 3EPRA 2HJGA 2MR6A 2AZDA 3C1UA 1OGJA 3L6UA 3MTDA 4TMYA 1O6BA 3RBAA 2J41A 1LFDB 1UAYA 4JNCA 3X3HA 3ZE8A 3CPJB 1JQAA 5AJZA 3T5MA 3ZWYA 1XPUA 1B8PA 4TXJA 1XQ6A 5AM2A 4CKZA 3W04A 1XZHA 2V8OA 4FFMA 4A8TA 2V7VA 2VIIA 4MDYA 4WL0A 2Z9DA 2VG8A 4U1RA 5D6NA 3WK4A 2ZVPX 3LA8A 1WVGA 2FEWB 4KIFA 3W9UA 1KO8A 4DG5A 1ZZGA 3RSLA 2F8TA 1HQKA 2AC7A 1NF8A 4B1FA 1XE3A 1PR3A 4TWRA 2IWRA 3WY9A 3GJZA 3HYRA 4K86A 4BX3A 2PMDA 1FB5A 4MJXA 4WGGA 2FVXA 3HS3A 3OLCX 3P97A 1CRQA 4LJ6A 4AZSA 5JCZA 2PWPA 3RGWS 3MN1A 3MTGA 3OKPA 2WSBA 4GSYA 2X4LA 4RY2A 1K86A 1Z0JA 2BMVA 4HUTA 1EX9A 1M1NB 2ID9A 1NONA 2ZKIA 4ZPXA 4BTEA 3AR6A 1L3IA 1JYSA 5EIBD 1PBNA 4PG8A 5CM8B 5HOEA 5I3CA 3T3NA 4US0R 4JL5A 2Q1TA 1ODFA 1BX0A 1VP3A 2QQGA 4E2FA 5KSYA 1ORHA 2K6GA 4ZI7A 3I5UA 1PP4A 1I4LD 3I23A 4G4GA 4UTOA 1I2ZA 2OQIA 1G3UA 3ESZA 4YMHA 1GG9A 3VGJA 1PKEA 3F67A 3FWPA 3TK1A 5CFPA 1MP0A 3MXTA 4Z0PA 4PQRA 1OSNA 2Y6VA 5T4EA 2BBOA 2LIPA 1N3YA 3ADKA 4ZU6X 2WM9B 1Z4QA 3VX3A 1QG6A 1QX4A 2B69A 4U0KA 3ND9A 4F4FA 4CMJA 1KYTA 4JSYA 5KTKA 2MYUA 2UAGA 3LPMA 5F7ZA 4IINA 3NBYC 2C9DA 1E92A 2CCJA 4RZSA 3LVRE 3KYIB 4JY7A 4YAOA 3WLIA 2IUFA 4MDHA 2JKZA 1FTSA 4DCMA 3OJCA 2YC4C 3Q11A 2A9VA 2PYDA 3EQ8A 3PQCA 3CRW1 2OBBA 2C7BA 1KXZA 4J9UE 1O87A 3ASUA 1NVEA 1DV1A 2JEOA 1MUUA 4NU5A 3A58B 3SMQA 3TQSA 5F78A 5LN1A 2WQ7A 3JARA 2PL3A 3G3EA 4TQUS 1KVUA 1ODLA 5EMNA 1LDNA 5GQSA 2JHFA 3A9SA 4K28A 2W8BA 3ZZTA 4DV1B 4GSLA 2HYIC 4PO9A 3CSSA 3S2GA 2PGDA 1VSBA 4MCJA 3A26A 1HT0A 4DW8A 5BW4A 1VYHA 1V5WA 1DZ3A 3NFYA 4NMHA 4O59O 5FHRA 2JGJA 4EQ6B 5LFAA 3ZOZA 5IM4F 1SXPA 3T7IA 2X0EA 4H4DA 4OU4A 4K9SA 1ZP6A 2I65A 3ZDYB 3V4PB 2Z08A 3GFTA 1W7AA 1F4VA 1GFZA 4J1QA 1DB3A 2PX5A 3RE1A 1GPNA 5DT2A 4L7QA 4Q9AA 1AD2A 2GZDA 1L4FA 2XI4A 3H6KA 1CK4A 1UZUA 3IOBA 5F4ZA 1QDUA 1RAFA 3T5CA 1B23P 4XTRA 1NE7A 1PT9A 1H6CA 3PGKA 2EW2A 3RFTA 3UO8B 4TLDA 2PGXA 1MJ5A 4V0OA 2H9IA 3QMWA 1L7PA 1XN4A 3MGCA 4L4YA 4N7BA 1N77A 1JHZA 5K6RA 1E66A 1V3QE 4PO1A 4B83A 1LPNA 1IQUA 2IEZA 2GCNA 5AKLA 1KI9A 3K5PA 2G1KA 2QD5A 2OA0A 1IH8A 3U4HA 3D4OA 5TGTA 2L17A 4YK7A 3WMEA 5JQGB 2AG8A 4FS8A 3GXBA 1YRWA 4FW9A 3HKCA 1W5TA 4L72A 1ND6A 5JR3A 2ODTX 1BX3A 3X1JA 2DHDA 1FUEA 1LI4A 3JARB 3OJLA 3M49A 2AFIE 4NBUA 5CNKA 4B5LA 3A0RB 3T1HB 4CEJA 2QN6A 2WTBA 2AI2A 4PRYA 1BN6A 4BLSA 2YMPA 1F7VA 4OXKA 1M1YB 3GVHA 1Z5PA 3HY4A 3SXJA 3KHTA 3GLFA 1K3TA 3SICE 1QP4A 4G07A 4TRRA 1X2BA 2QTCA 4MOWA 4EW6A 1BXZA 3IP9A 3AJ8A 2TECE 3Q0EA 3QA3E 4PG6A 4V0NA 4UREA 2H1HA 3Q3GE 2CXRA 3PUHA 3OLYA 1JA1A 1U63A 1VL1A 4Q82A 3VR4D 4H0CA 1G8KA 1YK0A 4GF5A 4H60A 2NV2B 4OLJA 1S8OA 4YO8A 1GVNB 2IZ6A 4Y2XA 4PPGA 4MGYR 4JFAA 4ZQIA 4U02A 3UN1A 1ST3A 2FSGA 4WXRA 5F35A 2QX7A 2IYYA 2JIRA 3PS9A 5A5FA 1MB9A 3VMMA 2WF6A 3VHLB 4QPJC 3LBHA 4E5VA 1KXJA 1LVGA 1M2JA 5ERXA 1LVHA 2R751 4EJ0A 5FL3A 1PZMA 4MEJA 3RRXA 3SOZA 5FBZA 3VNRA 4YV0A 1AMUA 4POAA 3ZJTA 4Z4FA 1DPGA 2H4ZA 4WT7A 1UDCA 3GXOA 3L0CA 1E6UA 2QTVA 2R85A 2HK7A 4RHEA 3VVMA 1O4WA 3NPMA 4CODB 4BNGA 1RYZA 2QBYB 4EKEA 5L95A 2MIIA 4DM3A 1NUPA 3H5WA 1XQXA 4DQXA 4RK5A 2WHPB 5ALMA 4X64B 5KOHA 1CR1A 3M5PA 5BV7A 3IX7A 1RYBA 3L0PA 4NE9A 4TT3A 4RY9A 1QGED 1DIAA 4MRNA 3S70A 1XELA 1QCCA 1ZG3A 1HYGA 1I9CA 5FPYA 2AL7A 2J3LA 1XTIA 5EIOA 4KJXA 2O5VA 4V3BA 1PTJA 3GLFB 5K0JA 1NVKA 2EJCA 2SBTA 5ABPA 3ZX4A 5BRNA 1IVNA 1X8XA 3H2BA 4YCNA 5CYPA 3THWB 1MOQA 2H9YA 3OVMA 5AHKA 2HOQA 1U2RA 4ZO8A 5C7LO 4M98A 3OCJA 1Y3FE 1EAYA 4MYHA 1OXTA 2B0JA 2J48A 4C4OA 2Q3JA 5H3HA 1XZJA 4U4AA 5BUSA 1ZC3A 4LYJA 3N8DA 2Q1XA 1HDOA 1L8OA 4RZXA 3CLSC 1OFUX 2OBNA 2NO4A 4ZC1A 1CULC 4PX2A 4Y1RB 4QTTB 3IVCA 2WG0A 4AMGA 3W8RA 4PHCA 4F5YA 3CXUA 4DUGA 1I30A 1UADA 5MDHA 1FP2A 4DLKA 4I8XA 1RC8A 1CHNA 1Q0QA 4MHTA 1T1RA 1FP6A 3FI0A 5DYTA 3KQVA 5ES3A 3BM5A 2QRLA 1KH1A 4EHHA 2GYUA 5HVNA 5KYUA 5KJFA 5A0TA 3WGJA 2VRWA 1L4HA 2QQEA 5D1HA 4CM8A 3MTJA 3SBXA 2JZNA 1X14A 2J8ZA 1HNZB 