5PRNA

E1m, y96w, s119w mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTWDSEMGYEASSFGDAQSSFFAYNWKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5prnA00
1GFMA 1PHOA 1HXTA 3JTYA 3T24A 1PRNA 3VZTX 4AUIA 1BT9A 3K19A 1OSMA 3PRNA 4LSFA 4KRAA 1BH3A 2QTKA 5DL6A 7PRNA 4GCQA 2XE5A 5PRNA 3UPGA 4KR4A 2J1NA 3A2SX 4D65A 1H6S1 1HXUA 3O0EA 3EMNX 4LSHA 3VZUX 3FYXA 3WI4A 3T20A 2FGQX 5DL8A 4FRTA 4GCPA 4JFBA 3SY9A 4FMSA 3SY7A 4RJXA 4LSEA 2ZLDA 4BUMX 3POXA 5JDPA 3VZWX 1GFOA 4FT6A 3HW9A 1E54A 3SZDA 6PRNA 2Y0LA 4D5UA 3SZVA 3HWBA 3SYSA 3NSGA 1MPFA 3UU2A 2OMFA 4KR8A 2PORA 2XE2A 2ODJA 4C69X 2XE1A 2Y0KA 2XG6A 4GCSA 3VY9X 3POUA 5DL7A 8PRNA 4FSPA 4FOZA 3WI5A 4FRXA 3VY8X 4D64A 4FSOA 2J4UP 2PRNA 2Y2XA 5DL5A 4LSIA 2XE3A 2ZFGA 1HXXA 2K4TA 3T0SA 3SYBA 2Y0HA 5FVNA 2O4VA 1GFPA 2FGRA 4RJWA 1GFQA 1OPFA 3POQA 3PORA 1GFNA
chains in the Genus database with same CATH superfamily
2R4PA 3AA6B 1GFMA 2X9KA 1PHOA 3AA1B 4F4BA 4N58A 4CTDA 3LK3B 1HXTA 2F1TA 3JTYA 3T24A 2X27X 4RL9A 4AYEC 4PR7A 2R4OA 2W81C 3PQUA 1PRNA 3QRCA 3VZTX 3BRZA 5ADXK 4AUIA 4UB8O 1BT9A 3K19A 1ZHZA 1OSMA 3PRNA 4AKMA 4LSFA 2IWWA 4KRAA 1BH3A 2QTKA 5DL6A 7PRNA 4GCQA 1T1LA 1IZNA 2R88A 1MM5A 4O3WA 4O3XB 2XE5A 5PRNA 3UPGA 3AAAA 3PGSA 1QJPA 4KR4A 3AA0B 2J1NA 3JCUO 5AFUK 3LK41 4AYNA 2GE4A 3A2SX 4IL6O 5G39A 5KAFO 5TISO 2N2MA 2R4LA 3A0HO 5D5DA 4D65A 1H6S1 4O49A 3AAEB 1HXUA 4AZLA 3O0EA 4AYID 3EMNX 3PQSA 4LSHA 3KZIO 3VZUX 4PUXA 5G26A 3DZMA 4GF4A 4AKRA 2KC0A 3V8UA 3FYXA 3WI4A 4RLCA 3T20A 1YS5A 3NJTA 4Z3TA 2R4NA 2KZ7A 2F1CX 3QRAA 1MM4A 5G3AA 2FGQX 5DL8A 4FRTA 4GCPA 3AA6A 3DA3A 3AA7B 4FZMA 4JFBA 1ZHYA 4FMSA 3SY9A 3LK3A 4G75A 2YNKA 4RLBA 2XMXA 3SY7A 4RJXA 1P4TA 4LSEA 3RBHA 5KAIO 2ZLDA 3GP6A 4BUMX 2KDYA 1G90A 4B61A 3POXA 2MHLA 5B66O 3HOEA 5JDPA 1IZNB 3BRYA 4FQEA 1THQA 3VZWX 1GFOA 5H2FO 3AAAB 4FT6A 3AA0A 3LK2A 3TZGA 3HW9A 2ERVA 3LK42 3VE1A 1E54A 3PGUA 4O4XA 3PGRA 3SZDA 6PRNA 3AAEA 2Y0LA 4FUVA 3WU2O 2F1VA 3SZVA 4O3ZA 4D5UA 3HWBA 4AYMC 3SYSA 3NSGA 1MPFA 3UU2A 5GV0A 4E1SA 2K0LA 2OMFA 2PORA 4KR8A 2XE2A 2JMMA 1Q9FA 1ZHXA 4E1TA 2KXPB 2KZ7B 2ODJA 4C69X 2XE1A 2M06A 2Y0KA 4O3YA 2XG6A 4GCSA 4K3CA 2JQYA 3VY9X 3AA7A 1QJ8A 