5PRNA

E1m, y96w, s119w mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTWDSEMGYEASSFGDAQSSFFAYNWKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5prnA00
1GFMA 2O4VA 3O0EA 4FRXA 2K4TA 5DL6A 5PRNA 4LSIA 3PRNA 2ZLDA 6PRNA 4GCQA 1GFNA 1MPFA 5DL8A 1H6S1 1OPFA 4LSFA 1GFQA 2FGQX 3PORA 2Y0LA 2OMFA 4FT6A 4KRAA 2XE1A 2PRNA 3SYBA 3VY9X 4D64A 3FYXA 8PRNA 4KR4A 4FMSA 4LSEA 1HXTA 4D65A 4GCSA 2Y0KA 1BH3A 1HXXA 4LSHA 4FSOA 2Y2XA 3JTYA 5DL7A 2J1NA 1GFOA 2XG6A 5JDPA 1PRNA 3T0SA 1HXUA 1BT9A 1PHOA 2J4UP 3UPGA 2FGRA 2ZFGA 3WI4A 3VZWX 2XE5A 4C69X 4GCPA 3POUA 4JFBA 3HW9A 3POXA 4D5UA 2PORA 4RJXA 7PRNA 5FVNA 4AUIA 3SZVA 4BUMX 1GFPA 3K19A 3VY8X 3A2SX 3EMNX 4KR8A 3VZTX 3NSGA 2XE3A 3VZUX 3POQA 4FSPA 4FRTA 2QTKA 3UU2A 3SYSA 3SY9A 4FOZA 3SZDA 1E54A 4RJWA 2Y0HA 1OSMA 3SY7A 3T20A 3WI5A 5DL5A 2ODJA 2XE2A 3T24A 3HWBA
chains in the Genus database with same CATH superfamily
1GFMA 3C5OA 4B61A 4C4VB 2AXTO 3AA1B 2O4VA 4FESA 3A0HO 3LK42 2N2MA 3LK3B 3O0EA 5GTIO 4AKRA 2N2LA 4FRXA 4CTDA 1QJ8A 2JMMA 2K4TA 5DL6A 3LK41 1MM5A 2ERVA 5PRNA 4O3WA 4O4UA 4LSIA 1ZHWA 2M06A 5TISO 4FZLA 3PRNA 2ZLDA 6PRNA 4GCQA 3AA0B 1GFNA 1MPFA 2MHLA 5DL8A 1H6S1 1OPFA 2R4LA 3KVDD 4XNLA 4LSFA 2K0LA 2R88A 5B66O 1GFQA 4Z3TA 2FGQX 3AAEB 2R8AA 3AA7A 3G7GA 3JCUO 3PORA 2Y0LA 2OMFA 3LK3A 1S5LO 3QRAA 4G75A 4AYEC 4QQ1A 4FT6A 3TZGA 3PGRA 4KRAA 4G76A 2XE1A 3AAEA 2PRNA 3SYBA 1G90A 3PQUA 4RL9A 4XNKA 4FZNA 5G38A 3VY9X 4D64A 5H2FO 3FYXA 2W81C 3HOEA 8PRNA 2MNHA 4F4BA 4KR4A 5GTHO 1IZNA 2M07A 2KXPB 4RLCA 4FMSA 4C4VA 4LSEA 1ZHTA 1HXTA 3DWOX 3GP6A 5KAFO 4AYNA 4C00A 4D65A 4GCSA 2Y0KA 3PF1A 1BH3A 1HXXA 2KDYA 2XTRA 3RBHA 4E1SA 1IZNB 4LSHA 4O4XA 5ADXL 4FSOA 2Y2XA 3JTYA 2KC0A 3AA6A 5DL7A 3LK2A 2J1NA 3DA4A 1GFOA 2WVPA 2XG6A 5JDPA 4JCHA 1PRNA 4O3ZA 3T0SA 5AFUK 2F1VA 4AYDC 3V8UA 1HXUA 1ZHXA 3VE2A 4GHBA 2LFUA 2X27X 3BRYA 1BT9A 1PHOA 3AA7B 4E1TA 2IWWA 2J4UP 2FGRA 3UPGA 1YS5A 4FUVA 4FQEA 2ZFGA 3A0BO 4O49A 4AKMA 2R4OA 3VZWX 2XE5A 5G26A 2LHFA 3WI4A 4UB8O 2F1TA 4C69X 1MM4A 3BS0A 4PUXA 2XMXA 4GCPA 3POUA 5AFUL 3DWNA 4JFBA 4K3BA 3AA1A 3HW9A 3POXA 4D5UA 1QJPA 5B5EO 4AZLA 2KZ7A 2PORA 2Y7SA 4N59A 2R89A 4RJXA 5E79O 3HWBA 3PQSA 