2WNSA 3X1KA 4C21A 2NVOA 4M87A 3I62A 5CHEA 2WU4A 4J16A 1BYUA 1Y89A 3DAYA 3U61B 3UK2A 4QXOA 5ELLA 4C03A 1BH2A 2Y2VA 3R5SA 3ZV6A 5FX2A 2G9UA 2WA1A 4RA6B 3RHTA 3TX2A 4C30A 4AJ9A 2BTEA 4DZZA 1A04A 3HPQA 3LT5A 2FHSA 2I67A 4JUCA 1VB5A 3SPXA 1DEOA 2PH3A 2XMBA 4S0ZA 5F7OA 4DA7A 2F59A 1NYQA 1RWVA 5AJUA 5FOUA 3VNVA 3U7FB 4LV5B 5J3JA 2R6JA 2NAFA 5AKKA 2NZWA 3GJ5A 4PW0A 3C7KA 1WMBA 4QT0A 5FUVA 4RANA 3KYDB 1A3CA 2A78A 2FZ5A 3CTMA 3N2IA 3PG5A 1QFZA 3OOJA 4IH9A 2EP7A 4LVNA 2PZKA 1D2NA 2JJ8A 1OR8A 4QJ4A 2BOVA 1RI2A 1IG3A 4QX6A 3FTCA 5HG0A 3ZLTA 2PA3A 2XE6A 3KJEA 4AJIA 4F84A 4H1VA 3SQDA 4M6WB 1BJRE 5DRTA 4EGQA 2GUWA 3VR1A 4IVRA 3FNGA 4EHKA 2QXTA 4JXZA 1QBKC 3JYHA 4PG4A 4G0ZA 4WBSA 2ZS9A 3VO2A 1JQBA 3VZDA 2LR0A 2BGGA 1XMSA 3U81A 4RF5A 2HNKA 5LUAA 1PEAA 4FOLA 1FYDA 3LQYA 4BO5A 1QHSA 4YIKA 3LQ4A 3ZBQA 2VH5R 1U9IA 2BGLA 2IYVA 2WUGA 2OLEA 3ESDA 3EVEA 2EFYA 3C14C 4G5RA 3VR6D 2PSSA 3VJLA 3DS8A 1YWGO 2B83A 1MXHA 4PONA 1TLFA 3B8HA 3INNA 4UBMA 4MW5A 1N57A 3REQB 2OZPA 3D7MA 4ZT4A 3VRHA 2NNLD 4QQKA 1QQAA 4J4BA 5TQJA 3W4IA 1J24A 1T29A 5ALRA 5E4JA 2Q49A 4KRXA 5H9WA 3KQWA 1SKUA 1FEZA 3AF0A 3DW1X 1DLJA 3FZYA 4P4UA 3WYCA 1AOXA 4G65A 1N1EA 3SHQA 4E51A 1D2HA 4B3RB 5F7XA 2W6JA 1YZYA 3BOSA 4LMBA 2QU8A 2GPTA 1XSEA 2DPHA 1PTJC 1E79A 4PSVA 1K7XB 4ZOLA 4RJTA 5BWCA 2D2EA 2CXOA 2QB5A 3AO0B 1GPMA 4IQGA 3W9YA 4IQ4A 3S2FA 4CFYA 3KPJA 1TTTA 4R4JA 4RAQA 3KEMA 4MI6A 1Z25A 2GCGA 4RJIA 1ODJA 1EGMB 1QRRA 1H94A 3B85A 3ED5A 1NAHA 5HM6A 2PS0A 4OP3A 3HLTA 2B5OA 2R48A 1T5DX 4YFYA 5L7YA 1FNCA 3E9RA 3AXTA 3GG2A 4KYIB 4UXIA 4U2KA 2IHNA 5E2AA 4TWJA 3DULA 4PANA 4GI3A 4BJ6A 4MV5A 3A7DA 4NG4A 1KI2A 2V7BA 2XRFA 5BN4B 2V7QA 4B3HA 2ZIXA 3VDXA 5CBPB 3BT7A 1OKKA 1Y6JA 2G40A 3PC7A 3RU9A 2FWIA 4M0LA 2P62A 3N9IA 1DTSA 1TZMA 2X77A 3EFOA 3HNOA 3KJFA 4LQCA 4N0QA 4NV1A 1PJBA 1YDFA 2CBXA 3OZUA 4J75A 4PX5A 1QYCA 1EM8B 2LUOA 4XM1A 3QSGA 4EKGA 2CVOA 5HRCA 3FNQA 4XTCS 1UPXA 1L4MA 2W2NA 3K6RA 2OAP1 3G0CA 3HZZA 3UWSA 2WWYA 2DP4E 2FSSA 1HL3A 4KO3S 2GO1A 4GFDA 2PX3A 2CJYA 1N5IA 4B40A 4FVTA 2ID8A 2R6R1 1R0ZA 2XQGA 4EPXA 1ILEA 3DQPA 5CXSA 1B8VA 1GLNA 3KPUA 1M2OA 2G07A 3M33A 1XMQB 2PUBA 1OTYA 1E5DA 2OV4A 4AN1A 4R16A 2Z5FA 3QEMA 3SC2A 4REQA 1KQPA 2BR3A 1YB1A 2JGMA 3HKBA 1OMOA 1KVSA 1NJFA 1TX4B 2O8VA 5ARCA 3TCKA 3NALA 3U4QA 1M8JA 1NNUA 2RBKA 1R8XA 2RG1A 2RGNC 3MGGA 2QW1A 4Q9DA 4MGEA 2HF2A 5AI9A 4ZI3A 1VBKA 5D3ZA 4KLNA 3IURA 1ZK4A 4GZ3A 2HMWA 3DO8A 3FWKA 4MYTA 4R7TA 5HR5A 3KLOA 3DR5A 1JEEA 2X76A 3I6YA 1GZVA 3FDIA 1TIPA 1O1YA 2FJ0A 3MINB 5L3RA 3WGUA 4DQ0A 4BOYA 1NG1A 4MP3A 3NUZA 4MRMB 3UG6A 4JMPA 2ECFA 4XWYA 4KWEA 3TQTA 3QMVA 4YAFA 1USUA 3CNHA 1ZN7A 4DZTA 5DWDA 4P7KA 5BOVA 5BWOA 2F8LA 2VJBA 5CFLA 3KZCA 5A2GA 4CXMA 4B4WA 1K0UA 1E1MA 1OTXA 3EY4A 2JAUA 4V0RA 3WQBA 3RAEC 3HNRA 5F77A 3T9EA 2AR7A 5LWQA 1YIDA 3AHEA 3MG9A 2AA3A 4W7HA 3ZE9A 4YR9A 1P9RA 3GT4A 2ES4A 5G41A 5TS2A 4PYJA 3KJHA 2QIPA 2RK6A 1OAAA 1EINA 1JEQA 3HBAA 2Q6OA 3UJBA 3V8VA 5U9CA 4FGJA 3A6GA 4FYVA 1VLMA 2AUTA 1PX0A 2I6UA 2IITA 1A69A 2WAAA 3J7AC 4NOMA 4OB8A 3F7TA 4BLWA 1H22A 3G9UA 3S2UA 4OUKX 3M2PA 2Q9BA 2IWHA 3BTOA 4AZ3B 1F2UA 2YHUA 3DEAA 3D5QA 4N6OA 3U7RA 4L75A 1NR7A 1XLWA 5T5QA 3P8ZA 2XCRB 1I6WA 4Q48A 1EIZA 4BHTA 4R2LA 1ZD9A 4TVBA 2MCFA 4OMUA 3S28A 2AZTA 2ODPA 5K1ZA 2HHLA 2KYRA 1GCAA 4J1TC 4UOZA 1JN0A 2RJ3A 1US8A 1VJ5A 2BSQA 1FDVA 3T4EA 1NN3A 3WLAA 2ZRNA 1NRXA 1RKQA 3RYFB 4XQGA 5FR1A 1BJKA 1SU4A 4KV9A 3UUWA 4EW1A 4H7HA 5JS1A 4KEAA 1VXRA 3BB4A 2BFOA 2WJ3A 1ZC4A 5CDUA 2I3BA 3AKEA 4OMCA 1S2IA 2V98A 3C5VA 3B9QA 4MUBA 3QYAA 3RS8A 4L0QA 3EXEB 2HU8A 3JZDA 2V1XA 5K8CA 3R5KA 1VIVA 4YJ2F 4LMAA 5FOSA 4DA8A 2YIVX 2EOAA 4MWGA 2GEDA 1NF9A 4F4HA 3ABQB 1IK4A 4AX4A 1A95A 3JZMA 4AMBA 4CL8A 2OV3A 5KYYA 2EG5A 1FQJA 1MORA 3V4RA 5EIWA 2FFHA 3V42A 2JB9A 4EX7A 1B3BA 1QPZA 4HB0A 1DC5A 1DT3A 3DGFC 1C3JA 3EEIA 5CLJA 1TZKA 