3POUA 4UB6O 3HOLA 5DL7A 1Q9GA 4FSPA 4C4VA 8PRNA 2WJQA 4FOZA 1BXWA 2MNHA 3WI5A 4FRXA 4AFKA 4FZNA 4G76A 2R8AA 5G38A 3VY8X 2YPVA 4D64A 3AA1A 4XNLA 4FSOA 2J4UP 4FZLA 4N59A 2Y7SA 4U9CA 5GTHO 2PRNA 1QJ9A 3C5OA 3G7GA 5T5FA 2Y2XA 5DL5A 5B5EO 4LSIA 4O4UA 1ZHTA 2XE3A 1ORMA 3LK2B 2WVPA 2XTRA 2ZFGA 1HXXA 5E79O 2K4TA 3UAQA 3T0SA 5AFUL 4QQ1A 3KVDD 2Y0HA 3SYBA 2M07A 4FESA 4PJ0O 4C00A 5FVNA 5IYUA 2O4VA 1GFPA 2FGRA 4RJWA 4XNKA 3PF1A 3VE2A 1T16A 1GFQA 2W80C 1ZHWA 3BS0A 1OPFA 4N74A 2AXTO 2KXPA 3DA4A 4JCHA 2WJRA 2XTQA 5ADXL 4AYDC 3POQA 4N75A 4AKRB 5EE2A 2R89A 2IWVA 1S5LO 2LHFA 2LFUA 2N2LA 3A0BO 3PORA 5GTIO 4C4VB 1GFNA 3DWNA 4GHBA 3DWOX 4K3BA
chains in the Genus database with same CATH topology
3AA6B 1GFMA 1PHOA 3AA1B 4F4BA 4N58A 3LK3B 1HXTA 2F1TA 3JTYA 3T24A 2X27X 4RL9A 4AYEC 2W81C 3QRCA 3PQUA 1PRNA 3VZTX 5ADXK 4AUIA 1BT9A 3K19A 1ZHZA 1OSMA 3PRNA 4AKMA 4LSFA 4KRAA 1BH3A 2QTKA 5DL6A 7PRNA 4GCQA 1IZNA 1MM5A 4O3WA 4O3XB 2XE5A 5PRNA 3UPGA 3AAAA 5AFUK 1QJPA 4KR4A 3AA0B 2J1NA 3LK41 4AYNA 2GE4A 3A2SX 2N2MA 5D5DA 4D65A 1H6S1 4O49A 3AAEB 1HXUA 4AZLA 3O0EA 4AYID 3EMNX 3PQSA 4LSHA 3VZUX 4AKRA 4PUXA 5G26A 4GF4A 2KC0A 3V8UA 3FYXA 3WI4A 4RLCA 3T20A 1YS5A 4Z3TA 2KZ7A 3QRAA 1MM4A 2FGQX 5DL8A 4FRTA 4GCPA 3AA6A 3DA3A 3AA7B 4FZMA 4JFBA 1ZHYA 4FMSA 3SY9A 3LK3A 4G75A 2YNKA 4RLBA 2XMXA 3SY7A 4RJXA 1P4TA 4LSEA 3RBHA 2ZLDA 3GP6A 4BUMX 2KDYA 1G90A 4B61A 3POXA 2MHLA 3HOEA 5JDPA 1IZNB 3VZWX 1THQA 1GFOA 3AAAB 4FT6A 3AA0A 3LK2A 3TZGA 3HW9A 2ERVA 3LK42 3VE1A 1E54A 4O4XA 3SZDA 6PRNA 3AAEA 2Y0LA 4FUVA 4D5UA 2F1VA 3SZVA 4O3ZA 3HWBA 4AYMC 3SYSA 3NSGA 1MPFA 3UU2A 5GV0A 4E1SA 2K0LA 2OMFA 2PORA 4KR8A 2XE2A 2JMMA 1Q9FA 1ZHXA 4E1TA 2KXPB 2KZ7B 2ODJA 4C69X 2XE1A 2M06A 2Y0KA 4O3YA 2XG6A 4GCSA 3VY9X 3AA7A 1QJ8A 3POUA 3HOLA 5DL7A 1Q9GA 4FSPA 8PRNA 4FOZA 3WI5A 1BXWA 2MNHA 4AFKA 4FRXA 4FZNA 4G76A 3VY8X 2YPVA 4D64A 3AA1A 4XNLA 4FSOA 2J4UP 4FZLA 4N59A 2Y7SA 4U9CA 2PRNA 1QJ9A 3C5OA 3G7GA 5T5FA 2Y2XA 5DL5A 4LSIA 4O4UA 1ZHTA 2XE3A 1ORMA 3LK2B 2XTRA 2ZFGA 1HXXA 2K4TA 3UAQA 3T0SA 5AFUL 4QQ1A 3KVDD 2Y0HA 3SYBA 2M07A 4FESA 5IYUA 5FVNA 2O4VA 1GFPA 2FGRA 4RJWA 4XNKA 3VE2A 1GFQA 2W80C 1ZHWA 1OPFA 2KXPA 