5PRNA

E1m, y96w, s119w mutant of rh. blastica porin
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAKLRMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTWDSEMGYEASSFGDAQSSFFAYNWKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
total genus 75
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 5prnA00
2XE3A 4FRXA 6PRNA 2XE5A 2ZFGA 1GFMA 3SZDA 3T0SA 2FGQX 3POQA 3WI4A 4C69X 8PRNA 3NSGA 2O4VA 4KR4A 4FT6A 3UU2A 4D65A 2OMFA 2PORA 3PRNA 4D5UA 4FOZA 2Y0KA 3FYXA 3SYSA 3T24A 1OPFA 1HXXA 1BT9A 4RJWA 3T20A 2J1NA 4FRTA 2J4UP 5DL8A 4AUIA 3SY7A 4KRAA 3EMNX 3UPGA 2XG6A 4FSOA 3JTYA 3VY9X 1BH3A 2QTKA 3PORA 3SZVA 4JFBA 3POXA 2PRNA 2ZLDA 2Y0LA 4LSFA 2Y0HA 1OSMA 7PRNA 1HXUA 1HXTA 1MPFA 1PHOA 2ODJA 3HWBA 5DL5A 5DL7A 5FVNA 3SY9A 3VY8X 4GCQA 4FMSA 1GFNA 2XE1A 4LSHA 4RJXA 3A2SX 1GFPA 3VZWX 4BUMX 1GFQA 3POUA 4LSEA 4GCSA 5DL6A 3VZTX 2FGRA 4GCPA 1GFOA 3VZUX 3WI5A 1E54A 3K19A 4FSPA 1PRNA 2Y2XA 4D64A 5JDPA 2XE2A 4LSIA 5PRNA 1H6S1 4KR8A 3O0EA 3SYBA 3HW9A 2K4TA
chains in the Genus database with same CATH superfamily
3DWNA 4N59A 3HOLA 5KAIO 3A0HO 1IZNB 2AXTO 4F4BA 2XE3A 2YPVA 5ADXL 4FRXA 1YS5A 2R88A 5TISO 6PRNA 2W80C 1ZHTA 4G75A 3V8UA 2XE5A 2ZFGA 3AA1B 4FQEA 3LK42 1GFMA 3SZDA 4XNLA 3T0SA 5T5FA 5GV0A 4K3BA 3KVDD 2WJQA 2FGQX 3POQA 4E1SA 3LK2A 2LFUA 4G76A 3WI4A 3DA4A 4C69X 4O3YA 3UAQA 4Z3TA 8PRNA 1MM4A 3WU2O 3NSGA 2O4VA 3G7GA 4FZNA 2WVPA 4KR4A 5GTIO 5AFUL 4AKRB 5G3AA 4C4VB 1S5LO 3AA6B 3LK3B 4FT6A 4FZMA 5EE2A 4UB8O 2KC0A 5E79O 3UU2A 2MHLA 4O4XA 2KXPB 4D65A 2K0LA 2OMFA 2PORA 3PRNA 4D5UA 2XTQA 4FOZA 4U9CA 2M07A 2Y0KA 4N75A 3FYXA 4E1TA 3SYSA 1IZNA 3T24A 1OPFA 1HXXA 5H2FO 1BT9A 4RJWA 1T1LA 3T20A 2J1NA 4FRTA 1QJ8A 4AKMA 5AFUK 2J4UP 2N2LA 4JCHA 3JCUO 5DL8A 3QRAA 3GP6A 3AAAB 2W81C 1MM5A 4FZLA 2R4NA 3PQUA 3AA1A 4AUIA 4GF4A 3SY7A 2N2MA 4KRAA 3EMNX 3TZGA 4AYNA 4XNKA 3UPGA 2GE4A 3AA0B 2XG6A 2F1TA 3QRCA 4FSOA 4N74A 4PUXA 5GTHO 3JTYA 3DWOX 1ZHWA 2ERVA 2KZ7B 1BH3A 2QTKA 3VY9X 3PORA 1BXWA 3SZVA 3BRZA 4AYDC 4JFBA 5B5EO 4RL9A 4AYEC 3POXA 2PRNA 2F1CX 2ZLDA 1QJPA 2LHFA 2Y0LA 4RLCA 2MNHA 3AA6A 3DZMA 4LSFA 4PR7A 3RBHA 3AA7B 1QJ9A 2Y0HA 2WJRA 1OSMA 2KXPA 2XMXA 1ZHXA 4K3CA 7PRNA 1HXUA 1HXTA 1MPFA 