4HUJA 1CUUA 2QW0X 4XOUA 1RABA 4DADA 1O9HA 1D6SA 3ABSB 2F64A 1NQXA 2X2EA 4EPRA 1T2UA 4M76B 3ROXA 1HK7A 3GJ3A 4LPSA 5E6RB 3D0OA 3ICWA 4FJ1A 3V7NA 4DS3A 1F2UB 3K1TA 4BTLA 4LRSB 1I1QB 5HDBB 2C1XA 1CCWA 1Y3DE 1U04A 3PKIA 3W3AD 3OLVA 3ORRA 3RG2A 3ZTYA 3L6RA 421PA 1ZAYA 4WKGA 1KY4A 2C9MA 3PQ2A 4PN7A 4NEGA 1XXHE 2VTEA 1L0BA 3M9WA 3JVEA 1A27A 3U9TA 2H1OA 3SQMA 1VPDA 3CN7A 3PFIA 1XEXA 1OB5A 5JS6A 4E5YA 2M98A 3I12A 2QJFA 3AEQB 4K9DA 4ZOQI 3FJOA 3PK0A 1JR4A 1LCIA 3E35A 4ENUA 1G1AA 1IFXA 2FEOA 2M9MA 3D7KA 4HRXA 4QOFA 4W5RA 3AL0C 1LPMA 2J9ZB 4HB2A 3T7JA 1CVRA 2I54A 4R9VA 1MJNA 2GRUA 2HJHA 3M6FA 3R3WA 2HFKA 3DKKA 4XIIA 4HGRA 4ZVKA 1M7HA 5C3MA 4WFIA 2ZREA 3G2MA 1XDSA 2YHAA 2R11A 3ZR4B 5DSXA 1JEAA 3I9V6 3LO5A 4D4GA 1LSUA 1J42A 1EEXB 2J0SA 2XMGA 1Z7WA 2QI9C 2X42A 1BRMA 1N0IA 5DGCA 1KZGB 1ZMTA 2WHYA 1D5CA 3MM4A 3BXFA 1U3UA 3ICVA 3NTQA 2Q3EA 1XB2A 4HNSA 4JEMA 1FDRA 4G0QA 1MDBA 3D43A 2QY9A 3HJTA 3MPUA 3B60A 4TUYF 2FOXA 1PCXA 2BDTA 2P9QA 3NCHA 2QD2A 2V65A 3DMFA 4H6WA 4DV0B 4W5WA 3U4DA 1HOTA 3BD9A 5I4CA 1JLKA 1ZGZA 2ECQA 3A2NA 3DOUA 3H2ZA 4M9QA 3IUPA 2EARA 2QVXX 1AQYA 4FKZA 1QIDA 2AUNA 4GRAA 7MDHA 2Q6LA 1M66A 2C98A 5TPWB 3DLCA 1ULSA 2F4VB 4DLLA 2XNJA 4DAOA 1DC4A 3OE7D 3C2QA 3PEFA 3PLNA 4HTAA 4UBJA 4V0KA 2GSWA 4V0ME 3T3OA 2C9ZA 3A8TA 3L8HA 1KYXA 1IY1A 5IXSA 4KR7A 4KE7A 2G5CA 1GYPA 2I99A 3QFTA 4JU8A 4NAUA 4BGEA 4YMSA 5JCOC 4I6JA 3DTYA 3EOBI 4V24A 1IVSA 4TMKA 4YEDA 1KSGA 3V3KA 1J9ZA 1I2CA 5AUQA 2ZEJA 1I33A 5EZSA 4KFTA 4HAIA 1DHTA 3H99A 3K7EA 4NV3A 2ZU6A 1UQUA 3G1WA 3C7AA 1MLDA 4ZK2A 5DYGA 3JYNA 4Y2VA 1BIFA 3X1DA 1R6AA 4F4CA 3P9SA 4B84A 3H4TA 4O2AA 1QIGA 3OQNA 2D1QA 4MV1A 4M0CA 2RCYA 2AUMA 1X1AA 2BL4A 4NDZA 5AO9A 5EKXA 4B31A 2R7LA 2PJRA 4CN9A 4UHHA 2VT2A 3GNSA 5MN4A 1JW9B 2AJBA 1TMOA 2IDJA 2YVKA 3HCRA 3TOXA 9GPBA 4MAMA 2HK8A 1JHUA 2VDLB 1G19A 4OKNA 3PDIB 1M8FA 4TV8B 1OAOA 1PS0A 1R0SA 3BGDA 3AHGA 2Z0MA 1UXIA 1IK6A 3KE8A 4KAAA 4Y6SA 4BP9A 2DB3A 1GCIA 2XBLA 2OEPA 2WKPA 3MTBA 1C41A 3GLIA 3P2KA 3L92A 4ZAZA 5HS6A 3BL8A 4BVBA 4EMSA 2ZSIA 5L51A 5LPNA 1I4TD 3PPXA 3QEAZ 1F17A 4MP6A 1CY6A 2QTBA 2VJCA 3GLQA 3OPNA 5LB4A 2BGIA 1UDBA 3F6RA 3G8CA 4PAWA 2COEA 3IT2A 4WOBA 5TQVA 4DCTA 2C7PA 3MLAA 1V5FA 2WIAA 4G1EB 1CJUC 4GUAA 1CT9A 4JIGA 1RXCA 2HQBA 1W1WA 2CXQA 4MVJG 3Q12A 3TMYA 2PD6A 4JJ6A 2RONA 4MR9B 3EZLA 4O1IA 3BWDD 4AO7A 1Y7HA 4XI9A 5F3DA 1JHPA 2E82A 5EP1A 1SU7A 4CMAA 1X86B 2WWTA 4IY1A 5L40A 1CR2A 1QIIA 1C1XA 4KHPB 1DKRA 4PLTA 4GYYA 5EKSA 1S0UA 4MIKA 2B2NA 4R2KA 1AUXA 1KP9A 3UVEA 1I14A 1ZUD1 4HDSB 4HGNA 3TECE 1G2PA 8MHTA 1KC3A 4H1TA 4JJ8A 3VM6A 4RTSA 4BEVA 4GECA 1VFPA 2FUEA 4IS2A 4BO0A 2RHOA 5JZOA 3BZBA 4AROA 3U48A 1T2EA 4RMNA 2PKYX 2XUFA 7AT1A 4OBXA 1QZZA 1NW7A 3Q9LA 4QO8A 4QC2A 5FBWB 2WJAA 3F1LA 3DD5A 5KHOC 2RIRA 2PLNA 3KWLA 2GJSA 3LMKA 5HBRA 1PV1A 5F2OA 2WJYA 3HL0A 3KJIA 1IU9A 1PR1A 1N4DA 1T8WA 2A5YB 1WDTA 4PTYA 4R3UC 4ZQEA 4BNKA 1V9CA 2XCIA 2BJHA 3TSAA 1YE5A 5AW2A 3OIUA 1AF4A 1QLHA 1FFGA 4DABA 4YP6A 2AN3A 2W6CX 4KO1S 2AFHB 4CRWB 1H23A 4FQ5A 4A16A 5CXUA 4RTMA 4KGZA 5F73A 3MCZA 1I80A 3U7EB 3ZBUA 4YRSA 1IHPA 4N40A 4OA5A 4Q3OA 5GV8A 1QVAA 2OVBA 5DHAA 4ALMA 2QD3A 4H7DA 4OF4A 4ZYLA 3O7WA 2QN8A 2JARA 1GCGA 2QVLA 1K8XB 221PA 1U81A 2ZRPA 2AMFA 2JEZA 1R0KA 3PRKE 3ZV4A 5I01A 4K0KB 1G8SA 4BUZA 3HADA 5CG1A 1JR6A 2CB0A 1KEEA 3K9BA 1I1NA 4OJMX 3LVFO 4WXMA 4J07A 1BVRA 1R18A 4LYHA 1HFKA 1Y1TA 1TVCA 2IELA 3IMEA 4H1UA 4YQEA 5AVUA 3JS5A 4FFPA 1N7IA 4L50A 3E48A 3R20A 1JKFA 2ZSUA 2FPPB 1MO3A 3C6BA 3IPXA 4KN5A 4P35A 4S1PA 4UTPA 4X65B 2C4KA 1FSPA 4DM7A 3RUDA 3WGYA 5H7XA 3G6KA 3BZWA 4DBLC 3MELA 4H15A 4V0LA 2ROQA 4IIGA 3V1YA 4Q00A 1BKYA 4ROTA 3KOOA 3TOCA 3HCCA 3WJ1A 2GBFA 2C97A 1LLDA 4LYDA 4IW3B 4MVJF 4BDSA 3LX6A 2VWGA 2Z58A 1BS1A 4EATA 1J7KA 4HADA 2QUKA 5LR6A 5DYNA 5GMOA 1BFUA 5A5EA 1PT8A 3AUSA 4M1KA 2NP6A 4KXUA 1OXKB 