3DA4A 4JCHA 2XTQA 5ADXL 4AYDC 3POQA 4AKRB 5EE2A 2LHFA 3PORA 2LFUA 2N2LA 1GFNA 4GHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFM A;  1PHO A;  1HXT A;  3JTY A;  3T24 A;  1PRN A;  3VZT X;  4AUI A;  1BT9 A;  3K19 A;  1OSM A;  3PRN A;  4LSF A;  4KRA A;  1BH3 A;  2QTK A;  5DL6 A;  7PRN A;  4GCQ A;  2XE5 A;  5PRN A;  3UPG A;  4KR4 A;  2J1N A;  3A2S X;  4D65 A;  1H6S 1;  1HXU A;  3O0E A;  3EMN X;  4LSH A;  3VZU X;  3FYX A;  3WI4 A;  3T20 A;  2FGQ X;  5DL8 A;  4FRT A;  4GCP A;  4JFB A;  3SY9 A;  4FMS A;  3SY7 A;  4RJX A;  4LSE A;  2ZLD A;  4BUM X;  3POX A;  5JDP A;  3VZW X;  1GFO A;  4FT6 A;  3HW9 A;  1E54 A;  3SZD A;  6PRN A;  2Y0L A;  4D5U A;  3SZV A;  3HWB A;  3SYS A;  3NSG A;  1MPF A;  3UU2 A;  2OMF A;  4KR8 A;  2POR A;  2XE2 A;  2ODJ A;  4C69 X;  2XE1 A;  2Y0K A;  2XG6 A;  4GCS A;  3VY9 X;  3POU A;  5DL7 A;  8PRN A;  4FSP A;  4FOZ A;  3WI5 A;  4FRX A;  3VY8 X;  4D64 A;  4FSO A;  2J4U P;  2PRN A;  2Y2X A;  5DL5 A;  4LSI A;  2XE3 A;  2ZFG A;  1HXX A;  2K4T A;  3T0S A;  3SYB A;  2Y0H A;  5FVN A;  2O4V A;  1GFP A;  2FGR A;  4RJW A;  1GFQ A;  1OPF A;  3POQ A;  3POR A;  1GFN A; 
#chains in the Genus database with same CATH topology
 2R4P A;  3AA6 B;  1GFM A;  2X9K A;  1PHO A;  3AA1 B;  4F4B A;  4N58 A;  4CTD A;  3LK3 B;  1HXT A;  2F1T A;  3JTY A;  3T24 A;  2X27 X;  4RL9 A;  4AYE C;  4PR7 A;  2R4O A;  2W81 C;  3PQU A;  1PRN A;  3QRC A;  3VZT X;  3BRZ A;  5ADX K;  4AUI A;  4UB8 O;  1BT9 A;  3K19 A;  1ZHZ A;  1OSM A;  3PRN A;  4AKM A;  4LSF A;  2IWW A;  4KRA A;  1BH3 A;  2QTK A;  5DL6 A;  7PRN A;  4GCQ A;  1T1L A;  1IZN A;  2R88 A;  1MM5 A;  4O3W A;  4O3X B;  2XE5 A;  5PRN A;  3UPG A;  3AAA A;  3PGS A;  1QJP A;  4KR4 A;  3AA0 B;  2J1N A;  3JCU O;  5AFU K;  3LK4 1;  4AYN A;  2GE4 A;  3A2S X;  4IL6 O;  5G39 A;  5KAF O;  5TIS O;  2N2M A;  2R4L A;  3A0H O;  5D5D A;  4D65 A;  1H6S 1;  4O49 A;  3AAE B;  1HXU A;  4AZL A;  3O0E A;  4AYI D;  3EMN X;  3PQS A;  4LSH A;  3KZI O;  3VZU X;  4PUX A;  5G26 A;  3DZM A;  4GF4 A;  4AKR A;  2KC0 A;  3V8U A;  3FYX A;  3WI4 A;  4RLC A;  3T20 A;  1YS5 A;  3NJT A;  4Z3T A;  2R4N A;  2KZ7 A;  2F1C X;  3QRA A;  