2R4LA 3AAEB 3DA3A 3LK2B 3PGRA 2R89A 1PHOA 4B61A 2KDYA 2ODJA 3HWBA 2R4PA 5DL5A 5DL7A 5FVNA 4IL6O 4O4UA 2X9KA 4GHBA 3SY9A 1P4TA 4AYID 4FUVA 3A0BO 3VY8X 4C00A 4GCQA 4FMSA 3BS0A 2Y7SA 4FESA 1GFNA 2IWVA 1Q9FA 4PJ0O 1THQA 4AZLA 4CTDA 2XE1A 4O3ZA 2F1VA 2X27X 4LSHA 4QQ1A 2IWWA 4RJXA 3LK41 3AA0A 3A2SX 3HOEA 1GFPA 3VE2A 3VZWX 5G38A 4BUMX 2JQYA 5G39A 5IYUA 2KZ7A 1GFQA 2YNKA 2R4OA 3POUA 1ZHZA 4AKRA 3VE1A 3PGSA 4C4VA 3LK3A 4LSEA 3PQSA 1T16A 4GCSA 5DL6A 4UB6O 3VZTX 1Q9GA 2FGRA 4AFKA 4GCPA 1GFOA 3VZUX 3WI5A 1E54A 1ORMA 3C5OA 3AA7A 4O49A 4AYMC 3K19A 4RLBA 5B66O 3PF1A 4FSPA 4O3WA 5ADXK 3AAEA 1PRNA 2R8AA 2Y2XA 4D64A 5JDPA 2XE2A 5D5DA 4LSIA 5PRNA 1H6S1 5KAFO 4O3XB 3PGUA 4KR8A 3BRYA 5G26A 1G90A 3O0EA 3NJTA 2JMMA 3AAAA 1ZHYA 3SYBA 3HW9A 2XTRA 4N58A 2K4TA 2M06A 3KZIO
chains in the Genus database with same CATH topology
4N59A 3HOLA 1IZNB 2XE3A 2YPVA 5ADXL 4FRXA 1YS5A 6PRNA 2W80C 1ZHTA 4G75A 3V8UA 2XE5A 2ZFGA 3AA1B 3LK42 1GFMA 3SZDA 4XNLA 3T0SA 5T5FA 5GV0A 3KVDD 2FGQX 3POQA 4E1SA 3LK2A 2LFUA 4G76A 3WI4A 3DA4A 4C69X 4O3YA 3UAQA 4Z3TA 8PRNA 1MM4A 3NSGA 2O4VA 3G7GA 4FZNA 4KR4A 5AFUL 4AKRB 4F4BA 3AA6B 3LK3B 4FT6A 4FZMA 5EE2A 2KC0A 3UU2A 2MHLA 4O4XA 2KXPB 4D65A 2K0LA 2OMFA 2PORA 3PRNA 4D5UA 2XTQA 4FOZA 4U9CA 2M07A 2Y0KA 4E1TA 3FYXA 3SYSA 1IZNA 3T24A 1OPFA 1HXXA 1BT9A 4RJWA 3T20A 2J1NA 4FRTA 1QJ8A 4AKMA 5AFUK 2J4UP 2N2LA 4JCHA 5DL8A 3QRAA 3GP6A 3AAAB 2W81C 1MM5A 4FZLA 4AUIA 3PQUA 3AA1A 4GF4A 3SY7A 2N2MA 4KRAA 3EMNX 3TZGA 4AYNA 4XNKA 3UPGA 2GE4A 3AA0B 2XG6A 2F1TA 3QRCA 4FSOA 4PUXA 3JTYA 1ZHWA 2ERVA 2KZ7B 1BH3A 2QTKA 3VY9X 3PORA 1BXWA 3SZVA 4AYDC 4JFBA 4RL9A 4AYEC 3POXA 2PRNA 2ZLDA 1QJPA 2LHFA 2Y0LA 4RLCA 2MNHA 3AA6A 4LSFA 3RBHA 3AA7B 1QJ9A 2Y0HA 1OSMA 2KXPA 2XMXA 1ZHXA 7PRNA 1HXUA 1HXTA 1MPFA 3AAEB 3DA3A 3LK2B 1PHOA 4B61A 2KDYA 2ODJA 3HWBA 5DL5A 5DL7A 5FVNA 3SY9A 4O4UA 4AYID 4GHBA 1P4TA 4FUVA 3VY8X 4GCQA 4FMSA 2Y7SA 4FESA 1GFNA 1Q9FA 1THQA 4AZLA 2XE1A 4O3ZA 2F1VA 2X27X 4LSHA 4QQ1A 4RJXA 3LK41 3AA0A 3A2SX 3HOEA 1GFPA 3VE2A 3VZWX 4BUMX 5IYUA 2KZ7A 1GFQA 2YNKA 3POUA 1ZHZA 4AKRA 3VE1A 3LK3A 4LSEA 3PQSA 4GCSA 5DL6A 3VZTX 4AFKA 1Q9GA 2FGRA 4GCPA 1GFOA 3VZUX 3WI5A 1E54A 1ORMA 3C5OA 3AA7A 4O49A 4AYMC 