1S8NA 2NYRA 1C7QA 1FJHA 2E6UX 2ZI4A 1QTRA 3IBTA 3PWSA 4J0QA 3QE2A 1A9ZA 1OJLA 4TXLA 5TGDA 3HK2A 5JJ5A 1DRJA 3EYAA 5BY2A 3OT1B 1N5MA 3RVDA 4Y9TA 3MFQA 2OHOA 3WGLA 2FPMA 4BFLA 4DMCA 4KITB 1A4XA 1Z5ZA 2DX7A 3CSDA 2XODA 4FNMA 1I2AA 2D5IA 4JGBA 3ZY2A 1E1RD 1FVXA 2RC6A 4F9EA 4MUXA 2OG1A 1WX1A 4LGVA 2YRFA 4I36A 5AK0A 1I7DA 2Q5JA 5BN1A 3UWOA 1VG0B 1WDLA 2C57A 4JLVA 2ZANA 3B6KA 3TQHA 4ESOA 4MROA 1E4EB 3DAPA 4DEVA 2PVCA 1B0ZA 1J99A 4N82A 1UMBA 4L8LA 4DV2B 1QPBA 1NE2A 4MQEA 5JMWA 3DNPA 1S8AA 4WMLA 1M0WA 3AESA 5TSDA 1DRVA 1C8KA 3QE9Y 4EYEA 4TMVA 5C8DA 1O8CA 2QHXA 4OI4A 3UTCA 4EW2A 5AHOA 5BR1A 2XUPA 5A3VA 3S8EA 1GQQA 4ZCMA 4V02A 3F6EX 4YCBA 1P6QA 2BJVA 3MJDA 4YP9A 1XIVA 2VAWA 1F5NA 4RQTA 3WGZA 4DRZA 3A1EA 4OYYA 3BCUA 2E48A 1BDBA 5C8ZA 3KB8A 4ND7A 1UCFA 3O03A 2J3DA 4V0MA 1SXIA 1OX4A 4MS1B 1Y1KE 2XQVA 1YBHA 2AG0A 3ODGA 1UT8A 5IMSA 2WVAA 3OZWA 2PRSA 2VJPA 2UYHA 2ILVA 3KXLA 5E7QA 3KFXA 3SY8A 1H0RA 2DPYA 3AOEA 5FL7D 2OCIA 2XXAB 5F2KA 3R7SA 4C89A 3FHLA 3W8EA 5IK2D 4UE6A 1QQBA 1R88A 5FBRB 1JR3D 4CZ2A 2XLBA 3UJCA 5KZMB 2HO4A 1DEKA 2HADA 4KC0A 3WB1A 3PEEA 3KVNA 1ZUNA 3AF5A 2Q6KA 5CLQA 2IDZA 2AQIA 3B9BA 4XD7A 3I52A 3BWXA 1E2JA 5J5VA 3KV3O 2IPMA 1XJWA 4CUKA 2HI0A 5IZ4A 2QTTA 1KEZA 5C81A 1E4EA 4TLCA 1VQ1A 2EX4A 2HLHA 2BHLA 3KKOA 3ZWBA 5IVHA 1DQRA 1XRQA 1XAGA 3QPDA 3LPCA 1NUQA 1RC0A 1VE3A 2HV9A 1HNXB 5JAUA 1YKFA 5EPUA 2D00A 3ZGXA 3O9MA 4NBLA 4R0MA 2AD1A 3DT8A 4BEWA 1DX9A 3E7PA 5B58T 4CVNA 1NA5A 2GDJA 2YX1A 1XVVA 1F0KA 4O4HB 3DLIA 4F7DA 2QUIA 3INRA 3PPIA 1Y5NA 3PE3A 4URWR 2QQ0A 3JXEA 2BBWA 1U1EA 1NY6A 2P9TA 1F9EA 2ZZKA 4H16A 2VC2B 5B6IA 4YUAA 5FWNA 3UCFA 2EC5A 4L5IA 2ODAA 3ISJA 2PE5A 3FD8A 4TV9A 2QP3A 2OHIA 1U7HA 4XJXA 5LA6F 3TUZC 4GT1A 5CH3A 1TCAA 1B0AA 1RXUA 1LKZA 2ZITA 4G24A 4K3UA 5FP0A 4B6EA 4XZ3A 4V38A 1Y1QA 3H4MA 1JL3A 1VZ3A 3GRZA 3W78A 1SZCA 4RTNA 4F2DA 1Y8ZA 4D81A 3H6GA 1NUAA 1O96A 3BA1A 5I9NA 4L9AA 2NIPA 2FW6A 1YUNA 4RU1A 1UDWA 4LZPA 2V0GA 1WUYA 2QUAA 4ODIA 1VJ0A 2AXEA 2PRKA 1AU9A 1COZA 4KLAA 4EPTA 4XWAA 2FPOA 2EFCB 2PMEA 3WAKA 4W1RA 2IY9A 2QTLA 1L8LA 2WZQA 5KOYA 2I87A 1L5YA 2A33A 2O7NA 4X92A 4WKOA 1PW5A 1D3AA 3BG5A 5ALZA 3U4AA 4OV6B 1G6Q1 5DNWA 1PK7A 1GL7A 1NJGA 5BPFA 3TTUA 1RWMA 1KI8A 1ZONA 2H31A 1NZJA 3NAZA 3HDJA 4OQEA 3G2IA 3B38A 1U8TA 3HUEA 2ZRBA 1PJZA 3B3QA 4IZHA 1TCVA 4DTCA 1TZCA 2O2DA 1H2EA 1ZL2A 1UR5A 3NT4A 1PNVA 2IP4A 4S12A 1ODKA 4RZQA 2PGOA 3AEUA 5A62A 5KDDA 3L7KA 2W2OA 2GAIA 2D0IA 4ENQA 3R8XA 2HLDD 2R1TA 3BJRA 4PCUA 1YS7A 3V00A 4HZIA 1NVFA 2QPTA 3VJKA 2E49A 2IH5A 1C7FA 1Y6ZA 3EGDA 3M4JA 1AQUA 4MGIR 3L1KA 1TA4A 4MO9A 4CF5A 5IJ0B 1M0EA 1GN8A 5TXGA 3PHJA 1O9BA 4C3OB 5J4YA 4B4VA 5ALDA 1RXWA 1NHGA 3DC7A 4QHTA 1ISSA 3IT0A 4G97A 4JXJA 3Q87B 4RVDA 4EB8A 4U7DA 1BGXT 2XMPA 3PGVA 1DIRA 1DEAA 1QGYA 4N12A 4F06A 4TV9B 5B7NA 4HLQB 2W8ZA 5D2CA 5JQGF 4ZD6A 5J2TA 3QYFA 5JPCA 4O25A 1JKJA 3WR5A 2OC9A 1SVIA 1HYBA 3THXA 4BMZA 4RHYA 1JU4A 1UAGA 1ND5A 3DD1A 1CEEA 1JG3A 4CN8A 3ZDAA 1N34B 1ZGHA 3WGNA 2CXPA 5A5GA 1HMPA 3URMA 2CMDA 3ML1A 3Q6IA 1H3NA 3NV7A 2AD5A 1KAGA 1NI3A 2KBEA 2R5WA 4L73A 1MFZA 3ITEA 4MCAA 3EGXB 2Q5FA 4PTLA 4UHEA 4BNHA 1MA3A 2W4IA 1PD1A 1VB3A 3COPA 1ZUIA 2YINC 4D5EA 4O2BF 3LA6A 4J0GA 3WFIA 4XJSA 4JCCA 1FPMA 3T0GA 2Z8YM 5K3BA 2AQKA 4PZCA 2I71A 3T7CA 5K03A 4DLZA 5KNCD 4WOPA 5AVVA 3QHPA 2YXDA 4BWFB 4H7EA 3OECA 5EYPA 1LFAA 1EWRA 1IEVA 621PA 2I4MA 4IYRA 5JAZA 1M34B 5DN6A 2XNCA 5E9QA 2FG6C 3FVQA 2Q4BA 1S4QA 2GEFA 3NOXA 5CCBA 2IGTA 2ZCVA 2EJUA 2J87A 5BXYA 1T9CA 1VIYA 1L5WA 2XX3A 3IUQA 1Y3BE 3BMOB 4LDAA 3SQLA 3ILVA 4BZQA 4LZNA 5HX7A 1EQAA 1ZSNA 3BWYA 1EFPA 5FQNA 4C04A 4RVCA 4KQCA 2WIGA 3WJAA 3DV0B 1TZ2A 2BH9A 4N3CA 3TRJA 3QLEA 3HC7A 1NR1A 5EJ2A 4A73A 4C0HA 1KK2A 1U3GA 1GNPA 1T3GA 1E3IA 4TYQA 4HEA1 3V1MA 2VWPA 2HPAA 5KWSA 1E3JA 1Y3IA 1ZN8A 4WRRA 2D54A 3HGMA 1NRWA 1ZCZA 2QPOA 3HDGA 4B3IA 