1MM4 A;  5G3A A;  2FGQ X;  5DL8 A;  4FRT A;  4GCP A;  3AA6 A;  3DA3 A;  3AA7 B;  4FZM A;  4JFB A;  1ZHY A;  4FMS A;  3SY9 A;  3LK3 A;  4G75 A;  2YNK A;  4RLB A;  2XMX A;  3SY7 A;  4RJX A;  1P4T A;  4LSE A;  3RBH A;  5KAI O;  2ZLD A;  3GP6 A;  4BUM X;  2KDY A;  1G90 A;  4B61 A;  3POX A;  2MHL A;  5B66 O;  3HOE A;  5JDP A;  1IZN B;  3BRY A;  4FQE A;  1THQ A;  3VZW X;  1GFO A;  5H2F O;  3AAA B;  4FT6 A;  3AA0 A;  3LK2 A;  3TZG A;  3HW9 A;  2ERV A;  3LK4 2;  3VE1 A;  1E54 A;  3PGU A;  4O4X A;  3PGR A;  3SZD A;  6PRN A;  3AAE A;  2Y0L A;  4FUV A;  3WU2 O;  2F1V A;  3SZV A;  4O3Z A;  4D5U A;  3HWB A;  4AYM C;  3SYS A;  3NSG A;  1MPF A;  3UU2 A;  5GV0 A;  4E1S A;  2K0L A;  2OMF A;  2POR A;  4KR8 A;  2XE2 A;  2JMM A;  1Q9F A;  1ZHX A;  4E1T A;  2KXP B;  2KZ7 B;  2ODJ A;  4C69 X;  2XE1 A;  2M06 A;  2Y0K A;  4O3Y A;  2XG6 A;  4GCS A;  4K3C A;  2JQY A;  3VY9 X;  3AA7 A;  1QJ8 A;  3POU A;  4UB6 O;  3HOL A;  5DL7 A;  1Q9G A;  4FSP A;  4C4V A;  8PRN A;  2WJQ A;  4FOZ A;  1BXW A;  2MNH A;  3WI5 A;  4FRX A;  4AFK A;  4FZN A;  4G76 A;  2R8A A;  5G38 A;  3VY8 X;  2YPV A;  4D64 A;  3AA1 A;  4XNL A;  4FSO A;  2J4U P;  4FZL A;  4N59 A;  2Y7S A;  4U9C A;  5GTH O;  2PRN A;  1QJ9 A;  3C5O A;  3G7G A;  5T5F A;  2Y2X A;  5DL5 A;  5B5E O;  4LSI A;  4O4U A;  1ZHT A;  2XE3 A;  1ORM A;  3LK2 B;  2WVP A;  2XTR A;  2ZFG A;  1HXX A;  5E79 O;  2K4T A;  3UAQ A;  3T0S A;  5AFU L;  4QQ1 A;  3KVD D;  2Y0H A;  3SYB A;  2M07 A;  4FES A;  4PJ0 O;  4C00 A;  5FVN A;  5IYU A;  2O4V A;  1GFP A;  2FGR A;  4RJW A;  4XNK A;  3PF1 A;  3VE2 A;  1T16 A;  1GFQ A;  2W80 C;  1ZHW A;  3BS0 A;  1OPF A;  4N74 A;  2AXT O;  2KXP A;  3DA4 A;  4JCH A;  2WJR A;  2XTQ A;  5ADX L;  4AYD C;  3POQ A;  4N75 A;  4AKR B;  5EE2 A;  2R89 A;  2IWV A;  1S5L O;  2LHF A;  2LFU A;  2N2L A;  3A0B O;  3POR A;  5GTI O;  4C4V B;  1GFN A;  3DWN A;  4GHB A;  3DWO X;  4K3B A; 
#chains in the Genus database with same CATH homology