3K19A 4RLBA 4O3WA 4FSPA 5ADXK 3AAEA 1PRNA 2Y2XA 4D64A 5JDPA 2XE2A 5D5DA 4LSIA 5PRNA 1H6S1 4O3XB 4KR8A 5G26A 1G90A 3O0EA 2JMMA 3AAAA 1ZHYA 3SYBA 3HW9A 2XTRA 4N58A 2K4TA 2M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XE3 A;  4FRX A;  6PRN A;  2XE5 A;  2ZFG A;  1GFM A;  3SZD A;  3T0S A;  2FGQ X;  3POQ A;  3WI4 A;  4C69 X;  8PRN A;  3NSG A;  2O4V A;  4KR4 A;  4FT6 A;  3UU2 A;  4D65 A;  2OMF A;  2POR A;  3PRN A;  4D5U A;  4FOZ A;  2Y0K A;  3FYX A;  3SYS A;  3T24 A;  1OPF A;  1HXX A;  1BT9 A;  4RJW A;  3T20 A;  2J1N A;  4FRT A;  2J4U P;  5DL8 A;  4AUI A;  3SY7 A;  4KRA A;  3EMN X;  3UPG A;  2XG6 A;  4FSO A;  3JTY A;  3VY9 X;  1BH3 A;  2QTK A;  3POR A;  3SZV A;  4JFB A;  3POX A;  2PRN A;  2ZLD A;  2Y0L A;  4LSF A;  2Y0H A;  1OSM A;  7PRN A;  1HXU A;  1HXT A;  1MPF A;  1PHO A;  2ODJ A;  3HWB A;  5DL5 A;  5DL7 A;  5FVN A;  3SY9 A;  3VY8 X;  4GCQ A;  4FMS A;  1GFN A;  2XE1 A;  4LSH A;  4RJX A;  3A2S X;  1GFP A;  3VZW X;  4BUM X;  1GFQ A;  3POU A;  4LSE A;  4GCS A;  5DL6 A;  3VZT X;  2FGR A;  4GCP A;  1GFO A;  3VZU X;  3WI5 A;  1E54 A;  3K19 A;  4FSP A;  1PRN A;  2Y2X A;  4D64 A;  5JDP A;  2XE2 A;  4LSI A;  5PRN A;  1H6S 1;  4KR8 A;  3O0E A;  3SYB A;  3HW9 A;  2K4T A; 
#chains in the Genus database with same CATH topology
 3DWN A;  4N59 A;  3HOL A;  5KAI O;  3A0H O;  1IZN B;  2AXT O;  4F4B A;  2XE3 A;  2YPV A;  5ADX L;  4FRX A;  1YS5 A;  2R88 A;  5TIS O;  6PRN A;  2W80 C;  1ZHT A;  4G75 A;  3V8U A;  2XE5 A;  2ZFG A;  3AA1 B;  4FQE A;  3LK4 2;  1GFM A;  3SZD A;  4XNL A;  3T0S A;  5T5F A;  5GV0 A;  4K3B A;  3KVD D;  2WJQ A;  2FGQ X;  3POQ A;  4E1S A;  3LK2 A;  2LFU A;  4G76 A;  3WI4 A;  3DA4 A;  4C69 X;  4O3Y A;  3UAQ A;  4Z3T A;  8PRN A;  1MM4 A;  3WU2 O;  3NSG A;  2O4V A;  3G7G A;  4FZN A;  2WVP A;  4KR4 A;  5GTI O;  5AFU L;  4AKR B;  5G3A A;  4C4V B;  1S5L O;  3AA6 B;  3LK3 B;  4FT6 A;  4FZM A;  5EE2 A;  4UB8 O;  2KC0 A;  5E79 O;  3UU2 A;  2MHL A;  4O4X A;  2KXP B;  4D65 A;  2K0L A;  2OMF A;  2POR A;  3PRN A;  4D5U A;  2XTQ A;  4FOZ A;  4U9C A;  2M07 A;  2Y0K A;  4N75 A;  3FYX A;  4E1T A;  3SYS A;  1IZN A;  3T24 A;  1OPF A;  1HXX A;  5H2F O;  1BT9 A;  4RJW A;  