1I6LA 1RZ3A 4H77A 5BWBA 2FYTA 5KSZA 5JYCA 4DR2B 7REQA 4LF6B 3EPJA 3CT4A 2VT6A 4MWTA 4RLSA 3MOIA 4LV6A 3RABA 5LLTA 5B7QA 4NTZA 3ZZUA 5KQRA 2FNAA 1GRVA 1KAEA 1V1MA 1Z38A 2NUAB 4NRDA 2P4SA 2CLKB 1TCBA 4K8OA 2RGAA 2CVQA 3FY4A 4IJVA 5IZCA 5KB3A 3KETA 2R8PA 4DQKA 4BPRA 4DLUA 3AK4A 3C8DA 1Y1PA 3IBSA 3IE0A 3TH5A 2Q9UA 5F9FA 1JB1A 3LX5A 2QRPA 3W5UA 4YT8A 3H2GA 2Z56A 1YVRA 1DCTA 4WNCA 5B1YA 3I4FA 4XX0B 1MC8A 1TYCA 3GZJA 3F3MA 4KVFA 1NQAO 2VJAA 4Q1AA 5LYJF 3G89A 1Q17A 3NC0C 1PR0A 1UFKA 1TE2A 1LK0A 1PK8A 2X0FA 4H7IA 1VHJA 1WWKA 1BE6A 1NPDA 5EMKA 4IH1A 4ZKEA 5HCNA 5KYVA 3LXMA 2WUFA 2B5VA 2QG6A 2WE8A 4WJLA 4UZSA 5A3QA 1J2EA 1F3LA 2ZRMA 5EAIA 2EF1A 4Q3CA 4BJ5A 1E0KA 2YMMA 1J20A 1LGYA 1IEQA 3GLUA 4EBBA 1ODSA 4DCPA 2G67A 1HQDA 4S2EA 3PJFA 2Q4OA 3AOGA 3NWJA 4LGYA 1ORDA 3C24A 3RVKA 4MJ3A 3KFVA 2JBAA 4MUJA 1ULBA 1UFOA 1ML3A 4L85A 5KTOA 1XTJA 1H8EA 4KK3A 2JFGA 2GYVA 3KU4A 3ZU5A 1XBTA 2CYCA 1UZLA 1W88B 3EPPA 1YOBA 3MJRA 1CPYA 3EXHC 3T3IA 3V8PA 4ENSA 2JFYA 3ONFA 1WRBA 3DF7A 1X77A 2PLAA 2RHHA 1S3IA 3LUJA 3QXSA 3IJPA 1HGXA 1EHIA 5GINE 4TN1A 1Y7TA 4I3HA 3EFHA 2E18A 3MJEA 3BL5A 1QTIA 4CTMA 1E6MA 4DDVA 2PBZA 1OW3B 1WHTB 3ANYB 3Q41A 4QU9A 1QC5B 5A4AA 3QUBA 1B3RA 2R1UA 1BJTA 2ZUCA 3M4YA 4NBWA 2EJWA 3ZXSA 3V4ZA 4F6RB 5HS4A 1NVVQ 4IV5A 1XQ9A 3EIQA 4MMYB 4KPEC 5K99A 4F6CA 1BEZA 1EPUA 1GNQA 1ZIPA 2UZAA 3DMTA 3MTAA 3MT8A 1ODTC 1H9AA 2ZJ8A 4ZEMA 1RE0A 3HVJA 4L8VA 5ALJA 1N92A 5KCMA 1QHNA 2VP9A 4O2BB 1DAHA 3TNLA 5AIBA 4JLKA 5IC5A 1EE9A 4IFEA 5ENVA 3T38A 2WYHA 1SC3A 4RVHA 5LNK1 4P1ZA 1EUCB 1SCUB 3D5TA 4H6XA 2R7KA 2V5VA 4GXRA 2NUPB 4FCCA 2P4QA 3WJ7A 1Y37A 1MABA 4FDLA 1L7BA 1SELA 4MUEA 4OUDA 4M9CA 4C22A 3LWZA 2IXBA 1SOVA 1A72A 2B4QA 3QLJA 3DAFA 3HYNA 1MEJA 3NRBA 3RAGA 1DC8A 4LX0A 3ILSA 1ACMA 1E9BA 3QMPA 1EWQA 1AQ6A 3VPAA 4AKIA 1ANKA 4AS3A 4JEIA 1WVMA 3O4RA 5JVDF 1GA4A 1K9SA 1QNFA 4RDXA 1H85A 4ZKDA 3LAWA 3Q7TA 4DQUA 2QEQA 4U6QA 3I5YA 1TYAE 2VUTA 2JLUA 4HN9A 1OF1A 4OHXA 3OG9A 4OO3A 1QP0A 1GAXA 2GCIA 3E9MA 3SNHA 2GKGA 3DEKA 3QJYA 4K6FA 4ENPA 2H4WA 4Q3LA 2NXCA 2H17A 1QFJA 1E18A 1MDFA 1EFDN 1ZMXA 2Q4RA 1KHTA 3JQAD 3C16C 2QD1A 1C5KA 3TBHA 3FCEA 4FN5A 3HJFA 3GF4A 1MV8A 5CLFA 3KQMA 3MJFA 3K0CC 4NIMA 1V96A 1WHTA 3DPUA 1LRLA 4E5KA 1E5QA 1DKNA 2YYAA 3L0ZA 3UJ3X 1DJPA 2CYAA 2R47A 4CCWA 1BDHA 1Z88A 3T52A 2J3JA 2FUG1 3UAVA 4KRGA 3N0XA 1TW2A 1D4ZA 3B89A 4YRRA 1OI4A 2B2CA 1AQJA 3VJMA 4ZMRA 3C5WP 3HPRA 3OESA 2BGJA 2IK8A 4R2JA 3L40A 1DXHA 4WNAA 5JATA 1KU0A 5B2ZA 3U4GA 3CURA 4ZAVA 5A9SA 1NVXQ 1RFGE 4ILEA 2FCRA 4INJA 2W2XA 5JPIA 3TZQA 1ZH6A 2DWUA 3V4OA 5I7FA 1HDEA 2C2OA 2IYZA 4LZWA 4RZIA 1OBHA 1UUFA 1GTG1 2W6OA 4CNBA 1KIAA 2CNDA 1H93A 5J59A 5LIPA 1N2JA 4D46A 1TKAA 2JD2A 4HJXA 5LMNB 3PUZA 2QRZA 1RAHA 3QWFA 2VUUA 4BBPA 1U8ZA 4Q24A 4QGFA 1GGHA 1N5OX 1NIJA 1ZD4A 1ZMBA 5EIEA 4FYYA 3HJHA 2QRVA 2PCLA 3A6LA 3N53A 4H7JA 3IP3A 4OQZA 3N59A 3GJXC 2C4VA 2CVZA 3M4ZA 3N5CA 3PU6A 3RVQA 3TR5A 4MYCA 3DKIA 4UATA 3THRA 1D2AA 5DN9A 3H19A 1Q91A 3N6XA 1XK7A 1FX1A 2A92A 4FHCA 4IIBA 3GEEA 1WPRA 3QNMA 2XCLA 2PMWB 5AI5A 3UHJA 1JEYA 1M0SA 4LHWA 3HYLA 4TKMA 1SCQA 3S3TA 2H29A 1TC1A 2FZGA 1MTOA 2OHGA 3Q5DA 4OSOA 4ZRMA 3O8DA 1T1IA 2OCBA 1C7JA 4C7OB 1GUZA 1Q12A 4FEEA 3KJQA 4E30A 3ESAA 1NNI1 4D7AA 2PKRA 2HFJA 2DLNA 1L7AA 4NABA 4W99A 4CDRA 5AVRA 1E3SA 1RCUA 1UBLS 3HCOA 3SXPA 4GSKA 2PQ0A 3P9QA 3SF0A 1XZKA 4YRLA 1XCMA 2OD2A 1WHSA 3HB9A 2OWDA 2J08A 4I5EA 1XWIA 1KQGA 5AOCA 5TNXA 1O54A 3FSRA 2Q4TA 4HNVA 1YS2X 3V8RA 4TRMA 2RHMA 4NENA 4C9BA 4YDRA 1J2UA 2CB9A 2HGSA 5KPDA 3QOFA 2YWGA 3GLGE 1T2CA 2HRRA 2GA9A 2WUWE 1E0SA 1YE8A 2H65A 3DFKA 4KXNA 3OC6A 3QBVA 1HFEL 4UVDA 1SZPA 2C2HA 3DFMA 3PX3A 4W4TA 5HJ7A 4JJ4A 4G4SP 1PGOA 1AXEA 2JDIA 5EEHA 1QF6A 2EX0A 2G71A 2GN6A 1YH3A 3LT1A 2VF8A 3FMGA 1G8JA 1GAQA 3TTWA 5KAPA 1L4BA 4EB0A 4EVQA 1HO3A 1L1QA 3AJEA 1NVWQ 4BGIA 4KN8A 3RM3A 