3DA3A 5EE2A 7PRNA 1T16A 5ADXK 2R4PA 4FZMA 5FVNA 4AFKA 3PGSA 1Q9FA 2GE4A 4K3CA 5T5FA 4N58A 2F1CX 4AUIA 4AYMC 1BXWA 3SZVA 4PJ0O 5KAIO 4BUMX 5D5DA 1GFPA 2WJQA 1P4TA 3K19A 3LK2B 3UAQA 3AA6B 2XTQA 3VY8X 5IYUA 1ZHYA 4PR7A 2X9KA 3A2SX 3EMNX 2KXPA 2R4NA 2YNKA 4UB6O 3KZIO 4KR8A 5G39A 3VZTX 3NSGA 3NJTA 3HOLA 2XE3A 3AAAA 2JQYA 3BRZA 3VZUX 3POQA 4GF4A 4FSPA 3QRCA 4IL6O 4O3YA 2W80C 4FRTA 4AKRB 2QTKA 3UU2A 3PGUA 3SYSA 1T1LA 5G3AA 4FOZA 3SY9A 3SZDA 3WU2O 1E54A 4N75A 4RJWA 4U9CA 4N74A 3DZMA 2YPVA 1QJ9A 2Y0HA 1ORMA 1OSMA 1THQA 2KZ7B 3SY7A 4O3XB 5GV0A 3T20A 3AA0A 3WI5A 5DL5A 1ZHZA 2ODJA 4RLBA 2XE2A 2WJRA 4AYID 3T24A 2IWVA 3AAAB 3VE1A 1Q9GA
chains in the Genus database with same CATH topology
1GFMA 3C5OA 4B61A 3AA1B 2O4VA 4FESA 3LK42 2N2MA 3LK3B 3O0EA 4AKRA 2N2LA 4FRXA 1QJ8A 2JMMA 2K4TA 5DL6A 3LK41 1MM5A 2ERVA 5PRNA 4O3WA 4O4UA 4LSIA 1ZHWA 2M06A 4FZLA 3PRNA 2ZLDA 6PRNA 4GCQA 3AA0B 1GFNA 1MPFA 2MHLA 5DL8A 1H6S1 1OPFA 4XNLA 3KVDD 4LSFA 2K0LA 1GFQA 4Z3TA 2FGQX 3AAEB 3AA7A 3G7GA 3PORA 3QRAA 4G75A 2Y0LA 2OMFA 3LK3A 4AYEC 4QQ1A 4FT6A 3TZGA 4KRAA 4G76A 2XE1A 3AAEA 2PRNA 3SYBA 1G90A 3PQUA 4RL9A 4XNKA 4FZNA 3VY9X 4D64A 3FYXA 2W81C 3HOEA 8PRNA 2MNHA 4F4BA 4KR4A 1IZNA 2M07A 2KXPB 4RLCA 4FMSA 4LSEA 1ZHTA 1HXTA 3GP6A 4AYNA 4D65A 4GCSA 2Y0KA 1BH3A 1HXXA 2KDYA 2XTRA 3RBHA 4E1SA 1IZNB 4LSHA 4O4XA 5ADXL 4FSOA 2Y2XA 3JTYA 2KC0A 3AA6A 5DL7A 3LK2A 2J1NA 3DA4A 1GFOA 2XG6A 5JDPA 4JCHA 1PRNA 4O3ZA 3T0SA 5AFUK 2F1VA 4AYDC 3V8UA 1HXUA 1ZHXA 3VE2A 4GHBA 2LFUA 2X27X 1BT9A 1PHOA 3AA7B 4E1TA 2J4UP 3UPGA 2FGRA 1YS5A 4FUVA 2ZFGA 4O49A 4AKMA 3WI4A 3VZWX 2XE5A 5G26A 2LHFA 2F1TA 4C69X 1MM4A 4PUXA 2XMXA 4GCPA 3POUA 5AFUL 4JFBA 3AA1A 3HW9A 3POXA 4D5UA 1QJPA 4AZLA 2KZ7A 2PORA 2Y7SA 4N59A 4RJXA 3HWBA 3PQSA 3DA3A 5EE2A 7PRNA 5ADXK 4FZMA 5FVNA 4AFKA 1Q9FA 2GE4A 5T5FA 4N58A 4AUIA 4AYMC 1BXWA 3SZVA 4BUMX 5D5DA 1GFPA 3LK2B 1P4TA 3K19A 3UAQA 3AA6B 2XTQA 3VY8X 5IYUA 1ZHYA 3A2SX 3EMNX 2KXPA 2YNKA 4KR8A 3VZTX 3NSGA 3HOLA 2XE3A 3AAAA 3VZUX 3POQA 4GF4A 4FSPA 3QRCA 4O3YA 2W80C 4FRTA 4AKRB 2QTKA 3UU2A 3SYSA 3SY9A 4FOZA 3SZDA 1E54A 4U9CA 4RJWA 2YPVA 1QJ9A 2Y0HA 1ORMA 1OSMA 1THQA 2KZ7B 3SY7A 4O3XB 