1T1L A;  3T20 A;  2J1N A;  4FRT A;  1QJ8 A;  4AKM A;  5AFU K;  2J4U P;  2N2L A;  4JCH A;  3JCU O;  5DL8 A;  3QRA A;  3GP6 A;  3AAA B;  2W81 C;  1MM5 A;  4FZL A;  2R4N A;  3PQU A;  3AA1 A;  4AUI A;  4GF4 A;  3SY7 A;  2N2M A;  4KRA A;  3EMN X;  3TZG A;  4AYN A;  4XNK A;  3UPG A;  2GE4 A;  3AA0 B;  2XG6 A;  2F1T A;  3QRC A;  4FSO A;  4N74 A;  4PUX A;  5GTH O;  3JTY A;  3DWO X;  1ZHW A;  2ERV A;  2KZ7 B;  1BH3 A;  2QTK A;  3VY9 X;  3POR A;  1BXW A;  3SZV A;  3BRZ A;  4AYD C;  4JFB A;  5B5E O;  4RL9 A;  4AYE C;  3POX A;  2PRN A;  2F1C X;  2ZLD A;  1QJP A;  2LHF A;  2Y0L A;  4RLC A;  2MNH A;  3AA6 A;  3DZM A;  4LSF A;  4PR7 A;  3RBH A;  3AA7 B;  1QJ9 A;  2Y0H A;  2WJR A;  1OSM A;  2KXP A;  2XMX A;  1ZHX A;  4K3C A;  7PRN A;  1HXU A;  1HXT A;  1MPF A;  2R4L A;  3AAE B;  3DA3 A;  3LK2 B;  3PGR A;  2R89 A;  1PHO A;  4B61 A;  2KDY A;  2ODJ A;  3HWB A;  2R4P A;  5DL5 A;  5DL7 A;  5FVN A;  4IL6 O;  4O4U A;  2X9K A;  4GHB A;  3SY9 A;  1P4T A;  4AYI D;  4FUV A;  3A0B O;  3VY8 X;  4C00 A;  4GCQ A;  4FMS A;  3BS0 A;  2Y7S A;  4FES A;  1GFN A;  2IWV A;  1Q9F A;  4PJ0 O;  1THQ A;  4AZL A;  4CTD A;  2XE1 A;  4O3Z A;  2F1V A;  2X27 X;  4LSH A;  4QQ1 A;  2IWW A;  4RJX A;  3LK4 1;  3AA0 A;  3A2S X;  3HOE A;  1GFP A;  3VE2 A;  3VZW X;  5G38 A;  4BUM X;  2JQY A;  5G39 A;  5IYU A;  2KZ7 A;  1GFQ A;  2YNK A;  2R4O A;  3POU A;  1ZHZ A;  4AKR A;  3VE1 A;  3PGS A;  4C4V A;  3LK3 A;  4LSE A;  3PQS A;  1T16 A;  4GCS A;  5DL6 A;  4UB6 O;  3VZT X;  1Q9G A;  2FGR A;  4AFK A;  4GCP A;  1GFO A;  3VZU X;  3WI5 A;  1E54 A;  1ORM A;  3C5O A;  3AA7 A;  4O49 A;  4AYM C;  3K19 A;  4RLB A;  5B66 O;  3PF1 A;  4FSP A;  4O3W A;  5ADX K;  3AAE A;  1PRN A;  2R8A A;  2Y2X A;  4D64 A;  5JDP A;  2XE2 A;  5D5D A;  4LSI A;  5PRN A;  1H6S 1;  5KAF O;  4O3X B;  3PGU A;  4KR8 A;  3BRY A;  5G26 A;  1G90 A;  3O0E A;  3NJT A;  2JMM A;  3AAA A;  1ZHY A;  3SYB A;  3HW9 A;  2XTR A;  4N58 A;  2K4T A;  2M06 A;  3KZI O; 
#chains in the Genus database with same CATH homology