 3AA6 B;  1GFM A;  1PHO A;  3AA1 B;  4F4B A;  4N58 A;  3LK3 B;  1HXT A;  2F1T A;  3JTY A;  3T24 A;  2X27 X;  4RL9 A;  4AYE C;  2W81 C;  3QRC A;  3PQU A;  1PRN A;  3VZT X;  5ADX K;  4AUI A;  1BT9 A;  3K19 A;  1ZHZ A;  1OSM A;  3PRN A;  4AKM A;  4LSF A;  4KRA A;  1BH3 A;  2QTK A;  5DL6 A;  7PRN A;  4GCQ A;  1IZN A;  1MM5 A;  4O3W A;  4O3X B;  2XE5 A;  5PRN A;  3UPG A;  3AAA A;  5AFU K;  1QJP A;  4KR4 A;  3AA0 B;  2J1N A;  3LK4 1;  4AYN A;  2GE4 A;  3A2S X;  2N2M A;  5D5D A;  4D65 A;  1H6S 1;  4O49 A;  3AAE B;  1HXU A;  4AZL A;  3O0E A;  4AYI D;  3EMN X;  3PQS A;  4LSH A;  3VZU X;  4AKR A;  4PUX A;  5G26 A;  4GF4 A;  2KC0 A;  3V8U A;  3FYX A;  3WI4 A;  4RLC A;  3T20 A;  1YS5 A;  4Z3T A;  2KZ7 A;  3QRA A;  1MM4 A;  2FGQ X;  5DL8 A;  4FRT A;  4GCP A;  3AA6 A;  3DA3 A;  3AA7 B;  4FZM A;  4JFB A;  1ZHY A;  4FMS A;  3SY9 A;  3LK3 A;  4G75 A;  2YNK A;  4RLB A;  2XMX A;  3SY7 A;  4RJX A;  1P4T A;  4LSE A;  3RBH A;  2ZLD A;  3GP6 A;  4BUM X;  2KDY A;  1G90 A;  4B61 A;  3POX A;  2MHL A;  3HOE A;  5JDP A;  1IZN B;  3VZW X;  1THQ A;  1GFO A;  3AAA B;  4FT6 A;  3AA0 A;  3LK2 A;  3TZG A;  3HW9 A;  2ERV A;  3LK4 2;  3VE1 A;  1E54 A;  4O4X A;  3SZD A;  6PRN A;  3AAE A;  2Y0L A;  4FUV A;  4D5U A;  2F1V A;  3SZV A;  4O3Z A;  3HWB A;  4AYM C;  3SYS A;  3NSG A;  1MPF A;  3UU2 A;  5GV0 A;  4E1S A;  2K0L A;  2OMF A;  2POR A;  4KR8 A;  2XE2 A;  2JMM A;  1Q9F A;  1ZHX A;  4E1T A;  2KXP B;  2KZ7 B;  2ODJ A;  4C69 X;  2XE1 A;  2M06 A;  2Y0K A;  4O3Y A;  2XG6 A;  4GCS A;  3VY9 X;  3AA7 A;  1QJ8 A;  3POU A;  3HOL A;  5DL7 A;  1Q9G A;  4FSP A;  8PRN A;  4FOZ A;  3WI5 A;  1BXW A;  2MNH A;  4AFK A;  4FRX A;  4FZN A;  4G76 A;  3VY8 X;  2YPV A;  4D64 A;  3AA1 A;  4XNL A;  4FSO A;  2J4U P;  4FZL A;  4N59 A;  2Y7S A;  4U9C A;  2PRN A;  1QJ9 A;  3C5O A;  3G7G A;  5T5F A;  2Y2X A;  5DL5 A;  4LSI A;  4O4U A;  1ZHT A;  2XE3 A;  1ORM A;  3LK2 B;  2XTR A;  2ZFG A;  1HXX A;  2K4T A;  3UAQ A;  3T0S A;  5AFU L;  4QQ1 A;  3KVD D;  2Y0H A;  3SYB A;  2M07 A;  4FES A;  5IYU A;  5FVN A;  2O4V A;  1GFP A;  2FGR A;  4RJW A;  4XNK A;  3VE2 A;  1GFQ A;  2W80 C;  1ZHW A;  1OPF A;  2KXP A;  3DA4 A;  4JCH A;  2XTQ A;  5ADX L;  4AYD C;  3POQ A;  4AKR B;  5EE2 A;  2LHF A;  3POR A;  2LFU A;  2N2L A;  1GFN A;  4GHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...