5GV0A 3T20A 3AA0A 3WI5A 5DL5A 1ZHZA 2ODJA 4RLBA 2XE2A 4AYID 3T24A 3AAAB 3VE1A 1Q9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFM A;  2O4V A;  3O0E A;  4FRX A;  2K4T A;  5DL6 A;  5PRN A;  4LSI A;  3PRN A;  2ZLD A;  6PRN A;  4GCQ A;  1GFN A;  1MPF A;  5DL8 A;  1H6S 1;  1OPF A;  4LSF A;  1GFQ A;  2FGQ X;  3POR A;  2Y0L A;  2OMF A;  4FT6 A;  4KRA A;  2XE1 A;  2PRN A;  3SYB A;  3VY9 X;  4D64 A;  3FYX A;  8PRN A;  4KR4 A;  4FMS A;  4LSE A;  1HXT A;  4D65 A;  4GCS A;  2Y0K A;  1BH3 A;  1HXX A;  4LSH A;  4FSO A;  2Y2X A;  3JTY A;  5DL7 A;  2J1N A;  1GFO A;  2XG6 A;  5JDP A;  1PRN A;  3T0S A;  1HXU A;  1BT9 A;  1PHO A;  2J4U P;  3UPG A;  2FGR A;  2ZFG A;  3WI4 A;  3VZW X;  2XE5 A;  4C69 X;  4GCP A;  3POU A;  4JFB A;  3HW9 A;  3POX A;  4D5U A;  2POR A;  4RJX A;  7PRN A;  5FVN A;  4AUI A;  3SZV A;  4BUM X;  1GFP A;  3K19 A;  3VY8 X;  3A2S X;  3EMN X;  4KR8 A;  3VZT X;  3NSG A;  2XE3 A;  3VZU X;  3POQ A;  4FSP A;  4FRT A;  2QTK A;  3UU2 A;  3SYS A;  3SY9 A;  4FOZ A;  3SZD A;  1E54 A;  4RJW A;  2Y0H A;  1OSM A;  3SY7 A;  3T20 A;  3WI5 A;  5DL5 A;  2ODJ A;  2XE2 A;  3T24 A;  3HWB A; 
#chains in the Genus database with same CATH topology
 1GFM A;  3C5O A;  4B61 A;  4C4V B;  2AXT O;  3AA1 B;  2O4V A;  4FES A;  3A0H O;  3LK4 2;  2N2M A;  3LK3 B;  3O0E A;  5GTI O;  4AKR A;  2N2L A;  4FRX A;  4CTD A;  1QJ8 A;  2JMM A;  2K4T A;  5DL6 A;  3LK4 1;  1MM5 A;  2ERV A;  5PRN A;  4O3W A;  4O4U A;  4LSI A;  1ZHW A;  2M06 A;  5TIS O;  4FZL A;  3PRN A;  2ZLD A;  6PRN A;  4GCQ A;  3AA0 B;  1GFN A;  1MPF A;  2MHL A;  5DL8 A;  1H6S 1;  1OPF A;  2R4L A;  3KVD D;  4XNL A;  4LSF A;  2K0L A;  2R88 A;  5B66 O;  1GFQ A;  4Z3T A;  2FGQ X;  3AAE B;  2R8A A;  3AA7 A;  3G7G A;  3JCU O;  3POR A;  2Y0L A;  2OMF A;  3LK3 A;  1S5L O;  3QRA A;  4G75 A;  4AYE C;  4QQ1 A;  4FT6 A;  3TZG A;  3PGR A;  4KRA A;  4G76 A;  2XE1 A;  3AAE A;  2PRN A;  3SYB A;  1G90 A;  3PQU A;  4RL9 A;  4XNK A;  4FZN A;  5G38 A;  3VY9 X;  4D64 A;  5H2F O;  3FYX A;  2W81 C;  3HOE A;  8PRN A;  2MNH A;  4F4B A;  4KR4 A;  5GTH O;  1IZN A;  2M07 A;  2KXP B;  4RLC A;  4FMS A;  4C4V A;  4LSE A;  1ZHT A;  