1OH6A 1H4QA 1Z4LA 3UA3A 4WZAE 1N7HA 2CSUA 3TW8B 4OBBA 1VLLA 1CYEA 4KQ9A 1ZSVA 1X94A 3ZIAD 2JFHA 5I7AA 3H1EA 1OBCA 1IN4A 2AOVA 2O52A 2Q1UA 3H9UA 5DP1A 5CB4F 1Y48E 2VLBA 5C1OA 1USVA 2WQ6A 1VIDA 4GKAA 4Q16A 5THQA 2B1IA 3BGVA 3SZ3A 1HC7A 3DVRX 4I46A 3RRFA 4FCWA 1E7WA 1NXVA 1MXFA 1S3FA 2WOOA 2R0QC 1JHOA 3GLSA 5BSMA 2JH9A 2P2DA 2H11A 1Q0UA 2NLOA 2VXCA 3ITKA 5FPSA 3L7YA 4DWJA 4IGAA 4R68A 2JLXA 4JNKA 4L15A 3GEBA 2R8EA 1P62B 4LI0A 3GARA 5BW5A 1TOAA 4UNIA 1YUMA 1JKXA 2OKGA 2WJIA 3B5IA 3M6UA 4LJ8A 4Q0MA 3UZUA 4AUEA 5JDIA 4AQYB 1T26A 2BUCA 1ECGA 3BMXA 1ISIA 3W05A 1E60A 1VL5A 4MWDA 1AGYA 1RLOA 4YY3B 1MIHA 1JHQA 1AM4D 3ZI0A 4CQNA 2WTEA 1YB2A 4N5HX 4YAWA 4DL9A 4CCSA 4OQDA 1DSSG 3EQ7A 3EK2A 4LDJA 2QE7D 1ORRA 3NMUF 1EXDA 3ZCRA 4F71A 4Q66C 1NHWA 2YHSA 3KHUA 4QYWA 5CB4B 3W5DA 3R5FA 3EWAA 1XK6A 3SEQA 5AM1A 2G36A 1KRWA 2V5AA 3VR3A 1I32A 4JGGA 4RJLA 5EZYF 3WFZA 2GK3A 4NY1A 4YJHB 4KPGA 1GNRA 3KR2A 3DB1A 5ISMA 1N2OA 1UJ6A 2PWBA 4WY2A 3WIEA 2QQ5A 2F1IA 2A5JA 2ADMA 1BN7A 4QOHA 3ZK7A 1C9KA 2WFMA 3UMFA 4HNTA 1A98A 3QXCA 5EXSA 4KXWA 3FUWA 1JLSA 1O58A 3RYHA 3PCRB 2JGAA 1SXJD 3IEIA 1EDOA 3HV0A 5ALEA 4ARVA 3VSDA 4EABA 2P65A 1QG4A 2KI5A 1OPXA 5BT9A 1T8RA 3IEPA 4F3CA 1DKPA 2IY8A 3C8UA 2HUPA 3K70B 4RFLA 1XVLA 5E6SB 5AK3A 1IPEA 4R2XA 1IG0A 1I0LA 3O4GA 3ZDZB 5AXDA 2HO5A 1LC3A 4JQSA 1TYDE 2G1AA 2XZDA 3Q2IA 5H16A 4UFNA 2OO5C 4EJ2A 1QO0A 2P90A 5C5IA 1N1DA 2BAGA 3DV9A 5T7BA 3K35A 1P2FA 2DHEA 3T95A 4L1KA 4A8JA 2EZTA 1J4AA 2FKNA 3IEVA 1A82A 1LLQA 2NVUA 2GUGA 5FULA 1KPIA 1TTHA 2HK6A 1M83A 3X2FA 4C87A 1QSGA 1VRCA 1DL5A 4EG0A 4RGQA 1SPXA 3QY9A 3QUSA 4AQ7A 5CEFA 1FP4A 2PMBA 4G01B 4RHFA 4RFSB 3TKLA 2BELA 2C5FA 1FTWA 2JGLA 1FL9A 4NVRA 4OI1A 3THOA 4EYOA 1OZHA 4HF7A 4IF4A 4CT5A 3FX2A 2WIBA 4X1IA 5HTOA 1NRJB 2NU8A 3ZDDA 2XB6A 5EJIA 3NG1A 2DBVO 1VJCA 5CJJA 4JVMA 1DOHA 4EA9A 4R98A 4XJVA 1BCSB 1DV2A 4R9RA 3CJTA 4CL3A 3HJBA 3DFFA 1YD7A 2BMAA 5IDWA 3A14A 1EKXA 1JDJA 1WABA 5ED4A 1UMKA 1ONBA 4RQBA 1GSAA 3B48A 2JHAA 1PT7A 4Y6RA 5DTQA 4TKUB 3VSBA 3CVWA 2V4ZA 1UZNA 3MT9A 1Z3IX 3OPVA 4G56A 1RVDA 1K06A 2VDKB 4Z3DA 1UPFA 3EZYA 1OPRA 2NTYC 3OTQA 3FN4A 2IHZA 3PC8A 1DO2A 5CXQA 4IDAA 2LGJA 2WIJA 4A23A 1JECA 3AJ9A 2G5PA 2K2WA 2J33A 4FW8A 2WF7A 4L8WB 3QKTA 3GRKA 4A8JB 4EP1A 3R6DA 1VKNA 1E1YA 1FYFA 3KB2A 5L53A 2ET6A 2OGWA 2ZYHA 4RSGA 1C0PA 4GBJA 4M99A 4CT0A 5I5EA 1LV7A 3AVXA 3BMNB 4K81B 3RBVA 4FFSA 3TUIC 3CVYA 4GDMA 1HM5A 3AM4A 1FW8A 3MD0A 1P75A 3FVWA 3HDHA 4MB6A 5K8UA 3I04M 3R0JA 2H18A 3AIKA 4CIDA 1RFLA 4RFSA 4RSRA 1XX6A 4I99A 5IN4A 5JFTA 2WM8A 1BKDR 4FDMA 2JEYA 4PZAA 1OX6A 1YGYA 1KGSA 4L8FA 4MQ6A 2IIPA 3NWEA 1U2DC 4P0PB 1BVHA 2B8EA 2QVZX 1GTJ1 2X5KO 1CUFA 1L7XA 1QK4A 3GVXA 2I1WA 3BDIA 2FZLA 2FMXA 2Z6UA 2FSUA 4HTFA 1VKRA 1NW5A 2ZRQA 1A96A 1DMRA 4C6SA 1YFKA 2B61A 2R68A 4TTAA 4BGDA 5EKTA 1B76A 3CZCA 3QG1A 4KBGA 4PR0A 2CHGA 4P0QB 4U7JA 1WB5A 5JMTA 3HO1A 1OI3A 1W4ZA 2ZCUA 1PLLA 4X7MA 3CZQA 2P5SA 1V7ZA 3IAFA 3MSCA 4ENRA 4XM2A 4RTQA 3WGHA 3VA7A 3L6BA 1W30A 1YA8A 5HKLA 2VSOA 2G25A 4QBHA 1OH7A 4KQJA 4BLRA 4EHAA 1SD2A 2QUBA 4RGBA 2IH2A 3HEBA 4X5OA 5L4NA 1Y8QB 5JJLA 7ABPA 4Y2YA 4FWTA 2A0FA 4NPHA 1K4MA 4PHFA 4D0GA 4DJFC 4PS1A 3G6WA 1AZSC 1HXHA 4FEGA 1WA5A 3QOWA 3TO5A 1VI2A 3CO0S 3WWZA 5LU9A 1ADBA 1S2LA 2F9MA 4TTJA 2Z6VA 5TV2A 2PMFA 2EDAA 3WA6A 4KE9A 4QE3A 2H08A 4HGQA 3U7IA 4CU5A 1JTFA 3M70A 4H08A 2C61A 2ZTLA 3FPSA 3MWLA 3V5NA 3II6X 3B1JA 3OX3A 4J03A 2OPHA 3TD6A 3TLJA 3H5NA 3TQCA 2J7KA 3I2KA 4NI5A 1HUQA 1W5EA 2XPCA 3QU5A 4TSFA 3S1SA 1HYHA 4ZYXA 5KTYA 5DRYA 2RGBA 3D8NA 4R0VA 4A2PA 4Z4QA 2E5FA 1G59A 4MV8A 3B3AA 4B2YA 1JHXA 2YW2A 3CRVA 3OA2A 1AKEA 2RH4A 3DBIA 3O95A 4ZOLB 4YWHA 1ZJWA 3FCOA 3P9IA 3EZFA 4HAVA 4HQNA 4UAVA 1HEYA 2ORVA 3OX1A 5DJ5A 4RZUA 1DAGA 2OB2A 3O92A 1KDRA 1DU4A 3F6SA 2Z9BA 3ZGNA 4IIJF 5KYKA 1NKVA 5D51S 4RYDA 3S2ZA 3LXUX 3ZQUA 5T8KA 