 4N59 A;  3HOL A;  1IZN B;  2XE3 A;  2YPV A;  5ADX L;  4FRX A;  1YS5 A;  6PRN A;  2W80 C;  1ZHT A;  4G75 A;  3V8U A;  2XE5 A;  2ZFG A;  3AA1 B;  3LK4 2;  1GFM A;  3SZD A;  4XNL A;  3T0S A;  5T5F A;  5GV0 A;  3KVD D;  2FGQ X;  3POQ A;  4E1S A;  3LK2 A;  2LFU A;  4G76 A;  3WI4 A;  3DA4 A;  4C69 X;  4O3Y A;  3UAQ A;  4Z3T A;  8PRN A;  1MM4 A;  3NSG A;  2O4V A;  3G7G A;  4FZN A;  4KR4 A;  5AFU L;  4AKR B;  4F4B A;  3AA6 B;  3LK3 B;  4FT6 A;  4FZM A;  5EE2 A;  2KC0 A;  3UU2 A;  2MHL A;  4O4X A;  2KXP B;  4D65 A;  2K0L A;  2OMF A;  2POR A;  3PRN A;  4D5U A;  2XTQ A;  4FOZ A;  4U9C A;  2M07 A;  2Y0K A;  4E1T A;  3FYX A;  3SYS A;  1IZN A;  3T24 A;  1OPF A;  1HXX A;  1BT9 A;  4RJW A;  3T20 A;  2J1N A;  4FRT A;  1QJ8 A;  4AKM A;  5AFU K;  2J4U P;  2N2L A;  4JCH A;  5DL8 A;  3QRA A;  3GP6 A;  3AAA B;  2W81 C;  1MM5 A;  4FZL A;  4AUI A;  3PQU A;  3AA1 A;  4GF4 A;  3SY7 A;  2N2M A;  4KRA A;  3EMN X;  3TZG A;  4AYN A;  4XNK A;  3UPG A;  2GE4 A;  3AA0 B;  2XG6 A;  2F1T A;  3QRC A;  4FSO A;  4PUX A;  3JTY A;  1ZHW A;  2ERV A;  2KZ7 B;  1BH3 A;  2QTK A;  3VY9 X;  3POR A;  1BXW A;  3SZV A;  4AYD C;  4JFB A;  4RL9 A;  4AYE C;  3POX A;  2PRN A;  2ZLD A;  1QJP A;  2LHF A;  2Y0L A;  4RLC A;  2MNH A;  3AA6 A;  4LSF A;  3RBH A;  3AA7 B;  1QJ9 A;  2Y0H A;  1OSM A;  2KXP A;  2XMX A;  1ZHX A;  7PRN A;  1HXU A;  1HXT A;  1MPF A;  3AAE B;  3DA3 A;  3LK2 B;  1PHO A;  4B61 A;  2KDY A;  2ODJ A;  3HWB A;  5DL5 A;  5DL7 A;  5FVN A;  3SY9 A;  4O4U A;  4AYI D;  4GHB A;  1P4T A;  4FUV A;  3VY8 X;  4GCQ A;  4FMS A;  2Y7S A;  4FES A;  1GFN A;  1Q9F A;  1THQ A;  4AZL A;  2XE1 A;  4O3Z A;  2F1V A;  2X27 X;  4LSH A;  4QQ1 A;  4RJX A;  3LK4 1;  3AA0 A;  3A2S X;  3HOE A;  1GFP A;  3VE2 A;  3VZW X;  4BUM X;  5IYU A;  2KZ7 A;  1GFQ A;  2YNK A;  3POU A;  1ZHZ A;  4AKR A;  3VE1 A;  3LK3 A;  4LSE A;  3PQS A;  4GCS A;  5DL6 A;  3VZT X;  4AFK A;  1Q9G A;  2FGR A;  4GCP A;  1GFO A;  3VZU X;  3WI5 A;  1E54 A;  1ORM A;  3C5O A;  3AA7 A;  4O49 A;  4AYM C;  3K19 A;  4RLB A;  4O3W A;  4FSP A;  5ADX K;  3AAE A;  1PRN A;  2Y2X A;  4D64 A;  5JDP A;  2XE2 A;  5D5D A;  4LSI A;  5PRN A;  1H6S 1;  4O3X B;  4KR8 A;  5G26 A;  1G90 A;  3O0E A;  2JMM A;  3AAA A;  1ZHY A;  3SYB A;  3HW9 A;  2XTR A;  4N58 A;  2K4T A;  2M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...