1HXT A;  3DWO X;  3GP6 A;  5KAF O;  4AYN A;  4C00 A;  4D65 A;  4GCS A;  2Y0K A;  3PF1 A;  1BH3 A;  1HXX A;  2KDY A;  2XTR A;  3RBH A;  4E1S A;  1IZN B;  4LSH A;  4O4X A;  5ADX L;  4FSO A;  2Y2X A;  3JTY A;  2KC0 A;  3AA6 A;  5DL7 A;  3LK2 A;  2J1N A;  3DA4 A;  1GFO A;  2WVP A;  2XG6 A;  5JDP A;  4JCH A;  1PRN A;  4O3Z A;  3T0S A;  5AFU K;  2F1V A;  4AYD C;  3V8U A;  1HXU A;  1ZHX A;  3VE2 A;  4GHB A;  2LFU A;  2X27 X;  3BRY A;  1BT9 A;  1PHO A;  3AA7 B;  4E1T A;  2IWW A;  2J4U P;  2FGR A;  3UPG A;  1YS5 A;  4FUV A;  4FQE A;  2ZFG A;  3A0B O;  4O49 A;  4AKM A;  2R4O A;  3VZW X;  2XE5 A;  5G26 A;  2LHF A;  3WI4 A;  4UB8 O;  2F1T A;  4C69 X;  1MM4 A;  3BS0 A;  4PUX A;  2XMX A;  4GCP A;  3POU A;  5AFU L;  3DWN A;  4JFB A;  4K3B A;  3AA1 A;  3HW9 A;  3POX A;  4D5U A;  1QJP A;  5B5E O;  4AZL A;  2KZ7 A;  2POR A;  2Y7S A;  4N59 A;  2R89 A;  4RJX A;  5E79 O;  3HWB A;  3PQS A;  3DA3 A;  5EE2 A;  7PRN A;  1T16 A;  5ADX K;  2R4P A;  4FZM A;  5FVN A;  4AFK A;  3PGS A;  1Q9F A;  2GE4 A;  4K3C A;  5T5F A;  4N58 A;  2F1C X;  4AUI A;  4AYM C;  1BXW A;  3SZV A;  4PJ0 O;  5KAI O;  4BUM X;  5D5D A;  1GFP A;  2WJQ A;  1P4T A;  3K19 A;  3LK2 B;  3UAQ A;  3AA6 B;  2XTQ A;  3VY8 X;  5IYU A;  1ZHY A;  4PR7 A;  2X9K A;  3A2S X;  3EMN X;  2KXP A;  2R4N A;  2YNK A;  4UB6 O;  3KZI O;  4KR8 A;  5G39 A;  3VZT X;  3NSG A;  3NJT A;  3HOL A;  2XE3 A;  3AAA A;  2JQY A;  3BRZ A;  3VZU X;  3POQ A;  4GF4 A;  4FSP A;  3QRC A;  4IL6 O;  4O3Y A;  2W80 C;  4FRT A;  4AKR B;  2QTK A;  3UU2 A;  3PGU A;  3SYS A;  1T1L A;  5G3A A;  4FOZ A;  3SY9 A;  3SZD A;  3WU2 O;  1E54 A;  4N75 A;  4RJW A;  4U9C A;  4N74 A;  3DZM A;  2YPV A;  1QJ9 A;  2Y0H A;  1ORM A;  1OSM A;  1THQ A;  2KZ7 B;  3SY7 A;  4O3X B;  5GV0 A;  3T20 A;  3AA0 A;  3WI5 A;  5DL5 A;  1ZHZ A;  2ODJ A;  4RLB A;  2XE2 A;  2WJR A;  4AYI D;  3T24 A;  2IWV A;  3AAA B;  3VE1 A;  1Q9G A; 
#chains in the Genus database with same CATH homology