3PT5A 1KS9A 1IY0A 3HZHA 5AOBA 5B30A 4HRAA 2C4HA 1QYXA 2VJMA 3FJ1A 5DX8A 1Q3KA 4EJMA 4QFMA 1F6WA 2N1BA 5BSUA 1GAWA 4TLAA 3AL3A 5E4FA 3TGPA 3JQ8A 4N0PA 1OXSC 2FPIA 3EARA 3EXIB 5EUQB 3HVRA 1DFIA 4FMDF 4B79A 3EFOB 2KMLA 1NMEA 2WFZA 5ANRB 2HX1A 2CLSA 2W5UA 1EJBA 4FI3F 2FQYA 1SGWA 1Y6RA 2AJCA 1YRQA 1B16A 2EHDA 4XPZA 2DFVA 2B4RO 4DJ5X 4WCVA 3I58A 3UKOA 4UUBA 3UW1A 1THZA 1AHIA 1C0LA 3A06A 3GEMA 3HYTA 3QW4B 3VO8A 1NBMD 1WW2A 2X1LA 4IJQA 3ND7A 3QM1A 5B1DA 2J9FB 1RXSA 3KIPA 2V8BA 3SN6A 4JLMA 3L07A 1Z29A 3VVCA 3HUFA 4AG3A 4EENA 1T0UA 5E95A 2N42A 5B1IA 2PSJA 3C85A 4ZQBA 1YZKA 2QRHA 4M53A 2AJTA 3ESCA 4UAGA 4MKHA 4UXHA 4AJNA 4KG7A 4EI9A 5B37A 1TM3E 2H1CA 4PFSA 1KFKB 3MB8A 4REQB 4OXYA 4F93B 4DV5B 3M6LA 4FZ5A 4K6KA 3H6HA 4KPUB 5DMHA 3I1JA 3B6ZA 4FZ3A 2R6FA 1IBRA 1P1BA 5H8WA 1ZL0A 2X1VA 3GV0A 2BEUB 2ECOA 3DLTA 3LGAA 1DQSA 4N7JA 5IKOA 2PK3A 5C8YA 3AHCA 4EVRA 3VR0A 1TM7E 2GBLA 3DZCA 1QVZA 5HA5A 1WKVA 2AGVA 2OK8A 3OLQA 1Q0TA 3TAXA 3CNNA 4C7XA 3OJOA 3EVAA 3WVNA 1Z17A 3E61A 3VZBA 3QI2A 3TEJA 4Y2UA 3VR4A 5AXBA 1Q44A 4BMPB 2OZKA 4IFIA 5M3BA 1BVYF 2ORYA 1P1JA 1S2OA 3F97A 5EVJA 3AU9A 5EJ5A 1PGQA 2ANCA 4FHDA 1BYIA 1KQOA 3U40A 5IT0A 2X4IA 2W37A 2Y77A 4BCDA 3IPRA 4Y6LA 1WG8A 1XQYA 4FC6A 2FJUA 5U1PA 5JU6A 2HRQA 3GFPA 1B43A 3A0UA 3R44A 5U4QA 4B9EA 4G1FA 4H3HB 5D6OA 1I4DD 3R76A 1ZESA 2HV8A 4NJMB 1MVLA 1TGVA 1EFVB 1ZIOA 4JR0A 1R66A 4K6HA 1XVTA 4ZJYA 4GOND 4AZ3A 2AKAB 3A4MA 4IOMA 5C2JB 3Q7SA 1GQRA 4OAPA 4B48A 5KVQA 3OAAD 3VHXB 4D45A 3GAMA 3I5AA 1F06A 1TB4A 4FBLA 4TS1A 5MFPA 5SYAA 4CIBA 2GBLC 1U1IA 2EU8A 2P30A 3T34A 3S40A 1SCJA 5LZ2A 1E8NA 2OQ2A 4P5PA 4HC4A 4M7WA 1ZLXA 2BRUA 2QTVB 1IUPA 3KXDA 1T34A 3PI6A 1KIMA 5B58C 5LLDA 2IOFK 2HPVA 2WHPA 2FE1A 3BE5A 3CW8X 5C8YB 1R3DA 5IHPA 5JSUA 4HT3B 5KOHB 3H11A 4BIMA 1V8ZA 2RGNA 4N5MA 2Q99A 3A3NA 3HBFA 3KAPA 5EZ6B 2ZBUA 4EFMA 3O2SB 4F2WA 4CKCB 2WD7A 3NBKA 5FWXB 4AKGA 4UW9A 1JLHA 2JA2A 2F1JA 3IILA 1XCBA 4B9AA 4ARIA 3K1AB 2RKBA 4ZAYA 4B3XA 1UFRA 1QXSA 1NJ6A 2DFPA 2W2MA 3OOYA 5BW6B 1RKXA 3WDLA 3ZX5A 2BI4A 3IT1A 5IM4A 4FYJA 1JIJA 1SM4A 4V03A 1GU0A 3CCBA 2EKZA 1LS1A 1U7WA 3KO8A 4GM4A 4RAOA 5M7EA 5GONB 2VP4A 3G2HA 3P0FA 5TARA 4DQDA 3KDPA 1H0KA 4TM8A 4KGXA 3OZVA 4HX5A 1T8UA 1TK2A 3NLLA 4BKPA 1NJ8A 3RFXA 4EM6A 4QBFA 2ZATA 3VPXA 3ZE7A 1EUZA 1F4LA 4L02A 2B4KA 2GA8A 5P8WA 4HV4A 1WV1A 2GEUA 2XUDA 3UK0A 1D6MA 1KTVA 1NX9A 3L04A 4FHGA 4ZCQA 3VVLA 3W6ZA 3R41A 2Z8ZA 2AKEA 4N18A 3ZV5A 5EHNA 2QLMA 3RT9A 3QHAA 1OU0A 4U9IS 4AJ1A 2M6SA 1JWAB 1JSRA 4X45A 3UCEA 4DIBA 5KYUB 1GHTA 1MW8X 4HYYA 5DEOA 1ITZA 4IV0A 5EWMB 5JAPA 1ZZEA 3MMNA 4IIHA 4OHZA 4G8BA 3PP8A 2ZB4A 3NTOA 4E15A 4OI0A 4YMIA 4NULA 3PYXA 1FUYB 2HPZA 2ID7A 2Y0BA 4WSOA 3OTOB 3A05A 2EATA 3H0CA 3ILXA 1U0TA 4S35A 4U9UA 2VRNA 1QHGA 3BYZA 4ALLA 4HATA 3R5XA 4F6LA 4N3NA 1XKTA 5IBRA 5IT9A 1E9RA 1GSHA 3ZYCA 4D4MA 5ITZB 2JS7A 2NSYA 5GWXA 1IJKA 1H3FA 3PUJA 1SUBA 2WVJA 2XQJA 4X8OA 3PGJA 4DOMA 1CQJB 2Z2ZA 1AB6A 4PRLA 2IPNA 2E3JA 3FPKA 1O03A 2M32A 3WXBA 2VQEB 1XC7A 4RGYA 4TKZA 1NVTA 1XTTA 3GFBA 3NHAA 1RLMA 5ALPA 1UH5A 1N7JA 4B81A 1N2CE 2OUKA 1UMDA 4DQVA 3OFND 2O0JA 4QGHA 2ZYTX 1SUWA 5J4HA 3KL4A 2YHBA 3UXEA 4BNNA 3ADBA 2GEBA 1U90A 2VBCA 3JASB 3LT2A 2HF7A 3WWOA 1CQPA 3Q72A 3R4VA 4XVQA 3NWPA 1UT5A 2O5CA 2JLSA 2HSWA 1BDJA 5DI3B 3VHRA 2XDWA 3RSSA 2D1FA 4XW2A 5DLDA 2GN2A 2OCYC 4GX5A 3Q7PA 2OM2A 2VL7A 2B1RA 2GVZC 3E58A 3TQQA 1VHQA 2ZIEA 1Q84A 2IUUA 4RPCA 3PR1A 4RCVA 1CDEA 2ATXA 4WXPA 1UF9A 2KLBA 1VG1A 5ARDA 4MDEA 2UUOA 3TIGA 1C3EA 1PO7A 3VU3A 2ZI7A 2HJ9A 3Q88A 4LG1A 2QMOA 2IU6A 2RGYA 3PIIA 4JBGA 1YA6A 3W5JA 1O95C 1U02A 4EG5A 2ZR9A 1AMOA 1YVEI 3CF6R 5B5SA 1QNLA 1TAHA 1XTRA 3PNBA 1GPUA 2VA8A 2XUGA 3L8YA 5CH8A 2V3CC 3ZWNA 4ZVMA 4M9ZA 2BDEA 3B13B 2ZR0A 5F1OA 2Q45A 1KMCA 3TVTA 3WZ2A 5DCLA 5FWDA 1JSXA 2C92A 4G67A 4NXMB 5JCXA 1XYGA 2QROA 2ZJ1A 4L5BA 3JR3A 