 1GFM A;  3C5O A;  4B61 A;  3AA1 B;  2O4V A;  4FES A;  3LK4 2;  2N2M A;  3LK3 B;  3O0E A;  4AKR A;  2N2L A;  4FRX A;  1QJ8 A;  2JMM A;  2K4T A;  5DL6 A;  3LK4 1;  1MM5 A;  2ERV A;  5PRN A;  4O3W A;  4O4U A;  4LSI A;  1ZHW A;  2M06 A;  4FZL A;  3PRN A;  2ZLD A;  6PRN A;  4GCQ A;  3AA0 B;  1GFN A;  1MPF A;  2MHL A;  5DL8 A;  1H6S 1;  1OPF A;  4XNL A;  3KVD D;  4LSF A;  2K0L A;  1GFQ A;  4Z3T A;  2FGQ X;  3AAE B;  3AA7 A;  3G7G A;  3POR A;  3QRA A;  4G75 A;  2Y0L A;  2OMF A;  3LK3 A;  4AYE C;  4QQ1 A;  4FT6 A;  3TZG A;  4KRA A;  4G76 A;  2XE1 A;  3AAE A;  2PRN A;  3SYB A;  1G90 A;  3PQU A;  4RL9 A;  4XNK A;  4FZN A;  3VY9 X;  4D64 A;  3FYX A;  2W81 C;  3HOE A;  8PRN A;  2MNH A;  4F4B A;  4KR4 A;  1IZN A;  2M07 A;  2KXP B;  4RLC A;  4FMS A;  4LSE A;  1ZHT A;  1HXT A;  3GP6 A;  4AYN A;  4D65 A;  4GCS A;  2Y0K A;  1BH3 A;  1HXX A;  2KDY A;  2XTR A;  3RBH A;  4E1S A;  1IZN B;  4LSH A;  4O4X A;  5ADX L;  4FSO A;  2Y2X A;  3JTY A;  2KC0 A;  3AA6 A;  5DL7 A;  3LK2 A;  2J1N A;  3DA4 A;  1GFO A;  2XG6 A;  5JDP A;  4JCH A;  1PRN A;  4O3Z A;  3T0S A;  5AFU K;  2F1V A;  4AYD C;  3V8U A;  1HXU A;  1ZHX A;  3VE2 A;  4GHB A;  2LFU A;  2X27 X;  1BT9 A;  1PHO A;  3AA7 B;  4E1T A;  2J4U P;  3UPG A;  2FGR A;  1YS5 A;  4FUV A;  2ZFG A;  4O49 A;  4AKM A;  3WI4 A;  3VZW X;  2XE5 A;  5G26 A;  2LHF A;  2F1T A;  4C69 X;  1MM4 A;  4PUX A;  2XMX A;  4GCP A;  3POU A;  5AFU L;  4JFB A;  3AA1 A;  3HW9 A;  3POX A;  4D5U A;  1QJP A;  4AZL A;  2KZ7 A;  2POR A;  2Y7S A;  4N59 A;  4RJX A;  3HWB A;  3PQS A;  3DA3 A;  5EE2 A;  7PRN A;  5ADX K;  4FZM A;  5FVN A;  4AFK A;  1Q9F A;  2GE4 A;  5T5F A;  4N58 A;  4AUI A;  4AYM C;  1BXW A;  3SZV A;  4BUM X;  5D5D A;  1GFP A;  3LK2 B;  1P4T A;  3K19 A;  3UAQ A;  3AA6 B;  2XTQ A;  3VY8 X;  5IYU A;  1ZHY A;  3A2S X;  3EMN X;  2KXP A;  2YNK A;  4KR8 A;  3VZT X;  3NSG A;  3HOL A;  2XE3 A;  3AAA A;  3VZU X;  3POQ A;  4GF4 A;  4FSP A;  3QRC A;  4O3Y A;  2W80 C;  4FRT A;  4AKR B;  2QTK A;  3UU2 A;  3SYS A;  3SY9 A;  4FOZ A;  3SZD A;  1E54 A;  4U9C A;  4RJW A;  2YPV A;  1QJ9 A;  2Y0H A;  1ORM A;  1OSM A;  1THQ A;  2KZ7 B;  3SY7 A;  4O3X B;  5GV0 A;  3T20 A;  3AA0 A;  3WI5 A;  5DL5 A;  1ZHZ A;  2ODJ A;  4RLB A;  2XE2 A;  4AYI D;  3T24 A;  3AAA B;  3VE1 A;  1Q9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...