4ZOCA 5M5BA 3RH0A 1ZH8A 3BDVA 2VF5X 2QXYA 1M2NA 2SKDA 4QQNA 1KQFA 3GJ0A 3UJ7A 1G5RA 3EIWA 5JHHB 1VZ2A 2DU8A 2JIZA 5JEEA 3U5ZB 1RTKA 3ISTA 4QYTA 2YFYA 1Z5UA 4QZVA 4OYLA 3NX4A 2ZETA 4JA0A 4CLOB 3GLFE 4RE5A 5AP9A 2BE9A 1PZHA 5CJPA 3NHLA 3BEOA 3OX2A 4LFAB 5F9MA 3L8DA 3IEUA 1DTWB 4RXTA 1QJ4A 2X0NA 2Q5IA 4IR7A 2FZVA 2FKAA 4FR0A 5DSTA 5IH3A 2FB9A 5A4MS 3ITDA 3CNQS 1SUCA 2ZIXB 1VL6A 1Q6YA 3ZZ1A 3AUAA 2H9AA 4OQ4A 4MWBA 1M0TA 1VLQA 2RAFA 2CDBA 2WYVA 1B8UA 2FPRA 2ZTVA 2VFAA 5KWVA 4HWGA 2VOEA 3W2HA 2BSAA 1ODIA 1UDRA 3BCRA 1RNLA 5F5XA 4MVJP 1P72A 3AW8A 1T6ZA 3HI6A 2ZWOA 3GUYA 3LUDA 3LUKA 4PLYA 2EYQA 2AS0A 2LCQA 4BO9A 3J81k 3I5XA 2DHCA 5K0EA 2EXXA 1CZKA 1GPYA 4QDXA 2V9PA 5LLSA 1AZTA 3I39X 2RIPA 4OREX 5SV2A 4Q4JB 3M8KA 4YO7A 5AW7A 1ONPA 1K5DA 1JFTA 4Q3NA 2AZXA 1M6EX 1U1GA 2EW1A 2DSNA 3PQ6A 3RO7A 2EJBA 2PA0A 3WGMA 3WLNA 1JQKA 3ZGVA 4JITA 3LL7A 5DYWA 1U7XA 2EFDB 3AP2A 3KS9A 3B6MA 1JXMA 3H75A 5GJCA 4POOA 3MGAA 4ZXFA 3SC2B 3EQ9A 1XCGB 4X91A 2R25B 5DNYB 2YWBA 4AIIA 2PPLA 5LWHA 3GRRA 3HVUA 5FA8A 1DELA 5AJHA 2BGWA 4FDAA 1L1FA 3BB3A 4K9KA 2ZI5A 3A4LA 5I9BA 4Z7QB 3HCWA 3HSSA 3PFGA 1XJQA 1UIMA 1YZLA 4F3TA 1G291 4EY7A 4GLOA 3LUCA 1CKEA 2X7JA 3JW8A 2H2DA 1G5HA 1XAHA 3KZNA 4BQPA 1NRIA 4N54A 1CETA 1O5TA 3WNCA 1XWWA 3FYCA 4EIWA 1RRMA 1A7JA 5G0VA 1M34E 3NNSA 2M1XA 1BAPA 2V0NA 4HPXB 3RSFA 4TYNA 2I2BA 1BHSA 1IWOA 4QUBA 4G1CA 4II2A 3RS5A 3EC1A 1EWVA 4ZGWA 3EG9A 4QL3A 1KYYA 3KQHA 2RJNA 3AR2A 3CZPA 3EJWA 5ESDA 3IQIX 3NEYA 3TVDA 4KH0A 5WRFA 4Y6GB 5B57C 2I22A 5C8YF 2YVAA 3OZCA 1MB2A 1L6RA 5AJVB 3K5HA 4IIVA 5CP8A 2VVTA 1QFYA 4JJFA 1G6KA 1XMVA 3FWHA 4OPMA 2FR8C 2SICE 1Y7LA 2BEVB 4ZREA 3TQIA 3W8DA 4E46A 2D3WA 5PGMA 4ZTUB 3D4IA 3HVIA 2K2QB 3BD7A 3OD5A 5D87A 1E2EA 4MUAA 5HQ3A 2HMVA 4B4UA 3EH1A 5DBIA 5EJGA 2D7JA 1T2VA 4DR3B 1VYUA 1WUTA 1KBQA 1P0FA 3EC2A 5SZIA 1GLGA 1DQYA 3R6WA 4X54A 2WLTA 3G0DA 4XDYA 1Z13A 2G1UA 1A7AA 2D6FA 3CXRA 3FYUB 4ZOAA 3DZHA 4MV0A 5K4AA 3CRZA 1I01A 2GNOA 4RDHA 2QRJA 3OJWA 4JT2A 2VHUA 5EMJA 4ON9A 3TZ6A 1R6BX 3CT6A 1XZPA 3EBPA 5A4DA 1CBUA 2WT9A 2WNIA 1ECCA 5DM2A 1NNLA 4AQDA 3D6HA 3AY3A 4P32A 4JB2A 5EE3A 1JQJC 5C5CA 2O8EA 3FH0A 1M2VA 5IF9A 3SNKA 2B25A 5FEMA 2Y93A 1KJZA 2BHNA 1FA9A 2VJYA 2QX8A 1DRUA 4DIEA 1OGIA 3OFNA 3MYRA 1U9YA 1XXLA 1BEUB 1EAMA 2XMDA 4I7EA 2WMDA 4NBTA 2XLCA 4X8HA 2DLDA 4EGJA 2WY2D 3FDFA 3FPGA 3DV2A 3VPHA 2E2WA 4ITUA 2PX8A 3FM9A 3HDQA 5DIZA 4X66B 4DRXA 3MS7A 2Q28A 3DZIA 3MS4A 5I3ZA 3KUCA 2XXJA 1FP1D 2QTFA 4NK4A 1RPAA 2F1OA 2DCMA 4FD3A 2M6KA 2BFEB 2FV8A 4GXNA 4IFBA 2GHIA 4E1BA 3IBGA 2BEVA 2FGJA 4LI3X 1RCTE 2X0KA 1QWSA 3PHBE 3QFRA 3RD5A 3WRXC 4GMFA 5ALXA 1YJCA 3NORA 5KOJB 2G7ZA 3W77A 3AQ4A 4FXOA 5CT9A 4BEBA 4E22A 3QLTA 1NQ5A 4GC9A 4UHBA 3ZWOA 5HGXA 3BMCA 3BULA 3ROPA 2AFIB 3OAAA 3NNNA 3REGA 1DBRA 5EXXA 1R27A 2ZUUA 3LKBA 5FDFA 1DDOA 2XECA 3KLNA 3ND6A 4XUDA 4B17A 1GA1A 1JIQA 4HNAA 2Y68A 1XDBA 1ZW6A 2RHDA 4IMJB 2QLNA 3VDMA 2XTZA 1ST2A 2KX7A 2J0VA 4XPIA 3PGA1 1OT3A 2DRIA 4ZVLA 1EE2A 3PL1A 4FI3C 1H5QA 1FMCA 4Y2TA 1NXOA 4G9EA 4ZCIA 4A2WA 1YA4A 2D1SA 3X1MA 1CP2A 2ECPA 1G7TA 3VX4A 1KEKA 2R00C 3SDZA 4ZIRB 1N8NA 4RVGA 5DISB 3RCBA 3DP7A 1NU8A 1YK1A 1OY1A 4CGZA 2LBPA 1WCIB 1L1EA 2ZRDA 3JQPA 3O93A 2ZIFA 1Z4KA 2IXFA 3B1ZA 1M6HA 2ACKA 1ESCA 2VAXA 5DASA 2GBIA 1A9YA 2EKBA 3U37A 3OEHD 1RWXA 1K6MA 4Q3EA 3F3YA 3TEFA 3R0XA 2DM6A 2W2QA 1L5QA 1Q7EA 1I4WA 1AB5A 2Q2WA 3ANTA 3B2QA 1UBUS 2WJWA 4AUNA 4CHGA 2QZSA 1HF3A 4IG9A 2Q0QA 2EGGA 3OZEA 4XUGB 3LPDA 4TZTA 5FBVB 1ZGCA 1TF2A 2RDMA 4BNMA 2YWRA 3TJMA 5KYXB 3X1YA 5K45A 2XIQA 1BSVA 1RQPA 2GLUA 3G59A 4Q01A 2ZI6A 4Q6BA 2C99A 3ZCQA 4E11A 4TZ6A 3I34X 2I7CA 2QNIA 1DP4A 1NY5A 4F8EA 4RTOA 1NOKA 1VE9A 4Q9LA 5EC8A 3SBEA 2DT8A 2EW8A 2B34A 4FMCB 3CUWA 2G9ZA 3EQ6A 4OQFA 2H3HA 1IYZA 1P5FA 3FNEA 4XDHA 2L82A 4ZDKA 4B3SB 3EEOA 3DMPA 1OVGA 3JRXA 4CWAA 2JJ1D 3GLKA 4QU0A